2NN6G

Structure of the human rna exosome composed of rrp41, rrp45, rrp46, rrp43, mtr3, rrp42, csl4, rrp4, and rrp40
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
259
structure length
236
Chain Sequence
ARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reconstitution, activities, and structure of the eukaryotic RNA exosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/transferase
molecule keywords Polymyositis/scleroderma autoantigen 1
total genus 33
structure length 236
sequence length 259
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nn6G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nn6G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2nn6G03
4R4TA 5M5XH 3GTJH 4A76A 2JA6G 2KCTA 1SR3A 4MZ9A 1X54A 1WOCA 1FVIA 1TWCH 4JI6Q 3CPFA 4YY3Q 3SE0A 2JEAI 4GKJL 3LWUA 1YHAA 3CCLA 2L5TA 2VQFL 1GUTA 1GD7A 1ASYA 2K50A 1QZGA 1AH9A 4H0LC 4OO1G 2WAQE 4H44C 3OPOA 1O7IA 2F4VQ 4GLXA 1HZBA 4A3GG 4LF5L 1SRUA 4YCVA 2A6EC 1GUOA 4LF7Q 3GTMH 1EWHA 4PZ8A 1HJPA 3D4RA 2D0OA 2K5VA 3TEHB 4RCNA 3P20A 4JC0A 1L0WA 3W1GA 4NXML 4OX9Q 2PQUA 2UXBL 1EYGA 1EIFA 1LUZA 1ZYRC 5JJLA 1BKBA 1XPRA 3I4NG 4A3IH 1A62A 3J81i 1D8LA 1B70B 1A0IA 4L5SA 4IPGA 1NTGA 1I94Q 4OXPA 4P75A 4JVHA 4YHHL 2DNCA 5JEAJ 1Q82C 1MJCA 2EDGA 5K36H 1E2WA 2OPUA 2OCEA 3VA7A 1MJEA 2YQRA 2O5IC 4LFAQ 4I7ZC 2UXDL 1C9OA 4A3GH 3CMEA 4JG2A 4GNXB 3H3VI 4GN5A 4RG1A 3STBD 3T1YQ 4IFDI 4OO1I 1VQNA 1QUQA 2ZT9C 3PUYA 1VQEA 5IP7H 3M9BA 5LMUQ 4A3JH 1IBML 1I3QH 4DV0Q 1Q46A 2HHHQ 2JZXA 4B3ML 1EWIA 1PYBA 1EFWA 1I94L 3PO2G 5C44G 3HOWG 1E3PA 2RHQB 5C4XG 1J5KA 2EIFA 1W2BA 3GTQH 1I6VC 1J6QA 3BJUA 1EQRA 3CW2C 4JI8Q 1DTJA 2A68C 4C3HH 3VR4A 3OW7A 2UXBQ 5EAYA 3RLOA 3A74A 1FYCA 4A75A 5GAEC 1CUKA 2DUDA 1IBLL 1RL2A 1BBUA 3T51B 3K7AH 4DUYQ 1K8AC 1IBKL 4LF8Q 3OTOQ 4GN3B 1Z7TA 1K0RA 2K5HA 4NXMQ 2NN6I 4A3JG 2GVAA 2ZM6L 2HT1A 2H5XA 1X3GA 2ALYB 4KLKA 4R4IA 4DV4Q 1QZHA 1Q1EA 4AIMA 1SROA 2GN5A 3RR5A 1WCMG 4XTCS 4A3FH 5IYDH 2CTLA 2JA7H 4LFCQ 1QUQB 3GQBA 1WE8A 4DR1L 1UE7A 3CC7A 3PV0A 1E1TA 1HR0Q 5FJ8G 2IHFA 3EBEA 4WJ3M 3V69A 4KKSA 3EQLC 4HIDA 3RLFA 4J15A 4NB3A 5HGQA 4UY8C 1GKHA 2D5DA 2PNHA 3KDFA 2WB1E 2HQLA 3NELA 4JI1L 5C0XI 4DV3L 1HZAA 1S40A 2JA5G 4GS3A 3T53B 3RN5A 2VQEL 3JAMc 2AWNA 2QNDA 2ANRA 4DK6C 3S15H 1YI2A 2JXMB 3ERSX 4A3DG 1GHKA 5IWAL 1Q8KA 2AHOB 2CWAA 1RIPA 4DUZQ 2NVXH 3PSIA 1VCIA 2IX1A 2ANNA 2WAQG 2Z6KC 3H15A 2QA4A 4AQYQ 5JJIA 2AXYA 4MNOA 3A8KE 4P73A 4RMFA 5LMNW 1XMOQ 1JJCB 4P74A 1KL9A 2I5MX 2NVQH 1KRTA 1I50H 1EC6A 1VF7A 3AFQA 3G71A 2PQAB 4JCVE 4OWXB 3OOCA 3S1RH 2A19A 5AJ3L 4JI2L 4JYAL 1UWVA 4A3KG 2WB1G 4X65L 1G291 3BZCA 4POGA 2DGRA 5M5WH 1K1GA 5FLMH 3GTLH 3VDYA 1O78A 1VQ9A 3TS2A 2KENA 4DK3C 3L2PA 3I56A 1FL0A 1X65A 4UP9A 3PO3G 3E9IA 2PI2E 4DUZL 3M4OH 2R7ZH 1H95A 1VQKA 1JT8A 2AWOA 1YHBA 1Y8OB 1L1OB 4TVAB 1E24A 4B3SQ 3HOUG 3PGZA 3B6YA 4UP8A 3KFUA 3ICEA 1PV4A 4H02A 4KKTA 5IYBH 1KRSA 1N34L 3G4SA 1PHJA 2V4DA 1YVCA 4JI0Q 2B63H 2WP8J 3AFPA 3J81j 5C44H 4HIMA 4HIOA 1Y1WG 4JBWA 1KAWA 1SFOH 4YY3L 1VQGA 4BY7G 1BVSA 3F1ZA 3M4PA 5DLQE 2E75C 4JI3Q 1SE8A 4JI6L 4A3CG 3H94A 5K36G 4B3TQ 3I4MG 5C0XH 2FXQA 2E3UA 1GM5A 2A6ED 2KCCA 1VQ4A 2HHHL 2ZJRA 3FPPA 2GVBA 1PH4A 2VW9A 2BA0A 4DV7Q 4A3LG 2VL6A 2DNEA 2N3SA 3I2ZA 4PMWA 4DKAC 2ZM6Q 3CP0A 3DLLA 3N6RA 1EIYB 1Q90A 1VQJA 1SN8A 1PFSA 2Q2TA 2Q2UA 4R4CA 4NXNL 3CF5A 4G7ZC 2PMZE 2A8VA 3CCMA 4KI0A 2K52A 1AE2A 3CQZH 1XJVA 3S1NH 4KKUA 4IFDG 2Q8IB 3FHWA 2UUBQ 2R92H 4TQUS 2JA7G 4BY7H 1CSQA 2NN6H 3TREA 5IT9c 2UUCL 3CCQA 2N78A 1HZCA 5IP9H 4NPSA 2V1CC 2LXJA 4JBJA 1VIGA 1TWAH 4X65Q 1JMCA 4KN4C 3E9HA 4HJ5A 3IKJA 4O2DA 2IHEA 3KYHC 3ZJYC 4AYBE 1LABA 1M90C 2K7VA 4DNTB 4P71A 1XTDA 3F2DA 4BBSG 4K0KQ 1ZKOA 1NE3A 3DXJC 5LMUL 1GVPA 1TWFH 3HFZB 4LF5Q 4BA1I 3S1MH 2EXDA 3D0FA 3CC2A 2D0PA 2R7DA 2R92G 3CCUA 3I4OA 1TXYA 4NBQA 4B8TA 4A3FG 1N33Q 4GKKQ 5BR8L 4H13C 2JQOA 2DN8A 3PO2H 1HPCA 3WDNA 3HOWH 2I5HA 1TKWB 1PH5A 2E74C 5JEAG 1EOVA 1CI3M 1VQBA 2IY5B 3A8JE 3I73A 5IP9G 2AUJD 1X3FA 1XNQQ 1E7ZA 5IY0A 2VQEQ 3AQQA 4LF4L 1H9MA 1CKMA 4G7HC 3BZKA 3FKIG 1MIUA 3F2BA 4A4IA 4GKKL 3G6EA 2VUMH 1Q81C 1IZ6A 4QJFA 2CQOA 3U58A 1KHIA 3G48A 3GTKH 3J80i 4WALA 2N49A 5IYCG 1YEZA 4LNQA 2EQSA 3JAMi 3VKEA 1WJJA 4GOPC 3M3YH 1K8OA 4IJHA 1HNXL 5M3FG 1K8GA 1NJIC 2UUAQ 3E0EA 1WCMH 4LWCA 5IYDG 3F2CA 3RNUA 1HR0W 1YIJA 1PA6A 1W3SA 4GN4B 3S14H 2E8GA 4A93G 4IFDJ 2BA1A 4BY1G 2D62A 2YV5A 3WWVA 2EVBA 5GADC 3CMAA 3IFTA 4LJZC 3I4MH 3A7LA 4BBRH 3HKZG 1NY4A 3K81C 3S17H 5KNDA 3T56B 3AEVB 1G51A 1YBYA 1VQ6A 2YU9H 2PPBC 3NE5B 1JE5A 1X3EA 4DK0A 4OWTB 4KHPQ 1OXVA 2BH8A 2I5LX 5FJ8H 4QGUA 4DR2Q 1X4NA 4IQZA 1VS0A 4GNXA 4Y52H 4IPCA 4GZYC 3U1KA 3I4NH 2EJGC 3UDXA 4LFAL 5LMNQ 2CTKA 4KMUC 1X56A 2RF4A 4AQYL 3RZOH 2UU9L 2JVZA 1IYVA 3I7FA 4YCWA 1Y8NB 4X66Q 1K83H 1X6OA 3HOXG 4DV2Q 2R6GA 3CRLC 3PUWA 4A3KH 3FKIH 1VQ8A 3HOYH 2B29A 1TWHH 3W3AA 3L7ZC 3GTGH 1UEBA 2E2IH 2VZAA 5FLMG 1Z6HA 1MKHA 1Z9FA 3ULLA 4DR5L 2UXCQ 2F3IA 2Q2HA 1VQCA 2WFWA 1HZ9A 1C7YA 3GTPH 3CCRA 4IJLA 5GQOA 4JI1Q 1XNRQ 3GD7A 1JJ2A 3TRZA 5JJKA 1ASZA 1N9WA 3NENA 1V1QA 1Y1VH 4DV5L 1KD1C 2PY9A 1N8RC 1L2FA 4XIGS 4DK1A 5BN4A 1VQFA 3CC4A 3S16H 2ES2A 2ZTCA 3M4QA 3MXNB 3AYHB 4LFCL 1Y14B 1Q86C 1H9RA 3HOZH 3CCEA 3UE0A 4DV5Q 4A93H 1HTPA 1Q12A 2ID0A 2A6HC 3JC66 2MJHA 3I4LA 4JI5L 4K0KL 4BBRG 2VY3A 1PH2A 2F4VL 3RZDH 2CFMA 1B9NA 5ELOA 4AH6A 1IBLQ 5IYBG 2L15A 5IYCH 1JB7A 2E2HH 1XPUA 2IX0A 3CAMA 4GLAC 2QEXA 2ZJPA 4BXXG 1KIXA 3FP9A 3M85A 4AYBG 3PF4A 5KNBA 1NMFA 4QIWE 3Q8DA 3I55A 3GO5A 5M3FH 4JOIC 5GAHC 2AUKA 3KJPA 1R9TH 1DGSA 4O0AA 4GNXC 2A6HD 2KA7A 5C0XG 1XNRL 2K75A 2I0QA 3J7A5 1TU2B 2F52A 2QF7A 2XTIA 4HIKA 3VR2A 4DR7L 5BR8Q 1IBMQ 1B9MA 4A3CH 1XPOA 4A3LH 4HJ7A 1B8AA 4DAMA 4ME3A 4EX5A 4A3EG 2UUCQ 3H3VH 1ZZJA 3KF6B 4DAYB 1E2ZA 1VQDA 4YCUA 2R7FA 2CTMA 1CKNA 1P16A 1K73C 4DR7Q 4UPAA 5M5YH 3HOUH 4QQBX 1I6HH 1WFQA 1VQMA 4GLVB 5JEAH 1Y1VG 2OQKA 1DT4A 3S2HH 4LFBL 2E5LQ 1WI5A 1HNWQ 1X4MA 1YNJC 2LMCB 1D7QA 1A6XA 1A8VA 3H0GG 5IWAQ 1ZZKA 3CRKC 1BBWA 3DM3A 3KOJA 3L0OA 2K33A 1A63A 3S24A 1Z47A 3K80C 4LUZA 4Y7NH 4PZ7A 2MNAA 4DV1Q 3CXCA 1I5FA 4B3SL 2MO0A 2ZTEA 1Q7YC 1X9NA 2FMRA 4X6AH 1UE6A 4BA2I 4HJ9A 1HNZQ 3PUXA 3PF5A 2NZHA 5HY6A 4C3IH 2CCZA 3PIPA 3U50C 5KNCA 3ND8A 1YNXA 4DUYL 1HR0L 1TUAA 4JBMA 2KHIA 4DV7L 3W1BA 3HGBA 4L5TA 1FR3A 4GKJQ 3CCJA 1GUNA 3KLWA 1OXUA 3EN2A 4A3IG 4IFDH 1AE3A 2VQFQ 1XMQL 4BXXH 1HNXQ 3H0GH 3D31A 1H9JA 5GROA 4C2MH 4POFA 4L5QA 1PH7A 3TZUA 3AEVA 2JA8H 1WVNA 2OTJA 4QMFB 3PUVA 5C3EG 2MQHA 2A69D 2Z0SA 4GOPB 4B3MQ 1T5EA 4JOIA 1PH9A 1IBKQ 1QVFA 3J80c 3QJYA 4HJ8A 2KCMA 1U0LA 4DR5Q 1CTMA 1VQPA 2Q2IA 5IP7G 2ZJQA 2OPVA 1NMGA 1DCZA 1H9KA 1YJWA 1UE5A 1GJXA 4FDBA 1VQ7A 3QG1A 2E76C 5E7NA 3TQYA 3LGJA 4X62Q 2Z6KA 4DV2L 2UU9Q 2AKWB 3EIVA 1EQQA 2E5LL 4LUVA 3LNNA 4X66L 5C3EH 4YHHQ 3PIOA 3I72A 4IOCA 2A69C 2BE5D 3U4ZA 1J5EQ 1N33L 2JA9A 2R7ZG 1FGUA 2RCNA 4G7OC 4JV5Q 3NBHB 1KQSA 1KHMA 5A35A 4HJAA 1L1OA 1IYJB 2JJQA 3HOVG 2MO1A 4YWKA 4OWWB 4HR7B 2CW0C 3VR3A 2Y0SG 5GAGC 3KJOA 4PG3A 4OX9L 4JBKA 1PYSB 4DR6L 4DR4Q 2HH2A 1E22A 1J4WA 1S3OA 3BU2A 1OTCA 4LF6L 1IL2A 2ASBA 1H9SB 4DR1Q 4L8JA 4DNRB 1PH8A 1CKOA 2ZTDA 2NN6G 5BN5A 4OO1H 3ER0A 3BDOA 1PH3A 4R1JA 3GTOH 4IPDA 3HOYG 1X55A 1U5KA 5FLXc 1HH2P 2MFIA 3HOXH 2B8GA 2YTYA 2CTEA 3S2DH 2CTJA 4X62L 1IYUA 3GDEA 4JI3L 3U4VA 4GOPA 2O5JC 4BBSH 1OXXK 4LF7L 3OTOL 3HOVH 1T9HA 4LUOA 3BG3A 1VQHA 3HKZE 4LF4Q 3TS0A 3IRBA 3FMCA 4P72A 1N32Q 2EJMA 2R93H 1YITA 1QJOA 4WANA 4DV6Q 3OW2A 3M4YA 5C4XH 1K9MC 4JI8L 1S72A 2NZOA 3ULPA 1VQ5A 4B3TL 1IXRA 1YZ6A 1PH1A 4ALPA 1VF5C 3M7NA 4LW1A 1E2VA 4EQ5A 1GHJA 1Q1BA 4L5RC 3UDFA 3RN2A 1Y1WH 1YHQA 2NVTH 4KHZA 1N34Q 2CWPA 4JI4Q 5LMNL 3SDZA 3NEMA 1IW7D 1V43A 3T1HL 2HH3A 2B3GA 4OGQC 2VUMG 2YTVA 3VR6A 3ND9A 1VQIA 2VNUD 1CSPA 4B3RQ 4DR4L 1OXSC 3A5UA 2N8NA 1M1KC 3PUZA 2D2CC 3K8AA 4KHPL 1VQAA 2BH2A 3SGIA 1L1OC 2LSSA 3STBC 1ONLA 3J81c 5C0XJ 3HKSA 1Y8PB 4DV1L 5BN3A 1VQOA 1YJ9A 3UDIA 2PNRC 4YWLA 2OTLA 2K5NA 4JV5L 4OONA 4QY7A 4X64Q 4BY1H 1IW7C 4TKOB 1PH6A 4JI7Q 2F1MA 2YTXA 1NBWA 4QL5A 1TWGH 5H1SE 1OXTA 4DV0L 2A68D 4IPHA 1SMYC 2UXCL 2K32A 2P2RA 2NVYH 2VS1A 4A3BH 2HIXA 4IOAA 2IT1A 3ULJA 2EJFC 1GO3E 1WYDA 3F8TA 4IO9A 2CKZB 2HIVA 1N36Q 4JI4L 1KXLA 4UP7A 1XMOL 2OWOA 3W5OA 4A3EH 1EUJA 2LXKA 2UUAL 1O7LA 1XNQL 4YWMA 1YJNA 2CPQA 3CCVA 4R4QA 3MXUA 1FJGQ 2B8FA 3A7AB 2A1AA 3CPWA 1GUGA 2K14A 4C3JH 1XMQQ 4JVYA 5J3BA 3RLNA 3J7ZC 3K0XA 1N32L 2KBNA 2JEBI 1K8MA 4JI0L 1N36L 1JJGA 4R4OA 3CD6A 3AB9A 5M3MG 4A3BG 2PI2A 3U9SA 1HNZL 1HQMC 1V9PA 3UDGA 1P8LA 2XGTA 4JI5Q 1FJGL 3KF8B 1DXMA 1LACA 2KHJA 4A3MH 1VIHA 4LIJA 4PV1C 2JK8A 3CCSA 4A3DH 2Y0SE 1LYLA 4DNIA 1CFMA 4KN7C 2JE6I 1HCZA 1PMRA 4DV4L 4LF9Q 1QVGA 3HOZG 3MFYA 2DGYA 4LF6Q 2K4KA 3S1QH 2BDOA 2ATWA 2UUBL 1LM0A 4APVA 4LFBQ 2PCFB 1DD2A 3PCOB 4LF8L 3UE1A 5AJ3Q 2BL5A 1CKNB 1YNNC 3K7UC 4A3MG 4DR6Q 3KF6A 4DPGA 2B63G 1PVOA 3VR5A 4JI2Q 2JA8G 4JYAQ 1K3RA 2RHSB 2R93G 2OQ0A 1SMXA 5M3MH 3OYYA 1B7YB 5C4JH 4LK1C 4DR3L 3T1YL 2PQAA 4MTNA 2JA5H 4JI7L 1QVCA 2BE5C 4X64L 3KLRA 4LF9L 1ZZIA 2YYZA 1VQLA 1HNWL 5ELNA 1UE1A 1J5EL 1KC8C 1ZTGA 1BDOA 1V8QA 4PZ6A 3A5ZB 5IE8A 2JA6H 4AM3A 1G6PA 3PO3H 1C0AA 2C35B 1VDZA 2QGQA 4WJ4A 4NXNQ 1SLJA 1Y69U 4B3RL 3MEFA 2E2JH 4JK1C 1E1OA 3KDFB 4DV6L 4DR3Q 1H9SA 4DV3Q 3T1HQ 2UXDQ 3QIAA 4DR2L 3A8IE 1GUSA 2AMCB 1LTLA 2CTFA 3A0JA
chains in the Genus database with same CATH superfamily
1A3TA 5I6WA 4M1UB 2KCTA 4MZ9A 1X54A 1TWCH 4IUVA 1YHAA 3EJIA 1O7IA 3NK9A 4CGYB 4GLXA 4A3GG 1EWCA 1R4QB 1SRUA 2A6EC 1EWHA 3VYSA 2SEBD 4JC0A 3P20A 1L0WA 1AP0A 4OX9Q 3S1MB 2H1EA 3QR8A 3KK7A 2L55A 4K8JA 1U4MA 1A62A 1B70B 4L5SA 2L9HA 3PQIA 5JEAJ 1PZID 2EDGA 3VA7A 1MJEA 5KGUA 2XWBB 4XYOA 4LF6H 4K2LA 2HCCA 4JG2A 4IFDI 1VQNA 1WTPA 4ABNA 4A3JH 2RCFA 3GP7A 1CHQD 1MGSA 4BY1B 2L0CA 1JQYD 3HOWG 5C4XG 2EIFA 3BDCA 2FINB 3NWSA 1EQRA 3CW2C 4JI8Q 2A68C 4C3HH 2PW7A 2UXBQ 1EQVA 1FYCA 5GAEC 1CUKA 1ODHA 5D65A 1RL2A 3T51B 4DUYQ 2B63B 4LF8Q 2DY7A 1I4XA 1SXTA 4XYQA 4N9TA 2NN6I 3HZXA 4A3JG 4EGVA 3SVMA 2H5XA 3SXHA 3UI2A 4DV4Q 3RR5A 1WCMG 4A3FH 5IYDH 1FNVA 5DEHA 1RODA 3GQBA 1WE8A 2CWHA 3CC7A 1KDCA 1PZJD 5JPNC 4A3FB 1HR0Q 3EBEA 5JJZA 4KKSA 4HSVA 2PNHA 5C0XI 3NTIA 2HQLA 3MC0B 1S40A 2JA5G 2VQEL 4HSPA 2EYJA 2XVSA 1B44D 4HTHA 3VYTA 2NVXH 3PSIA 4LF5H 4B3RH 1FGBD 4RMFA 5LMNW 3W2DA 4KK7A 3RUZA 3S1RH 4JCVE 3OOCA 2A19A 4JI2L 4A3KG 2B2WA 2DGRA 2XRQD 5FLMH 3GTLH 5C3EB 1O78A 1VQ9A 5CC4A 3R2TA 1MSGA 3I56A 2RA4A 2NTSA 1X65A 2JSOA 3E9IA 2JA7B 4DUZL 3JAML 5IT9L 2R7ZH 1VQKA 1H95A 4JI2H 1L1OB 4TVAB 4Z9CB 1IL8A 4B3SQ 3PGZA 1PV4A 4H02A 5F2DA 2F0OA 3K7AB 2V4DA 3HOYB 3AFPA 5C44H 1SFOH 1VQGA 2IWHA 1SYFA 1SE8A 4A3CG 3H94A 3I4MG 3G6JB 1II3A 1GM5A 1WTVA 1TWCB 1PH4A 4DV7Q 2VL6A 2DNEA 2ZM6Q 1S03G 1QOHA 4FXKC 4RA8A 4NXNL 3K57A 1AEXA 3CF5A 2PMZE 4G7ZC 4KI0A 1AE2A 3FRPB 2IX3A 1U9RA 4IFDG 1CSQA 2NN6H 3TREA 1HZCA 1BCPD 4JBJA 4UDUC 1TWAH 2EY5A 5JVH3 3HOYG 4O2DA 3N52A 3ZJYC 4BWGB 3F2DA 5ELFA 3Q0AA 1NE3A 1QB5D 5LMUL 1TWFH 1IKLA 4BA1I 2D0PA 3I4OA 1TXYA 1CQFA 1KLGD 4GKKQ 2H4OA 5BR8L 3PO2H 2DJGC 5M3FB 2I5HA 1TKWB 1PH5A 1VQBA 1XNQQ 5IY0A 3BZKA 3FKIG 3F2BA 4GKKL 2VUMH 1Q81C 2F3VA 1EL0A 3GTKH 1ZYRD 2N49A 1YEZA 4LNQA 1V1OA 3M3YH 1K8OA 1WTWA 2K1HA 2VQFH 3E0EA 2NYZD 1NCVA 5CBEE 1HR0W 1PA6A 4A93G 4IFDJ 3WWVA 2EVBA 3J81W 5EJWA 2ZXPA 3S17H 5KNDA 3T56B 4NXMH 5ELEA 4ZUIA 3GTGB 4DK0A 4GNXA 1VS0A 1X9ZA 5CBAE 1JC7A 3U1KA 3UDXA 2CTKA 4DV2H 3VA5A 3DM1A 2O4XA 1IYVA 4DV2Q 1X6OA 3D3RA 4A3MB 2E2IH 1V9NA 5FLMG 3BDLA 1LO5D 3ULLA 4HMJA 2F3IA 2Q2HA 1VQCA 2R61A 2WFWA 5DM63 1JJ2A 1ASZA 1Y1VH 1I4HA 4C3JB 2EYPA 1Y1VB 3I0PA 5L37A 3CC4A 1EEID 5IT9W 3AYHB 1Y14B 4DV4H 3UE0A 4EVOA 2ID0A 3EZJA 2R3ZA 2CFMA 4KV6A 4A3KB 1PXUA 2RDGA 3CKIB 1A3UA 4K14A 4BXXG 3HS0C 4ZK9B 1KIXA 1QNKA 1J5EH 4QIWE 3I55A 5IT9E 5GAHC 1I4RA 4DR6H 1XX8A 2A6HD 1XNRL 2K75A 1GXDC 2B2WC 1CHPD 2QF7A 3DMUA 4X65H 4A3LH 2J7ZA 3H3VH 5G3LD 4DAYB 4YCUA 2R7FA 3K5NA 1CKNA 4BBRB 1K73C 1I6HH 3MXGA 1VQMA 3I4MB 3OWFA 2E5LQ 2RDFA 1DOMA 4DR3H 2LMCB 4LF4H 3KOJA 3M3YB 2L4NA 2K33A 3BVZA 2HD3A 3S24A 1Z47A 3K80C 4LUZA 4DV1Q 3CXCA 5C4HA 5IGBA 3BVMA 4X3TA 1AZPA 1HNZQ 2R93B 1HUNA 4XQQA 1MD2D 4DUYL 1TUAA 1KNEA 2F3WA 1PLFA 1F9RA 3HGBA 3KLWA 1OXUA 4A3IG 1B3AA 1XMQL 4IFDH 3S2DB 2UUAH 4B3SH 2O4CA 1CT1D 2OF1A 4L5QA 2RSNA 1DJRD 1SYBA 4GOPB 4JOIA 4B08A 2QILA 1NAPA 3QJYA 2J4XA 4MHEA 4FNFA 2Q2IA 2ZJQA 3MEHA 1JOOA 2Z9HA 2UU9H 1SE2A 2PYKA 3TQYA 3LGJA 3TZDA 2UU9Q 2AKWB 3OMGA 1EQQA 5JVG3 2E5LL 3LNNA 3I72A 3D4WA 2A69C 2R7ZG 5M5WB 2JA9A 2GA4B 1BUVT 1G91A 1EU3A 3S1NB 1SSOA 1KHMA 1IYJB 1M8AA 4HMIA 4KHVA 5GAGC 3KJOA 4LF7H 2F0HA 4DN4M 3BU2A 4LF6L 1H9SB 4H8AA 4DNRB 4JI0H 1CKOA 3ER0A 4XXEA 5BN5A 3L3OC 1U5KA 3HEJA 1AW7A 2MFIA 5FLXc 1R9TB 4X62L 2A1SA 4JI3L 3OHXC 3FAUA 4LF7L 3BG3A 2WKDA 1VQHA 4J6HA 4P72A 2R93H 1YITA 1QJOA 1VQ5A 4KTAA 5EBDA 1PH1A 1Q8IA 1VF5C 2EY1A 4CHTB 5I6YA 1Q1BA 1C48A 4ZRZA 5FLXE 1YHQA 2B3GA 3RD4A 2YTVA 3S1RB 1VMPA 1CQVA 1CSPA 1OXSC 4CJ0B 1A15A 2A73B 3OSOA 2FFKB 2LSSA 3STBC 5DAUA 4KD3A 1U4LA 3T1HH 2CH4W 4IUTA 4OONA 4QUFA 1JWUD 1IW7C 2ZXOA 3K58A 4FXDA 2F1MA 1XWEA 5D14A 4DV0L 2A68D 3C3LA 2M2LA 2UXCL 4A3BH 4IOAA 2EJFC 1WYDA 3F8TA 1N36Q 1KXLA 1PQXA 1TS4A 1M4VA 1N36H 5ELDA 1KTKA 3Q22A 2B8FA 3A7AB 2D9UA 1GUGA 1XMQQ 5LL6b 5IGGA 1XMOH 1BO0A 3TN2A 1BBXC 3J81L 1IBKH 3EROA 1B50A 3KUPA 1U4RA 1P8LA 2WINB 2ICEC 4LIJA 2KHJA 4A3MH 1WD1A 2F03A 1BOSA 3NHHA 4A3DH 1LYLA 1LT3D 1CFMA 5LL6S 4LF9Q 1HCZA 1I4GA 3HOZG 3HOWB 2K4KA 2ATWA 2UUBL 3VYRA 5FOBB 3H6MA 2PMZB 3UE1A 1YNNC 5ELCA 1V1PB 2EPBA 3KF6A 1OO9B 4DR6Q 4FJUA 3VR5A 2JA8G 1SMXA 5AFWA 5M3MH 1B7YB 5C4JH 4LK1C 4KJNA 1HQRD 2PQAA 2XN9C 4MTNA 2JA5H 2BE5C 1LTID 3KLRA 1ZZIA 2NB0A 5ELNA 1J5EL 3FPUB 1KC8C 4AM3A 3A5ZB 1BCPF 2DJFC 5C4JB 4BY7B 4J1MA 4JI7H 2FMMA 4B3RL 4M8AA 1F9SA 4DR3Q 1PRTD 2NZ1D 4B9WA 3GTKB 1S5CD 1F0XA 1D5MC 2F0JA 2JA6G 4JI6Q 1CA6A 1SYDA 2ZQEA 4J8QA 2K1BA 3CCLA 1LT4D 3H91A 1HFNA 1HA5A 1QZGA 1U4PA 1AH9A 4H0LC 4OO1G 2WAQE 3D4DA 3PO2B 4JI4H 1HZBA 3SK8A 1NNXA 2B2YA 3U9OA 1HJPA 1HUMA 3D4RA 3W1GA 2E2JB 3OMCA 5I4DA 3KDKA 1EIFA 3L9AX 1BKBA 5KYLA 5JJLA 4A3IH 1BQQT 1D8LA 3K5MA 1A0IA 1NTGA 4P75A 4YHHL 1QNUA 1E2WA 2OCEA 2O5IC 4A3BB 2CQAA 3OIQA 3A56A 1VBIA 1C9OA 3NSWA 2AQ3B 2EXZA 3T1YQ 3H3VI 4LAAA 3PUYA 5IP7H 5JPMC 3M9BA 4OIJA 5LMUQ 1I3QH 4DV0Q 4B3ML 2L12A 4X3KA 1C4QA 1EFWA 5C44G 1E3PA 1TVXA 5E3FA 1W2BA 1J6QA 1I6VC 1DTJA 3OW7A 3RLOA 4A75A 2QDBA 4RWSC 1JR0D 5G3LF 4B3TH 1Z7TA 4N8FA 4B3MH 4DV3H 3CHBD 2HT1A 2ALYB 5D3IB 1CM9A 3HKZB 5EKIA 2GN5A 2R7ZB 5C3WA 1RF2D 1QUQB 4HEDA 1ET9A 1UE7A 1E1TA 5FJ8G 2IHFA 1WTRA 3V69A 1JE4A 1C8CA 4HIDA 4J15A 1I6UA 4JI1L 2D5DA 2NVYB 2VB3X 4DV3L 3T53B 4DK6C 3S15H 2MHVA 4QIWB 2JXMB 3SR1A 4A3DG 1G8ZD 1GHKA 1G2SA 1Q8KA 2AHOB 1AN7A 4XQJA 1VCIA 2IX1A 1MSHA 2I07B 2Z6KC 4ULLA 3H15A 4AQYQ 2AXYA 4P73A 5JOBA 4DXFA 1WTXA 1D6EC 4UAIA 4IALA 2I5MX 2NVQH 2B2TC 1QE6A 1VF7A 3AFQA 3I91A 4OWXB 3RMHA 5AJ3L 2WB1G 2B2UA 4X65L 1G291 1TS5A 5KIXA 5KYIA 1K1GA 3VDYA 3TS2A 3SB1A 2KOLA 4DK3C 4YY3H 5C3XA 5E1FA 1FL0A 3PO3G 1ZXTA 3J80E 2KCNA 2AWOA 1YHBA 1Y8OB 2UXBH 4IN3A 1JWMD 2F0KA 3B6YA 5J1ZA 3ICEA 4C1NI 4KKTA 2MJHA 1ENCA 3G4SA 1PHJA 2B63H 2G8YA 2PQUA 2WP8J 3J81j 1Y1WG 1KAWA 4RH6A 4YY3L 4BY7G 3F1ZA 3M4PA 5DLQE 1LLRD 1STHA 4DUYH 2FXQA 4L6TB 2HHHL 2GVBA 2Y0SB 2VW9A 2RVLA 4A3LG 1EIYB 1Q90A 1VQJA 4LF9H 2Q2UA 4R4CA 1IHZA 1F9QA 1XJVA 1PDQA 4A3GB 4KKUA 2Q8IB 3J7YW 4BY7H 3QOJA 4C3JG 2F0UA 4OD6A 2V1CC 2LXJA 4NKLA 5D3DA 4X65Q 1JMCA 4HJ5A 2M6QA 1LABA 4ILWA 2JA5B 4K0KQ 2WKCA 3S1MH 4LF5Q 4OCHA 3OTOH 3CC2A 2R7DA 1UAPA 3CCUA 4NBQA 4B8TA 4A3FG 1N33Q 1ICFB 4NZTM 4H13C 2JQOA 4JI5H 3P7JA 3WDNA 3HOWH 2E74C 1CI3M 3I73A 2PO4A 4G57A 3AU7A 4DV6H 4LF4L 1KABA 4G7HC 1MIUA 3JAMW 1IZ6A 4C3HG 3U58A 1W6JA 3G48A 3J80i 1D5XC 2MP1A 2FMCA 1KLUD 4GOPC 1HNXL 5M3FG 1K8GA 1ENFA 2UUAQ 1WCMH 5IYDG 3F2CA 1YIJA 2E8GA 4I7AA 4BY1G 4CKBA 1ML0D 1GUWA 5KEEA 4ME5A 3DWPA 3HKZG 3K81C 3AEVB 4EQPA 2CH4A 1X3EA 1EY0A 2BOSA 2F0EA 2PPBC 3ERQA 2L1BA 1OXVA 1RHPA 2BH8A 2I5LX 4DR2Q 1JOKA 4Y52H 4IPCA 1NXUA 4GZYC 1PTOF 4K8IA 5LMNQ 1X56A 3NBHA 3RZOH 1KDAA 2UU9L 4XT1B 1ZEQX 1AN8A 2R6GA 2PQEA 3A55A 3FKIH 2ENBA 3RZDB 1TWHH 3V2TA 4NZRM 2BCOA 1Z6HA 1X3PA 4DR5L 1Z9FA 2KUMA 2NTTA 1HZ9A 4WJWA 1WD0A 1A2UA 3OETA 3HOZB 4O1NA 3NENA 3IL8A 1KD1C 2PY9A 1N8RC 1VQFA 4XIGS 3QOLA 4DK1A 3KBXA 2F0QA 2ES2A 2ZTCA 2ZXRA 4LFCL 1PYWD 3HOZH 2MJ8A 1PRTF 3D6WA 3C46A 4DR5H 1D2BA 2VY3A 3SK6A 3RZDH 1B9NA 4AH6A 5IYBG 4P2CB 5IYCH 1X0AA 2QEXA 1XRHA 2B2TA 1R9TH 3Q8DA 3KJPA 5C0XG 1SNPA 1UUPA 4U68A 2XTIA 1YNJD 4ZCKA 4A3CH 1IBMQ 4HJ7A 1STGA 1J9OA 3MWYW 4RGMA 4DAMA 4EX5A 1EY8A 1ZZJA 3KF6B 1E2ZA 1VQDA 4HN7A 4RCOA 2CTMA 1P16A 4QQBX 5JEAH 1Y1VG 4LFBL 1WI5A 3S14B 1VMCA 2X69A 1A6XA 3LWEA 4LMQD 1HTLD 3MTSA 4PZ7A 4IUQA 4HCSA 1Q7YC 1X9NA 4X6AH 5HY6A 4C3IH 1YNXA 3ND8A 5KNCA 3H3VC 4JBMA 3FEWX 1F2MA 1EY4A 1FR3A 4F88A 3EN2A 1WTHA 3HOXB 1HNXQ 5C44B 4DUZH 3D31A 1H9JA 1PH7A 3P75A 2JA8H 3I8ZA 2VXWA 2Z0SA 1IBKQ 3J80c 2UXDH 1VQPA 1EY6A 1EEFD 1H9KA 1UE5A 2CW0D 4NW2A 4Y7NB 2E76C 4LFAH 3QD7X 4LUVA 4X66L 5C3EH 1IKMA 4YHHQ 1PTOB 3U4ZA 2BE5D 1EZ8A 3PMFA 1J5EQ 2RCNA 5FKAC 3NBHB 1KQSA 1BCPB 2WIIB 4CDDC 2O2LD 2TMPA 4YWKA 2Y0SG 1NR4A 3VR3A 4OX9L 2Q8RE 4PG3A 4EQNA 4DR6L 1J4WA 2JYOA 4JW0A 2ASBA 1D1KA 4WORA 4L8JA 1PH8A 5CMDA 4RFBA 2G9HD 3CU7A 1PH3A 4IPDA 2RBMA 3HOXH 2B8GA 1L0YB 3J80L 5CV7A 2CTJA 1IYUA 3FDTA 4GOPA 2O5JC 1STYA 1T9HA 5DM73 3J7AV 5EKKA 4C3IB 3HKZE 4LF4Q 1N32Q 3IRBA 3FMCA 4WANA 4DV6Q 3M4YA 5C4XH 3BYYB 4JI8L 4B3TL 1YZ6A 3X3NA 3J7AK 4ALPA 2F0DA 4LW1A 1Y1WH 1SNQA 1B3QA 2WB1B 4JI4Q 3SDZA 3NEMA 1V43A 4OGQC 3VR6A 3ND9A 1ENAA 3A5UA 1M1KC 2NVQB 4JI1H 2D2CC 4C3HB 2BH2A 1L1OC 5I9PA 4X3UA 1YJ9A 1VQOA 1PTOD 2OTLA 3R93A 2K5NA 5EGTA 3GV6A 4QY7A 4X64Q 1PH6A 1LV9A 4RHSA 1DM0B 4QL5A 3S15B 4H7BA 4OELB 3OSSD 5H1SE 4MTKA 1CZWA 2K32A 2N88A 3TBIB 4IO9A 2AQ2B 1RTNA 4UP7A 3S17B 3FVQA 1EUJA 2LXKA 1FJGH 3MFGA 1O7LA 4RAUC 4IURA 4R4QA 3MXUA 3MXPA 1FJGQ 2A1AA 3RLNA 3GTMB 4JI0L 1N36L 4ZKCB 1JJGA 3CD6A 2XRSD 3A54A 3K6OA 4CKEA 1FJGL 3KF8B 1DXMA 1PFNA 1STBA 1EYAA 4IUUA 3SK4A 2Y0SE 3Q6SA 4DNIA 3K59A 4DV4L 1PMRA 3RZOB 5NUCA 1I3QB 2PCFB 2Z4IA 3PCOB 4LF8L 5LL6X 2BL5A 1CKNB 3K7UC 2C5CA 4FYDA 4A3MG 2CWFA 4DAYA 4JYAQ 1PZKD 2R93G 2RHSB 1B4OA 2OQ0A 2UUCL 3OYYA 1PTOC 4LF9L 4AYBB 1B53A 5IGFA 3PO3H 1C0AA 1G6PA 1VDZA 4DGZA 4WJ4A 2ICIA 4NXNQ 2RDHA 4QF4A 4L63B 4XDXA 2E2JH 1E1OA 2CTFA 3T16A 3KBGA 3T1HQ 2LFNA 5ELOA 1LTLA 4ZUJA 4ZKBB 3E5SA 4A76A 1KDBA 4KJOA 1Z2IA 3CPFA 4YY3Q 3SE0A 4GKJL 2EY2A 3DWQA 3LWUA 2L5TA 1GD7A 5C5MA 2K50A 2LTLA 1QWYA 2F4VQ 1FNUA 2OEOA 4YCVA 3T13A 1GUOA 1F2ZA 5ISRA 3GTMH 4DR4H 4RCNA 1RD9D 4PMBA 2VKCA 2UXBL 2KECA 1EYGA 1XMQH 1LUZA 3J81i 4E6IA 3KF8A 3C1EA 4IPGA 1I94Q 4OXPA 4JVHA 2DNCA 1Q82C 1MJCA 5K36H 4LFAQ 3TP6A 4I7ZC 1S5BD 4K5XA 4A3GH 2E2DC 4GNXB 3NQIA 4GN5A 4RG1A 4OO1I 4X3SA 1MBYA 2ZT9C 1IBML 5IGCA 4IUNA 1SAPA 3NTKA 1S20A 5T1GA 1RDPD 1J5KA 3GTQH 3ITPA 4R8NA 1QG7A 3A74A 2DUDA 2Z8LA 2YQRA 1SEBD 1K8AC 4NXMQ 1CZGA 3OTOQ 1EY7A 1K0RA 2K5HA 3TP5A 2GVAA 4Q5VA 4KLKA 4AIMA 1SROA 2FHTA 3Q24A 2CTLA 2MPMA 4LFCQ 4X62H 5C4XB 3PV0A 4XQNA 5I2XA 4CJ1B 3RLFA 5CV9A 3EFXD 2CPMA 4UY8C 1GKHA 1FKAH 1HZAA 4QMGA 4FF4A 4GS3A 4PDBA 2IJ0A 1HRJA 3GTOB 1RIPA 2M00A 2WAQG 1LTTD 3A8KE 1LT6D 2KEDA 3GTQB 1XMOQ 4P74A 4KY6A 5J39A 2A74C 2K5DA 1NR2A 2VB2X 1KRTA 1EC6A 1TY0A 2PQAB 3DUZA 4DR2H 4QB4A 4POGA 4PQXA 1EQTA 1LT5D 5DT9A 2KENA 4CDFC 2PI2E 4LFBH 4DV0H 3M4OH 3NXWA 2F0NA 2QKIC 1E24A 4RHRA 1XXGA 2KVMA 2JA8B 5IYBH 4JI0Q 1O80A 4HIOA 4HIMA 2PZUA 2PT7G 4JI3Q 2E75C 2Q8TA 2LF0A 2J0TD 4B3TQ 5C0XH 2E3UA 1EIHA 1VQ4A 1YNND 2BA0A 2SNMA 3VYUA 2N3SA 4R8IA 3I2ZA 4DKAC 3CP0A 2UXCQ 3N6RA 2Q2TA 1SN8A 1PFSA 3NBIA 4DXGA 5K5PA 2F0VA 3NP8A 1SE4A 3CQZH 3S1NH 3X3MA 2B39A 2HHHH 3C1FA 1F9PA 4YIJA 2UUBQ 4TQUS 2N78A 2SNSA 2JA6B 2UUBH 2SDFA 1XNRH 1MI2A 3IKJA 3WOEA 2IHEA 3KYHC 4DNTB 1S5ED 1ZKOA 4R9WA 1WTOA 1GVPA 2IW3A 2R92G 3NTHA 3S1QB 5JEAG 2IY5B 3A8JE 2BDNA 1WVLA 2AUJD 4FXGC 1E7ZA 1SEIA 2VQEQ 3AQQA 4UHVA 1CKMA 5CR3A 2HH3A 4A4IA 4QJFA 2CQOA 1MHWC 4IUPA 2R92B 1K3BC 2EQSA 1DONA 3JAMi 3VKEA 5E4XA 3S16B 4IJHA 1NJIC 1V8CA 4LWCA 3TP7A 1JORA 3CMAA 2YV5A 3I4MH 1AFPA 3IFTA 5M5YB 1DZ1A 3A7LA 4WFN3 4BBRH 1NY4A 1YBYA 3Q23A 1G6ZA 1JE5A 3NE5B 4PNYA 4KHPQ 5M3MB 5FJ8H 1I94H 3NWTA 4QGUA 4OIKA 4IQZA 1WTQA 4RGNA 1EIGA 3I4NH 1STAA 4KMUC 4YHHH 4AQYL 5EPLA 3WOFA 2JVZA 1DOLA 3I7FA 4YCWA 1Y8NB 4X66Q 1K83H 1FD7D 4V0BA 3HOXG 4A3DB 2E2HB 3C2PA 3E3XA 3PUWA 4A3KH 2X6LA 1VQ8A 4X66H 1N34H 2K04A 1UEBA 1EZ6A 3GTPH 4K0KH 3R8BA 3M7GA 3CCRA 5FO8B 3GD7A 4OX9H 5JJKA 1N9WA 4CDCC 4DV5L 4B8CD 5IGEA 1L2FA 5BN4A 4CJ2C 1A2TA 3M4QA 1H9RA 3IAYA 3CCEA 4DV5Q 1HTPA 1Q12A 1K28A 1F77A 2IPKD 2K5QA 3I4LA 4JI5L 4K0KL 2F4VL 2K28A 5A2QW 4K6DA 2L15A 2E2HH 1JB7A 1J8IA 1JICA 3CAMA 1TT2A 4GLAC 2ZJPA 3FP9A 3DWAA 4ID6A 3M85A 1NMFA 3GO5A 4JOIC 4GNXC 2KA7A 2PZTA 3BZDB 1TU2B 3URYA 4DR7L 5BR8Q 5I2YA 1B9MA 1XPOA 1B8AA 2KEEA 3HRZC 4A3EG 2UUCQ 5J22A 4DR7Q 3R2IA 1KNAA 4MIUA 4UPAA 1FNWA 5M5YH 1WFQA 1ESFA 2OQKA 1DT4A 3S2HH 1YNJC 1D7QA 1PTOH 3H0GG 3RF2A 1UEAB 2OXPA 1B1ZA 2MNAA 4DV7H 4Y7NH 1I5FA 2MO0A 2ZTEA 3HP3A 2VUMB 4BA2I 4HJ9A 4F87A 3PUXA 4ODGA 3PF5A 1BF4A 1PRTC 3PIPA 4KD4A 3GKUA 2KHIA 4BBSB 4DA2A 3TP8A 1TY2A 4L5TA 4GKJQ 3CCJA 2F4IA 3DEPA 3H0GH 2EYOA 1WVNA 4POFA 2OTJA 4QMFB 1LTRD 5C3EG 2MQHA 1PRTB 3PIO3 3GABA 1QVFA 1SNCA 1T5EA 1XTCD 4B3MQ 1LTGD 4CBVA 4HJ8A 4DR5Q 1BXTA 1U0LA 2WV6D 3I70A 2FFMA 1K0SA 1GJXA 4FDBA 4TRDA 3QG1A 4DV2L 4BS9A 2Z6KA 3EIVA 1BCPC 3PIOA 2ANNA 5CYUA 4IOCA 4OEMB 1FGUA 4JV5Q 4CKCA 5A35A 2M8WA 4HJAA 3IFDA 5CV6A 2JJQA 3HOVG 1L0XB 1HXYD 4OWWB 2CW0C 2B2UC 1I50B 1SYEA 2P5ZX 2HH2A 1E22A 1S3OA 1OTCA 3D8GA 3SHLA 2F0LA 2NUCA 1RKNA 3TSSA 4DR1Q 3KLSX 5FO7B 1EY9A 1UG8A 2ZTDA 1ILQA 3GR5A 3MAQA 4OL7A 1SFOB 3JAME 3O13A 2YTYA 2CTEA 1LTBD 3S2DH 3U4VA 4N9PA 4BBSH 1OXXK 3OTOL 3HOVH 2KQ3A 4LUOA 2EJMA 3M4OB 5LMNH 2VQEH 2QDLA 2NZOA 5EQ0A 1RTOA 3ULPA 2JP1A 3EA6A 3M7NA 1A3VA 1TS3A 4L5RC 3UDFA 3RN2A 3GTLB 5C5LA 4KHZA 2CWPA 2QW7A 3S2HB 1IW7D 4JI8H 1XYIA 2TSSA 1CA5A 2Z1CA 3PUZA 1PFBA 1DYQA 4KHPL 3SGIA 5FLXL 2JA7G 1ONLA 3J81c 3FKIB 4DV1L 1Y8PB 1RCVD 5BN3A 3UDIA 4YWLA 2AQ1B 2K5WA 2LTMA 2NVXB 5HURA 4FF3A 4TKOB 1JWSD 1B2TA 1TWGH 1HR0H 1XNQH 1LTSD 2HIXA 4WRDA 3ULJA 1GO3E 2HIVA 2UUAL 4AQYH 1YJNA 2CPQA 3CCVA 2K14A 4C3JH 5J3BA 3J7ZC 1CK1A 3K0XA 1N32L 1MSZA 4EQOA 2LRRA 3HG9A 5M3MG 4A3BG 2PI2A 2A5HA 1HNZL 1V9PA 3UDGA 4JI5Q 2XGTA 2E2IB 1LACA 1SNDA 1VIHA 3OWEB 4LFCH 2PZWA 3CCSA 3ONAB 4KN7C 1I4PA 1QVGA 5M5XB 3GTJB 3MFYA 2DGYA 4LF6Q 2BDOA 4A3JB 4RKLA 5AJ3Q 1HNZH 2B63G 3MA2B 4JI2Q 1K3RA 3ZYYX 3KLSA 2B2VC 3MVVA 4X64L 1SMYD 2F0FA 1VQLA 1HNWL 4LF8H 2EYLA 2QEJC 2Z4HA 1ZTGA 1SBBB 4ZYSA 2NWGA 1SLJA 1Y69U 2I46A 3MEFA 1QCBD 4JK1C 3KDFB 3QIAA 3QO2A 2AMCB 2R92H 4FF2A 3A0JA 4R4TA 5M5XH 3GTJH 1SR3A 1WOCA 1FVIA 1PFMA 3QB3A 2JEAI 2XIWA 2OT2A 2VQFL 1GUTA 1ASYA 4H44C 3OPOA 4LF5L 4TSSA 4LF7Q 4PZ8A 2LY7A 2K5VA 3TEHB 2D0OA 5CGKA 4NXML 1HA6A 4ZQ3A 1EU4A 1ZYRC 1N33H 3GV3A 1T5XD 1XPRA 3I4NG 4K6LA 3NQTA 4FVMA 4E9JA 3UOEA 3SK5A 2OPUA 1AZQA 4C56C 2K03A 3MHBA 1SNMA 5CV4A 1BNZA 2UXDL 2L11A 3CMEA 1X32A 3CQZB 3STBD 1QUQA 1VQEA 1NUCA 1SJED 2JZXA 1Q46A 2HHHQ 2EYMA 4PMCA 1EWIA 1PYBA 1I94L 3PO2G 2RHQB 4KY7A 1GUSA 5FLXW 2RQXA 1F2YA 3BJUA 1IBMH 3VR4A 3KDGA 5EAYA 4DR1H 2EYFA 1W6KA 1IBLL 1BBUA 1IBKL 3K7AH 3HOYH 4GN3B 2QCPX 5COYA 2ZM6L 1Q3LA 1X3GA 4R4IA 1QZHA 1SJHD 1Q1EA 4XTCS 2JA7H 1SDFA 4DR1L 5JAVA 2WACA 5CORA 4WJ3M 1IBLH 3EQLC 4NB3A 5HGQA 2M9VA 3KDFA 2WB1E 3NELA 3RN5A 2QNDA 3JAMc 2AWNA 2ANRA 3T4AC 1YI2A 3ERSX 5IWAL 3BS1A 2CWAA 4DUZQ 1HNXH 5JJIA 2QA4A 4MNOA 1HHVA 1JJCB 1KL9A 4MN3A 1I4QA 1I50H 1JOQA 4HAEA 2CVRA 3G71A 1JB3A 4JYAL 1UWVA 2HDLA 3BZCA 5M5WH 3K0YA 2F0PA 1STEA 1EYDA 3L2PA 4UP9A 1ESRA 1JT8A 1ICWA 1QILA 4JYAH 5I9OA 4I65A 3HOUG 4UP8A 4IZ8A 3J7AF 3KFUA 2EYHA 3SEBA 1KRSA 1N34L 1YVCA 3OIPA 3MXNA 4JBWA 3I90A 1BVSA 4JI6L 5K36G 2E5LH 2A6ED 2KCCA 4DV5H 2B2VA 3FPPA 2ZJRA 2F0IA 2XNAC 4PMWA 4RGOS 1N32H 3DLLA 2EOTA 2A8VA 3CCMA 2K52A 2KJXA 5EPKA 4ZLTF 4K5WA 1EOTA 5DNFA 3FHWA 1EFID 1STNA 5IT9c 3CCQA 1BR9A 4NPSA 5IP9H 2F0GA 2MUYA 1VIGA 5BR8H 3E9HA 4KN4C 4AYBE 1M90C 2K7VA 4P71A 4BBSG 1XTDA 2UUCH 1SNOA 2MGSA 4HCEA 3DXJC 3HFZB 4JPBW 2EXDA 3D0FA 2X06A 1S5FD 5CV8A 5IIFA 1S5DD 5HGTA 3F2UA 2DN8A 4X64H 1HPCA 1EOVA 5IP9G 1X3FA 2SOBA 1H9MA 4K5VA 5CV5A 3G6EA 1V1PA 1KHIA 3J80W 4WALA 2N55A 5IYCG 2F0WA 1WJJA 4DAVA 2DY8A 3RNUA 3G7LA 3S14H 1W3SA 4GN4B 1SYGA 1O7YA 2G9DA 2BA1A 2D62A 5GADC 4LJZC 1G51A 1VQ6A 1EYCA 2YU9H 4OWTB 4O42A 3DHQA 3BVGA 1O7ZA 1X4NA 2UXCH 3NUCA 1TWGB 4G4KA 2EJGC 2XSCA 4JVZA 3EVQA 3BYTB 4LFAL 2RF4A 2RKSA 4DV1H 3CRLC 1SE3A 2B29A 3W3AA 3L7ZC 3GTGH 2VZAA 4DFAA 1MKHA 5E4WC 1G2TA 1C7YA 4IJLA 5GQOA 4JI1Q 1XNRQ 1V1QA 4XT3B 3S16H 3MXNB 1Q86C 4A93H 4A3EB 3I3CA 2A6HC 3JC66 1X3QA 4DF7A 4BBRG 1D1IA 2B2YC 1PH2A 4G08A 1TQOA 3D6CA 3T1YH 1IBLQ 3HOVB 4Q0FA 1XPUA 2IX0A 4AYBG 3PF4A 5KNBA 5M3FH 2AUKA 2X6GA 1DGSA 4O0AA 5M9OA 2F4VH 2I0QA 3J7A5 2F52A 4NDXA 4HIKA 3VR2A 5FO9B 2F0TA 2HCIA 4F7XA 4ME3A 2YU9B 4C3IG 1TWAB 4JI3H 3HOUH 4GLVB 5IWAH 1ET6A 1HNWQ 1X4MA 2NVTB 4KHPH 1A8VA 5IWAQ 5LHY1 1Y1WB 1ZZKA 1BBWA 3CRKC 3DM3A 3L0OA 1A63A 1JCKB 2C9OA 4OHJA 3J81E 4B3SL 2FMRA 2D9IA 1UE6A 2NZHA 2CCZA 2JN4A 3U50C 1HR0L 4C1NK 4DAPA 4DV7L 3W1BA 1S4ZA 1GUNA 3H0GB 1AE3A 2K01A 2WAQB 2VQFQ 5IGDA 4BXXH 5GROA 4C2MH 5A2QE 3AEVA 3TZUA 2EE1A 5T1IA 3PUVA 4NXNH 2A69D 2HQEA 1PH9A 2KCMA 2OPVA 1CTMA 3H09A 3QWNA 5IP7G 3V05A 1DCZA 1NMGA 1YJWA 1E0BA 1VQ7A 3NPPA 1TIID 5E7NA 3DEOA 4X62Q 1SYCA 4JI6H 1N33L 3AMUA 4G7OC 1L1OA 2MO1A 1I6HB 4HR7B 2FPHX 2HDMA 2Y3MA 4JBKA 1PYSB 4DR4Q 1IL2A 2F0SA 4FO2A 4DR7H 2XWJB 2NN6G 4OO1H 3BDOA 3R3OA 4R1JA 4RKBA 4C2MB 3GTOH 1X55A 2EZVA 1HH2P 5EPJA 5IOCA 3GDEA 1UNSA 4RGTA 1TS2A 3TS0A 3OW2A 3TDQA 1K9MC 5C6AA 4U673 1S72A 2K6AA 1IXRA 3MZ5A 3S9WA 1E2VA 4EQ5A 1GHJA 4GKJH 3P1HA 5FK9C 2NVTH 1N34Q 1TR5A 3E0JA 5LMNL 5EKLA 1WTJA 2LS01 3T1HL 4KY5A 3PIP3 2VUMG 3NCVA 3HOUB 4DU9A 1VQIA 2NBFA 3GTPB 2VNUD 4B3RQ 2CHBD 4DR4L 2EY6A 2N8NA 3K8AA 1VQAA 5C0XJ 3HKSA 3K5OA 5EBCA 2PNRC 1NSNS 4JV5L 1K83B 4BY1H 4JI7Q 2YTXA 4NMZA 4ZAIA 2HUGA 1NBWA 3I4NB 1WHRA 1OXTA 2P2RA 4IPHA 4F8MA 2NVYH 2VS1A 4FF1A 2IT1A 1ILPA 2CKZB 4JI4L 1XMOL 2OWOA 4JV5H 3W5OA 5KRUA 4A3EH 4A93B 4FJSA 1XNQL 4YWMA 1RJTA 2G5DA 5TSSA 3CPWA 4JVYA 2IL8A 4QCLA 2KBNA 2JEBI 1K8MA 4S3SA 4FP5D 3TMEA 4R4OA 3AB9A 4EC5A 3U9SA 1HQMC 2KHSA 1TWHB 3LX0A 2JK8A 2F0MA 4PV1C 2ZM6H 2PW5A 3TRZA 2JE6I 5C4ZA 4N8X1 1LTAD 3S1QH 4LFBQ 1LM0A 4APVA 3K5LA 1DD2A 2RSOA 3E6ZX 5LMUH 2FJ2A 4DPGA 1PVOA 1TWFB 1R4PB 4V190 4K2KA 4DR3L 5A2QL 5ELBA 3T1YL 4JI7L 3PO3B 1QVCA 2LKVA 1F2LA 4QUCA 2YYZA 1UE1A 4A3IB 1BDOA 1V8QA 4PZ6A 2K05A 5IE8A 2JA6H 2Z6BA 4B9XA 1D5ZC 2C35B 2QGQA 1WCMB 3V96A 1HFGA 4GKKH 4CDEC 1GOZA 1HNWH 4DV6L 1H9SA 4DV3Q 2UXDQ 4NP5A 1DOKA 3A8IE 1SMYC 4DR2L 5IODA 1EY5A 1KAAA
chains in the Genus database with same CATH topology
1A3TA 5I6WA 4M1UB 2KCTA 4MZ9A 1X54A 1TWCH 4IUVA 1YHAA 3EJIA 3NK9A 1O7IA 4CGYB 4GLXA 4A3GG 1EWCA 1R4QB 1SRUA 2A6EC 1EWHA 3VYSA 2SEBD 4JC0A 3P20A 1L0WA 1AP0A 3S1MB 4OX9Q 2H1EA 3KK7A 2L55A 4K8JA 1U4MA 1A62A 1B70B 4L5SA 2L9HA 5JEAJ 1PZID 2EDGA 3VA7A 1MJEA 5KGUA 2XWBB 4XYOA 4K2LA 2HCCA 4IFDI 4JG2A 1VQNA 1WTPA 4ABNA 4A3JH 3GP7A 1CHQD 1MGSA 4BY1B 2L0CA 1JQYD 3HOWG 5C4XG 2EIFA 3BDCA 2FINB 3NWSA 1EQRA 3CW2C 4JI8Q 2A68C 4C3HH 2PW7A 2UXBQ 1EQVA 1FYCA 5GAEC 1CUKA 5D65A 1RL2A 3T51B 2B63B 4DUYQ 4LF8Q 2DY7A 1I4XA 1SXTA 4XYQA 4N9TA 2NN6I 3HZXA 4A3JG 4EGVA 3SVMA 2H5XA 3SXHA 3UI2A 4DV4Q 3RR5A 1WCMG 4A3FH 5IYDH 1FNVA 5DEHA 1RODA 3GQBA 1WE8A 3CC7A 1KDCA 1PZJD 5JPNC 4A3FB 1HR0Q 3EBEA 5JJZA 4KKSA 4HSVA 2PNHA 5C0XI 3NTIA 2HQLA 3MC0B 1S40A 2JA5G 2VQEL 4HSPA 2EYJA 2XVSA 1B44D 4HTHA 3VYTA 2NVXH 3PSIA 1FGBD 4RMFA 5LMNW 3W2DA 4KK7A 3RUZA 3S1RH 4JCVE 3OOCA 2A19A 4JI2L 4A3KG 2B2WA 2DGRA 2XRQD 5FLMH 3GTLH 5C3EB 1O78A 1VQ9A 5CC4A 3R2TA 1MSGA 3I56A 2RA4A 2NTSA 1X65A 2JSOA 2JA7B 3E9IA 4DUZL 3JAML 5IT9L 2R7ZH 1VQKA 1H95A 1L1OB 4TVAB 4Z9CB 1IL8A 4B3SQ 3PGZA 1PV4A 4H02A 5F2DA 2F0OA 3K7AB 2V4DA 3HOYB 3AFPA 5C44H 1SFOH 1VQGA 2IWHA 1SYFA 1SE8A 4A3CG 3H94A 3I4MG 3G6JB 1II3A 1GM5A 1WTVA 1TWCB 1PH4A 4DV7Q 2VL6A 2DNEA 2ZM6Q 1QOHA 4FXKC 4RA8A 4NXNL 3K57A 1AEXA 4G7ZC 2PMZE 3CF5A 4KI0A 2IX3A 3FRPB 1AE2A 1U9RA 4IFDG 1CSQA 2NN6H 3TREA 1HZCA 1BCPD 4JBJA 4UDUC 1TWAH 2EY5A 5JVH3 3HOYG 4O2DA 3N52A 3ZJYC 4BWGB 3F2DA 5ELFA 3Q0AA 1NE3A 1QB5D 5LMUL 1TWFH 1IKLA 4BA1I 2D0PA 3I4OA 1TXYA 1CQFA 1KLGD 4GKKQ 2H4OA 5BR8L 3PO2H 5M3FB 2I5HA 1TKWB 1PH5A 1VQBA 1XNQQ 5IY0A 3BZKA 3FKIG 3F2BA 4GKKL 2VUMH 1Q81C 2F3VA 1EL0A 3GTKH 1ZYRD 2N49A 1YEZA 4LNQA 1V1OA 3M3YH 1K8OA 1WTWA 3E0EA 2NYZD 1NCVA 5CBEE 1HR0W 1PA6A 4A93G 4IFDJ 3WWVA 2EVBA 5EJWA 2ZXPA 3S17H 5KNDA 3T56B 5ELEA 4ZUIA 3GTGB 4DK0A 4GNXA 1VS0A 5CBAE 1JC7A 3U1KA 3UDXA 2CTKA 3VA5A 3DM1A 2O4XA 1IYVA 4DV2Q 1X6OA 3D3RA 4A3MB 2E2IH 5FLMG 3BDLA 1LO5D 3ULLA 4HMJA 2F3IA 2R61A 1VQCA 2Q2HA 2WFWA 5DM63 1JJ2A 1ASZA 1Y1VH 1I4HA 4C3JB 2EYPA 1Y1VB 3CC4A 1EEID 3AYHB 1Y14B 4EVOA 3UE0A 2ID0A 2R3ZA 2CFMA 4KV6A 4A3KB 1PXUA 2RDGA 3CKIB 1A3UA 4K14A 4BXXG 3HS0C 4ZK9B 1KIXA 1QNKA 4QIWE 3I55A 5IT9E 5GAHC 1I4RA 1XX8A 2A6HD 1XNRL 2K75A 1GXDC 2B2WC 1CHPD 2QF7A 3DMUA 4A3LH 2J7ZA 3H3VH 5G3LD 4DAYB 4YCUA 2R7FA 3K5NA 4BBRB 1CKNA 1K73C 1I6HH 3MXGA 1VQMA 3I4MB 3OWFA 2E5LQ 2RDFA 1DOMA 2LMCB 3KOJA 3M3YB 2L4NA 2K33A 3BVZA 3S24A 1Z47A 3K80C 4LUZA 4DV1Q 3CXCA 5C4HA 5IGBA 3BVMA 4X3TA 1AZPA 2R93B 1HNZQ 1HUNA 4XQQA 1MD2D 4DUYL 1TUAA 1KNEA 2F3WA 1PLFA 1F9RA 3HGBA 3KLWA 1OXUA 3S2DB 1B3AA 4IFDH 4A3IG 1XMQL 1CT1D 2OF1A 4L5QA 2RSNA 1DJRD 1SYBA 4GOPB 4B08A 4JOIA 2QILA 1NAPA 3QJYA 2J4XA 4FNFA 4MHEA 2Q2IA 2ZJQA 3MEHA 1JOOA 1SE2A 2PYKA 3TQYA 3LGJA 3TZDA 2UU9Q 2AKWB 3OMGA 1EQQA 5JVG3 2E5LL 3LNNA 3I72A 3D4WA 2A69C 2R7ZG 5M5WB 1G91A 2GA4B 1BUVT 2JA9A 1EU3A 3S1NB 1SSOA 1KHMA 1IYJB 1M8AA 4HMIA 4KHVA 5GAGC 3KJOA 2F0HA 4DN4M 3BU2A 4LF6L 1H9SB 4DNRB 1CKOA 3ER0A 4XXEA 5BN5A 3L3OC 3HEJA 1U5KA 1AW7A 2MFIA 5FLXc 1R9TB 4X62L 4JI3L 3OHXC 4LF7L 3BG3A 2WKDA 4J6HA 1VQHA 4P72A 2R93H 1YITA 1QJOA 1VQ5A 4KTAA 5EBDA 1PH1A 1Q8IA 1VF5C 2EY1A 4CHTB 5I6YA 1Q1BA 1C48A 4ZRZA 5FLXE 1YHQA 2B3GA 3RD4A 2YTVA 3S1RB 1VMPA 1CQVA 1CSPA 1OXSC 4CJ0B 1A15A 2A73B 3OSOA 2FFKB 2LSSA 3STBC 5DAUA 4KD3A 1U4LA 4IUTA 4OONA 4QUFA 1JWUD 1IW7C 2ZXOA 3K58A 4FXDA 2F1MA 1XWEA 5D14A 4DV0L 2A68D 3C3LA 2M2LA 2UXCL 4A3BH 4IOAA 2EJFC 1WYDA 3F8TA 1N36Q 1KXLA 1TS4A 1M4VA 5ELDA 1KTKA 3Q22A 2B8FA 3A7AB 2D9UA 1GUGA 1XMQQ 5IGGA 1BO0A 3TN2A 1BBXC 3J81L 3EROA 1B50A 3KUPA 1U4RA 2WINB 1P8LA 2ICEC 4LIJA 2KHJA 4A3MH 1WD1A 2F03A 1BOSA 3NHHA 4A3DH 1LYLA 1LT3D 1CFMA 5LL6S 4LF9Q 1HCZA 1I4GA 3HOZG 3HOWB 2K4KA 2ATWA 2UUBL 3VYRA 5FOBB 3H6MA 2PMZB 3UE1A 1YNNC 5ELCA 1V1PB 2EPBA 3KF6A 1OO9B 4DR6Q 3VR5A 2JA8G 1SMXA 5AFWA 5M3MH 1B7YB 5C4JH 4LK1C 4KJNA 1HQRD 2XN9C 2PQAA 4MTNA 2JA5H 2BE5C 1LTID 3KLRA 1ZZIA 2NB0A 5ELNA 1J5EL 3FPUB 1KC8C 4AM3A 3A5ZB 1BCPF 5C4JB 4BY7B 4J1MA 2FMMA 4B3RL 4M8AA 1F9SA 4DR3Q 1PRTD 2NZ1D 4B9WA 3GTKB 1S5CD 1D5MC 2F0JA 2JA6G 4JI6Q 1CA6A 1SYDA 4J8QA 2K1BA 3CCLA 1LT4D 3H91A 1HFNA 1HA5A 1QZGA 1U4PA 1AH9A 4H0LC 4OO1G 3D4DA 3PO2B 2WAQE 1HZBA 3SK8A 2B2YA 3U9OA 1HUMA 3D4RA 2E2JB 1HJPA 3W1GA 3OMCA 5I4DA 1EIFA 3L9AX 5KYLA 1BKBA 5JJLA 4A3IH 1BQQT 1D8LA 3K5MA 1A0IA 1NTGA 4P75A 4YHHL 1QNUA 1E2WA 2OCEA 2O5IC 4A3BB 2CQAA 3OIQA 3A56A 1C9OA 3NSWA 2AQ3B 2EXZA 3T1YQ 3H3VI 4LAAA 3PUYA 5JPMC 5IP7H 4OIJA 3M9BA 5LMUQ 1I3QH 4DV0Q 4B3ML 2L12A 4X3KA 1C4QA 1EFWA 5C44G 1E3PA 1TVXA 5E3FA 1W2BA 1I6VC 1J6QA 1DTJA 3OW7A 3RLOA 4A75A 2QDBA 4RWSC 1JR0D 5G3LF 1Z7TA 3CHBD 2HT1A 5D3IB 2ALYB 1CM9A 3HKZB 5EKIA 2GN5A 2R7ZB 5C3WA 1RF2D 4HEDA 1QUQB 1ET9A 1UE7A 1E1TA 5FJ8G 2IHFA 1WTRA 3V69A 1JE4A 1C8CA 4HIDA 4J15A 4JI1L 2D5DA 2NVYB 2VB3X 4DV3L 3T53B 4DK6C 3S15H 2MHVA 4QIWB 2JXMB 3SR1A 4A3DG 1G8ZD 1GHKA 1G2SA 1Q8KA 2AHOB 4XQJA 1VCIA 2IX1A 1MSHA 2I07B 2Z6KC 4ULLA 3H15A 4AQYQ 2AXYA 5JOBA 4DXFA 1WTXA 4P73A 1D6EC 4UAIA 4IALA 2I5MX 2NVQH 2B2TC 1QE6A 1VF7A 3I91A 3AFQA 4OWXB 3RMHA 5AJ3L 2WB1G 2B2UA 4X65L 1G291 1TS5A 5KIXA 5KYIA 1K1GA 3VDYA 3TS2A 2KOLA 4DK3C 5C3XA 5E1FA 1FL0A 3PO3G 1ZXTA 3J80E 2KCNA 2AWOA 1YHBA 1Y8OB 4IN3A 1JWMD 2F0KA 3B6YA 5J1ZA 3ICEA 4C1NI 4KKTA 2MJHA 1ENCA 3G4SA 1PHJA 2B63H 2PQUA 2WP8J 3J81j 1Y1WG 1KAWA 4RH6A 4YY3L 4BY7G 3F1ZA 3M4PA 5DLQE 1LLRD 1STHA 2FXQA 4L6TB 2HHHL 2GVBA 2Y0SB 2VW9A 2RVLA 4A3LG 1EIYB 1Q90A 1VQJA 2Q2UA 4R4CA 1IHZA 1F9QA 1XJVA 1PDQA 4A3GB 4KKUA 2Q8IB 3J7YW 4BY7H 3QOJA 4C3JG 2F0UA 2V1CC 2LXJA 4NKLA 5D3DA 4X65Q 1JMCA 4HJ5A 1LABA 4ILWA 2JA5B 4K0KQ 2WKCA 3S1MH 4LF5Q 3CC2A 2R7DA 1UAPA 3CCUA 4NBQA 4B8TA 4A3FG 1N33Q 4H13C 2JQOA 3P7JA 3WDNA 3HOWH 2E74C 1CI3M 3I73A 2PO4A 4G57A 3AU7A 4LF4L 1KABA 4G7HC 1MIUA 1IZ6A 4C3HG 3U58A 1W6JA 3G48A 3J80i 1D5XC 2MP1A 2FMCA 1KLUD 4GOPC 1HNXL 5M3FG 1K8GA 1ENFA 2UUAQ 1WCMH 5IYDG 3F2CA 1YIJA 2E8GA 4CKBA 4BY1G 1ML0D 1GUWA 5KEEA 4ME5A 3DWPA 3HKZG 3K81C 3AEVB 4EQPA 2BOSA 1EY0A 2F0EA 2PPBC 1X3EA 3ERQA 2L1BA 1RHPA 1OXVA 2BH8A 2I5LX 4DR2Q 1JOKA 4Y52H 4IPCA 4GZYC 1PTOF 4K8IA 5LMNQ 1X56A 3NBHA 3RZOH 1KDAA 2UU9L 4XT1B 1ZEQX 1AN8A 2R6GA 2PQEA 3A55A 3FKIH 2ENBA 3RZDB 1TWHH 3V2TA 2BCOA 1Z6HA 1X3PA 4DR5L 1Z9FA 2KUMA 2NTTA 1WD0A 4WJWA 1HZ9A 1A2UA 3HOZB 4O1NA 3NENA 3IL8A 1KD1C 2PY9A 1N8RC 1VQFA 4XIGS 3QOLA 4DK1A 3KBXA 2F0QA 2ES2A 2ZTCA 2ZXRA 4LFCL 1PYWD 3HOZH 2MJ8A 1PRTF 3D6WA 3C46A 1D2BA 2VY3A 3SK6A 3RZDH 1B9NA 4AH6A 5IYBG 4P2CB 5IYCH 2QEXA 2B2TA 1R9TH 3Q8DA 3KJPA 5C0XG 1SNPA 1UUPA 4U68A 2XTIA 1YNJD 4A3CH 1IBMQ 4HJ7A 1STGA 1J9OA 3MWYW 4RGMA 4DAMA 4EX5A 1EY8A 1ZZJA 3KF6B 1E2ZA 1VQDA 4HN7A 4RCOA 2CTMA 1P16A 4QQBX 5JEAH 1Y1VG 4LFBL 1WI5A 3S14B 1VMCA 2X69A 1A6XA 3LWEA 4LMQD 1HTLD 3MTSA 4PZ7A 4IUQA 4HCSA 1Q7YC 1X9NA 4X6AH 5HY6A 4C3IH 5KNCA 3ND8A 1YNXA 3H3VC 4JBMA 3FEWX 1F2MA 1EY4A 1FR3A 4F88A 3EN2A 3HOXB 1HNXQ 5C44B 3D31A 1H9JA 1PH7A 3P75A 2JA8H 3I8ZA 2VXWA 2Z0SA 1IBKQ 3J80c 1VQPA 1EY6A 1EEFD 1H9KA 2CW0D 1UE5A 4NW2A 4Y7NB 2E76C 4LUVA 4X66L 5C3EH 1IKMA 4YHHQ 1PTOB 3U4ZA 2BE5D 1EZ8A 3PMFA 1J5EQ 2RCNA 5FKAC 3NBHB 1KQSA 1BCPB 2WIIB 2O2LD 2TMPA 4YWKA 3VR3A 1NR4A 2Y0SG 4OX9L 2Q8RE 4PG3A 4EQNA 4DR6L 1J4WA 2JYOA 2ASBA 1D1KA 4WORA 4L8JA 1PH8A 5CMDA 4RFBA 2G9HD 3CU7A 1PH3A 4IPDA 2RBMA 3HOXH 2B8GA 1L0YB 3J80L 5CV7A 2CTJA 1IYUA 3FDTA 4GOPA 2O5JC 1STYA 1T9HA 5DM73 3J7AV 5EKKA 4C3IB 3HKZE 4LF4Q 1N32Q 3IRBA 3FMCA 4WANA 4DV6Q 3M4YA 5C4XH 3BYYB 4JI8L 4B3TL 1YZ6A 3X3NA 4ALPA 2F0DA 4LW1A 1Y1WH 1SNQA 2WB1B 4JI4Q 3SDZA 3NEMA 1V43A 4OGQC 3VR6A 3ND9A 1ENAA 3A5UA 1M1KC 2NVQB 2D2CC 4C3HB 2BH2A 1L1OC 5I9PA 4X3UA 1YJ9A 1VQOA 1PTOD 2OTLA 3R93A 2K5NA 5EGTA 3GV6A 4QY7A 4X64Q 1PH6A 1LV9A 4RHSA 1DM0B 4QL5A 3S15B 4H7BA 5H1SE 1CZWA 2K32A 2N88A 3TBIB 4IO9A 2AQ2B 1RTNA 4UP7A 3S17B 3FVQA 1EUJA 2LXKA 3MFGA 1O7LA 4RAUC 4IURA 4R4QA 3MXUA 3MXPA 1FJGQ 2A1AA 3RLNA 3GTMB 4JI0L 1N36L 4ZKCB 1JJGA 3CD6A 2XRSD 3A54A 3K6OA 4CKEA 1FJGL 3KF8B 1DXMA 1PFNA 1STBA 1EYAA 4IUUA 3SK4A 2Y0SE 3Q6SA 3K59A 4DNIA 4DV4L 1PMRA 3RZOB 5NUCA 1I3QB 2PCFB 2Z4IA 3PCOB 4LF8L 5LL6X 2BL5A 1CKNB 4FYDA 2C5CA 3K7UC 4A3MG 4DAYA 4JYAQ 1PZKD 2R93G 2RHSB 1B4OA 2OQ0A 2UUCL 3OYYA 1PTOC 4LF9L 4AYBB 1B53A 5IGFA 3PO3H 1C0AA 1G6PA 1VDZA 4DGZA 4WJ4A 2ICIA 4NXNQ 2RDHA 4QF4A 4L63B 4XDXA 2E2JH 1E1OA 2CTFA 3T16A 3KBGA 3T1HQ 2LFNA 4ZUJA 1LTLA 5ELOA 4ZKBB 3E5SA 4A76A 1KDBA 4KJOA 3CPFA 4YY3Q 3SE0A 4GKJL 2EY2A 3DWQA 3LWUA 2L5TA 1GD7A 5C5MA 2K50A 1QWYA 2F4VQ 1FNUA 2OEOA 4YCVA 3T13A 1GUOA 1F2ZA 5ISRA 3GTMH 4RCNA 1RD9D 4PMBA 2UXBL 2KECA 1EYGA 1LUZA 3J81i 4E6IA 3KF8A 3C1EA 4IPGA 1I94Q 4OXPA 4JVHA 2DNCA 1Q82C 1MJCA 5K36H 3TP6A 4LFAQ 4I7ZC 1S5BD 4K5XA 4A3GH 2E2DC 4GNXB 3NQIA 4GN5A 4RG1A 4OO1I 4X3SA 1MBYA 2ZT9C 1IBML 5IGCA 4IUNA 1SAPA 3NTKA 5T1GA 1RDPD 1J5KA 3GTQH 3ITPA 4R8NA 1QG7A 3A74A 2DUDA 2Z8LA 2YQRA 1SEBD 1K8AC 4NXMQ 1CZGA 3OTOQ 1EY7A 1K0RA 2K5HA 3TP5A 2GVAA 4Q5VA 4KLKA 4AIMA 1SROA 2FHTA 3Q24A 2CTLA 2MPMA 4LFCQ 5C4XB 3PV0A 4XQNA 5I2XA 4CJ1B 3RLFA 5CV9A 3EFXD 4UY8C 1GKHA 1HZAA 4QMGA 4FF4A 4GS3A 2IJ0A 1HRJA 3GTOB 1RIPA 2M00A 2WAQG 1LTTD 3A8KE 1LT6D 2KEDA 3GTQB 1XMOQ 4P74A 4KY6A 5J39A 2A74C 2K5DA 1NR2A 2VB2X 1KRTA 1EC6A 1TY0A 2PQAB 3DUZA 4QB4A 4POGA 4PQXA 1EQTA 1LT5D 2KENA 2PI2E 3M4OH 3NXWA 2F0NA 2QKIC 1E24A 4RHRA 1XXGA 2KVMA 2JA8B 5IYBH 4JI0Q 1O80A 4HIOA 4HIMA 2PZUA 4JI3Q 2E75C 2Q8TA 2J0TD 4B3TQ 5C0XH 2E3UA 1EIHA 1VQ4A 1YNND 2BA0A 2SNMA 3VYUA 2N3SA 4R8IA 3I2ZA 4DKAC 3CP0A 2UXCQ 3N6RA 2Q2TA 1SN8A 3NBIA 1PFSA 4DXGA 5K5PA 2F0VA 3NP8A 1SE4A 3CQZH 3S1NH 3X3MA 2B39A 3C1FA 1F9PA 4YIJA 2UUBQ 4TQUS 2SNSA 2N78A 2JA6B 2SDFA 1MI2A 3IKJA 3WOEA 2IHEA 3KYHC 4DNTB 1WTOA 1S5ED 1ZKOA 4R9WA 1GVPA 2IW3A 2R92G 3NTHA 3S1QB 5JEAG 2IY5B 3A8JE 2BDNA 1WVLA 2AUJD 4FXGC 1E7ZA 2VQEQ 3AQQA 1CKMA 5CR3A 2HH3A 4A4IA 4QJFA 2CQOA 4IUPA 2R92B 2EQSA 1DONA 3JAMi 3VKEA 5E4XA 3S16B 4IJHA 1NJIC 4LWCA 3TP7A 1JORA 3CMAA 2YV5A 3I4MH 1AFPA 3IFTA 5M5YB 1DZ1A 3A7LA 4WFN3 4BBRH 1NY4A 1YBYA 3Q23A 1G6ZA 3NE5B 4PNYA 1JE5A 4KHPQ 5M3MB 5FJ8H 3NWTA 4QGUA 4OIKA 4IQZA 1WTQA 4RGNA 1EIGA 3I4NH 1STAA 4KMUC 4AQYL 5EPLA 3WOFA 2JVZA 1DOLA 3I7FA 4YCWA 1Y8NB 4X66Q 1K83H 1FD7D 4V0BA 4A3DB 3HOXG 2E2HB 3C2PA 3PUWA 4A3KH 1VQ8A 2X6LA 2K04A 1UEBA 1EZ6A 3GTPH 3R8BA 3M7GA 3CCRA 5FO8B 3GD7A 5JJKA 1N9WA 4DV5L 5IGEA 1L2FA 5BN4A 4CJ2C 1A2TA 3M4QA 1H9RA 3IAYA 3CCEA 4DV5Q 1HTPA 1Q12A 1F77A 2IPKD 2K5QA 3I4LA 4JI5L 4K0KL 2F4VL 2K28A 4K6DA 2L15A 1J8IA 1JB7A 2E2HH 1JICA 3CAMA 1TT2A 4GLAC 2ZJPA 3FP9A 3DWAA 4ID6A 3M85A 1NMFA 3GO5A 4JOIC 4GNXC 2KA7A 2PZTA 3BZDB 1TU2B 3URYA 4DR7L 5I2YA 5BR8Q 1B9MA 1XPOA 1B8AA 2KEEA 3HRZC 4A3EG 2UUCQ 5J22A 4DR7Q 3R2IA 1KNAA 4MIUA 4UPAA 1FNWA 5M5YH 1WFQA 1ESFA 2OQKA 1DT4A 3S2HH 1YNJC 1D7QA 1PTOH 3H0GG 1UEAB 2OXPA 1B1ZA 2MNAA 4Y7NH 1I5FA 2MO0A 3HP3A 2ZTEA 2VUMB 4BA2I 4HJ9A 4F87A 3PUXA 4ODGA 1BF4A 3PF5A 1PRTC 3PIPA 4KD4A 2KHIA 4BBSB 4DA2A 3TP8A 1TY2A 4L5TA 4GKJQ 3CCJA 2F4IA 3DEPA 3H0GH 2EYOA 1WVNA 4POFA 2OTJA 4QMFB 1LTRD 5C3EG 2MQHA 1PRTB 3PIO3 1QVFA 1SNCA 1T5EA 1XTCD 4B3MQ 1LTGD 4CBVA 4HJ8A 4DR5Q 1BXTA 1U0LA 2WV6D 3I70A 1GJXA 4FDBA 4TRDA 3QG1A 4DV2L 4BS9A 2Z6KA 3EIVA 1BCPC 3PIOA 2ANNA 5CYUA 4IOCA 1FGUA 4JV5Q 4CKCA 5A35A 4HJAA 3IFDA 5CV6A 2JJQA 3HOVG 1L0XB 1HXYD 4OWWB 2CW0C 2B2UC 1I50B 1SYEA 2HH2A 1E22A 1S3OA 1OTCA 3D8GA 3SHLA 2F0LA 3TSSA 2NUCA 1RKNA 4DR1Q 3KLSX 5FO7B 1EY9A 2ZTDA 1ILQA 3MAQA 4OL7A 1SFOB 3JAME 3O13A 2YTYA 2CTEA 1LTBD 3S2DH 3U4VA 4N9PA 4BBSH 1OXXK 3OTOL 3HOVH 2KQ3A 4LUOA 2EJMA 3M4OB 5EQ0A 2NZOA 1RTOA 3ULPA 2JP1A 3EA6A 3M7NA 1A3VA 1TS3A 4L5RC 3UDFA 3GTLB 3RN2A 5C5LA 4KHZA 2CWPA 3S2HB 1IW7D 1XYIA 2TSSA 1CA5A 2Z1CA 3PUZA 1PFBA 1DYQA 4KHPL 3SGIA 5FLXL 2JA7G 1ONLA 3J81c 3FKIB 4DV1L 1Y8PB 1RCVD 5BN3A 3UDIA 4YWLA 2AQ1B 2K5WA 2NVXB 5HURA 4FF3A 4TKOB 1JWSD 1B2TA 1TWGH 1SMYC 1LTSD 2HIXA 4WRDA 3ULJA 1GO3E 2HIVA 2UUAL 1YJNA 2CPQA 3CCVA 2K14A 4C3JH 5J3BA 3J7ZC 1CK1A 3K0XA 1N32L 4EQOA 3HG9A 5M3MG 4A3BG 2PI2A 2A5HA 1HNZL 1V9PA 3UDGA 4JI5Q 2XGTA 2E2IB 1LACA 1SNDA 1VIHA 3OWEB 2PZWA 3CCSA 3ONAB 4KN7C 1I4PA 1QVGA 5M5XB 3GTJB 3MFYA 2DGYA 4LF6Q 2BDOA 4A3JB 4RKLA 5AJ3Q 2B63G 3MA2B 4JI2Q 1K3RA 3ZYYX 3KLSA 2B2VC 3MVVA 4X64L 1SMYD 2F0FA 1VQLA 1HNWL 2EYLA 2QEJC 2Z4HA 1ZTGA 1SBBB 4ZYSA 2NWGA 1SLJA 1Y69U 2I46A 3MEFA 1QCBD 4JK1C 3KDFB 3QIAA 3QO2A 2AMCB 2R92H 4FF2A 3A0JA 4R4TA 5M5XH 3GTJH 1SR3A 1WOCA 1FVIA 1PFMA 3QB3A 2JEAI 2XIWA 2OT2A 2VQFL 1GUTA 1ASYA 4H44C 3OPOA 4LF5L 4TSSA 4LF7Q 4PZ8A 2LY7A 5CGKA 2K5VA 2D0OA 3TEHB 1HA6A 4NXML 4ZQ3A 1EU4A 1ZYRC 3GV3A 1T5XD 1XPRA 3I4NG 4K6LA 3NQTA 4FVMA 3SK5A 2OPUA 1AZQA 4C56C 2K03A 3MHBA 1SNMA 5CV4A 1BNZA 2UXDL 2L11A 3CMEA 1X32A 3CQZB 3STBD 1QUQA 1VQEA 1NUCA 1SJED 2JZXA 1Q46A 2HHHQ 2EYMA 4PMCA 1EWIA 1PYBA 1I94L 3PO2G 2RHQB 4KY7A 2RQXA 1F2YA 3BJUA 3VR4A 5EAYA 2EYFA 1W6KA 1IBLL 1BBUA 1IBKL 3K7AH 3HOYH 4GN3B 2QCPX 5COYA 2ZM6L 1Q3LA 1X3GA 4R4IA 1QZHA 1SJHD 1Q1EA 4XTCS 2JA7H 1SDFA 4DR1L 5JAVA 2WACA 5CORA 4WJ3M 3EQLC 4NB3A 5HGQA 2M9VA 3KDFA 2WB1E 3NELA 3RN5A 2QNDA 3JAMc 2AWNA 2ANRA 3T4AC 1YI2A 3ERSX 5IWAL 3BS1A 2CWAA 4DUZQ 5JJIA 2QA4A 4MNOA 1HHVA 1JJCB 4MN3A 1KL9A 1I4QA 1I50H 1JOQA 4HAEA 2CVRA 3G71A 1JB3A 4JYAL 1UWVA 2HDLA 3BZCA 5M5WH 3K0YA 2F0PA 1STEA 1EYDA 3L2PA 4UP9A 1ESRA 1JT8A 1ICWA 1QILA 5I9OA 4I65A 3HOUG 4UP8A 4IZ8A 3J7AF 3KFUA 2EYHA 3SEBA 1KRSA 1N34L 1YVCA 3OIPA 3MXNA 4JBWA 3I90A 1BVSA 4JI6L 5K36G 2A6ED 2KCCA 2B2VA 3FPPA 2ZJRA 2F0IA 2XNAC 4PMWA 4RGOS 3DLLA 2EOTA 2A8VA 3CCMA 2KJXA 5EPKA 4ZLTF 2K52A 4K5WA 1EOTA 5DNFA 3FHWA 1EFID 1STNA 5IT9c 3CCQA 1BR9A 4NPSA 5IP9H 2F0GA 2MUYA 1VIGA 4KN4C 3E9HA 4AYBE 1M90C 2K7VA 4P71A 4BBSG 1XTDA 1SNOA 2MGSA 4HCEA 3DXJC 3HFZB 2EXDA 3D0FA 1S5FD 5CV8A 5IIFA 1S5DD 5HGTA 3F2UA 2DN8A 1HPCA 1EOVA 5IP9G 1X3FA 2SOBA 1H9MA 4K5VA 5CV5A 3G6EA 1V1PA 1KHIA 4WALA 2N55A 5IYCG 2F0WA 1WJJA 4DAVA 2DY8A 3RNUA 3G7LA 3S14H 1W3SA 4GN4B 1SYGA 1O7YA 2G9DA 2BA1A 2D62A 5GADC 4LJZC 1G51A 1VQ6A 1EYCA 2YU9H 4OWTB 4O42A 3DHQA 3BVGA 1O7ZA 1X4NA 3NUCA 1TWGB 4G4KA 2EJGC 2XSCA 3EVQA 3BYTB 4LFAL 2RF4A 2RKSA 3CRLC 1SE3A 2B29A 3W3AA 3L7ZC 3GTGH 2VZAA 4DFAA 1MKHA 5E4WC 1G2TA 1C7YA 4IJLA 5GQOA 4JI1Q 1XNRQ 1V1QA 4XT3B 3S16H 3MXNB 1Q86C 4A93H 4A3EB 3I3CA 2A6HC 3JC66 1X3QA 4DF7A 4BBRG 1D1IA 2B2YC 1PH2A 1TQOA 3D6CA 3HOVB 1IBLQ 4Q0FA 1XPUA 2IX0A 4AYBG 3PF4A 5KNBA 5M3FH