2NN6G

Structure of the human rna exosome composed of rrp41, rrp45, rrp46, rrp43, mtr3, rrp42, csl4, rrp4, and rrp40
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
259
structure length
236
Chain Sequence
b'ARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymyositis/scleroderma autoantigen 1
publication title Reconstitution, activities, and structure of the eukaryotic RNA exosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/transferase
total genus 33
structure length 236
sequence length 259
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nn6G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nn6G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2nn6G03
3DXJC 4DV7Q 1N36Q 5LMUQ 4DR4Q 3S2HH 3M4PA 1DTJA 1Q1EA 4JI2Q 5GROA 2ZJQA 2D0OA 2HIVA 2UUAQ 3KF6B 2Q2IA 4H44C 5C0XI 1HQMC 3S15H 1IW7C 3TS2A 3MEFA 3VR6A 3RR5A 2YV5A 2PY9A 3EN2A 1KXLA 1VQ7A 4K0KL 1XMQQ 4DUYQ 3EIVA 1SE8A 5DLQE 4QMFB 1JJCB 1NBWA 1U5KA 3S16H 4IJHA 1C9OA 4UP9A 1G6PA 4UY8C 4X64Q 3STBC 4I7ZC 2AUJD 2PCFB 1VQCA 1J5EL 4UP7A 1VQDA 1N32Q 4HJAA 3PIOA 4L5TA 3CAMA 3E0EA 1XJVA 3WWVA 2UUBQ 3LWUA 2NZHA 1GUOA 2UUCL 5H1SE 2KENA 4X65L 1VCIA 4BXXH 4KLKA 1Q86C 2AWOA 2BDOA 2JA6G 1WYDA 2N3SA 2OTJA 3K80C 2CTLA 3AFPA 1IBLL 1J5KA 1SR3A 1YVCA 3N6RA 1Y8PB 3RNUA 5IP7H 3I72A 4A3FG 1ASZA 1B9NA 4C3HH 4QQBX 4AQYQ 3RZOH 3SDZA 2UXDQ 1I5FA 1VQEA 1PMRA 4DNIA 3L7ZC 3H15A 4JCVE 2WP8J 1KIXA 3TREA 4O0AA 2JXMB 1K8AC 3I4NH 4DK0A 1FGUA 2A68D 1OXSC 4A3KG 2AXYA 3W3AA 2WB1E 4OO1I 2JA7H 4LF9Q 3F1ZA 3M4YA 4JK1C 2ZJRA 1YEZA 4P72A 4GN3B 1E2WA 1K8OA 3CQZH 3GDEA 2JEBI 4B3RL 3S17H 3JAMc 2CTEA 1GM5A 1YJ9A 2HHHQ 3A74A 1MIUA 1Y8OB 2VUMG 2KCCA 3ICEA 1HR0Q 4C3IH 2BH8A 4YWLA 5IWAL 4R1JA 3RLOA 3ULJA 2VQEQ 4J15A 4JVYA 3J7ZC 4GLAC 1X54A 4NXML 1V9PA 4HR7B 1IZ6A 1EFWA 3CPWA 3AYHB 1E1OA 1K9MC 4LNQA 4KN4C 2FMRA 2HIXA 1FL0A 3B6YA 2R7ZG 3S24A 5LMNW 1X3FA 4JOIC 3Q8DA 2V1CC 4OWWB 2PMZE 2A8VA 1VQFA 1AE2A 1CKNA 2BA1A 1XNRL 2NVYH 4B3RQ 2EQSA 4B3ML 1V43A 4A3MH 3RLNA 2E5LQ 4WJ4A 4LF5L 3RZDH 2CWPA 3NENA 1VDZA 1HJPA 2JA8G 1JT8A 4G7OC 2Q8IB 1NE3A 2VL6A 3U4VA 1I94Q 1HTPA 4L5SA 3HOUG 2F4VQ 4R4OA 1IYVA 1VF7A 5JEAH 5FJ8H 1CUKA 2B3GA 1YHAA 1RIPA 2MFIA 1YJNA 2JK8A 1Y1VG 3GO5A 2CPQA 4PZ7A 2YQRA 4A3DG 1N9WA 1VQ9A 3A8JE 2ASBA 4JYAQ 4JI6L 1UE5A 2HH3A 3CCUA 1E2ZA 4JI8L 2JE6I 4IPDA 4KKUA 4A4IA 2K14A 3CCJA 2K33A 4BA2I 2JVZA 1XNRQ 4JI3Q 3F2BA 2UU9Q 2NN6I 1N8RC 5IP9G 1DT4A 2L5TA 4IOCA 4LF5Q 2P2RA 5C3EH 3VR3A 4GS3A 2PNRC 4DV3L 3U4ZA 4IJLA 4OO1H 1C7YA 2Y0SG 3CP0A 2IX1A 4JI5Q 3GD7A 2QNDA 4HIDA 3K7UC 4P75A 3L2PA 2YU9H 1XPOA 2CFMA 2C35B 1OXTA 3TZUA 4LF7Q 4KHPL 5BR8Q 1CKNB 4PMWA 5KNCA 1IBKQ 1PFSA 2ZTEA 1JE5A 5IYBG 3GTLH 4DV1Q 4JI8Q 1AH9A 1VQLA 4DV2L 2JZXA 3HKZG 4TVAB 1KQSA 3H94A 1QVFA 3OTOQ 1HH2P 1V1QA 4LFBL 1I6HH 3TEHB 4A3LG 1M90C 4AYBG 3E9IA 4LFAQ 3KDFA 4LW1A 2O5IC 5HGQA 4JG2A 4DR2L 1YZ6A 3ERSX 3I4MG 2R93H 1HNWQ 4QL5A 2CKZB 2E3UA 2IT1A 3UDIA 1GKHA 3S14H 3ND8A 3J80c 3RN2A 1ZZJA 4JI4Q 3HOYG 4NXNQ 1EC6A 1VQHA 3I56A 4JC0A 1TWHH 4DV5L 2ZM6L 2UXCL 3J81i 4H13C 2E2IH 4JOIA 3JC66 4O2DA 5C4XG 1A63A 5LMNL 4IFDJ 1VQ4A 4A3BG 4OX9L 3S1MH 1O7IA 3KF6A 1IBMQ 2V4DA 1VQIA 3L0OA 4A3IG 2A68C 4DR7L 1T9HA 4JI0Q 1YI2A 4B3TL 1PH3A 1PYBA 5ELOA 3CCEA 1H9JA 3S1QH 2B63G 2D0PA 4C3JH 5JJIA 4GKJL 4BBRH 3KJPA 3K8AA 4PV1C 4DPGA 2ALYB 3K7AH 4G7HC 3KLWA 5BN3A 3U50C 3IFTA 4H02A 4R4TA 1B70B 1ZYRC 1PA6A 1I50H 4YHHQ 1H9MA 3LGJA 4L5QA 2NN6H 2GN5A 3KDFB 4YCUA 1N34L 4DR6L 2ANNA 3JAMi 3KFUA 2AWNA 1DD2A 3HOWH 4GNXC 2R92G 4YY3L 1PH2A 3TQYA 4YWMA 1K73C 3GQBA 1Y14B 3CCMA 4HIOA 4B3TQ 1Q1BA 2VS1A 4DK1A 1TWFH 1IL2A 3NEMA 1FJGL 3HOZH 1GUTA 1VQ6A 1EOVA 1EIFA 1SMYC 1RL2A 4BXXG 2VZAA 1CSQA 4Y52H 2PQUA 2A6HD 4GLVB 3NE5B 4PZ8A 4MTNA 3ZJYC 3G6EA 4B3SQ 2MQHA 5M3MH 4HIMA 2I5HA 2BH2A 2DUDA 3BZCA 4A93H 4DR6Q 4A3GH 1PH4A 4DAMA 2YTXA 4BY1H 1LYLA 5C44H 3KF8B 2YTYA 2N78A 2KA7A 3PO3G 3A8KE 3VDYA 1Q8KA 4GKKL 1GUSA 4YY3Q 1HNXL 3F2CA 4DK6C 3BJUA 1PH5A 1KC8C 2IHEA 2CCZA 3W5OA 4X66Q 1JJGA 3H0GG 1T5EA 1FYCA 1KHMA 2NZOA 1PHJA 1MJEA 3I4NG 1BBWA 1MJCA 2UXBL 2JA7G 3H3VH 3KYHC 3HOXH 1CSPA 3FMCA 1H95A 5IYCG 1GUGA 1I3QH 1LUZA 3ULLA 2E8GA 4JBJA 4K0KQ 3GTGH 1A0IA 4QGUA 4BY7H 1ONLA 1V8QA 1Y1WG 4PG3A 3HFZB 2JEAI 2F52A 4X62L 1SRUA 2K52A 4FDBA 1G291 1NMFA 4L5RC 2B8GA 1K3RA 2VQFL 4DV0L 1J5EQ 4DK3C 1WI5A 4G7ZC 4LWCA 1GHKA 4L8JA 4HIKA 2XGTA 1HZAA 2AHOB 1O78A 2UUCQ 1VF5C 5M3FG 2F1MA 1ZTGA 4X65Q 1XTDA 1UEBA 3G48A 3I7FA 2A69D 2KCMA 3GTOH 4LFCL 4JI1L 2Y0SE 2EIFA 1IBLQ 4GNXA 3FP9A 1X9NA 4A3MG 1LABA 5C0XJ 3KLRA 5K36H 4RG1A 3PO2H 4LIJA 2JA6H 2ANRA 2IX0A 1L0WA 2R7FA 5C0XH 1K8GA 4A3EH 5FJ8G 2BE5D 3GTKH 3W1GA 1YNXA 2VQFQ 3J80i 1ZZKA 3BDOA 1GUNA 2KBNA 3U1KA 4DR1L 1SLJA 1GHJA 1IXRA 2KCTA 5M5XH 3I55A 3HGBA 1Q90A 4JBWA 1PH7A 1N33L 3AEVB 2I5LX 4LF8L 1PH1A 1PH6A 5M5WH 2K5HA 3QJYA 3PSIA 1HCZA 5BN4A 1VQ5A 2D5DA 4RMFA 3CCQA 5C3EG 5JEAJ 4OO1G 1W2BA 5IWAQ 1TKWB 3VR5A 1Q46A 3BU2A 3M7NA 1TXYA 2Q2HA 5AJ3L 3RLFA 4NXMQ 1J4WA 4Y7NH 1VQKA 1NMGA 1TUAA 4DR5L 1IYJB 2VUMH 1NTGA 4GNXB 4GOPC 2XTIA 1KL9A 1VQAA 1YBYA 3E9HA 1UE7A 4LF8Q 3T1YL 2A1AA 2BL5A 4XIGS 2R7ZH 1VIHA 3D4RA 1OXUA 1JB7A 5KNBA 4B3MQ 3PF4A 5FLMH 2PQAB 1G51A 1EYGA 1QZGA 3CRLC 3KJOA 3M4QA 2OWOA 2YTVA 1M1KC 3PCOB 4DAYB 2D2CC 1K8MA 3S1RH 4DR5Q 2WAQG 2NVQH 3HOUH 1HZ9A 4JI6Q 1CFMA 1PVOA 1JJ2A 3CMAA 1XMOL 3W1BA 4JBKA 1WVNA 1Z6HA 3CF5A 3HOVG 4IFDG 1DXMA 3T1HL 4KKSA 4BBRG 2EXDA 4DV6L 1D7QA 1E1TA 1UE6A 5IYDH 1U0LA 4DV3Q 2GVAA 2KHJA 1H9SA 2DGRA 5FLXc 4UP8A 3D31A 1P16A 3F8TA 3M9BA 3OOCA 2Q2TA 4A3CG 2WFWA 5M5YH 3UDXA 3A5UA 4KHPQ 2RF4A 1QUQA 1HNZL 5HY6A 3TS0A 1PH8A 4P73A 3VA7A 5EAYA 1Y69U 2CTKA 3K0XA 3ND9A 4NB3A 3FKIH 3MXNB 2Q2UA 4JVHA 3M85A 4IPGA 4DV2Q 2CTMA 3A7AB 2H5XA 4LFBQ 4JV5L 2EDGA 4OONA 4R4IA 4DR3L 1HR0W 4BBSH 2A69C 4EX5A 5IYBH 3HOZG 3CC4A 2D62A 1K83H 4DR2Q 4WANA 5JJKA 4X6AH 1VS0A 1A62A 1WCMH 1KRTA 4LUZA 1X4MA 2JA5H 3V69A 4YCVA 1H9RA 2QA4A 4DV4L 1TWCH 1X3EA 4GOPA 3I4MH 1NY4A 5M3MG 1N36L 4DR4L 1EQRA 4DV5Q 3VKEA 2ZM6Q 4A93G 4JI2L 2UXCQ 5GAEC 1OXXK 4BY1G 3FPPA 5BN5A 1I6VC 1GO3E 1X55A 5LMNQ 4DUZL 4OX9Q 1H9SB 1XNQL 1VQBA 2BA0A 2A19A 5JJLA 4DR7Q 1HZBA 4HJ9A 1XMQL 2I5MX 4DUYL 3EBEA 1QVCA 4DKAC 2RHSB 1VIGA 4GKJQ 1D8LA 2AMCB 1QUQB 1GD7A 1FR3A 1SROA 1VQOA 4BA1I 3PUXA 4X64L 1LACA 3IKJA 5IE8A 3PIPA 1L1OC 3FHWA 2R6GA 2OQKA 3HOXG 4NBQA 2ATWA 1N32L 3I2ZA 4MZ9A 4IO9A 1Q82C 4IQZA 2MJHA 1Q7YC 4DNTB 4A3JH 4LK1C 3CRKC 4BY7G 2A6ED 2O5JC 2ZTDA 1N34Q 5IP7G 1BDOA 2QF7A 1TWAH 4GN4B 1VQ8A 1DGSA 1TWGH 4DUZQ 4HJ5A 1XNQQ 1E22A 2PPBC 4HJ7A 3CPFA 2LMCB 5C4JH 4WALA 1QVGA 4P71A 3A7LA 1X65A 4GOPB 5E7NA 2GVBA 3J7A5 3TRZA 4AM3A 4AQYL 2R92H 1FJGQ 5GQOA 2UXDL 2DGYA 3PGZA 3KOJA 3OW7A 2OCEA 3VR4A 4LF6L 2VNUD 2VW9A 2E76C 4LF4L 1PYSB 2L15A 1WOCA 1WFQA 4YCWA 3EQLC 2K5NA 3MFYA 3CCVA 1EWIA 1WJJA 4TQUS 2FXQA 4LUOA 5K36G 4LF9L 1VQNA 3ER0A 1Z9FA 3PO2G 1E2VA 1XPRA 1BBUA 4GKKQ 3AEVA 5C0XG 3J81c 3QG1A 4A3EG 1HNXQ 3CC7A 1L2FA 2HHHL 3AB9A 3OPOA 4KMUC 3A5ZB 2VY3A 1HR0L 1XPUA 3S1NH 3PO3H 2VQEL 1YJWA 1UWVA 4IPCA 2ZT9C 4C2MH 4WJ3M 1O7LA 4OGQC 2UXBQ 4LF6Q 3H0GH 2CTJA 2ES2A 1EQQA 5IY0A 3M4OH 4LF4Q 1E3PA 1YNNC 3S2DH 3D0FA 4YWKA 1BKBA 4A76A 2JJQA 4OWXB 2N49A 1X56A 2LXKA 5GAGC 1CI3M 4TKOB 1A6XA 3U58A 3F2DA 1B8AA 4UPAA 3T51B 1KAWA 1GVPA 1YHQA 1UE1A 1R9TH 1YNJC 5IYCH 4X62Q 3CCSA 2IHFA 2WAQE 5JEAG 3SE0A 3A8IE 2RHQB 2E5LL 2K4KA 4HJ8A 2PNHA 4DV0Q 4KKTA 1BVSA 4A3FH 3LNNA 1Y1WH 2CQOA 3HKZE 1K0RA 3A0JA 1I94L 2ID0A 1L1OA 2MNAA 2F4VL 2PQAA 2DNCA 3T53B 2OTLA 4QIWE 3AQQA 1X3GA 1SMXA 4AYBE 1VQPA 4EQ5A 1LM0A 2HH2A 4H0LC 4QJFA 1IYUA 1KRSA 4POFA 4OXPA 4AH6A 4LFCQ 3J81j 4JYAL 4JI1Q 4JBMA 4APVA 3CXCA 2OPUA 4A3KH 1B9MA 2K5VA 3DM3A 4B8TA 3U9SA 5FLMG 5M3FH 3GTQH 5ELNA 2B29A 3MXUA 2NVXH 2MO1A 4GLXA 3I4OA 2MO0A 4JI3L 2K32A 2UU9L 1HZCA 2OPVA 2R7DA 2K75A 1EUJA 1VQMA 3QIAA 1SN8A 2LSSA 1FVIA 4XTCS 1E24A 1IW7D 4DR1Q 4JI5L 4IOAA 5GAHC 4POGA 1EWHA 2EVBA 1Z7TA 4IFDI 5IT9c 3UDGA 1N33Q 4LF7L 2EJMA 5BR8L 1OXVA 3PUYA 2Z0SA 1ZKOA 1IBKL 3WDNA 4A75A 1KHIA 4DV1L 2A6HC 3STBD 2Z6KC 2E75C 3SGIA 3HKSA 1C0AA 2IY5B 3PUVA 5IYDG 3ULPA 3VR2A 2R93G 1L1OB 3OTOL 1S3OA 4KI0A 1S40A 2CW0C 1A8VA 1VQJA 4NPSA 4MNOA 2A6EC 4R4CA 2KHIA 4LFAL 2WB1G 5AJ3Q 3G4SA 1LTLA 1HNWL 4RCNA 3P20A 2JA8H 1KD1C 1S72A 2AKWB 1HPCA 2YYZA 4R4QA 2AUKA 3PUZA 1ZZIA 3PUWA 3FKIG 1CKMA 4JI4L 4NXNL 1W3SA 1Y1VH 2NVTH 3DLLA 4KHZA 3I4LA 1DCZA 3T1YQ 4A3DH 1Q12A 2EJGC 4ME3A 4JI7L 4GZYC 2CWAA 2K7VA 3RN5A 1NJIC 4BBSG 4ALPA 1JMCA 2DN8A 1IBML 2E2JH 2DNEA 4JI0L 1WCMG 2JA5G 2E2HH 1GJXA 3UE1A 5IP9H 2E74C 4AIMA 2NN6G 3CD6A 4IPHA 1CKOA 1PH9A 3AFQA 5J3BA 3CW2C 1YITA 2HQLA 3HOWG 2LXJA 1XMOQ 3M3YH 1YIJA 3CMEA 4YHHL 1SFOH 4DNRB 3OYYA 2F3IA 2EJFC 1QJOA 1AE3A 1YHBA 3T56B 1EIYB 3T1HQ 1E7ZA 1B7YB 1Z47A 4JI7Q 1Y8NB 5A35A 3BG3A 4DV6Q 1ASYA 3H3VI 1OTCA 3CCLA 3GTJH 2RCNA 3HOVH 2CTFA 2HT1A 3IRBA 4IFDH 3NBHB 4OWTB 1CTMA 4QY7A 4A3LH 4LUVA 1Q81C 2PI2A 3UE0A 1PV4A 2PI2E 3NELA 1TU2B 4A3JG 2QGQA 2N8NA 4PZ6A 4DV7L 5LMUL 1HNZQ 2BE5C 4A3GG 2OQ0A 2ZJPA 2UUAL 5C44G 3I73A 5KNDA 2JQOA 3BZKA 3GTMH 2K50A 3GTPH 4A3CH 3HOYH 4GN5A 3CCRA 2QEXA 1WE8A 4B3SL 3UDFA 4P74A 1J6QA 2Z6KA 4JV5Q 3G71A 1K1GA 4DR3Q 2B8FA 2I0QA 1MKHA 5C4XH 2ZTCA 1X4NA 4A3BH 1X6OA 1QZHA 3PF5A 2JA9A 1VQGA 4A3IH 4KN7C 4LJZC 4X66L 3OW2A 3PV0A 3CC2A 2B63H 3K81C 4DV4Q 2UUBL 1H9KA 1P8LA 5GADC
chains in the Genus database with same CATH superfamily
4LF9H 3DXJC 1EIGA 4DV7Q 1N36Q 5LMUQ 4DR4Q 3S2HH 3M4PA 2A1SA 1DTJA 1DOLA 2RVLA 3GTOB 1Q1EA 4JI2Q 1BCPB 5GROA 5EKIA 3TP5A 2ZJQA 2D0OA 2HIVA 3KF6B 2UUAQ 2Q2IA 4H44C 5C0XI 2CWHA 1HQMC 5CBEE 1J9OA 3S15H 1IW7C 3TS2A 3MEFA 2HHHH 4V0BA 3VR6A 3RR5A 2YV5A 3EA6A 3MAQA 2PY9A 3EN2A 1KXLA 3OMCA 1VQ7A 4K0KL 1L0XB 1F0XA 1HR0H 2EYJA 1XMQQ 4RHSA 4DUYQ 3EIVA 4C3IB 3PO2B 1SE8A 5DLQE 2LY7A 2VQEH 4QMFB 4FF2A 1B4OA 1JJCB 4A3EB 1EIHA 1NBWA 1PLFA 1U5KA 3S16H 4IJHA 5J22A 1B53A 1X3QA 5ELFA 5J39A 2Y3MA 3GTKB 1C9OA 4UP9A 4KJOA 1G6PA 4UY8C 5CV4A 4X64Q 3STBC 4I7ZC 2AUJD 2PCFB 2XN9C 4RGNA 1SJED 1TQOA 1VQCA 1ICFB 1J5EL 5I4DA 4FYDA 2D9IA 1PRTF 1QWYA 5M5XB 4RHRA 4UP7A 1AN8A 1VQDA 3Q24A 1N32Q 4HJAA 3PIOA 3T16A 2B2WC 3CAMA 4L5TA 3E0EA 4XT3B 1PTOD 1XJVA 2IJ0A 3WWVA 2UUBQ 2CVRA 3LWUA 2NZHA 1GUOA 2UUCL 5C4ZA 2HQEA 2L55A 5H1SE 5M5WB 2C5CA 2KENA 2K05A 4K5XA 4C1NI 4ZUJA 4X65L 1VCIA 2TMPA 4BXXH 4S3SA 3D8GA 4KLKA 1V1OA 3BYYB 2NVYB 1Q86C 2AWOA 2BDOA 3I8ZA 2JA6G 1WYDA 2N3SA 1X32A 2E5LH 2OTJA 3K80C 2CTLA 3AFPA 5CV6A 4CDEC 1IBLL 1J5KA 4ABNA 1SR3A 1YVCA 4M1UB 3N6RA 4Q0FA 1NR4A 1Y8PB 3RNUA 3I70A 1I94H 5IP7H 3I72A 4A3FG 1ASZA 2F4VH 3OSSD 1PTOF 4JW0A 1B9NA 2EY5A 4C3HH 4QQBX 2XSCA 2NTSA 4DA2A 4AQYQ 1UAPA 3RZOH 3SDZA 4U673 2UXDQ 1I5FA 1VQEA 1PMRA 4ZLTF 1LT3D 4DNIA 5EGTA 1HA6A 4EQNA 1EOTA 3L7ZC 3R3OA 1KLGD 4JCVE 2WP8J 5C4HA 3H15A 4JYAH 2XWJB 3WOFA 2OF1A 4FF1A 5I6WA 3NPPA 5EKLA 1KIXA 4F88A 3TREA 2WKCA 2F4IA 4O0AA 2JXMB 1K8AC 3I4NH 1HTLD 1JORA 4DK0A 3KDGA 3NCVA 2B2VA 2KUMA 1FGUA 2A68D 4WFN3 1OXSC 4A3KG 4WRDA 3DWAA 2AXYA 3JAME 2RDHA 2EOTA 1GXDC 2WB1E 3W3AA 5A2QL 4OO1I 1QILA 2JP1A 3TMEA 2PYKA 2JA7H 1U4RA 1HUMA 4LF9Q 3F1ZA 3M4YA 4JK1C 4JI3H 2ZJRA 2UU9H 1YEZA 4P72A 4GN3B 2RA4A 1EY0A 1E2WA 3CQZH 1K8OA 3GDEA 4XDXA 2JEBI 5EPJA 1C4QA 3S17H 4B3RL 4RKLA 3JAMc 2F0UA 2CTEA 1SYCA 3VYUA 4DU9A 1GM5A 1AW7A 1YJ9A 2HHHQ 4JI5H 3A74A 1MIUA 1Y8OB 1V9NA 3Q22A 4BS9A 1SYEA 2VUMG 2KCCA 4H7BA 3ICEA 1HR0Q 3NHHA 4C3IH 2BH8A 4YWLA 5IWAL 4R1JA 1ZYRD 2QDLA 3RLOA 1TVXA 3BZDB 3ULJA 1MI2A 2VQEQ 2YU9B 2WIIB 4FF3A 3J80L 4J15A 3OHXC 4LF7H 4JVYA 1ENFA 3J7ZC 4GLAC 1X54A 4NXML 1V9PA 4HR7B 1IZ6A 5BR8H 1SNMA 1EFWA 3CPWA 3AYHB 1E1OA 5NUCA 1K9MC 4LNQA 4KN4C 1IBKH 2FMRA 4KHVA 1DOMA 3K5LA 4DAPA 2HIXA 1FL0A 4OIKA 4DV1H 3B6YA 2R7ZG 4FP5D 3S24A 1MHWC 1LTSD 3AMUA 1W6JA 5LMNW 3OTOH 5KGUA 5CBAE 3GP7A 1WTJA 1X3FA 2KQ3A 4G57A 4JOIC 1JWSD 4XYOA 3Q6SA 1I6HB 3Q8DA 2M6QA 2V1CC 4LFAH 4CDCC 1CA6A 2F0TA 4OWWB 1BCPC 1EYDA 1EEID 1S5CD 3E5SA 1TS2A 2F0HA 2PMZE 2K1HA 2A8VA 1VQFA 1AE2A 1CKNA 4L63B 2BA1A 5CGKA 1ML0D 2FJ2A 2NVYH 1XNRL 1HNWH 4B3RQ 2R93B 2EQSA 4ZKCB 4B3ML 1SYDA 1E0BA 1V43A 1F9SA 4A3MH 3RLNA 2E5LQ 4WJ4A 2CQAA 4LF5L 3RZDH 2CWPA 1TS3A 3NENA 3S14B 1UUPA 1HJPA 1VDZA 3NBIA 2JA8G 1JT8A 4G7OC 2KOLA 2X6GA 2Q8IB 1NE3A 4IUNA 2WB1B 1WTQA 4JI4H 2VL6A 3U4VA 1I94Q 1HTPA 4L5SA 4NXNH 3HOUG 2F4VQ 4R4OA 1IYVA 1VF7A 5FJ8H 5JPMC 1CUKA 5JEAH 2B3GA 1YHAA 3K58A 1RIPA 2FMCA 3FEWX 2B2WA 2MFIA 1YJNA 1HHVA 2JK8A 2SNSA 1Y1VG 5EBCA 3GO5A 3QB3A 2CPQA 4JI7H 1HUNA 4PZ7A 3Q0AA 2YQRA 4A3DG 3U9OA 4TSSA 1N9WA 2VB2X 1VQ9A 1DM0B 3A8JE 3TBIB 1ODHA 3FKIB 2ASBA 4JYAQ 1MSZA 2RKSA 1IBMH 2PW5A 4JI6L 1UE5A 3S1MB 2HH3A 4MIUA 1EY8A 1I4RA 1E2ZA 2EYOA 3CCUA 4JI0H 3KBXA 2F3WA 4JI8L 1K28A 4CKBA 3WOEA 1XXGA 3J7AK 1STHA 2JE6I 4IPDA 1QG7A 4IUPA 4KKUA 4A4IA 2K14A 2P5ZX 3CCJA 2K33A 1STAA 3NQTA 4BBSB 4BA2I 1KLUD 2WACA 1K83B 2JVZA 1XNRQ 1WTWA 4JI3Q 3F2BA 2LTLA 2UU9Q 2NN6I 2KEEA 5I2XA 1STGA 1ZEQX 3R2TA 1N8RC 1WCMB 5IP9G 1DT4A 2L5TA 2JA5B 4IOCA 4LF5Q 4ID6A 2P2RA 5C3EH 3VR3A 4GS3A 2PNRC 1IKMA 4E6IA 4DV3L 3U4ZA 4IJLA 3NK9A 4OO1H 1SDFA 2F03A 3NTKA 1C7YA 2Y0SG 4MTKA 1MD2D 1QNKA 3CP0A 1IL8A 4JI5Q 3GD7A 2IX1A 2NYZD 2QNDA 4YHHH 4HIDA 2LS01 5C3XA 1ILPA 1WD0A 5EBDA 3K7UC 4P75A 3HG9A 3L2PA 2Z6BA 1JOQA 2F0FA 2YU9H 2EY2A 1XPOA 2CFMA 2C35B 2HCCA 4DF7A 2PMZB 5A2QE 1OXTA 3TZUA 4LF7Q 4I7AA 4KHPL 5BR8Q 1CKNB 1SNCA 4PMWA 3QR8A 2QW7A 3HOWB 5KEEA 4K6LA 5KNCA 5HGTA 1IBKQ 4IURA 3MZ5A 1PFSA 1A15A 2M9VA 1EZ6A 2ZTEA 4KV6A 1JE5A 5IYBG 2SDFA 3GTLH 4DV1Q 4JI8Q 1AH9A 2F0OA 1UG8A 1BNZA 1LT5D 1VQLA 4DV2L 2JZXA 3HKZG 1BXTA 4TVAB 1KQSA 3H94A 4K8JA 1QVFA 3OTOQ 5CMDA 1HH2P 4FXDA 1V1QA 1AFPA 4LFBL 1I6HH 1V8CA 5FLXE 3TEHB 4A3LG 1M90C 4Z9CB 4AYBG 3E9IA 2ICEC 4LFAQ 1TY2A 3KDFA 4LW1A 5HGQA 2O5IC 4DV7H 4JG2A 2MJ8A 4DR2L 1YZ6A 2RDFA 4HMIA 3ERSX 4N8X1 3I4MG 2R93H 2Z1CA 3G6JB 1EY9A 1HNWQ 4DAVA 3NTHA 1YNND 4QL5A 4KY6A 2CKZB 2E3UA 2IT1A 3UDIA 1GKHA 3S14H 3ND8A 3C1EA 1VMPA 4DGZA 3VYTA 4B3SH 4KD3A 3J80c 3RN2A 1ZZJA 4A3JB 4JI4Q 3HOYG 3C2PA 2JYOA 2M00A 4NXNQ 4DR6H 1FD7D 2XVSA 4XXEA 1EC6A 1VQHA 3I56A 1TWAB 4A3GB 4B9WA 3H91A 4JC0A 1TWHH 4CKEA 4DV5L 4OIJA 5C44B 4UAIA 2ZM6L 2IX3A 2UXCL 1SE4A 3J81i 4H13C 2Z9HA 2E2IH 4YY3H 1TWGB 4JOIA 3JC66 2H4OA 4O2DA 5C4XG 4RKBA 1A63A 3R8BA 5LMNL 4IFDJ 1VQ4A 4A3BG 1KAAA 2F0VA 3MA2B 5C4JB 4OX9L 4X66H 3S1MH 1O7IA 3KF6A 5DM63 1IBMQ 2V4DA 1VQIA 3L0OA 1JQYD 4FNFA 4A3IG 2A68C 1RODA 1ICWA 4DR7L 1T9HA 4K2KA 1YI2A 4JI0Q 4B3TL 2G9DA 1PH3A 1PYBA 5ELOA 3CCEA 3OWFA 1H9JA 3S1QH 2OXPA 2D0PA 2MPMA 4C3JH 2B63G 5JJIA 2RSOA 2UUBH 4GKJL 4BBRH 3KJPA 1SYGA 4IUUA 1S5ED 1J8IA 1M4VA 3K8AA 2K1BA 4X3UA 3SB1A 4RH6A 3KF8A 4PV1C 1KABA 4HN7A 1S4ZA 4DPGA 2ALYB 4E9JA 3K7AH 1SEIA 2QILA 2QDBA 4G7HC 2EZVA 3KLWA 1CQVA 4X3TA 2MHVA 5BN3A 4IN3A 3IFTA 3U50C 2JSOA 4K14A 4K0KH 3S9WA 4H02A 4R4TA 1WTPA 1B70B 4OEMB 1ENCA 1ZYRC 1PA6A 1I50H 3G7LA 4YHHQ 1H9MA 5J1ZA 1NAPA 3LGJA 4MN3A 4L5QA 1DZ1A 1A2TA 3GV6A 2NN6H 2GN5A 3A54A 3KDFB 5CV5A 4YCUA 1N34L 4DR6L 4N9PA 2FINB 2ANNA 3JAMi 2WV6D 1CK1A 2AWNA 3KFUA 1DD2A 3HOWH 4GNXC 4CGYB 5FLXW 3K0YA 5EPLA 3R93A 2ZQEA 2R92G 4YY3L 3GV3A 1PH2A 3SK8A 3TQYA 4YWMA 1J5EH 1K73C 3GQBA 1Y14B 4IALA 1S5FD 2IWHA 1I4XA 3CCMA 4HIOA 3HS0C 4B3TQ 1Q1BA 1SNPA 1STYA 1CHQD 2VS1A 4DK1A 1TWFH 2A5HA 1IL2A 2UUCH 4QB4A 3NEMA 5ISRA 1FJGL 3HOZH 1GUTA 1VQ6A 1EOVA 4X65H 3K6OA 1SNDA 1EIFA 5FO7B 1FGBD 1SMYC 3S2DB 2PQEA 1RL2A 2J7ZA 3A56A 3OIQA 4BXXG 5TSSA 2VZAA 1CSQA 3DWPA 4HCEA 4RGTA 1JICA 4Y52H 2A6HD 1IBLH 2PQUA 1S5BD 4GLVB 1PRTD 3NE5B 4PZ8A 5KYIA 5LL6S 4MTNA 3ZJYC 3G6EA 3N52A 4B3SQ 2MQHA 4ODGA 2F0QA 5M3MH 4HIMA 2EYHA 2CW0D 2I5HA 2BH2A 5CV7A 2DUDA 3DWQA 1R9TB 3BZCA 3MXPA 4A93H 1STBA 4DR6Q 1HQRD 1PH4A 4A3GH 4OL7A 3MEHA 4DAMA 2YTXA 2JA6B 4FJUA 4BY1H 1LYLA 1TR5A 5C44H 3KF8B 2YTYA 2N78A 4FXGC 4C3HG 1NR2A 2KA7A 4ZK9B 3A8KE 3PO3G 3VDYA 1Q8KA 3P7JA 4GKKL 4MHEA 1NUCA 1GUSA 4YY3Q 1HNXL 2F0EA 3R2IA 1SJHD 3F2CA 4PMCA 5E4WC 4DK6C 3BJUA 4A3FB 1PH5A 3FAUA 1KC8C 2IHEA 2CCZA 3W5OA 4X66Q 1JJGA 3H0GG 1T5EA 1FYCA 3AU7A 2MP1A 2Q8TA 1KHMA 1PYWD 2K04A 2NZOA 2VKCA 3NWSA 1KDAA 3TSSA 1PHJA 1MJEA 4NW2A 3I4NG 1B50A 5DT9A 4QF4A 1BBWA 4YIJA 1F9RA 2IPKD 2EY1A 1MJCA 3C3LA 5L37A 2UXBL 1FNWA 2JA7G 3H3VH 3KYHC 3HOXH 1DJRD 1CSPA 4B3RH 2I07B 3FMCA 2H1EA 1H95A 2ZXRA 5IYCG 1TS5A 4A3KB 3J7YW 1EY5A 1GUGA 2N55A 1I3QH 1LUZA 3GTQB 3ULLA 2E8GA 3TP6A 4JBJA 3J7AV 2KVMA 3FDTA 4K0KQ 3ZYYX 3GTGH 5IWAH 1A0IA 1JWMD 4QGUA 4BY7H 3FPUB 2G8YA 4ZCKA 1ONLA 1V8QA 1X3PA 1Y1WG 4PG3A 3HFZB 2L1BA 4NXMH 2F52A 2JEAI 4X62L 1SRUA 1I4GA 2K52A 3KDKA 4FDBA 4Y7NB 3I3CA 2M8WA 1G291 4OELB 1NMFA 4L5RC 2VUMB 2B8GA 1K3RA 3E0JA 2PZWA 2HD3A 1L0YB 2VQFL 4DV0L 1JE4A 1J5EQ 4DK3C 1WI5A 1OO9B 3DHQA 4ILWA 4G7ZC 2XRSD 4LWCA 1GHKA 4L8JA 4HIKA 2XGTA 3K5MA 1PTOB 1HZAA 2AHOB 1O78A 2UUCQ 3PIP3 1VF5C 1Q8IA 1U4MA 5FO8B 1B3AA 1XX8A 5C5MA 5M3FG 4QMGA 2F1MA 2PO4A 1ZTGA 3MHBA 1I4QA 4X65Q 1NXUA 1BOSA 1PFMA 2KJXA 2R7ZB 1XTDA 1UEBA 3G48A 3RMHA 1QE6A 3I7FA 2A69D 1XNRH 2KCMA 1CM9A 1ESRA 4LFCL 3GTOH 4B3MH 4JI1L 2Y0SE 4LF5H 2EIFA 1IBLQ 4GNXA 1D2BA 3FP9A 1X9NA 4A3MG 1X0AA 1LABA 4O42A 4PDBA 1FNUA 3KLRA 5C0XJ 5K36H 2N88A 4RG1A 3V05A 5I6YA 3ERQA 1D1IA 5ELCA 3PO2H 1AEXA 4LIJA 5FLXL 2JA6H 2ANRA 2IX0A 1L0WA 3OIPA 2R7FA 2NUCA 2Z4IA 5C0XH 1K8GA 4A3EH 5FJ8G 4XYQA 3S1RB 4DR5H 2BE5D 2JA8B 3GTKH 1PZKD 3W1GA 1YNXA 2VQFQ 3J80i 1ZZKA 3BDOA 4JI6H 1GUNA 2KBNA 3U1KA 2FHTA 3HOUB 2NVQB 5CC4A 5DNFA 1WTXA 4DR1L 1SLJA 1VMCA 1GHJA 1IXRA 4JI8H 1I4PA 4IUQA 2KCTA 5M5XH 3I55A 5D3IB 1Y1VB 3TN2A 2NVTB 3HGBA 1Q90A 3J81W 4JBWA 4A3DB 2G9HD 3KLSA 1PH7A 1N33L 5M9OA 3AEVB 2I5LX 4LF8L 1PH1A 2LKVA 3PIO3 1PH6A 5M5WH 2K5HA 4DAYA 1KDBA 1EU4A 3QJYA 2K5WA 1LTID 3D6CA 2BDNA 3PSIA 3V96A 1II3A 1HCZA 5BN4A 1VQ5A 2GA4B 1JB3A 3SK4A 4DV3H 2D5DA 4RMFA 3CCQA 2PT7G 2LTMA 5C3EG 5JEAJ 4OO1G 1CHPD 3MC0B 2KHSA 3NTIA 4RWSC 2E2HB 1W2BA 5COYA 5IWAQ 1TKWB 1BUVT 5CV9A 3VR5A 2LF0A 1Q46A 3BU2A 5DM73 5E3FA 3M7NA 3I90A 1TXYA 2Q2HA 1CQFA 5M5YB 5AJ3L 1LT4D 4KHPH 3RLFA 2KECA 4NXMQ 2EYPA 1J4WA 4CDDC 3C1FA 4Y7NH 5CR3A 5LL6X 4RAUC 3L3OC 1VQKA 1NMGA 2Y0SB 1TUAA 1O80A 4DR5L 1IYJB 2VUMH 2B39A 3BS1A 2A74C 3EFXD 1D5MC 1NTGA 4J6HA 3SVMA 4FF4A 4GNXB 4GOPC 2XTIA 2D9UA 1FNVA 4DV2H 1KL9A 1VQAA 4HCSA 1YBYA 3E9HA 1UE7A 4CJ1B 3SR1A 2ZXOA 4LFBH 4LF8Q 3P1HA 2X69A 3T1YL 2A1AA 1WTVA 2BL5A 4O1NA 3NXWA 4XIGS 4ZUIA 1BO0A 4DR2H 2HUGA 2R7ZH 3CHBD 4LAAA 4XQNA 1VIHA 3D4RA 5I2YA 1VBIA 3GTJB 1PDQA 3HKZB 3MFGA 1OXUA 1HA5A 1JB7A 3NUCA 5KNBA 5E1FA 4B3MQ 1G2TA 3PF4A 1PRTC 1EZ8A 2KCNA 5FLMH 4QIWB 2PQAB 2CPMA 3V2TA 1G51A 1EYGA 2L0CA 4AYBB 1PXUA 1QZGA 3MXNA 1WTRA 1TWCB 3HP3A 3CRLC 4EVOA 2BCOA 3DUZA 1S03G 3KJOA 5LL6b 3M4QA 4ME5A 4DFAA 2OWOA 2YTVA 3I4MB 1M1KC 2WKDA 3PCOB 3VYSA 4DV5H 4HAEA 2ZM6H 4DAYB 2UXCH 3KBGA 2D2CC 4PQXA 1K8MA 2B2TC 3X3MA 3S1RH 2K5QA 1D6EC 1SSOA 3E6ZX 3DM1A 4DR5Q 2O4CA 3K5NA 3GTMB 5LMNH 4OX9H 2WAQG 3GTPB 2O2LD 3HOYB 2NVQH 1ZXTA 1HZ9A 3HOUH 4JI6Q 1CFMA 1PVOA 1JJ2A 4CDFC 2RCFA 3CMAA 1XMOL 4DR7H 3W1BA 4JBKA 2MGSA 4B8CD 4B3TH 1PTOC 1WVNA 1Z6HA 1QCBD 3CF5A 3HOVG 4GKJH 2IL8A 2QCPX 2EE1A 4IFDG 5C4XB 1XTCD 5FK9C 1DXMA 3T1HL 2HCIA 4KKSA 4QUFA 2OEOA 3NP8A 5CV8A 4C3JG 1KNAA 4A3BB 4FJSA 4BBRG 1T5XD 1U4PA 2EXDA 4DV6L 4A3IB 2EY6A 2F0SA 1QB5D 3TDQA 2WINB 1RKNA 2AQ1B 1U9RA 1D7QA 1E1TA 1UE6A 2FMMA 2DJGC 3M7GA 5IYDH 5FKAC 2SNMA 4XQQA 2B63B 5IT9W 5IGGA 1U0LA 1EQTA 4DV3Q 1R4QB 2GVAA 2KHJA 1H9SA 2DGRA 5FLXc 2FFKB 1LTGD 1CZGA 4UP8A 3QD7X 3D31A 1P16A 3F8TA 3M9BA 3OOCA 5IOCA 4CBVA 4HSVA 2Q2TA 5C5LA 4WORA 4A3CG 3DEOA 2WFWA 3ITPA 1N34H 5M5YH 3UDXA 5E4XA 3A5UA 4KHPQ 4H8AA 2RF4A 3D3RA 1QUQA 1HNZL 1YNJD 5HY6A 3TS0A 1PH8A 4P73A 3VA7A 3K59A 5EAYA 1Y69U 1F9QA 1WVLA 4FXKC 5JVG3 2CTKA 1ET9A 3K0XA 3ND9A 4CJ2C 4NB3A 1WTHA 3FKIH 1AP0A 1PFBA 3J81L 1A3VA 5D65A 1EEFD 3MXNB 2Q2UA 4JVHA 3M85A 4IPGA 4DV2Q 1B3QA 2CTMA 3A7AB 1CT1D 2H5XA 1EL0A 1F2ZA 1C48A 3S16B 3URYA 1FJGH 3MTSA 4LFBQ 4NP5A 4JV5L 2EDGA 4OONA 2R92B 2EPBA 4R4IA 4DR3L 1HR0W 2L11A 4BBSH 2A69C 4EX5A 4FVMA 5IYBH 3HOZG 4G08A 3CC4A 1DYQA 1CZWA 2D62A 1K83H 1D5ZC 2ICIA 4DR2Q 1RTNA 1IKLA 4ZYSA 4WANA 1M8AA 5JJKA 4X6AH 1VS0A 1A62A 1EYAA 1WCMH 1KRTA 4LUZA 1X4MA 1LTRD 2JA5H 4BWGB 3IAYA 3HRZC 3V69A 2DJFC 4YCVA 1H9RA 2QA4A 1BBXC 1W6KA 4DV4L 1TWCH 1TIID 1X3EA 4R8NA 4GOPA 4K8IA 3I4MH 3QWNA 1NY4A 3SHLA 1I4HA 5M3MG 1N36L 4DR4L 4NZRM 1STEA 1BCPD 1EQRA 4DV5Q 3VKEA 2ZM6Q 4A93G 4JI2L 2UXCQ 5GAEC 4GKKH 4OHJA 3H09A 1OXXK 4BY1G 3EVQA 3FPPA 5BN5A 1I6VC 1HNXH 1GO3E 2HDLA 3MXGA 3IFDA 3I0PA 1X55A 5LMNQ 4DUZL 4OX9Q 2Q8RE 3CU7A 2K6AA 2JN4A 2ZXPA 4J8QA 1H9SB 1XNQL 1F2YA 1VQBA 2A19A 2BA0A 1F9PA 1SE3A 5JJLA 4DR7Q 1HZBA 4HJ9A 1XMQL 2I5MX 1PZJD 4C3HB 4DUYL 1SXTA 3S1NB 3EBEA 3PO3B 3OETA 2DY8A 1QVCA 4DKAC 4KJNA 2RHSB 1VIGA 3RZOB 5KIXA 1G91A 4R8IA 4GKJQ 1D8LA 3EZJA 2MUYA 3OMGA 2NWGA 1RD9D 2LRRA 2AMCB 4KY7A 1QUQB 4K6DA 3SXHA 2UXBH 4LF6H 4C2MB 1GD7A 1FR3A 1SROA 1BCPF 5JAVA 3H0GB 4B9XA 1I6UA 1RCVD 1VQOA 4BA1I 3PUXA 5AFWA 1S20A 4X64L 1A3TA 1LACA 1V1PB 3M4OB 3IKJA 5IE8A 4NZTM 3PIPA 1L1OC 3FHWA 5IGDA 2R6GA 2OQKA 3CKIB 1PZID 3HOXG 4NBQA 3I4NB 2ATWA 5CORA 2B2TA 1N32L 4ULLA 3I2ZA 4MZ9A 1MGSA 4IO9A 4JVZA 1Q82C 4IQZA 2JA7B 2MJHA 1Q7YC 2SEBD 4DNTB 4A3JH 1KDCA 4LK1C 3PQIA 3CRKC 3K5OA 2VB3X 4BY7G 4X62H 2A6ED 3BYTB 2ZTDA 2O5JC 1N34Q 5IP7G 1SYBA 1BDOA 2QF7A 1TWAH 2VXWA 1BF4A 1X9ZA 4GN4B 3VYRA 3CQZB 3Q23A 1VQ8A 3MWYW 3BVGA 3S17B 4KD4A 1JC7A 1DGSA 1TWGH 1EY4A 3NQIA 4DUZQ 4P2CB 4HJ5A 1NCVA 4FO2A 5CYUA 3LX0A 2VQFH 4DV0H 3KUPA 1XNQQ 1E22A 3IL8A 4HJ7A 2PPBC 3CPFA 2XWBB 1LTBD 2LMCB 1HFNA 5C4JH 4WALA 1LV9A 4P71A 4WJWA 1QVGA 1Y1WB 3A7LA 1EY6A 1X65A 2CH4W 4RCOA 3PMFA 4GOPB 5E7NA 1ENAA 2GVBA 1G2SA 3J7A5 3TRZA 4AM3A 1C8CA 4AQYL 4TRDA 3D6WA 1FJGQ 5EKKA 5GQOA 2R92H 2UXDL 2DGYA 3PGZA 3KOJA 3KK7A 2OCEA 3OW7A 4PNYA 5IT9L 3VR4A 2HDMA 4LF6L 4LFCH 4JI1H 2VNUD 1PQXA 2VW9A 1JOOA 1LT6D 2E76C 4LF4L 1PYSB 2L15A 1WOCA 3KLSX 5JPNC 1WFQA 1RJTA 3OWEB 4YCWA 2K5NA 3EQLC 2AQ2B 3MFYA 3J81E 3CCVA 5M3FB 1PRTB 1EWIA 1ET6A 1WJJA 4TQUS 2FXQA 2F3VA 4KY5A 1LLRD 2PZTA 4ZQ3A 4LUOA 1RHPA 2FFMA 4NMZA 1CA5A 4LF9L 5K36G 2LFNA 1VQNA 2XNAC 1G8ZD 3ER0A 1EY7A 2NVXB 1SBBB 1Z9FA 3UOEA 2NB0A 4KK7A 2C9OA 1TS4A 4C3IG 3PO2G 4DXGA 4HSPA 1NSNS 1E2VA 1XPRA 1BBUA 3O13A 3AEVA 4GKKQ 3GABA 4A3MB 5C0XG 3J81c 3QG1A 2B2UC 4A3EG 1HNXQ 1S5DD 3CC7A 3RZDB 2F0KA 3I91A 1B44D 5FO9B 2K28A 1L2FA 2HHHL 4DR1H 4KTAA 3QOLA 3AB9A 3OPOA 4KMUC 3A5ZB 1GOZA 1MSGA 2VY3A 5EJWA 1HR0L 1XPUA 4CKCA 3S1NH 3PO3H 2VQEL 4ZAIA 2R61A 5ELEA 1N33H 4CHTB 4LF8H 1D5XC 4RA8A 1YJWA 2KEDA 1UWVA 4IPCA 2ZT9C 4C2MH 4WJ3M 1O7LA 1K0SA 2ENBA 4OGQC 3H0GH 4LF6Q 2UXBQ 3BDCA 2CTJA 2ES2A 1EQQA 1JR0D 5IY0A 3DEPA 3M4OH 4LF4Q 1E3PA 1YNNC 2EYMA 3D0FA 3S2DH 4C1NK 4YWKA 1BKBA 4A76A 2JJQA 3DMUA 4OWXB 2N49A 2Z4HA 1X56A 2LXKA 5GAGC 1CI3M 4TKOB 1NNXA 1FKAH 1A6XA 3H3VC 1A3UA 3U58A 3F2DA 1B8AA 4UPAA 3T51B 1KAWA 1GVPA 5F2DA 1YHQA 1UE1A 5KYLA 1R9TH 1YNJC 5ELDA 5IYCH 4X62Q 1F2LA 4OCHA 1SNQA 3CCSA 3MVVA 1RF2D 2IHFA 1MSHA 2WAQE 5JEAG 3TZDA 3SE0A 5C3EB 3A8IE 3OSOA 4U68A 2RHQB 2L9HA 3SEBA 2L4NA 2E5LL 3FVQA 2K4KA 2NTTA 1HRJA 4HJ8A 2PNHA 3T4AC 2NZ1D 4F87A 4DV0Q 4KKTA 1BVSA 4A3FH 2EYLA 3LNNA 1Y1WH 2CQOA 1WTOA 5T1GA 3HKZE 1K0RA 1EFID 3A0JA 1AZPA 1I94L 2ID0A 1L1OA 2MNAA 2F4VL 2PQAA 2DNCA 3T53B 2OTLA 4QIWE 4ZKBB 3AQQA 1X3GA 2CHBD 1SMXA 3T1YH 4AYBE 1VQPA 4EQ5A 2IW3A 1LM0A 3TP7A 1ESFA 2OT2A 3F2UA 4IZ8A 2HH2A 1G6ZA 4H0LC 4RFBA 4QJFA 1IYUA 4HEDA 1KRSA 4POFA 4OXPA 4AH6A 4LFCQ 3J81j 4R9WA 3GTLB 4JYAL 1SEBD 4JI1Q 1PFNA 4JPBW 1K3BC 4JBMA 5EPKA 4APVA 2E2JB 4EQPA 1KTKA 3CXCA 4DXFA 2OPUA 2X06A 1EWCA 4A3KH 1B9MA 2K5VA 3DM3A 4B8TA 3U9SA 5FLMG 3J7AF 5M3FH 4C56C 2NBFA 3GTQH 2X6LA 1QOHA 5ELNA 2K01A 2B29A 3MXUA 2NVXH 2FPHX 1B2TA 2MO1A 2XRQD 3I4OA 4GLXA 2MO0A 2F0NA 4JI3L 2K32A 2UU9L 1HZCA 2OPVA 2R7DA 2K75A 1SMYD 1EUJA 3D4WA 4RGOS 3QO2A 3A55A 2DY7A 5IT9E 1VQMA 4G4KA 3QIAA 1SN8A 4RGMA 1ILQA 2LSSA 1FVIA 1GUWA 1Z2IA 1D1KA 1E24A 4XTCS 1IW7D 1XMOH 4DR1Q 4JI5L 2F0WA 5IODA 3M3YB 4IOAA 5GAHC 4POGA 1EWHA 1SFOB 4NDXA 2EVBA 1TWHB 2E2DC 4Q5VA 1Z7TA 4IFDI 3T1HH 5IT9c 1O7ZA 1JCKB 1PTOH 3UDGA 1N33Q 2E2IB 4LF7L 3JAMW 2EJMA 2WAQB 4XT1B 2B2YC 5BR8L 1OXVA 3PUYA 4DV6H 2Z0SA 1ZKOA 2RDGA 3BVZA 1IBKL 1DONA 3WDNA 4A75A 5EQ0A 1KHIA 3HOVB 4DV1L 2A6HC 3STBD 2Z6KC 2E75C 3SGIA 3HKSA 3RD4A 1C0AA 1UEAB 2IY5B 3PUVA 2R3ZA 5IYDG 3UI2A 3ULPA 3VR2A 2R93G 5DEHA 1L1OB 3S1QB 4C3JB 2B2UA 1BQQT 1TY0A 1S3OA 2A73B 3OTOL 4BBRB 4KI0A 1S40A 2CW0C 1A8VA 1VQJA 4NPSA 4MNOA 2XIWA 2A6EC 4L6TB 4R4CA 3EROA 2KHIA 4EQOA 2F0PA 4LFAL 3K7AB 5T1IA 2WB1G 5AJ3Q 3G4SA 4IUVA 2AQ3B 2SOBA 1HNZH 1LTLA 3HZXA 5C3WA 3W2DA 4DN4M 2I46A 1HNWL 1B1ZA 4RCNA 5IGCA 3P20A 2JA8H 1KD1C 4B08A 1S72A 2AKWB 1HPCA 1I50B 4I65A 2YYZA 4ZRZA 1LO5D 4R4QA 1AN7A 2AUKA 3L9AX 3PUZA 1ZZIA 3VA5A 3PUWA 1KNEA 2PW7A 3FKIG 3NBHA 1CKMA 4JI4L 1O7YA 5JJZA 4NXNL 5D14A 1W3SA 2RSNA 1Y1VH 2NVTH 3DLLA 4JV5H 4KHZA 3I4LA 4DR3H 1DCZA 3T1YQ 4A3DH 2F0LA 1XWEA 1Q12A 4UHVA 2EJGC 4ME3A 2F0IA 1DOKA 4JI7L 4GZYC 1R4PB 2CWAA 2K7VA 1A2UA 2Z8LA 3RN5A 1NJIC 4BBSG 3EJIA 4ALPA 4V190 4EGVA 1JMCA 2DN8A 2F0GA 1IHZA 2F0DA 1IBML 1EQVA 2E2JH 1XRHA 2DNEA 1TWFB 3BDLA 3ONAB 4JI0L 1WCMG 2CWFA 2J0TD 2JA5G 4DV4H 4EC5A 1SNOA 3NSWA 3HOZB 3TP8A 1LTTD 5IGFA 2E2HH 3E3XA 3J80E 1N36H 5LMUH 4DR4H 1SAPA 1GJXA 5D3DA 3S2HB 1Q3LA 2G5DA 4K5WA 3UE1A 5IP9H 4JI2H 2E74C 4AIMA 2UUAH 2NN6G 1U4LA 5LHY1 3CD6A 4IPHA 1CKOA 4M8AA 1PH9A 3AFQA 3S15B 4DUZH 3GKUA 4X3SA 5J3BA 3CW2C 1XYIA 3FRPB 1YITA 2HQLA 1V1PA 3HOWG 2LXJA 4J1MA 1XNQH 3BVMA 2F0MA 5DAUA 1TT2A 1XMOQ 5M3MB 3M3YH 1YIJA 2PZUA 1XMQH 3CMEA 4DUYH 4YHHL 4NKLA 1SFOH 4DNRB 4A93B 3OYYA 3X3NA 2F3IA 2EJFC 1QJOA 1AE3A 1LTAD 4BY1B 1YHBA 5IGEA 3RF2A 1BR9A 4K5VA 3T56B 1EIYB 1F2MA 5ELBA 3T1HQ 1B7YB 1E7ZA 1UNSA 1Z47A 4JI7Q 1Y8NB 5A35A 3GR5A 3BG3A 4N9TA 1STNA 1HFGA 5I9OA 4DV6Q 1ASYA 4X64H 2BOSA 2K5DA 1AZQA 3C46A 5G3LD 4UDUC 3H3VI 1RDPD 1OTCA 3CCLA 2CH4A 3GTJH 2RCNA 3H6MA 3HOVH 5C6AA 2CTFA 2HT1A 1N32H 3IRBA 3K57A 4IFDH 4QCLA 1WHRA 3NBHB 4OWTB 1CTMA 4QY7A 3T13A 4LMQD 4A3LH 1SYFA 4LUVA 5I9PA 4F8MA 2O4XA 1Q81C 2PI2A 3UE0A 1PV4A 3QOJA 4XQJA 1MBYA 2PI2E 3NELA 1TU2B 4A3JG 2QGQA 2N8NA 4PZ6A 3HOXB 4DV7L 4HTHA 5LMUL 5A2QW 2M2LA 2TSSA 2K03A 1HNZQ 2BE5C 2F0JA 4A3GG 2OQ0A 3SK6A 2B2VC 2ZJPA 2UUAL 5C44G 3I73A 5KNDA 1I3QB 1HXYD 2JQOA 1QNUA 2B2YA 1JOKA 5G3LF 3BZKA 3GTMH 2K50A 5FOBB 4QUCA 3GTPH 4A3CH 3HOYH 3GTGB 4GN5A 3CCRA 1SE2A 2QEXA 4BY7B 1WE8A 4B3SL 5K5PA 3JAML 1JWUD 3P75A 4P74A 3UDFA 3HEJA 3SK5A 1J6QA 5HURA 2Z6KA 4HMJA 2L12A 2QEJC 5JOBA 4AQYH 2RQXA 1EYCA 2UXDH 4JV5Q 5IIFA 3G71A 2EXZA 4DR3Q 2B8FA 4OD6A 1K1GA 3D4DA 2I0QA 1MKHA 5C4XH 4CJ0B 2ZTCA 5IGBA 1X4NA 1F77A 4A3BH 2J4XA 3J80W 1X6OA 3RUZA 1QZHA 2RBMA 3PF5A 2JA9A 2QKIC 1VQGA 4A3IH 4KN7C 4LJZC 4LF4H 4F7XA 4X66L 4PMBA 4X3KA 3NWTA 3OW2A 3PV0A 3LWEA 4K2LA 2EYFA 3CC2A 5KRUA 2B63H 3K81C 5JVH3 4DV4Q 1WD1A 1EU3A 2UUBL 4N8FA 4IUTA 1H9KA 1P8LA 5GADC 1RTOA
chains in the Genus database with same CATH topology
3DXJC 1EIGA 4DV7Q 1N36Q 5LMUQ 4DR4Q 3S2HH 3M4PA 1DTJA 1DOLA 2RVLA 3GTOB 1Q1EA 4JI2Q 1BCPB 5GROA 5EKIA 3TP5A 2ZJQA 2D0OA 2HIVA 3KF6B 2UUAQ 2Q2IA 4H44C 5C0XI 1HQMC 5CBEE 1J9OA 3S15H 1IW7C 3TS2A 3MEFA 4V0BA 3VR6A 3RR5A 3MAQA 3EA6A 2YV5A 2PY9A 3EN2A 1KXLA 3OMCA 1VQ7A 4K0KL 1L0XB 2EYJA 1XMQQ 4RHSA 3PO2B 4C3IB 3EIVA 4DUYQ 1SE8A 5DLQE 2LY7A 4QMFB 4FF2A 1B4OA 1JJCB 4A3EB 1EIHA 1PLFA 1NBWA 1U5KA 3S16H 4IJHA 5J22A 1B53A 1X3QA 5ELFA 5J39A 3GTKB 1C9OA 4UP9A 4KJOA 1G6PA 4UY8C 5CV4A 4X64Q 3STBC 4I7ZC 2AUJD 2PCFB 2XN9C 4RGNA 1SJED 1TQOA 1VQCA 1J5EL 5I4DA 4FYDA 1PRTF 1QWYA 5M5XB 4RHRA 4UP7A 1AN8A 3Q24A 1VQDA 1N32Q 4HJAA 3PIOA 3T16A 2B2WC 3CAMA 4L5TA 4XT3B 3E0EA 1PTOD 1XJVA 2IJ0A 3WWVA 2UUBQ 2CVRA 3LWUA 2NZHA 1GUOA 2UUCL 5C4ZA 2HQEA 2L55A 5H1SE 5M5WB 2C5CA 2KENA 2K05A 4K5XA 4C1NI 4ZUJA 4X65L 1VCIA 2TMPA 4BXXH 4S3SA 3D8GA 4KLKA 1V1OA 3BYYB 2NVYB 1Q86C 2AWOA 2BDOA 3I8ZA 2JA6G 1WYDA 2N3SA 1X32A 2OTJA 3K80C 2CTLA 3AFPA 5CV6A 1IBLL 1J5KA 4ABNA 1SR3A 1YVCA 4M1UB 3N6RA 4Q0FA 1NR4A 1Y8PB 3RNUA 3I70A 5IP7H 3I72A 4A3FG 1ASZA 1PTOF 1B9NA 2EY5A 4C3HH 4QQBX 2XSCA 2NTSA 4DA2A 4AQYQ 1UAPA 3RZOH 3SDZA 4U673 2UXDQ 1I5FA 1VQEA 1PMRA 4ZLTF 1LT3D 4DNIA 5EGTA 1HA6A 4EQNA 1EOTA 3L7ZC 3R3OA 1KLGD 5C4HA 2WP8J 4JCVE 3H15A 2XWJB 3WOFA 2OF1A 4FF1A 5I6WA 3NPPA 5EKLA 1KIXA 4F88A 3TREA 2WKCA 2F4IA 4O0AA 2JXMB 1K8AC 3I4NH 1HTLD 1JORA 4DK0A 2B2VA 2KUMA 1FGUA 2A68D 4WFN3 1OXSC 4A3KG 4WRDA 3DWAA 2AXYA 3JAME 2RDHA 2EOTA 1GXDC 3W3AA 5A2QL 2WB1E 4OO1I 1QILA 2JP1A 3TMEA 2PYKA 2JA7H 1U4RA 1HUMA 4LF9Q 3F1ZA 3M4YA 4JK1C 2ZJRA 1YEZA 4P72A 4GN3B 2RA4A 1EY0A 1E2WA 1K8OA 3CQZH 3GDEA 4XDXA 2JEBI 5EPJA 1C4QA 3S17H 4B3RL 4RKLA 3JAMc 2F0UA 2CTEA 1SYCA 3VYUA 4DU9A 1GM5A 1AW7A 1YJ9A 2HHHQ 3A74A 1MIUA 1Y8OB 3Q22A 4BS9A 1SYEA 2VUMG 2KCCA 4H7BA 3ICEA 1HR0Q 3NHHA 4C3IH 2BH8A 4YWLA 5IWAL 4R1JA 1ZYRD 3RLOA 1TVXA 3BZDB 3ULJA 1MI2A 2YU9B 4FF3A 2WIIB 2VQEQ 3J80L 4J15A 3OHXC 4JVYA 1ENFA 3J7ZC 4GLAC 1X54A 4NXML 1V9PA 4HR7B 1IZ6A 1SNMA 1EFWA 3CPWA 3AYHB 1E1OA 5NUCA 1K9MC 4LNQA 4KN4C 2FMRA 4KHVA 1DOMA 3K5LA 4DAPA 2HIXA 1FL0A 4OIKA 3B6YA 2R7ZG 4FP5D 3S24A 1LTSD 3AMUA 1W6JA 5LMNW 5KGUA 5CBAE 3GP7A 1X3FA 2KQ3A 4G57A 4JOIC 1JWSD 4XYOA 3Q6SA 1I6HB 3Q8DA 2V1CC 1CA6A 2F0TA 4OWWB 1BCPC 1EYDA 1EEID 1S5CD 3E5SA 1TS2A 2F0HA 2PMZE 2A8VA 4L63B 1AE2A 1CKNA 1VQFA 2BA1A 5CGKA 1ML0D 2FJ2A 2NVYH 1XNRL 4B3RQ 2R93B 4ZKCB 2EQSA 4B3ML 1SYDA 1E0BA 1V43A 1F9SA 4A3MH 3RLNA 2E5LQ 4WJ4A 2CQAA 4LF5L 3RZDH 2CWPA 1TS3A 3NENA 3S14B 1UUPA 1VDZA 3NBIA 1HJPA 2JA8G 1JT8A 4G7OC 2KOLA 2X6GA 2Q8IB 1NE3A 4IUNA 2WB1B 1WTQA 2VL6A 3U4VA 1I94Q 1HTPA 4L5SA 3HOUG 2F4VQ 4R4OA 1IYVA 1VF7A 5JEAH 5JPMC 1CUKA 5FJ8H 2B3GA 1YHAA 3K58A 1RIPA 2FMCA 3FEWX 2B2WA 2MFIA 1YJNA 1HHVA 2JK8A 2SNSA 5EBCA 1Y1VG 3GO5A 3QB3A 2CPQA 1HUNA 4PZ7A 3Q0AA 2YQRA 4A3DG 3U9OA 4TSSA 1N9WA 2VB2X 1VQ9A 1DM0B 3A8JE 3TBIB 3FKIB 2ASBA 4JYAQ 2RKSA 2PW5A 4JI6L 3S1MB 1UE5A 2HH3A 4MIUA 1EY8A 1I4RA 1E2ZA 2EYOA 3CCUA 3KBXA 2F3WA 4JI8L 4CKBA 3WOEA 1XXGA 1STHA 2JE6I 4IPDA 1QG7A 4IUPA 4KKUA 4A4IA 2K14A 3CCJA 2K33A 1STAA 3NQTA 4BBSB 4BA2I 1KLUD 2WACA 1K83B 2JVZA 1XNRQ 1WTWA 4JI3Q 3F2BA 2UU9Q 2NN6I 2KEEA 5I2XA 1STGA 1ZEQX 3R2TA 1N8RC 1WCMB 5IP9G 1DT4A 2L5TA 2JA5B 4IOCA 4LF5Q 4ID6A 2P2RA 5C3EH 3VR3A 4GS3A 2PNRC 1IKMA 4E6IA 4DV3L 3U4ZA 4IJLA 3NK9A 4OO1H 1SDFA 2F03A 3NTKA 1C7YA 2Y0SG 1MD2D 1QNKA 3CP0A 1IL8A 2IX1A 3GD7A 4JI5Q 2NYZD 2QNDA 4HIDA 2LS01 5C3XA 1ILPA 1WD0A 5EBDA 3K7UC 4P75A 3HG9A 3L2PA 1JOQA 2F0FA 2YU9H 2EY2A 1XPOA 2CFMA 4DF7A 2HCCA 2C35B 2PMZB 5A2QE 1OXTA 3TZUA 4LF7Q 4KHPL 5BR8Q 1CKNB 1SNCA 4PMWA 3HOWB 5KEEA 4K6LA 5KNCA 5HGTA 1IBKQ 4IURA 3MZ5A 1PFSA 1A15A 2M9VA 1EZ6A 2ZTEA 4KV6A 1JE5A 5IYBG 2SDFA 3GTLH 4DV1Q 4JI8Q 1AH9A 2F0OA 1BNZA 1LT5D 1VQLA 4DV2L 2JZXA 3HKZG 1BXTA 4TVAB 1KQSA 3H94A 4K8JA 1QVFA 3OTOQ 5CMDA 1HH2P 4FXDA 1V1QA 1AFPA 4LFBL 1I6HH 5FLXE 3TEHB 4A3LG 1M90C 4Z9CB 4AYBG 3E9IA 2ICEC 4LFAQ 1TY2A 3KDFA 4LW1A 2O5IC 5HGQA 4JG2A 2MJ8A 4DR2L 1YZ6A 2RDFA 4HMIA 3ERSX 3I4MG 2R93H 2Z1CA 3G6JB 1EY9A 1HNWQ 4DAVA 3NTHA 1YNND 4QL5A 4KY6A 2CKZB 2E3UA 2IT1A 3UDIA 1GKHA 3S14H 3ND8A 3C1EA 1VMPA 4DGZA 3VYTA 4KD3A 3J80c 3RN2A 1ZZJA 4A3JB 4JI4Q 3HOYG 3C2PA 2JYOA 2M00A 4NXNQ 1FD7D 2XVSA 4XXEA 1EC6A 4A3GB 1VQHA 1TWAB 3I56A 4B9WA 3H91A 4CKEA 1TWHH 4JC0A 4DV5L 4OIJA 5C44B 4UAIA 2ZM6L 2IX3A 2UXCL 1SE4A 3J81i 4H13C 2E2IH 1TWGB 4JOIA 3JC66 2H4OA 4O2DA 5C4XG 4RKBA 1A63A 3R8BA 5LMNL 4IFDJ 1VQ4A 4A3BG 1KAAA 2F0VA 3MA2B 5C4JB 4OX9L 3S1MH 5DM63 1O7IA 3KF6A 1IBMQ 2V4DA 1VQIA 3L0OA 1JQYD 4FNFA 4A3IG 2A68C 1RODA 1ICWA 4DR7L 1T9HA 4K2KA 1YI2A 4JI0Q 4B3TL 2G9DA 1PH3A 1PYBA 5ELOA 3CCEA 3OWFA 1H9JA 3S1QH 2OXPA 2D0PA 2MPMA 4C3JH 2B63G 5JJIA 2RSOA 4GKJL 4BBRH 3KJPA 1SYGA 4IUUA 1S5ED 1J8IA 1M4VA 3K8AA 2K1BA 4X3UA 4RH6A 3KF8A 4PV1C 1KABA 4HN7A 1S4ZA 4DPGA 2ALYB 3K7AH 2QILA 2QDBA 4G7HC 2EZVA 3KLWA 1CQVA 4X3TA 2MHVA 5BN3A 4IN3A 3IFTA 3U50C 2JSOA 4K14A 3S9WA 1WTPA 4H02A 4R4TA 1B70B 1ENCA 1ZYRC 1PA6A 1I50H 3G7LA 4YHHQ 1H9MA 5J1ZA 1NAPA 3LGJA 4MN3A 4L5QA 1DZ1A 1A2TA 3GV6A 2NN6H 2GN5A 3A54A 3KDFB 5CV5A 4YCUA 1N34L 4DR6L 4N9PA 2FINB 2ANNA 3JAMi 2WV6D 1CK1A 2AWNA 3KFUA 1DD2A 3HOWH 4GNXC 4CGYB 3K0YA 5EPLA 3R93A 2R92G 4YY3L 3GV3A 1PH2A 3SK8A 3TQYA 4YWMA 1K73C 3GQBA 1Y14B 4IALA 1S5FD 2IWHA 1I4XA 3CCMA 4HIOA 3HS0C 4B3TQ 1Q1BA 1SNPA 1STYA 1CHQD 2VS1A 4DK1A 1TWFH 2A5HA 1IL2A 4QB4A 3NEMA 5ISRA 1FJGL 3HOZH 1GUTA 1VQ6A 1EOVA 3K6OA 1SNDA 1EIFA 5FO7B 1FGBD 1SMYC 3S2DB 2PQEA 1RL2A 2J7ZA 3A56A 3OIQA 4BXXG 5TSSA 2VZAA 1CSQA 3DWPA 4HCEA 4RGTA 1JICA 4Y52H 2A6HD 2PQUA 1S5BD 4GLVB 1PRTD 3NE5B 4PZ8A 5KYIA 5LL6S 4MTNA 3ZJYC 3G6EA 3N52A 4B3SQ 2MQHA 4ODGA 2F0QA 5M3MH 4HIMA 2EYHA 2CW0D 2I5HA 2BH2A 5CV7A 3DWQA 2DUDA 1R9TB 3MXPA 3BZCA 4A93H 1STBA 4DR6Q 1HQRD 1PH4A 4A3GH 4OL7A 3MEHA 2JA6B 2YTXA 4DAMA 4BY1H 1LYLA 1TR5A 5C44H 3KF8B 2YTYA 2N78A 4FXGC 4C3HG 1NR2A 2KA7A 4ZK9B 3A8KE 3PO3G 3VDYA 1Q8KA 3P7JA 4GKKL 4MHEA 1NUCA 1GUSA 4YY3Q 1HNXL 2F0EA 3R2IA 1SJHD 3F2CA 4PMCA 5E4WC 4DK6C 3BJUA 4A3FB 1PH5A 1KC8C 2IHEA 2CCZA 3W5OA 4X66Q 1JJGA 3H0GG 1T5EA 1FYCA 3AU7A 2MP1A 2Q8TA 1KHMA 1PYWD 2K04A 2NZOA 3NWSA 1KDAA 3TSSA 1B50A 1PHJA 4NW2A 1MJEA 3I4NG 4QF4A 1BBWA 4YIJA 1F9RA 2IPKD 2EY1A 1MJCA 3C3LA 2UXBL 1FNWA 2JA7G 3H3VH 3KYHC 3HOXH 1DJRD 1CSPA 2I07B 3FMCA 2H1EA 1H95A 2ZXRA 5IYCG 1TS5A 4A3KB 3J7YW 1EY5A 1GUGA 2N55A 1I3QH 1LUZA 3GTQB 3ULLA 2E8GA 3TP6A 4JBJA 3J7AV 2KVMA 3FDTA 4K0KQ 3ZYYX 3GTGH 1A0IA 1JWMD 4QGUA 4BY7H 3FPUB 1ONLA 1V8QA 1X3PA 1Y1WG 4PG3A 3HFZB 2L1BA 2JEAI 2F52A 4X62L 1SRUA 1I4GA 2K52A 4Y7NB 4FDBA 3I3CA 1G291 1NMFA 2VUMB 4L5RC 2B8GA 1K3RA 3E0JA 2PZWA 1L0YB 2VQFL 4DV0L 1JE4A 1J5EQ 4DK3C 1WI5A 1OO9B 3DHQA 4ILWA 4G7ZC 2XRSD 4LWCA 1GHKA 4L8JA 4HIKA 2XGTA 3K5MA 1PTOB 1HZAA 2AHOB 1O78A 2UUCQ 3PIP3 1VF5C 1Q8IA 1U4MA 5FO8B 1B3AA 1XX8A 5C5MA 5M3FG 4QMGA 2F1MA 2PO4A 1ZTGA 3MHBA 1I4QA 4X65Q 1BOSA 1PFMA 2KJXA 2R7ZB 1XTDA 1UEBA 3G48A 3RMHA 1QE6A 3I7FA 2A69D 2KCMA 1CM9A 1ESRA 4LFCL 3GTOH 4JI1L 2Y0SE 2EIFA 1IBLQ 4GNXA 1D2BA 3FP9A 1X9NA 4A3MG 1LABA 4O42A 1FNUA 3KLRA 5C0XJ 5K36H 2N88A 4RG1A 3V05A 5I6YA 3ERQA 1D1IA 5ELCA 3PO2H 1AEXA 4LIJA 5FLXL 2JA6H 2ANRA 2IX0A 1L0WA 3OIPA 2R7FA 2NUCA 2Z4IA 5C0XH 1K8GA 4A3EH 5FJ8G 4XYQA 3S1RB 2BE5D 2JA8B 3GTKH 1PZKD 3W1GA 1YNXA 2VQFQ 3J80i 1ZZKA 3BDOA 1GUNA 2KBNA 3U1KA 2FHTA 3HOUB 2NVQB 5CC4A 5DNFA 1WTXA 4DR1L 1SLJA 1VMCA 1GHJA 1IXRA 1I4PA 4IUQA 2KCTA 5M5XH 3I55A 5D3IB 1Y1VB 3TN2A 2NVTB 3HGBA 1Q90A 4JBWA 4A3DB 2G9HD 3KLSA 1PH7A 1N33L 5M9OA 3AEVB 2I5LX 4LF8L 1PH1A 2LKVA 3PIO3 1PH6A 5M5WH 2K5HA 4DAYA 1KDBA 1EU4A 3QJYA 2K5WA 1LTID 3D6CA 2BDNA 3PSIA 3V96A 1II3A 1HCZA 5BN4A 1VQ5A 2GA4B 1JB3A 3SK4A 2D5DA 4RMFA 3CCQA 5C3EG 5JEAJ 4OO1G 1CHPD 3MC0B 2KHSA 3NTIA 4RWSC 2E2HB 1W2BA 5COYA 5IWAQ 1TKWB 1BUVT 5CV9A 3VR5A 5DM73 1Q46A 3BU2A 5E3FA 3M7NA 3I90A 1TXYA 2Q2HA 1CQFA 5M5YB 5AJ3L 1LT4D 3RLFA 2KECA 4NXMQ 2EYPA 1J4WA 3C1FA 4Y7NH 5CR3A 5LL6X 4RAUC 3L3OC 1VQKA 2Y0SB 1NMGA 1TUAA 1O80A 4DR5L 1IYJB 2VUMH 2B39A 3BS1A 2A74C 3EFXD 1D5MC 1NTGA 4J6HA 3SVMA 4FF4A 4GNXB 4GOPC 2XTIA 2D9UA 1FNVA 1KL9A 1VQAA 4HCSA 1YBYA 3E9HA 4CJ1B 1UE7A 3SR1A 2ZXOA 4LF8Q 3P1HA 2X69A 3T1YL 2A1AA 1WTVA 2BL5A 4O1NA 3NXWA 4XIGS 4ZUIA 1BO0A 2HUGA 2R7ZH 3CHBD 4LAAA 4XQNA 1VIHA 3D4RA 5I2YA 3GTJB 1PDQA 3HKZB 3MFGA 1OXUA 1HA5A 1JB7A 3NUCA 5KNBA 5E1FA 4B3MQ 1G2TA 3PF4A 1PRTC 1EZ8A 2KCNA 5FLMH 4QIWB 2PQAB 3V2TA 1G51A 1EYGA 2L0CA 4AYBB 1PXUA 1QZGA 3MXNA 1WTRA 1TWCB 3HP3A 3CRLC 4EVOA 2BCOA 3DUZA 3KJOA 3M4QA 4ME5A 4DFAA 2OWOA 2YTVA 3I4MB 1M1KC 2WKDA 3PCOB 3VYSA 4HAEA 4DAYB 3KBGA 2D2CC 4PQXA 1K8MA 2B2TC 3X3MA 3S1RH 2K5QA 1D6EC 1SSOA 3E6ZX 3DM1A 4DR5Q 3K5NA 3GTMB 3GTPB 2WAQG 2O2LD 3HOYB 2NVQH 1ZXTA 1HZ9A 3HOUH 4JI6Q 1CFMA 1PVOA 1JJ2A 3CMAA 1XMOL 3W1BA 4JBKA 2MGSA 1PTOC 1WVNA 1Z6HA 1QCBD 3CF5A 3HOVG 2IL8A 2QCPX 2EE1A 4IFDG 5C4XB 1XTCD 5FK9C 1DXMA 3T1HL 2HCIA 4KKSA 4QUFA 2OEOA 3NP8A 5CV8A 4C3JG 1KNAA 4A3BB 4BBRG 1T5XD 1U4PA 2EXDA 4DV6L 4A3IB 2EY6A 2F0SA 1QB5D 3TDQA 2WINB 1RKNA 2AQ1B 1U9RA 1D7QA 1E1TA 2FMMA 1UE6A 3M7GA 5IYDH 5FKAC 2SNMA 4XQQA 2B63B 5IGGA 1U0LA 1EQTA 4DV3Q 1R4QB 2GVAA 2KHJA 1H9SA 2DGRA 5FLXc 2FFKB 1LTGD 1CZGA 4UP8A 3D31A 1P16A 3F8TA 3M9BA 3OOCA 5IOCA 4CBVA 4HSVA 2Q2TA 5C5LA 4WORA 4A3CG 3DEOA 2WFWA 3ITPA 5M5YH 3UDXA 5E4XA 3A5UA 4KHPQ 3D3RA 2RF4A 1QUQA 1HNZL 1YNJD 5HY6A 3TS0A 1PH8A 4P73A 3VA7A 3K59A 5EAYA 1Y69U 1F9QA 1WVLA 4FXKC 5JVG3 2CTKA 1ET9A 3K0XA 3ND9A 4CJ2C 4NB3A 3FKIH 1AP0A 1PFBA 3J81L 1A3VA 5D65A 1EEFD 3MXNB 2Q2UA 4JVHA 3M85A 4IPGA 4DV2Q 2CTMA 3A7AB 1CT1D 2H5XA 1EL0A 1F2ZA 1C48A 3S16B 3URYA 3MTSA 4LFBQ 4NP5A 4JV5L 2EDGA 2R92B 4OONA 2EPBA 4R4IA 4DR3L 1HR0W 2L11A 4BBSH 2A69C 4EX5A 4FVMA 5IYBH 3HOZG 3CC4A 1DYQA 1CZWA 2D62A 2ICIA 1D5ZC 1K83H 4DR2Q 1RTNA 1IKLA 4ZYSA 4WANA 1M8AA 5JJKA 4X6AH 1VS0A 1A62A 1EYAA 1WCMH 1KRTA 4LUZA 1X4MA 1LTRD 2JA5H 4BWGB 3IAYA 3HRZC 3V69A 4YCVA 1H9RA 2QA4A 1BBXC 1W6KA 4DV4L 1TWCH 1TIID 1X3EA 4R8NA 4GOPA 4K8IA 3I4MH 3QWNA 1NY4A 3SHLA 1I4HA 5M3MG 1N36L 4DR4L 1STEA 1BCPD 1EQRA 4DV5Q 3VKEA 2ZM6Q 4A93G 4JI2L 2UXCQ 5GAEC 4OHJA 3H09A 1OXXK 4BY1G 3EVQA 3FPPA 5BN5A 1I6VC 3MXGA 2HDLA 1GO3E 3IFDA 1X55A 5LMNQ 4DUZL 4OX9Q 2Q8RE 3CU7A 2K6AA 4J8QA 2ZXPA 1H9SB 1XNQL 1F2YA 2BA0A 1VQBA 2A19A 1F9PA 1SE3A 5JJLA 4DR7Q 1HZBA 4HJ9A 1XMQL 4C3HB 1PZJD 2I5MX 4DUYL 1SXTA 3S1NB 3PO3B 3EBEA 2DY8A 1QVCA 4DKAC 4KJNA 2RHSB 1VIGA 3RZOB 5KIXA 1G91A 4R8IA 4GKJQ 1D8LA 2MUYA 3OMGA 2NWGA 1RD9D 2AMCB 4KY7A 4K6DA 3SXHA 1QUQB 4C2MB 1GD7A 5JAVA 1FR3A 1BCPF 1SROA 3H0GB 4B9XA 1RCVD 1VQOA 4BA1I 3PUXA 5AFWA 4X64L 1A3TA 1LACA 1V1PB 3M4OB 3IKJA 5IE8A 3PIPA 1L1OC 3FHWA 5IGDA 2R6GA 2OQKA 3CKIB 1PZID 3HOXG 4NBQA 3I4NB 2ATWA 5CORA 2B2TA 1N32L 4ULLA 3I2ZA 4MZ9A 1MGSA 4IO9A 1Q82C 4IQZA 2JA7B 2MJHA 1Q7YC 4DNTB 2SEBD 4A3JH 1KDCA 4LK1C 3CRKC 3K5OA 2VB3X 4BY7G 2A6ED 3BYTB 2O5JC 2ZTDA 1N34Q 5IP7G 1SYBA 1BDOA 2QF7A 2VXWA 1BF4A 1TWAH 3VYRA 3Q23A 3CQZB 4GN4B 1VQ8A 3MWYW 3BVGA 3S17B 4KD4A 1JC7A 1DGSA 1TWGH 1EY4A 3NQIA 4DUZQ 4P2CB 4HJ5A 1NCVA 4FO2A 5CYUA 3LX0A 3KUPA 1XNQQ 3IL8A 2PPBC 1E22A 4HJ7A 3CPFA 2XWBB 1LTBD 2LMCB 1HFNA 5C4JH 4WALA 1LV9A 4WJWA 1Y1WB 4P71A 1QVGA 3A7LA 1EY6A 1X65A 4RCOA 3PMFA 4GOPB 5E7NA 1ENAA 2GVBA 1G2SA 3J7A5 3TRZA 4AM3A 1C8CA 4AQYL 4TRDA 3D6WA 1FJGQ 5EKKA 5GQOA 2R92H 2UXDL 2DGYA 3PGZA 3KOJA 3KK7A 3OW7A 4PNYA 2OCEA 5IT9L 3VR4A 2HDMA 4LF6L 2VNUD 2VW9A 1JOOA 1LT6D 2E76C 4LF4L 1PYSB 2L15A 3KLSX 5JPNC 1WOCA 1WFQA 1RJTA 3OWEB 4YCWA 3EQLC 2K5NA 2AQ2B 3MFYA 3J81E 3CCVA 5M3FB 1PRTB 1EWIA 1ET6A 1WJJA 4TQUS 2FXQA 2F3VA 4KY5A 1LLRD 2PZTA 4ZQ3A 4LUOA 1RHPA 4NMZA 1CA5A 5K36G 4LF9L 2LFNA 1VQNA 2XNAC 1G8ZD 3ER0A 1EY7A 2NVXB 1SBBB 1Z9FA 2NB0A 4KK7A 2C9OA 1TS4A 4C3IG 3PO2G 4DXGA 4HSPA 1NSNS 1E2VA 1XPRA 1BBUA 3O13A 3AEVA 4GKKQ 4A3MB 5C0XG 3J81c 3QG1A 2B2UC 4A3EG 1HNXQ 1S5DD 3RZDB 3CC7A 2F0KA 3I91A 1B44D 5FO9B 2K28A 1L2FA 2HHHL 4KTAA 3QOLA 3AB9A 3OPOA 4KMUC 3A5ZB 1GOZA 1MSGA 2VY3A 5EJWA 1HR0L 1XPUA 4CKCA 3S1NH 3PO3H 2VQEL 4ZAIA 2R61A 5ELEA 4CHTB 1D5XC 4RA8A 1YJWA 2KEDA 1UWVA 4IPCA 2ZT9C 4C2MH 4WJ3M 1O7LA 4OGQC 2ENBA 3H0GH 4LF6Q 2UXBQ 3BDCA 2CTJA 2ES2A 1EQQA 1JR0D 5IY0A 3DEPA 3M4OH 4LF4Q 1E3PA 1YNNC 2EYMA 3D0FA 3S2DH 4C1NK 4YWKA 1BKBA 4A76A 3DMUA 2JJQA 4OWXB 2N49A 2Z4HA 1X56A 2LXKA 5GAGC 1CI3M 4TKOB 1A6XA 3H3VC 1A3UA 3U58A 3F2DA 1B8AA 4UPAA 3T51B 1KAWA 1GVPA 5F2DA 1YHQA 5KYLA 1UE1A 1R9TH 1YNJC 5ELDA 5IYCH 4X62Q 1F2LA 1SNQA 3CCSA 3MVVA 1RF2D 2IHFA 1MSHA 2WAQE 5JEAG 3TZDA 3SE0A 5C3EB 3A8IE 3OSOA 4U68A 2RHQB 2L9HA 3SEBA 2L4NA 2E5LL 3FVQA 2NTTA 1HRJA 2K4KA 4HJ8A 2PNHA 3T4AC 2NZ1D 4F87A 4DV0Q 4KKTA 1BVSA 4A3FH 2EYLA 3LNNA 1Y1WH 1WTOA 2CQOA 5T1GA 3HKZE 1K0RA 1EFID 1AZPA 3A0JA 1I94L 2ID0A 1L1OA 2MNAA 2F4VL 2PQAA 2DNCA 3T53B 2OTLA 4QIWE 4ZKBB 3AQQA 1X3GA 2CHBD 1SMXA 4AYBE 1VQPA 4EQ5A 2IW3A 3TP7A 1LM0A 1ESFA 2OT2A 3F2UA 4IZ8A 2HH2A 1G6ZA 4H0LC 4RFBA 4QJFA 1IYUA 4HEDA 1KRSA 4POFA 4OXPA 4AH6A 3GTLB 3J81j 4R9WA 4LFCQ 4JYAL 1SEBD 4JI1Q 1PFNA 4JBMA 5EPKA 2E2JB 4APVA 4EQPA 1KTKA 3CXCA 4DXFA 2OPUA 1EWCA 4A3KH 1B9MA 2K5VA 3DM3A 4B8TA 3U9SA 3J7AF 5FLMG 5M3FH 4C56C 2NBFA 3GTQH 2X6LA 1QOHA 5ELNA 2K01A 2B29A 3MXUA 2NVXH 1B2TA 2MO1A 2XRQD 3I4OA 4GLXA 2MO0A 2F0NA 4JI3L 2K32A 2UU9L 1HZCA 2OPVA 2R7DA 2K75A 1SMYD 3D4WA 4RGOS 1EUJA 3QO2A 3A55A 2DY7A 5IT9E 1VQMA 4G4KA 3QIAA 1SN8A 4RGMA 1ILQA 2LSSA 1FVIA 1GUWA 1D1KA 4XTCS 1E24A 1IW7D 4DR1Q 4JI5L 2F0WA 5IODA 3M3YB 4IOAA 5GAHC 4POGA 1EWHA 1SFOB 4NDXA 2EVBA 1TWHB 2E2DC 4Q5VA 1Z7TA 4IFDI 5IT9c 1O7ZA 1JCKB 1PTOH 3UDGA 1N33Q 2E2IB 4LF7L 2EJMA 2WAQB 4XT1B 2B2YC 5BR8L 1OXVA 3PUYA 2Z0SA 1ZKOA 2RDGA 3BVZA 1IBKL 1DONA 3WDNA 4A75A 5EQ0A 1KHIA 3HOVB 4DV1L 2A6HC 3STBD 2Z6KC 2E75C 3SGIA 3HKSA 3RD4A 1C0AA 1UEAB 2IY5B 3PUVA 2R3ZA 5IYDG 3UI2A 3ULPA 3VR2A 2R93G 5DEHA 1L1OB 3S1QB 4C3JB 2B2UA 1BQQT 1TY0A 1S3OA 2A73B 3OTOL 4BBRB 4KI0A 1S40A 2CW0C 1A8VA 1VQJA 4NPSA 4MNOA 2XIWA 2A6EC 4L6TB 4R4CA 3EROA 4EQOA 2KHIA 2F0PA 4LFAL 3K7AB 5T1IA 2WB1G 5AJ3Q 3G4SA 4IUVA 2AQ3B 2SOBA 3HZXA 1LTLA 5C3WA 3W2DA 4DN4M 2I46A 1HNWL 1B1ZA 4RCNA 5IGCA 3P20A 2JA8H 1KD1C 4B08A 1S72A 2AKWB 1HPCA 1I50B 4I65A 2YYZA 4ZRZA 1LO5D 4R4QA 2AUKA 3L9AX 3PUZA 1ZZIA 3VA5A 3PUWA 1KNEA 2PW7A 3FKIG 3NBHA 1CKMA 4JI4L 1O7YA 5JJZA 4NXNL 5D14A 1W3SA 2RSNA 1Y1VH 2NVTH 3DLLA 4KHZA 3I4LA 1DCZA 3T1YQ 4A3DH 2F0LA 1XWEA 1Q12A 2EJGC 4ME3A