2NN6G

Structure of the human rna exosome composed of rrp41, rrp45, rrp46, rrp43, mtr3, rrp42, csl4, rrp4, and rrp40
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
259
structure length
236
Chain Sequence
ARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reconstitution, activities, and structure of the eukaryotic RNA exosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/transferase
molecule keywords Polymyositis/scleroderma autoantigen 1
total genus 33
structure length 236
sequence length 259
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nn6G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nn6G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2nn6G03
2NZOA 3CCMA 3ND9A 1T9HA 1MJCA 3CW2C 4YWMA 3BG3A 1HQMC 3UDFA 4AYBG 5C0XG 5JEAJ 1VQ8A 1MKHA 3E9IA 3EIVA 5JEAG 1PH4A 1E2ZA 2NVYH 2ZJPA 3GTJH 1C0AA 3CAMA 4UPAA 4JBJA 3TRZA 1W2BA 4X6AH 2RCNA 1J5KA 4JVYA 2A6HD 3TEHB 1N8RC 3U58A 2ANNA 4YWLA 1VF7A 2NN6I 4DUYL 1JJ2A 1FJGL 4A3BH 2R92H 3BZKA 4DR4L 2R93G 2D2CC 5JJLA 3PCOB 4UP8A 5IYBH 1S3OA 4LF8L 5C4JH 2B63G 3A7AB 3MXUA 3VR6A 1V9PA 2I5MX 3OTOQ 1JJCB 4P71A 1EQRA 4B3SQ 1UE1A 2YU9H 2B29A 4KHPQ 1HR0L 5IYCG 4IQZA 4DNRB 2KCCA 4X64Q 2O5JC 4GNXC 4IPCA 4IOCA 5M3MG 3PV0A 5C44H 3S17H 4B3MQ 3SE0A 1SMYC 4TKOB 5BN5A 1NE3A 5IYCH 3CCVA 4A3EG 1VQPA 4OX9Q 5KNBA 4JBWA 4HJ5A 2JEAI 1XNQQ 5AJ3Q 2JA9A 4C3IH 4A76A 3AEVB 1LACA 3HOYG 2PCFB 2LSSA 4JI4Q 1BBWA 4DR7L 1VIHA 3F2BA 3BDOA 4UP7A 4DV0Q 1E3PA 2JA5H 4JI5L 1E7ZA 2PNRC 3L0OA 1Y1WG 4DV7L 3HOUG 3NBHB 4GKJQ 1GUNA 4X66L 1WE8A 1FGUA 4POFA 3PO3G 1DXMA 1IBLQ 1J5EL 2K5HA 4MNOA 2AMCB 5FJ8G 3TZUA 1HNWL 4JI8Q 1PA6A 5JEAH 2MQHA 1YNJC 1WI5A 2ES2A 4A3MH 2ZJRA 4R4QA 5FLMG 4A3GG 1VCIA 4Y52H 1VQJA 1TWAH 2NVTH 3QG1A 3HOZG 3CMAA 2VQFL 3M85A 3A5UA 2OQKA 4HJ7A 1K8AC 4A3KH 3KLWA 1TWHH 1BVSA 1E1OA 3T1HQ 4HJ8A 2N8NA 5H1SE 4FDBA 1TWFH 3BJUA 1GUOA 5BN4A 1VQOA 1GHJA 3GTQH 3EN2A 2A69D 4OO1G 3JAMi 1PH2A 1Q1EA 3I72A 5C3EH 4X62Q 1PH3A 4KI0A 2AHOB 1GM5A 1VQ5A 4DR6Q 3A5ZB 1V8QA 2ASBA 2B8GA 3FKIG 3HOXG 3UDIA 1YITA 1VQLA 2UUBL 3U1KA 4R4IA 2RHSB 5J3BA 2VY3A 2F3IA 4A4IA 1H9KA 2AUKA 2A6HC 5IP9H 2EQSA 1Y14B 2KHJA 2KA7A 3VDYA 4A3EH 2HH3A 3J7ZC 4A3IH 2R7ZH 4DNTB 3AEVA 2OTJA 1KL9A 1VS0A 4X62L 1JB7A 3K81C 5IT9c 1YHQA 1Y1VG 3KOJA 4LNQA 1YHBA 4C3JH 1ZYRC 3M4PA 4DAMA 2BE5C 4DK3C 3G6EA 1TWCH 3T1HL 3PF4A 3PO3H 4WJ4A 1X3FA 1N9WA 2VS1A 3CC4A 3KDFB 4OXPA 4BBRH 2JA8G 1HH2P 3GDEA 1KD1C 1L2FA 1KHMA 2F52A 1WJJA 1HNWQ 3OYYA 3VA7A 4LF6Q 4YHHQ 4P75A 2CCZA 4JV5Q 3ER0A 4PZ8A 3CRKC 3L2PA 4IOAA 3H0GG 1EIYB 4JC0A 4DV6L 4DR5L 2MNAA 2WB1E 1VQNA 5BR8L 3CMEA 4QY7A 4GOPC 3JAMc 1X55A 2BH8A 3WDNA 4YCVA 4LF6L 3DM3A 1Q90A 3H3VH 1LM0A 1X65A 1QVFA 1KXLA 1N32Q 2B3GA 4DR7Q 3S1RH 2UXBQ 1HZAA 4LUZA 3GTOH 4DV5L 3E0EA 4MTNA 2HH2A 1VQ6A 1KC8C 4OX9L 4GLVB 4GNXB 2FMRA 2K5NA 4BXXH 1UWVA 3I4MH 4B3ML 1IYJB 3QIAA 1I5FA 1V43A 2ID0A 2LXKA 3PUXA 4JOIC 2MO1A 1Q8KA 2ATWA 1AE2A 1GHKA 2YQRA 4A3DG 1SN8A 2DNCA 3U50C 3RLNA 1X6OA 4DV3Q 5C4XH 4A3FG 2JE6I 4B3SL 3I4NH 1QJOA 2LMCB 1Q1BA 3GTLH 3S2DH 4BY7H 1PVOA 2BL5A 5GROA 1NMGA 1U0LA 3J7A5 5IY0A 2P2RA 4C3HH 3PUWA 2C35B 3NENA 1PFSA 4JCVE 3KF6A 4RMFA 1XMOL 1S72A 1EC6A 3T56B 1B70B 2BDOA 3G4SA 1OXTA 2WB1G 2CTEA 2CPQA 1ZZJA 2GVBA 1YVCA 4QGUA 4DR1Q 3D4RA 1G51A 2JA7H 1X4MA 4DV3L 2JA7G 1YHAA 2Z0SA 5JJKA 2NVQH 4GN4B 4QIWE 1H9RA 3OPOA 2K32A 2E8GA 4IJHA 2E3UA 1HNZQ 3QJYA 1DGSA 1TUAA 2I5LX 4PMWA 2E5LL 4NXNQ 3GTMH 3OW7A 2Q2UA 2E75C 2B8FA 4YY3L 2AWOA 4LJZC 4GNXA 3F8TA 4L8JA 4KKUA 1B8AA 1OXSC 3K7AH 5C0XJ 2QNDA 1VQMA 2BH2A 3I4NG 1XJVA 1N32L 4G7OC 1X3GA 1PH7A 4JG2A 4DV1L 1IL2A 3PO2H 4JI1Q 1GUSA 2OPUA 3UDGA 3AFQA 5HGQA 3CCSA 1X9NA 1ASYA 1NTGA 1PH6A 1G291 1XPRA 3K7UC 3I2ZA 1PH8A 1VQEA 2HIVA 1N36L 4GKJL 4JV5L 2ANRA 4ALPA 3RNUA 1N34L 3KYHC 1I94L 4JI5Q 3PUYA 1CFMA 1PYBA 2A6EC 3P20A 1YI2A 3CXCA 1ZKOA 3U9SA 4O0AA 4AQYL 1O78A 1KRTA 5AJ3L 4A3CG 2PMZE 3H3VI 3HOVG 2GVAA 4KKSA 5ELOA 2HHHL 1Y8OB 2A68D 3LNNA 1KRSA 1L1OC 1H9MA 2F1MA 4BA1I 1CSQA 1O7IA 3A8KE 1QVCA 1OXVA 1KAWA 5M5YH 1IBMQ 2Q2HA 5GADC 5IYDH 2CWAA 1V1QA 2IHEA 3STBC 2CFMA 1C7YA 1XNRQ 3T1YL 1OXUA 5IP7H 4H44C 3H15A 1YJ9A 3U4VA 4EX5A 2YV5A 1ASZA 3KJOA 1VQCA 4H0LC 1SRUA 2Q2IA 2YYZA 3OTOL 4OO1I 1ZZIA 2PQUA 1IBML 1FJGQ 2PY9A 3S1QH 2R6GA 4IFDG 4GN5A 4LF7Q 2MO0A 4JI2Q 2UUCL 1KIXA 4LF8Q 3ULLA 1Y1VH 2DNEA 1M90C 1VIGA 1T5EA 4QMFB 1HJPA 1ZTGA 2UUAQ 4XTCS 1PH5A 2E74C 2K7VA 4PZ6A 2VL6A 5M5WH 2Z6KA 1VQGA 1S40A 1SMXA 4LF7L 1A6XA 4X65L 4BBSH 1CI3M 1X4NA 5IWAL 1L1OB 2VQEL 1CTMA 2A69C 4A3JG 4JBMA 3RLFA 4JBKA 4LWCA 3J81j 5HY6A 1Y8PB 1IBKQ 3M4QA 1K8OA 1XNRL 1P8LA 4P72A 1HZCA 4A3LG 2AXYA 2EJFC 2UXCQ 1H9SB 1DT4A 1GUGA 3GO5A 2AWNA 4JOIA 4OO1H 4H13C 3W1GA 1K9MC 2A8VA 1K1GA 4GLXA 3CF5A 1PMRA 1QUQB 3PF5A 2BA0A 3HOWG 4H02A 4DV7Q 2I5HA 4LFAL 2CW0C 1C9OA 2EVBA 3KLRA 2K4KA 3D31A 3DXJC 1PH1A 3GTGH 2R7ZG 4DV2L 4HIDA 3S14H 3T51B 3J81i 2Z6KC 4DV2Q 3TS2A 4B3RQ 4HJAA 5M3FH 4OWTB 3IKJA 4BY1H 4GOPA 2CTFA 1B7YB 5M5XH 1EYGA 1VQ4A 2E2JH 5GAEC 3MEFA 1WCMG 4KHZA 2RHQB 3IRBA 3AQQA 3W5OA 1J6QA 2WFWA 3RZOH 3A0JA 4K0KQ 2ZTCA 4BXXG 3CRLC 3CCQA 3A8IE 1Z47A 4GLAC 3ERSX 4OWWB 4R4CA 1UE7A 1OTCA 4A3KG 2FXQA 1K0RA 4Y7NH 1XMQL 3HKZE 1HNXQ 1O7LA 4X65Q 3I7FA 1IYVA 1OXXK 2EJGC 5IE8A 2NVXH 2UU9L 4A3MG 4DKAC 4A3GH 5C0XI 3KDFA 5GAGC 2JJQA 2PNHA 2Y0SG 2GN5A 2OCEA 4L5QA 5LMNL 2UUAL 4UY8C 4GKKL 4JI6Q 1X54A 4A3DH 1Q81C 4JI6L 2UXDL 4L5RC 2PPBC 1NY4A 4KLKA 1Y1WH 2K5VA 3VR2A 3PIPA 2IY5B 3HOWH 1Q82C 1JJGA 2JA5G 1L0WA 1XMOQ 4LIJA 1BKBA 2LXJA 1XMQQ 1QZGA 1MIUA 4R1JA 3BU2A 5FLXc 1VQFA 1HNXL 4DR3Q 2BE5D 2JA6H 3HOYH 2DN8A 2XTIA 3G48A 4LFBL 1EUJA 4HIMA 1EWIA 3T1YQ 3SDZA 1HR0W 2VW9A 1KQSA 4B3TQ 1E22A 1Q7YC 5C44G 1RIPA 3UE1A 3GTPH 4K0KL 2ZTDA 1G6PA 4LFCQ 1VF5C 1DCZA 2D0PA 2NZHA 3PGZA 1XPOA 1FYCA 4AH6A 2MJHA 1WOCA 4LF4Q 4NXML 1BBUA 3EQLC 1AE3A 3FPPA 4I7ZC 4UP9A 4DNIA 4GOPB 2QGQA 4AIMA 2ZJQA 1N36Q 1I6VC 1A0IA 4KN4C 1KHIA 1PYSB 5IYBG 1I94Q 1IYUA 2KCTA 1Z7TA 1N34Q 2B63H 2Y0SE 1B9MA 5K36G 5BR8Q 5KNDA 4BA2I 3CC7A 3FMCA 4DR2Q 2R92G 3TS0A 1BDOA 1P16A 2AKWB 3I56A 1QUQA 4L5TA 2L5TA 1DTJA 4DPGA 3HKZG 4YHHL 2WAQE 3NEMA 3CD6A 2D62A 5GAHC 2UXCL 3J80c 4R4OA 4IPHA 4YY3Q 1Z6HA 5FLMH 3NE5B 2YTYA 5LMUQ 4L5SA 3CPFA 1IBKL 2VQEQ 4LF5Q 4G7HC 5IWAQ 1SLJA 2ZM6Q 2DGRA 3V69A 1LTLA 4DK1A 2AUJD 3FP9A 1IW7C 3S1NH 2CTMA 1PV4A 2Q2TA 3VR4A 2ZTEA 3BZCA 2WAQG 4JI0Q 3S2HH 1GUTA 3RN2A 4DR1L 2A68C 1VQ9A 2N78A 3PSIA 3S24A 3RN5A 2QA4A 3AFPA 1PH9A 4LUVA 4BY1G 1NBWA 2KCMA 2XGTA 2DUDA 2PI2A 2PQAB 4A3JH 3IFTA 4BBSG 3HOZH 4DK6C 3S15H 3I55A 5M3MH 1GJXA 2VUMG 3E9HA 3K80C 4DR6L 2K50A 3OOCA 4PV1C 2V4DA 1WFQA 1I6HH 2A6ED 5E7NA 3UE0A 4IPDA 1A62A 2IHFA 1EWHA 4LF5L 3HOUH 3M7NA 4LFCL 5K36H 3A74A 1X56A 4PZ7A 2IX0A 1VQBA 1WYDA 1FVIA 4ME3A 4RG1A 4DV5Q 4A93G 2IX1A 1RL2A 3CP0A 1WVNA 2OPVA 4HIKA 3CCJA 1QZHA 1UEBA 2EXDA 3F1ZA 1CUKA 4LF9Q 2CTJA 3I4LA 3CQZH 4DV4L 4XIGS 1K73C 1YNNC 4G7ZC 3STBD 1HZ9A 1YIJA 1FR3A 3H94A 4KKTA 1QVGA 4YCWA 2F4VQ 1FL0A 1LUZA 4O2DA 2EJMA 1JT8A 4JVHA 4AYBE 1E2VA 3M4YA 4YCUA 1K3RA 4MZ9A 2CTLA 4JI1L 4IO9A 2K52A 3HOVH 4DV6Q 4DV4Q 4DR5Q 2O5IC 2E76C 2HQLA 3KF8B 1EIFA 4LF9L 2IT1A 3PUZA 3AB9A 1H9JA 2MFIA 2F4VL 1L1OA 4GS3A 3CCRA 2JA6G 4POGA 3HFZB 4LUOA 4JI2L 4YWKA 1Y69U 1YZ6A 3DLLA 1E24A 1YNXA 4NXNL 2E5LQ 4RCNA 3VKEA 4P73A 1U5KA 3LGJA 5IP7G 4JI7Q 1HNZL 5LMNW 2QF7A 2R93H 4A3BG 5GQOA 1HCZA 3A8JE 4B3TL 1X3EA 3VR3A 2E2IH 5KNCA 3M3YH 3S1MH 3B6YA 1CKNA 1Q86C 5EAYA 4GZYC 3LWUA 4IJLA 3N6RA 1SROA 3GTKH 5C0XH 4A3CH 1SFOH 3GQBA 4KN7C 2DGYA 1EQQA 3JC66 4C2MH 1YBYA 5DLQE 2UUBQ 2NN6H 1E2WA 1HTPA 1SR3A 3G71A 3ND8A 1A63A 1ZZKA 1VQAA 1VQKA 2UXDQ 4PG3A 3L7ZC 4QQBX 2ZT9C 1M1KC 4IFDJ 1GVPA 4GKKQ 2CTKA 2N49A 2YTVA 3RZDH 4OONA 3A7LA 1Q46A 4WALA 1J4WA 3OW2A 3PO2G 1CSPA 1WCMH 2A19A 4LW1A 3MXNB 4P74A 4JI7L 2VQFQ 3CCEA 3UDXA 3CCLA 2ZM6L 3ICEA 1H9SA 1TXYA 3ZJYC 2UUCQ 1E1TA 3FHWA 1VQIA 1UE6A 4HR7B 1Y8NB 3RR5A 3CPWA 5M3FG 3GD7A 4DUZL 2UXBL 1A8VA 4OWXB 1JMCA 1J5EQ 2JEBI 3HGBA 4JI8L 2KHIA 4R4TA 2V1CC 1I3QH 2KBNA 1EFWA 1B9NA 1NMFA 2JXMB 2R7FA 1NJIC 4JK1C 4IFDH 3K0XA 3KF6B 3TREA 4X66Q 4GN3B 4QJFA 3CCUA 2OWOA 5JJIA 4AM3A 1Q12A 1TKWB 3HKSA 1YJNA 2Q8IB 1K8GA 4LF4L 4B3RL 1XNQL 1D7QA 4WANA 5BN3A 4OGQC 3TQYA 3CC2A 4JI4L 1YJWA 2CKZB 2OTLA 1HZBA 4BY7G 5IYDG 4HIOA 4X64L 1Z9FA 1W3SA 3AYHB 3H0GH 1HR0Q 4JYAL 1GD7A 3D0FA 3Q8DA 4TVAB 3ULJA 4LFBQ 3PUVA 2HIXA 2VZAA 4DR3L 1TWGH 1VQ7A 4NBQA 1VQHA 1MJEA 2D5DA 4B8TA 3NELA 1VDZA 2EDGA 2D0OA 1TU2B 4IFDI 1YEZA 3F2DA 2PQAA 2EIFA 1CKNB 3WWVA 2WP8J 1CKOA 3PIOA 5LMNQ 1AH9A 4DK0A 2OQ0A 1GKHA 3U4ZA 3F2CA 4DUYQ 4DR4Q 4JI0L 3S16H 3M4OH 2JK8A 1EOVA 2UU9Q 2RF4A 3RLOA 3M9BA 4A3IG 1LYLA 4NB3A 5IP9G 4KMUC 1D8LA 4HJ9A 3KFUA 5LMUL 1R9TH 5A35A 2CQOA 2JVZA 3T53B 4A75A 1UE5A 3FKIH 3HOXH 4A93H 4BBRG 4NPSA 1N33L 2R7DA 3W1BA 2L15A 2JQOA 1K8MA 4JI3Q 4QL5A 1DD2A 5ELNA 2QEXA 4JYAQ 4A3LH 3SGIA 1CKMA 1IBLL 5C4XG 2HHHQ 2K33A 4J15A 2I0QA 2K14A 1H95A 4DR2L 3K8AA 2N3SA 3I4OA 4AQYQ 2VNUD 3MFYA 3I73A 2VUMH 4DV0L 1IW7D 1ONLA 1VQDA 1GO3E 4IPGA 3W3AA 1JE5A 3KJPA 4NXMQ 2JZXA 2BA1A 5FJ8H 1PHJA 4A3FH 4TQUS 4LK1C 3VR5A 2ALYB 2YTXA 1K83H 2K75A 4DAYB 4LFAQ 1SE8A 4WJ3M 2CWPA 4DV1Q 2A1AA 4EQ5A 1HPCA 1XTDA 2HT1A 1N33Q 5C3EG 1IZ6A 2KENA 1LABA 2JA8H 3I4MG 2PI2E 3J81c 2H5XA 4KHPL 4APVA 4JI3L 3J80i 3EBEA 4DUZQ 1XPUA 2E2HH 1IXRA 2NN6G 3ULPA 1I50H
chains in the Genus database with same CATH superfamily
4YWMA 4AYBG 3UDFA 1VQ8A 1WTPA 1MKHA 1X3QA 3E9IA 2CWFA 5FOBB 1E2ZA 2F0PA 2QCPX 3GTJH 4UPAA 4JBJA 1MSGA 2IX3A 3MWYW 1N8RC 1VF7A 2MUYA 2R92H 1SNCA 5CV7A 2G9HD 5IYBH 4LF8L 2LKVA 5C4JH 2R93B 3VR6A 1JJCB 2EYOA 1EOTA 2YU9H 1HR0L 3K5OA 3TP7A 4X64Q 5A2QL 3JAMW 2EE1A 5M3MG 4TKOB 5IYCH 3CCVA 3TSSA 4HJ5A 4C3IH 3AEVB 2OEOA 2NVYB 3F2BA 4UP7A 4DV0Q 4JI5L 5NUCA 3K5MA 3DHQA 1SJED 2PNRC 1Y1WG 5CBAE 1GUNA 4X66L 2EY2A 3T16A 1J5EL 1IBLQ 3D3RA 5FJ8G 4B8TA 2AMCB 3PO3B 5JEAH 1UUPA 2ES2A 1JOOA 1I4PA 4BY7B 3VYUA 4HJ7A 1K8AC 1BF4A 2FMCA 3KLWA 3WOEA 4MHEA 4K6LA 2VXWA 2F3VA 2SEBD 3EN2A 4OO1G 1PH3A 1VQ5A 4DR6Q 2B8GA 3UDIA 2EYJA 3HOYB 5J3BA 1A3TA 3VDYA 3J7ZC 4A3IH 3AEVA 5G3LD 3QD7X 4X62L 5IT9L 1JB7A 1PTOC 3KF8A 2RQXA 4XQJA 3BVZA 4RKLA 4DAMA 3PF4A 4FJUA 4B3TH 2A5HA 2XIWA 2VB2X 4HN7A 3GDEA 2QDBA 1G6ZA 1L2FA 3HRZC 5EQ0A 2F52A 1WJJA 4QIWB 4F7XA 4YHHQ 1EY0A 1PRTB 1O7ZA 2LRRA 4DR5L 1SYFA 2WB1E 3Q6SA 2BH8A 3EA6A 3WDNA 1Q90A 3H3VH 2GA4B 3CU7A 1KXLA 1F9QA 2B3GA 5J1ZA 2G8YA 2RA4A 1PTOH 2HH2A 1KC8C 2FMRA 1A2TA 1UWVA 2KECA 4B3ML 4KHPH 1IYJB 1I5FA 1TS4A 2MO1A 4O1NA 4X62H 2YQRA 4A3FG 1KDAA 1MGSA 1X6OA 4B3SL 2JE6I 1QJOA 1F77A 2BL5A 1U0LA 1U4MA 3J7A5 3RZOB 4C3HH 4JCVE 3KUPA 1PFSA 1EC6A 1B70B 3G4SA 2CPQA 5COYA 4Y7NB 4QGUA 1YVCA 5EKKA 3D4RA 4K8IA 2K1BA 4GN4B 1S4ZA 5DM73 1PZID 2K32A 1FGBD 5IIFA 3A56A 1BUVT 4KY6A 1PTOD 5FLXL 1SXTA 4L8JA 3K7AH 5C0XJ 1PFNA 1J5EH 1N32L 1IL2A 3GR5A 3PO2H 3UDGA 1X9NA 3RNUA 3HOVB 2A6EC 3CXCA 1ZKOA 4O0AA 3H3VC 1O78A 3OWFA 1KRTA 1II3A 5FO9B 5KRUA 1ILQA 2PMZE 5ELOA 3VYSA 1H9MA 2F1MA 5C4XG 1CSQA 2EY5A 4JYAH 1OXVA 3PQIA 2CH4A 1ML0D 1XNRQ 2CFMA 4CDCC 3H15A 5IP7H 1LTID 2K05A 3U4VA 1ENFA 2YV5A 3KJOA 1VQCA 4H0LC 4LF4H 1IBML 1FJGQ 3S1QH 4LF7Q 1SMYD 3DWPA 2MO0A 2PYKA 3NTHA 1M90C 1PXUA 4ID6A 5IGDA 4QMFB 1ZTGA 3C46A 3TP5A 4BS9A 4BBSH 1CI3M 5IWAL 3SHLA 4O42A 3M4QA 1X3PA 4P72A 4IZ8A 1HZCA 2EJFC 4E9JA 5C3WA 5C4HA 4OO1H 1Y1WB 1BNZA 3MEHA 3CF5A 1PMRA 3HP3A 3PF5A 4LFAL 2I5HA 3J80W 4U68A 3OHXC 3S14H 2R7ZG 4HIDA 3J81i 4EC5A 5LMUH 1SE2A 3ITPA 1RHPA 2AQ1B 5M3FH 3K59A 1I50B 2E2JH 1CA5A 3MEFA 2NWGA 5IGBA 5ISRA 4PDBA 3IRBA 3A0JA 1JICA 2ZTCA 2OXPA 4BXXG 3A8IE 4OWWB 1OTCA 5DAUA 1K0RA 4I65A 2R3ZA 3MC0B 3KBGA 4C3HG 1IYVA 1OXXK 2SDFA 4A3MG 3KDFA 5GAGC 5IGEA 2JJQA 1XYIA 3Q22A 5IT9W 4L5QA 5LMNL 1LTGD 2ICIA 2G9DA 4JI6L 4HCSA 1NY4A 5ELBA 5C44B 2JA5G 3EFXD 4K2KA 4DXGA 4EQNA 1BKBA 1W6KA 4R1JA 4OX9H 2BE5D 1JQYD 2XTIA 1EWIA 1KDBA 1KQSA 4B3TQ 5C44G 2Y3MA 4K0KL 1G6PA 1VF5C 2F0OA 1CZGA 2NZHA 3PGZA 1XPOA 2K5QA 3R2TA 1PRTC 2MJHA 1HFGA 1WOCA 3HG9A 2NVTB 3C1FA 2F0VA 3FPPA 4GOPB 2ZJQA 1PLFA 1PYSB 4RKBA 2JA8G 2N88A 3HOWG 2JP1A 1N34Q 5BR8Q 5K36G 4DR2Q 2PW5A 4L5TA 3JAML 2JSOA 2D62A 3J80c 4YY3Q 3G6JB 4DR2H 3CPFA 1IBKL 1K28A 1N34H 4LF5Q 4JV5H 4H7BA 4X3SA 1IW7C 2Q2TA 2IW3A 1GUTA 3RN2A 4DR1L 4K14A 1VQ9A 4RGOS 1B4OA 2B39A 2QA4A 2KCMA 2PI2A 2Z4HA 1L0YB 3I55A 2VUMG 3E9HA 4UHVA 4PV1C 2V4DA 5CV5A 1I6HH 1AP0A 5E7NA 3UE0A 5ELEA 1YNND 5HY6A 1IBKQ 2XVSA 4DV7H 1VQBA 4DV5Q 1WVNA 3CP0A 4HIKA 1UEBA 3F1ZA 1CUKA 3CQZH 1VMCA 4G7ZC 5C5LA 1QVGA 1FL0A 4JVHA 3GTLB 1NAPA 3HOVH 1ILPA 2E76C 3AB9A 1H9JA 4OHJA 3C3LA 1L1OA 3CCRA 1XMQH 2JA6G 4POGA 4LFCQ 1YZ6A 4RCNA 3T1YH 1U5KA 3LGJA 1HNZL 2QF7A 2X6GA 1ENCA 5GQOA 1HCZA 4HSVA 4B3TL 4RAUC 2E2IH 3HOWB 5A2QW 3B6YA 2UXBH 4GZYC 4IJLA 5F2DA 4CKEA 4A3CH 4IUNA 4C2MH 1YBYA 2UUBQ 1IL8A 1X32A 1F0XA 1E2WA 2F0IA 2HCCA 5HURA 3ND8A 1ZZKA 1LT5D 1VQAA 4PG3A 4QQBX 1KABA 2CTKA 2N49A 1LV9A 4OONA 3A7LA 1T5XD 4JI7L 2VQFQ 3CCEA 2ZM6L 1H9SA 1TXYA 4R8NA 3FHWA 3RR5A 4AYBB 1EL0A 3X3MA 3DEOA 2UXBL 1JMCA 3MXPA 2EOTA 3HGBA 1QB5D 4R4TA 1FNWA 4K8JA 1I3QH 4RGTA 3IL8A 2B2WC 4ODGA 3RF2A 3GTKB 4JK1C 4A3LG 5JJIA 4QJFA 3CCUA 1TKWB 4G4KA 1N33H 1D7QA 4ZK9B 3NTKA 3TQYA 4WORA 4N9PA 3TP6A 2OTLA 4A3MB 3H0GH 3MFGA 3CQZB 1V1PA 3Q8DA 3OETA 3ULJA 5I2YA 4C56C 3QO2A 2HIXA 4PQXA 4NBQA 2H4OA 2EY1A 1VQHA 4KHVA 4FXDA 2Z6BA 1TU2B 4IFDI 1X0AA 3WWVA 2EIFA 1CKNB 4GKJH 2FMMA 4C3JG 1CKOA 2J7ZA 2UUAH 3S16H 2JK8A 5IGFA 3SK6A 3RLOA 1LYLA 3E5SA 2I07B 4KMUC 4JW0A 5CV6A 4DA2A 5IP9G 3GTGB 1R9TH 3HOXH 1BCPB 4NPSA 3I3CA 1VBIA 2QEXA 3NBIA 1CKMA 1ICFB 3HZXA 3HS0C 2B2YA 4DR2L 3I4OA 3NBHA 3MFYA 3TZDA 5DT9A 1IW7D 1WTQA 1ONLA 1VQDA 1D5ZC 1JE5A 1TWFB 3KJPA 2JZXA 4LF7H 4DV0H 2DY7A 2RDFA 2KUMA 1X9ZA 1KTKA 2CWPA 2B2UA 3RMHA 1HPCA 1WTVA 1XNRH 4C3IB 2PI2E 2L11A 3J80L 3J81L 2Y0SB 3I0PA 2E2HH 4QMGA 2UUCL 3ULPA 1S5BD 3ND9A 1MJCA 2WAQB 4UDUC 5JEAJ 4DAVA 4RFBA 3EIVA 4LF6H 1TS3A 2LY7A 2A6HD 2PW7A 4A3BH 2LFNA 3BZKA 5JJLA 4N8X1 4AQYH 2X06A 1KLGD 4A3JB 1TWHB 3SB1A 3MXUA 4XYQA 1O80A 1TWAB 2F03A 1EQRA 1I4GA 1PRTD 1J8IA 2KCCA 1RJTA 2O5JC 4GNXC 4DV1H 4IPCA 3PV0A 4B3MQ 1SMYC 1NE3A 4A3EG 1VQPA 4RGNA 2JEAI 1XNQQ 3HOYG 1BBWA 3FVQA 5I2XA 1EZ8A 1E7ZA 4ZCKA 2K01A 3HOUG 4GKJQ 4LFCH 3PO3G 2PZTA 2K5HA 1HNWL 3H0GB 4JI8H 1WI5A 4R4QA 4A3GG 2WB1B 3CMAA 2VQFL 1WVLA 1CK1A 1TWHH 2N8NA 4YIJA 1NNXA 4FDBA 1TWFH 3GTQH 5BN4A 2HQEA 3JAMi 1PH2A 3I72A 1GM5A 4FF3A 4X62Q 4KI0A 1AN8A 3CKIB 3HOXG 2WINB 1C4QA 1PTOB 4R4IA 1TVXA 5KYIA 2F3IA 2A6HC 5IP9H 2HH3A 4FXGC 3X3NA 4CKCA 1Y1VG 1YHBA 4C3JH 1ZYRC 3G6EA 4BBSB 1B3QA 1HUMA 1X3FA 3KDFB 4OXPA 4R9WA 1QCBD 5LL6X 1DZ1A 1SNDA 1FNUA 1HNWQ 3OYYA 2F0SA 4P2CB 3ER0A 4JV5Q 1EY8A 3H0GG 1VQNA 1WD1A 4LF6L 1X55A 1HNZH 5M5XB 3DM3A 2F4IA 5A2QE 4FNFA 4LUZA 1LTAD 3J81E 4BXXH 3I4MH 4JOIC 1AE2A 1QWYA 2NUCA 2DNCA 3U50C 3I4NH 4IN3A 4N9TA 2KVMA 1SJHD 2LMCB 4V0BA 1NMGA 4DFAA 1XMOL 4RMFA 2C35B 4XQQA 2ZQEA 1C8CA 4B3RH 2HCIA 4K2LA 1ZZJA 4K5WA 1F2YA 4DR1Q 2JA7H 2MGSA 2Z0SA 1C48A 1Q8IA 5ELCA 5I4DA 4QIWE 2E3UA 2O2LD 1SFOB 2IWHA 2C9OA 1DGSA 1DYQA 2I5LX 3NK9A 2E5LL 4NXNQ 3OW7A 2E75C 5M9OA 1K0SA 2AWOA 2L1BA 4KD3A 4B3SH 4KKUA 2B2VA 2F0FA 5G3LF 1XJVA 4JI1Q 2FJ2A 2OPUA 1G91A 3KK7A 1G291 5CR3A 1VQEA 1PFMA 4X3KA 4GKJL 4JV5L 4ALPA 1N34L 3DEPA 1PYBA 3U9SA 3NXWA 5AJ3L 2DJGC 4A3CG 3HOVG 4N8FA 2HHHL 1Y8OB 3LNNA 3SVMA 1KRSA 3KDGA 4DR5H 1QVCA 4BA1I 1SBBB 5DNFA 3A8KE 2Q8TA 5M5YH 1KAWA 2CWAA 1V1QA 2J0TD 4DF7A 4H44C 2VKCA 5KGUA 1ZZIA 1SRUA 4OO1I 1ESRA 2PY9A 1BXTA 2R6GA 4GN5A 3S1QB 4IFDG 1KIXA 3ULLA 1T5EA 1WTXA 3HKZB 2K7VA 4FO2A 2Z6KA 3K57A 1QILA 1TWCB 1X4NA 4WRDA 2VQEL 1CTMA 3J7AF 4XT1B 4JBMA 3SEBA 4JI3H 2ZM6H 1K8OA 4IUVA 1P8LA 1NR2A 1H9SB 1GUGA 1K1GA 3W1GA 4H13C 4JI6H 2Z9HA 1IKLA 1QUQB 2BA0A 4HEDA 2HDLA 2QKIC 4H02A 5KIXA 2BCOA 1C9OA 3KLRA 2QDLA 3SXHA 3TS2A 2Z6KC 3H09A 3S1NB 3IKJA 4Q0FA 3WOFA 5GAEC 4EQPA 1WCMG 4IURA 4JI5H 3VYTA 3GABA 4A3KG 1XMQL 1HNXQ 1XWEA 5AFWA 3DMUA 1TQOA 5IE8A 1MHWC 3NCVA 2GN5A 2OCEA 3RUZA 3OSSD 3FAUA 4RCOA 3VR2A 3PIPA 3HOWH 4JI4H 1TY0A 1JJGA 1L0XB 1XMOQ 1XNQH 4TSSA 1IBMQ 1XMQQ 1HNXL 1MIUA 3DUZA 3G48A 4LFBL 1EUJA 3S2HB 1PZKD 3GV3A 2JA6B 2O4CA 2ZXRA 1HR0W 1E22A 1Q7YC 1PTOF 1RIPA 3UE1A 5E3FA 3GTPH 1QG7A 2ZTDA 2M8WA 1STGA 3BDCA 1JOQA 4PMCA 5K5PA 4LF4Q 4NXML 1HNXH 5CV4A 3L3OC 4I7ZC 2QGQA 4AIMA 2PZUA 1A0IA 2JYOA 2B63H 1STAA 2NVQB 1EU4A 1D6EC 2CVRA 1I94Q 2Y0SE 1B9MA 3CC7A 3FMCA 1EU3A 3I56A 1QUQA 2L5TA 1ZXTA 2CHBD 5FK9C 4DPGA 2WAQE 3NEMA 4EQOA 1S03G 1IBKH 4R4OA 4KY7A 2YTYA 4ZAIA 4L5SA 1KAAA 4A3IB 5D3IB 2SNMA 2ZM6Q 1AFPA 4BY1B 2AUJD 3FP9A 2CTMA 4DU9A 1PV4A 2ZTEA 4JI0Q 3BZCA 2NTSA 3IFDA 3S2HH 3K0YA 1NBWA 2XGTA 3IFTA 4BBSG 4DK6C 1LTTD 3S15H 5M3MH 1Z2IA 1A62A 2IHFA 3G7LA 4LF5L 3BVGA 4RG1A 2IX0A 4ME3A 4A93G 3SK4A 4CDFC 1S20A 1FNVA 3KDKA 4C2MB 3W2DA 3FEWX 3STBD 1YIJA 3MTSA 1FR3A 3H94A 3S14B 4YCWA 5IT9E 1JT8A 3Q23A 5LMNH 3M4YA 5BR8H 4JI1L 1IKMA 4DR5Q 1G8ZD 1BCPC 3KF8B 1EIFA 4B08A 4LF9L 5D14A 2F0TA 1IHZA 4YWKA 1BO0A 3DLLA 1NXUA 1E24A 1YNXA 2FHTA 1V1PB 4P73A 5IP7G 4JI7Q 5LMNW 5C4JB 2R93H 1SNQA 4NDXA 1X3EA 4R8IA 2VB3X 2M00A 3P75A 3LWUA 2ENBA 3N6RA 1SROA 1JC7A 5C0XH 2DGYA 3JC66 1JR0D 2EPBA 3J80E 5DLQE 2NN6H 3EROA 2HDMA 1HTPA 1A63A 4IFDJ 2ZT9C 1M1KC 4GKKQ 1O7YA 3RZDH 1J4WA 1Q46A 4WALA 3KLSX 3PO2G 1WCMH 3MXNB 2P5ZX 3ICEA 3ZJYC 1SYCA 1VQIA 2B2TA 2X6LA 1Y8NB 4HR7B 4DUZL 1HA6A 2EYLA 4XT3B 1G2SA 3IAYA 3S1MB 1A8VA 4OWXB 1J5EQ 3DWAA 2JEBI 4RHRA 5LL6b 2V1CC 1XRHA 1I3QB 2WV6D 3U9OA 5EPJA 2R7FA 1AZPA 1SSOA 3SR1A 3K0XA 1JE4A 4X66Q 4IFDH 4JI2H 2OWOA 4AM3A 1GXDC 1YJNA 4LF4L 5DEHA 4B3RL 1XNQL 1EY4A 4OGQC 2XRQD 4JI4L 1XMOH 4DR7H 1HZBA 4X64L 1W3SA 4KK7A 4JYAL 2Q8RE 3D0FA 4LFBQ 3V2TA 2N55A 1TWGH 1B3AA 4MIUA 1MJEA 3LX0A 3DWQA 5M5YB 2LTMA 3FDTA 2MHVA 2E2DC 4JVZA 5C4ZA 4CDEC 2OQ0A 1GKHA 3U4ZA 1FJGH 1DONA 3M4OH 1EOVA 1CQVA 2RF4A 3JAME 4A3IG 1N32H 1F2MA 3GKUA 2LTLA 1MSZA 2CQOA 2JVZA 4KTAA 1UE5A 4A93H 2R7DA 4CJ0B 2L15A 1STNA 4JI3Q 4QL5A 1DD2A 5ELNA 4JYAQ 4DN4M 3FKIB 4B9WA 1H95A 1CA6A 1LT3D 1DOLA 3BYTB 4CJ1B 1FD7D 2XSCA 4DUZH 2BA1A 5JOBA 5FJ8H 3S16B 1PHJA 2ALYB 4TQUS 3VR5A 4DAYB 1BOSA 1FKAH 2CTFA 3I4MG 4KHPL 1V1OA 4B3MH 1EEID 4IALA 4DUZQ 2XNAC 5I6YA 4A3EB 3A55A 1D1KA 1I50H 2NZOA 4DXFA 3CW2C 2G5DA 4JPBW 4L6TB 3BG3A 4ULLA 4C1NI 5M3FB 2DY8A 1HNWH 5JEAG 1PH4A 1JWSD 2NVYH 4JVYA 3TRZA 2ANNA 4ILWA 4YWLA 4CKBA 1DT4A 4DUYL 4DR4L 3HOZB 3D6CA 4Q5VA 2B63G 2M2LA 4HTHA 3A7AB 2CH4W 4ZRZA 2I5MX 4P71A 4B3SQ 1I4HA 1UE1A 2B29A 4KHPQ 5IYCG 4IQZA 2K28A 2X69A 5IGGA 4JI1H 1F9SA 4IOCA 3S17H 3Q0AA 4FF4A 5CV8A 1B1ZA 5KNBA 4OX9Q 4JBWA 5AJ3Q 2JA9A 3PIP3 2LSSA 1VIHA 3D4DA 3L0OA 3NBHB 1FGUA 4WJWA 1STEA 4OL7A 1LLRD 4MNOA 3D8GA 3TZUA 4JI8Q 5FLMG 1VCIA 3D4WA 1VQJA 3HOZG 2NVTH 1KLUD 2PZWA 3M85A 3A5UA 4A3KH 1E1OA 4HJ8A 5H1SE 1GUOA 4DV3H 1Q1EA 5C3EH 2AHOB 5EKLA 2ASBA 3V96A 1S5FD 3J81W 1VQLA 2UUBL 2RHSB 4A4IA 4HAEA 3ERQA 2AUKA 1Y14B 2KHJA 4A3EH 3PIO3 3BZDB 3L9AX 2JA5B 1B50A 1YHQA 2PO4A 3KOJA 1HR0H 3M4PA 2QW7A 4DK3C 3PO3H 3T1HL 1TWCH 2B2UC 1SDFA 1EQTA 1RTNA 3LWEA 4BBRH 1KD1C 1CHPD 2WKDA 1KHMA 3VYRA 5FLXW 4LF6Q 4OIKA 2CCZA 4PZ8A 3CRKC 4IOAA 4JC0A 4DV6L 1K83B 2MNAA 1JWUD 4GOPC 3OIQA 4YCVA 1X65A 1N32Q 3S1RH 3J7YW 1SE4A 2M6QA 4DV5L 2DJFC 3QOJA 5TSSA 3T1HH 1UNSA 1V43A 2ID0A 2R61A 1Q8KA 2ATWA 1D2BA 3Q24A 4A3DG 1SN8A 3RLNA 1Q1BA 3RD4A 1AW7A 3I90A 5GROA 4DV4H 4RH6A 1G2TA 2UUBH 5E4XA 3MZ5A 2JA7B 1OXTA 2CTEA 2CWHA 1X4MA 4DV3L 5JJKA 5FKAC 1HNZQ 3QJYA 2D9UA 1SNOA 4PMWA 1E0BA 5LL6S 1DOKA 4YY3L 3F8TA 2QNDA 1OXSC 1PH7A 4JG2A 4DV1L 1EYCA 1JORA 4C1NK 4JI0H 5HGQA 3CCSA 3GP7A 2TSSA 1NTGA 1PH6A 4LAAA 3K7UC 3I2ZA 1XPRA 2HIVA 5C4XB 4FP5D 4NZTM 2ANRA 4JI5Q 3PUYA 1EY7A 1CFMA 2EYMA 3P20A 1CM9A 4AQYL 3H3VI 2GVAA 4KKSA 1WHRA 1L1OC 1HRJA 1AN7A 1C7YA 2AQ3B 1O7IA 3J7AK 2KEEA 5C3XA 2HD3A 5GADC 2F0JA 2IHEA 3STBC 3T1YL 1D1IA 1YJ9A 4EX5A 2NBFA 1ASZA 2Q2IA 2YYZA 2PQUA 4DUYH 4DR4H 1ZYRD 4LF8Q 1EZ6A 1U4LA 3K6OA 2DNEA 5JVH3 2K03A 2IL8A 1SYEA 4PZ6A 2VL6A 1S40A 4LF7L 1L1OB 4C3JB 4A3JG 3QWNA 3C1EA 4JBKA 1Y8PB 3BYYB 4QUFA 2AXYA 3GTQB 1K9MC 2A8VA 1LTBD 1LT4D 1KNAA 2EVBA 2H1EA 3GTGH 1PH1A 4HCEA 5FO7B 2CPMA 5I9OA 3S1RB 2BOSA 3I91A 4OWTB 4BY1H 4GOPA 1VQ4A 3UI2A 2E5LH 1KNEA 3I8ZA 1JB3A 4ZUIA 3W5OA 3AQQA 4K0KQ 5I6WA 3H91A 3RZDB 4GLAC 3ERSX 4R4CA 2AQ2B 3I4NB 2O4XA 2E2IB 3HKZE 4X65Q 3PMFA 2F4VH 2IPKD 2NVXH 4A3GH 2F0DA 2Y0SG 4UY8C 1NSNS 4JI6Q 4A3DH 3GTOB 2NZ1D 1BCPF 5C3EB 1Q81C 5CC4A 2UXDL 4L5RC 4K5XA 4OEMB 4KLKA 2PPBC 2K5VA 3OMCA 1L0WA 1QZGA 1ET6A 1EY6A 3BU2A 2JA6H 3HOYH 3I4MB 3ONAB 2DN8A 3SK5A 4X65H 1PYWD 3SDZA 2VW9A 4OD6A 4X64H 4CHTB 4K0KH 3OWEB 2F0KA 1DCZA 2A74C 5T1IA 5JAVA 4CJ2C 4A3KB 4A3BB 3R93A 1DOMA 3ZYYX 2KQ3A 4OIJA 1AE3A 3EQLC 4UP9A 1N36Q 1I6VC 4KN4C 3NP8A 1IYUA 2KCTA 1BCPD 1Z7TA 2K5DA 4RA8A 5KNDA 4BA2I 3QOLA 3TS0A 1BDOA 2AKWB 4ZKBB 3HKZG 4YHHL 4KV6A 5GAHC 1Z6HA 4NMZA 2I46A 3NE5B 5LMUQ 4PNYA 3NPPA 2VQEQ 5IWAQ 1SLJA 2DGRA 1ESFA 1N36H 4DK1A 3S1NH 2WAQG 2N78A 3S24A 4F87A 3AFPA 1HUNA 4LUVA 3K58A 3R2IA 3HOZH 2A73B 4QUCA 4DR6L 2RSNA 2K50A 1GOZA 3OOCA 4IPDA 1EWHA 4LFCL 4Y52H 4PZ7A 1X56A 5K36H 1WYDA 2OPVA 2IX1A 1RL2A 1QZHA 4RGMA 4LF9Q 4LF9H 2EXDA 1Y1VB 4DV5H 1YNNC 1HZ9A 2HUGA 4KKTA 4J1MA 2F4VQ 4O2DA 2EJMA 5EPLA 1E2VA 4YCUA 1K3RA 4MZ9A 2CTLA 2QEJC 1RF2D 2K52A 1I4XA 2PQEA 2O5IC 1HHVA 2HQLA 2IT1A 3PUZA 1IBMH 4GS3A 3HFZB 4NW2A 4LF5H 4NXNL 2E5LQ 4XDXA 2F0MA 1RTOA 2NVXB 1STYA 3MAQA 3M3YH 5J22A 5KNCA 1CKNA 1Q86C 3GTKH 2D9IA 4KN7C 1EQQA 2L12A 1SYGA 1SR3A 4QB4A 2CW0D 1YNJD 1VQKA 2UXDQ 1GVPA 5CORA 2YTVA 2Z4IA 1CSPA 4LW1A 4CDDC 3CCLA 4KJNA 2UUCQ 1E1TA 2SOBA 5JJZA 3MXNA 3CPWA 3KLSA 5M3FG 4A3FB 4L63B 1SYDA 2L9HA 2KEDA 3KBXA 1CHQD 2KHIA 1EEFD 2KBNA 1EFWA 1B9NA 2RKSA 2JXMB 1NJIC 4KJOA 4NXNH 1B44D 1SNMA 2F0GA 2L55A 1EQVA 4GN3B 2Q8IB 1K8GA 1MD2D 3GTMB 4BY7G 1WCMB 4FYDA 1WTJA 3AYHB 1HR0Q 3F2UA 1GD7A 4LFBH 2VZAA 2C5CA 1VQ7A 1QE6A 4FF1A 2D5DA 1YEZA 2PQAA 2RDGA 3HEJA 2WP8J 4HSPA 1TR5A 5LMNQ 1AH9A 4DK0A 4DR6H 2RSOA 3M9BA 1S5CD 2EYHA 1EIHA 4NB3A 1MBYA 1RDPD 1A3VA 2MPMA 5CGKA 1I6HB 3KFUA 5LMUL 5A35A 3BDLA 4A75A 3FKIH 1N33L 3W1BA 1D5XC 1K8MA 2JQOA 1IBLL 2NYZD 3T13A 2B2WA 2K33A 4J15A 5D65A 2K14A 3TDQA 2EZVA 2VNUD 4AQYQ 5T1GA 3I73A 2VUMH 4LMQD 3W3AA 2RVLA 4QCLA 1HQRD 1WTHA 4A3FH 2YTXA 1K83H 4LFAQ 1SE8A 4WJ3M 2A1AA 4EQ5A 2HT1A 1N33Q 1IZ6A 2KENA 1LABA 4HMIA 3J81c 2H5XA 4JI3L 4M1UB 2R7ZB 1IXRA 2NN6G 5IGCA 3CCMA 1T9HA 5CYUA 1HQMC 4ZUJA 5C0XG 3MHBA 1BQQT 2ZJPA 1C0AA 3CAMA 4E6IA 1W2BA 4X6AH 2RCNA 1J5KA 4DAPA 3TEHB 1A15A 5FLXE 3U58A 3S2DB 2NN6I 1JJ2A 1FJGL 2R93G 3TMEA 2KCNA 2D2CC 3FPUB 4HMJA 3PCOB 1DJRD 3A54A 4UP8A 1S3OA 1SEIA 1EYAA 2Z8LA 1V9PA 3OTOQ 2F0UA 1F2LA 2UXDH 4K6DA 4DNRB 5C44H 3SE0A 5BN5A 5JPNC 4A76A 1LACA 3QR8A 2PCFB 4JI4Q 4DR7L 1D5MC 3BDOA 1E3PA 4WFN3 2JA5H 4EVOA 4FVMA 2PT7G 5HGTA 1WE8A 4DV7L 3P1HA 2E2JB 2XN9C 1PFBA 3I70A 3M7GA 1B53A 4POFA 1DXMA 4NKLA 1PA6A 1V8CA 2MQHA 5EKIA 1YNJC 4NZRM 4A3MH 2ZJRA 1TT2A 3QB3A 1TWAH 3QG1A 3MA2B 1RD9D 2OQKA 2B2YC 1BVSA 3T1HQ 4DAYA 3BJUA 1VQOA 1GHJA 2A69D 5JVG3 1PQXA 3A5ZB 1V8QA 3FKIG 1QNUA 1YITA 1XTCD 3O13A 3U1KA 2VY3A 1H9KA 1M4VA 4B8CD 2EQSA 1EFID 2KA7A 1RODA 2CQAA 2ICEC 2R7ZH 4DNTB 2OTJA 1KL9A 1TS2A 1VS0A 3K81C 5IT9c 1EYDA 5ELFA 1R9TB 3C2PA 4LNQA 4WJ4A 2BE5C 1N9WA 2VS1A 1PRTF 5EBDA 3CC4A 4CGYB 1HH2P 4BBRB 4G57A 5E4WC 5EJWA 3VA7A 2YU9B 4P75A 5CBEE 3L2PA 1EIYB 5BR8L 3CMEA 2F0WA 4QY7A 3JAMc 1GUWA 1LM0A 1QVFA 1MI2A 4DR7Q 5D3DA 5CMDA 2UXBQ 1HZAA 4IUTA 3GTOH 3E0EA 4MTNA 1S5DD 1VQ6A 4OX9L 4GLVB 5CV9A 4GNXB 2K5NA 3GTJB 1F9PA 3QIAA 4XYOA 4EGVA 2LXKA 3PUXA 4G08A 2KJXA 1CQFA 5M5WB 1GHKA 2OF1A 3TN2A 4DV3Q 5C4XH 3S2DH 3GTLH 1PVOA 2WKCA 4BY7H 3E6ZX 1CZWA 5IY0A 2P2RA 5FO8B 3NENA 3PUWA 3BS1A 1S72A 3KF6A 4K5VA 3T56B 2BDOA 1M8AA 2WB1G 2EYFA 3OMGA 2GVBA 3M4OB 1G51A 1EY9A 1IBLH 2JA7G 1I4QA 1YHAA 4V190 3URYA 2NVQH 1H9RA 2E8GA 3OPOA 4IJHA 1TUAA 4U673 1PZJD 3GTMH 2Q2UA 2B8FA 4LJZC 4GNXA 1B8AA 5E1FA 2IJ0A 3K5NA 1VQMA 2BH2A 3I4NG 4A93B 4G7OC 1X3GA 4ZLTF 1GUSA 4LFAH 3AFQA 1J9OA 1ASYA 1PH8A 3NUCA 1N36L 1RKNA 1I6UA 1JCKB 3KYHC 1I94L 2RDHA 3P7JA 4CBVA 2B2VC 1YI2A 5EGTA 2L4NA 4I7AA 2XRSD 2A68D 5IWAH 4DV6H 5IYDH 2Q2HA 5C6AA 4ABNA 1OXUA 2KOLA 3NQIA 3HOUB 4Z9CB 3OTOL 1HXYD 2JA8B 1HA5A 1NCVA 4F88A 4ZYSA 2MP1A 1VIGA 1Y1VH 1HJPA 1UAPA 2UUAQ 4XTCS 1PH5A 2E74C 4ZQ3A 5M5WH 4NP5A 1VQGA 1SMXA 4X65L 1A6XA 2MJ8A 2A69C 1JOKA 3RLFA 4LWCA 3J81j 1CT1D 3FRPB 3SK8A 1XNRL 1OO9B 2XWJB 5KEEA 1ENAA 3T4AC 2UXCQ 1NUCA 3GO5A 2AWNA 4JOIA 2K04A 4GLXA 4A3DB 2K5WA 4DV7Q 2PMZB 4DGZA 2CW0C 1SYBA 2K4KA 3D31A 3DXJC 3NTIA 2ZXPA 4DV2L 3T51B 2OT2A 4DV2Q 5IODA 4B3RQ 4HJAA 1DM0B 2LS01 3K7AB 5DM63 1B7YB 5M5XH 1EYGA 2FPHX 5JPMC 1ET9A 1TIID 4J6HA 1EY5A 2Z1CA 4KHZA 1V9NA 2RHQB 1J6QA 2WFWA 3RZOH 3CRLC 3CCQA 1QOHA 1Z47A 2TMPA 3J7AV 1U4PA 1ODHA 4XQNA 1UE7A 2FXQA 3E3XA 2EXZA 4Y7NH 1WTOA 1O7LA 1R4QB 3I7FA 5I9PA 2UU9L 2EJGC 4DR3H 2K1HA 4DKAC 2VQEH 5C0XI 2PNHA 2UUAL 3OIPA 1UG8A 2NTTA 4GKKL 1X54A 5M3MB 4FXKC 3NSWA 4KY5A 1Y1WH 3S17B 1LT6D 3M3YB 1Q82C 4H8AA 1BBXC 4LIJA 1ICWA 2LXJA 3NHHA 4IUUA 5FLXc 1VQFA 4C3IG 4DR3Q 4KD4A 2ZXOA 2FFKB 3NWSA 4HIMA 3T1YQ 1W6JA 2D0PA 1FYCA 1TS5A 4AH6A 2HHHH 1BBUA 4DNIA 1TY2A 5IYBG 1KHIA 2K6AA 2L0CA 3S15B 2R92G 1P16A 4GKKH 1HTLD 2EY6A 1K3BC 3CD6A 3S9WA 2UXCL 3AU7A 2UU9H 4IPHA 5FLMH 1EWCA 4JI7H 1WTRA 4G7HC 4YHHH 1SAPA 3V69A 2FINB 3H6MA 1LTLA 3GTPB 3MVVA 2WACA 3V05A 2F0NA 1STBA 2F0QA 3VR4A 2QILA 1WTWA 2A68C 3PSIA 4A3GB 3RN5A 4ZKCB 1PH9A 4BY1G 4IUPA 2DUDA 2PQAB 4A3JH 2LF0A 4YY3H 1MSHA 1GJXA 1A2UA 3K80C 2B63B 1KDCA 1BR9A 2F3WA 1WFQA 3DM1A 2A6ED 1S5ED 2XWBB 4M8AA 3HOUH 3M7NA 4JI2Q 3A74A 4X66H 1FVIA 2F0LA 3GV6A 4BWGB 2E2HB 3CCJA 1F2ZA 2CTJA 3I4LA 4DV4L 1K73C 4XIGS 4FJSA 4XXEA 1LUZA 2FFMA 4AYBE 4IO9A 4DV6Q 4DV4Q 3N52A 4F8MA 2F4VL 2MFIA 2RBMA 2VUMB 4LUOA 4JI2L 1Y69U 3VKEA 1VMPA 3VA5A 4LF8H 1HFNA 4UAIA 2NB0A 3EVQA 4A3BG 1ZEQX 3A8JE 3S1MH 3VR3A 1AEXA 5EAYA 1QNKA 5IOCA 4OELB 2B2TC 3R3OA 2F0EA 3AMUA 1SFOH 3GQBA 4MTKA 1SE3A 3PO2B 4DR1H 1I94H 2UXCH 3G71A 2RCFA 5J39A 3L7ZC 2A1SA 4FF2A 3OW2A 3E0JA 2A19A 4P74A 2KHSA 1DTJA 3UDXA 1UE6A 2SNSA 3GD7A 2VQFH 5KYLA 1LTSD 3EZJA 4JI8L 3D6WA 2M9VA 4PMBA 1NMFA 3TREA 3KF6B 3UOEA 4OCHA 1WD0A 1Q12A 3HKSA 4QF4A 1PDQA 4TRDA 1RCVD 4WANA 1JWMD 5BN3A 5C5MA 3CC2A 2EYPA 5EBCA 1YJWA 1Q3LA 2CKZB 1LTRD 4B9XA 5IYDG 4HIOA 1Z9FA 4MN3A 2F0HA 4TVAB 4IUQA 3BVMA 3PUVA 4DR3L 5LHY1 1TWGB 1XXGA 3K5LA 1I4RA 1SNPA 3NELA 1VDZA 2EDGA 1STHA 2BDNA 2D0OA 3TP8A 4C3HB 3F2DA 4RHSA 1U9RA 3PIOA 4DUYQ 3F2CA 1A3UA 3MXGA 4DR4Q 4JI0L 1LO5D 3TBIB 2UU9Q 1AZQA 1SEBD 1XX8A 3OSOA 4RWSC 3CHBD 4HJ9A 1D8LA 5L37A 4DV2H 3T53B 2UUCH 4ME5A 4BBRG 5ELDA 4A3LH 1EIGA 2R92B 1U4RA 3SGIA 3NQTA 4X3UA 3HOXB 1NR4A 2HHHQ 2I0QA 1R4PB 3K8AA 2N3SA 1UEAB 4DV0L 4X3TA 4J8QA 2JN4A 1GO3E 4IPGA 4S3SA 4NXMQ 1B2TA 4LK1C 3NWTA 2K75A 2WIIB 5EPKA 3R8BA 4DV1Q 2J4XA 3EJIA 1XTDA 2IY5B 5C3EG 2JA8H 1F9RA 4APVA 3J80i 3EBEA 4NXMH 1XPUA 3OTOH
chains in the Genus database with same CATH topology
4YWMA 4AYBG 3UDFA 1VQ8A 1WTPA 1X3QA 1MKHA 3E9IA 5FOBB 1E2ZA 2F0PA 2QCPX 3GTJH 4UPAA 4JBJA 1MSGA 2IX3A 3MWYW 1N8RC 1VF7A 2MUYA 2R92H 1SNCA 5CV7A 2G9HD 5IYBH 4LF8L 2LKVA 2R93B 5C4JH 3VR6A 2EYOA 1JJCB 1EOTA 2YU9H 1HR0L 3K5OA 3TP7A 4X64Q 5A2QL 2EE1A 5M3MG 4TKOB 5IYCH 3CCVA 3TSSA 4HJ5A 4C3IH 3AEVB 2OEOA 2NVYB 3F2BA 4UP7A 4DV0Q 4JI5L 5NUCA 3K5MA 3DHQA 1SJED 2PNRC 1Y1WG 5CBAE 1GUNA 4X66L 2EY2A 3T16A 1J5EL 1IBLQ 3D3RA 5FJ8G 4B8TA 2AMCB 3PO3B 5JEAH 1UUPA 2ES2A 1JOOA 1I4PA 4BY7B 3VYUA 1BF4A 4HJ7A 1K8AC 2FMCA 3KLWA 3WOEA 4MHEA 4K6LA 2VXWA 2F3VA 2SEBD 4OO1G 3EN2A 1PH3A 1VQ5A 4DR6Q 2B8GA 3UDIA 2EYJA 3HOYB 5J3BA 1A3TA 3VDYA 3J7ZC 4A3IH 3AEVA 5G3LD 4X62L 5IT9L 1JB7A 1PTOC 3KF8A 2RQXA 4XQJA 3BVZA 4RKLA 4DAMA 3PF4A 2A5HA 2XIWA 2VB2X 4HN7A 1G6ZA 2QDBA 3GDEA 1L2FA 3HRZC 5EQ0A 2F52A 1WJJA 4QIWB 4F7XA 4YHHQ 1EY0A 1PRTB 1O7ZA 4DR5L 1SYFA 2WB1E 3Q6SA 3EA6A 3WDNA 2BH8A 1Q90A 3H3VH 2GA4B 3CU7A 1KXLA 1F9QA 2B3GA 5J1ZA 2RA4A 1PTOH 2HH2A 1KC8C 2FMRA 1A2TA 2KECA 1UWVA 4B3ML 1IYJB 1I5FA 1TS4A 4O1NA 2MO1A 2YQRA 4A3FG 1KDAA 1MGSA 1X6OA 4B3SL 2JE6I 1QJOA 1F77A 2BL5A 1U0LA 1U4MA 3RZOB 3J7A5 4C3HH 4JCVE 3KUPA 1PFSA 1EC6A 1B70B 3G4SA 2CPQA 5COYA 4Y7NB 4QGUA 1YVCA 5EKKA 3D4RA 4K8IA 2K1BA 5DM73 1S4ZA 4GN4B 1PZID 2K32A 1FGBD 5IIFA 3A56A 1BUVT 4KY6A 1PTOD 5FLXL 1SXTA 4L8JA 3K7AH 5C0XJ 1PFNA 1N32L 1IL2A 3PO2H 3UDGA 1X9NA 3RNUA 3HOVB 2A6EC 3CXCA 1ZKOA 3H3VC 4O0AA 1O78A 3OWFA 5FO9B 1II3A 5KRUA 1KRTA 1ILQA 2PMZE 5ELOA 3VYSA 1H9MA 2F1MA 5C4XG 1CSQA 2EY5A 1OXVA 1ML0D 1XNRQ 2CFMA 3H15A 5IP7H 1LTID 2K05A 3U4VA 1ENFA 2YV5A 3KJOA 1VQCA 4H0LC 1IBML 1FJGQ 3S1QH 4LF7Q 1SMYD 3DWPA 2PYKA 3NTHA 2MO0A 1M90C 1PXUA 4ID6A 5IGDA 4QMFB 1ZTGA 3C46A 3TP5A 4BS9A 4BBSH 1CI3M 5IWAL 3SHLA 4O42A 3M4QA 1X3PA 4P72A 4IZ8A 1HZCA 2EJFC 5C3WA 5C4HA 4OO1H 1Y1WB 1BNZA 3MEHA 3CF5A 1PMRA 3HP3A 3PF5A 4LFAL 2I5HA 4U68A 3OHXC 3S14H 2R7ZG 4HIDA 3J81i 1SE2A 3ITPA 1RHPA 2AQ1B 5M3FH 3K59A 1I50B 2E2JH 1CA5A 3MEFA 2NWGA 5IGBA 5ISRA 3IRBA 3A0JA 1JICA 2ZTCA 2OXPA 4BXXG 3A8IE 4OWWB 1OTCA 5DAUA 1K0RA 4I65A 2R3ZA 3MC0B 3KBGA 4C3HG 1IYVA 1OXXK 2SDFA 4A3MG 3KDFA 5IGEA 5GAGC 2JJQA 1XYIA 3Q22A 4L5QA 5LMNL 1LTGD 2ICIA 2G9DA 4JI6L 4HCSA 1NY4A 5ELBA 5C44B 2JA5G 3EFXD 4K2KA 4DXGA 4EQNA 1BKBA 1W6KA 4R1JA 2BE5D 1JQYD 2XTIA 1EWIA 1KDBA 1KQSA 4B3TQ 5C44G 4K0KL 1G6PA 1VF5C 2F0OA 1CZGA 2NZHA 3PGZA 1XPOA 2K5QA 3R2TA 1PRTC 2MJHA 1HFGA 1WOCA 3HG9A 2NVTB 3C1FA 2F0VA 3FPPA 4GOPB 2ZJQA 1PLFA 1PYSB 4RKBA 2JA8G 2N88A 3HOWG 2JP1A 1N34Q 5BR8Q 5K36G 4DR2Q 2PW5A 4L5TA 3JAML 2JSOA 2D62A 3J80c 4YY3Q 3G6JB 3CPFA 1IBKL 4LF5Q 4H7BA 4X3SA 1IW7C 2Q2TA 2IW3A 1GUTA 3RN2A 4DR1L 4K14A 1VQ9A 4RGOS 1B4OA 2B39A 2QA4A 2KCMA 2Z4HA 2PI2A 1L0YB 3I55A 2VUMG 3E9HA 4PV1C 2V4DA 5CV5A 1AP0A 1I6HH 5E7NA 3UE0A 5ELEA 1YNND 5HY6A 1IBKQ 2XVSA 1VQBA 4DV5Q 1WVNA 3CP0A 4HIKA 1UEBA 3F1ZA 1CUKA 3CQZH 1VMCA 4G7ZC 5C5LA 1QVGA 1FL0A 4JVHA 3GTLB 1NAPA 3HOVH 1ILPA 2E76C 3AB9A 1H9JA 4OHJA 3C3LA 1L1OA 3CCRA 2JA6G 4POGA 4LFCQ 1YZ6A 4RCNA 1U5KA 3LGJA 1HNZL 2QF7A 2X6GA 1ENCA 5GQOA 1HCZA 4HSVA 4B3TL 4RAUC 3HOWB 2E2IH 3B6YA 4GZYC 4IJLA 5F2DA 4CKEA 4A3CH 4IUNA 4C2MH 1YBYA 2UUBQ 1IL8A 1X32A 1E2WA 2F0IA 2HCCA 5HURA 3ND8A 1ZZKA 1LT5D 1VQAA 4PG3A 4QQBX 1KABA 2CTKA 2N49A 1LV9A 4OONA 3A7LA 1T5XD 4JI7L 2VQFQ 3CCEA 2ZM6L 1H9SA 1TXYA 4R8NA 3FHWA 3RR5A 4AYBB 1EL0A 3X3MA 3DEOA 2UXBL 1JMCA 3MXPA 2EOTA 3HGBA 1QB5D 4R4TA 1FNWA 4K8JA 4RGTA 1I3QH 2B2WC 3IL8A 4ODGA 3GTKB 4JK1C 4A3LG 5JJIA 4QJFA 3CCUA 1TKWB 4G4KA 1D7QA 4ZK9B 3NTKA 3TQYA 4WORA 4N9PA 3TP6A 2OTLA 4A3MB 3MFGA 3H0GH 3CQZB 1V1PA 3Q8DA 3ULJA 5I2YA 4C56C 3QO2A 2HIXA 4PQXA 4NBQA 2H4OA 2EY1A 1VQHA 4KHVA 4FXDA 4IFDI 1TU2B 3WWVA 2EIFA 1CKNB 2FMMA 4C3JG 1CKOA 2J7ZA 3S16H 2JK8A 5IGFA 3SK6A 3RLOA 1LYLA 3E5SA 2I07B 4KMUC 5CV6A 4DA2A 5IP9G 3GTGB 1R9TH 3HOXH 1BCPB 4NPSA 3I3CA 2QEXA 3NBIA 1CKMA 3HZXA 3HS0C 2B2YA 4DR2L 3I4OA 3NBHA 3MFYA 3TZDA 1IW7D 1WTQA 1ONLA 1VQDA 1D5ZC 1JE5A 1TWFB 3KJPA 2JZXA 2DY7A 2RDFA 2KUMA 1KTKA 3RMHA 2B2UA 2CWPA 1HPCA 1WTVA 4C3IB 2PI2E 2L11A 3J80L 3J81L 2Y0SB 2E2HH 4QMGA 2UUCL 3ULPA 1S5BD 3ND9A 1MJCA 2WAQB 4UDUC 5JEAJ 4DAVA 4RFBA 3EIVA 1TS3A 2LY7A 2A6HD 2PW7A 4A3BH 2LFNA 3BZKA 5JJLA 1KLGD 4A3JB 1TWHB 3MXUA 4XYQA 1O80A 1TWAB 2F03A 1I4GA 1EQRA 1PRTD 1J8IA 2KCCA 1RJTA 2O5JC 4GNXC 4IPCA 3PV0A 4B3MQ 1SMYC 1NE3A 4A3EG 1VQPA 4RGNA 2JEAI 1XNQQ 3HOYG 1BBWA 3FVQA 5I2XA 1EZ8A 1E7ZA 2K01A 3HOUG 4GKJQ 3PO3G 2PZTA 2K5HA 1HNWL 3H0GB 1WI5A 4R4QA 4A3GG 2WB1B 1WVLA 3CMAA 2VQFL 1CK1A 1TWHH 2N8NA 4YIJA 4FDBA 1TWFH 3GTQH 5BN4A 2HQEA 3JAMi 1PH2A 3I72A 1GM5A 4FF3A 4X62Q 4KI0A 1AN8A 3CKIB 3HOXG 2WINB 1C4QA 1PTOB 5KYIA 1TVXA 4R4IA 2F3IA 2A6HC 5IP9H 2HH3A 4FXGC 3X3NA 4CKCA 1Y1VG 1YHBA 4C3JH 1ZYRC 3G6EA 4BBSB 1HUMA 1X3FA 3KDFB 4OXPA 4R9WA 1QCBD 5LL6X 1DZ1A 1SNDA 1FNUA 1HNWQ 3OYYA 2F0SA 4P2CB 3ER0A 4JV5Q 1EY8A 3H0GG 1VQNA 1WD1A 4LF6L 1X55A 5M5XB 3DM3A 2F4IA 5A2QE 4FNFA 3J81E 1LTAD 4LUZA 4BXXH 3I4MH 4JOIC 1AE2A 1QWYA 2NUCA 2DNCA 3U50C 3I4NH 4IN3A 4N9TA 2KVMA 1SJHD 2LMCB 4V0BA 4DFAA 1NMGA 1XMOL 4RMFA 2C35B 4XQQA 1C8CA 2HCIA 4K2LA 1ZZJA 4K5WA 1F2YA 4DR1Q 2JA7H 2MGSA 2Z0SA 1C48A 1Q8IA 5ELCA 5I4DA 4QIWE 2E3UA 2O2LD 1SFOB 2IWHA 2C9OA 1DGSA 1DYQA 2I5LX 3NK9A 2E5LL 4NXNQ 3OW7A 2E75C 5M9OA 2AWOA 2L1BA 4KD3A 4KKUA 2B2VA 2F0FA 5G3LF 1XJVA 4JI1Q 2FJ2A 2OPUA 1G91A 3KK7A 1G291 5CR3A 1VQEA 1PFMA 4X3KA 4GKJL 4JV5L 4ALPA 1N34L 3DEPA 1PYBA 3U9SA 3NXWA 5AJ3L 4A3CG 3HOVG 2HHHL 1Y8OB 3LNNA 3SVMA 1KRSA 1QVCA 4BA1I 1SBBB 5DNFA 3A8KE 2Q8TA 5M5YH 1KAWA 2CWAA 1V1QA 2J0TD 4DF7A 4H44C 5KGUA 1ZZIA 1SRUA 4OO1I 1ESRA 2PY9A 1BXTA 2R6GA 3S1QB 4IFDG 4GN5A 1KIXA 3ULLA 1T5EA 1WTXA 3HKZB 2K7VA 4FO2A 2Z6KA 3K57A 1QILA 1TWCB 1X4NA 4WRDA 2VQEL 1CTMA 3J7AF 4XT1B 4JBMA 3SEBA 1K8OA 4IUVA 1P8LA 1NR2A 1H9SB 1GUGA 1K1GA 3W1GA 4H13C 1IKLA 2QKIC 2BA0A 4HEDA 2HDLA 5KIXA 1QUQB 4H02A 2BCOA 1C9OA 3KLRA 3SXHA 3TS2A 2Z6KC 3H09A 3S1NB 3IKJA 4Q0FA 3WOFA 5GAEC 4EQPA 1WCMG 4IURA 3VYTA 4A3KG 1XMQL 1HNXQ 5AFWA 1XWEA 3DMUA 1TQOA 5IE8A 2GN5A 3RUZA 2OCEA 4RCOA 3VR2A 3PIPA 3HOWH 1TY0A 1JJGA 1L0XB 1XMOQ 4TSSA 1IBMQ 1XMQQ 1HNXL 1MIUA 3DUZA 3G48A 4LFBL 3S2HB 1EUJA 1PZKD 3GV3A 2JA6B 2ZXRA 1HR0W 1E22A 1Q7YC 1PTOF 1RIPA 3UE1A 5E3FA 3GTPH 1QG7A 2ZTDA 1STGA 3BDCA 1JOQA 4PMCA 5K5PA 4LF4Q 4NXML 5CV4A 3L3OC 4I7ZC 2QGQA 4AIMA 2PZUA 2NVQB 2JYOA 1A0IA 1STAA 2B63H 1EU4A 1D6EC 2CVRA 1I94Q 2Y0SE 1B9MA 3CC7A 3FMCA 1EU3A 3I56A 1QUQA 2L5TA 1ZXTA 2CHBD 5FK9C 4DPGA 2WAQE 3NEMA 4EQOA 4R4OA 4KY7A 2YTYA 4ZAIA 4L5SA 1KAAA 4A3IB 5D3IB 2SNMA 1AFPA 2ZM6Q 4BY1B 2AUJD 3FP9A 2CTMA 4DU9A 1PV4A 2ZTEA 4JI0Q 3BZCA 2NTSA 3IFDA 3S2HH 3K0YA 1NBWA 2XGTA 3IFTA 4BBSG 4DK6C 1LTTD 3S15H 5M3MH 1A62A 3G7LA 2IHFA 4LF5L 3BVGA 4RG1A 2IX0A 4ME3A 4A93G 3SK4A 1FNVA 4C2MB 3W2DA 3FEWX 3STBD 1YIJA 3MTSA 1FR3A 3H94A 3S14B 4YCWA 5IT9E 1JT8A 3Q23A 3M4YA 4JI1L 1IKMA 4DR5Q 1G8ZD 1BCPC 3KF8B 1EIFA 4B08A 4LF9L 5D14A 2F0TA 1IHZA 4YWKA 1BO0A 3DLLA 1E24A 2FHTA 1YNXA 1V1PB 4P73A 5IP7G 4JI7Q 5LMNW 5C4JB 2R93H 1SNQA 4NDXA 1X3EA 4R8IA 2VB3X 2M00A 3P75A 3LWUA 2ENBA 3N6RA 1SROA 1JC7A 5C0XH 2DGYA 3JC66 1JR0D 2EPBA 3J80E 5DLQE 2NN6H 3EROA 2HDMA 1HTPA 1A63A 4IFDJ 2ZT9C 1M1KC 4GKKQ 1O7YA 3RZDH 1J4WA 1Q46A 4WALA 3KLSX 3PO2G 1WCMH 3MXNB 3ICEA 3ZJYC 1SYCA 1VQIA 2B2TA 2X6LA 1Y8NB 4HR7B 1HA6A 4DUZL 2EYLA 4XT3B 1G2SA 3IAYA 3S1MB 1A8VA 4OWXB 1J5EQ 3DWAA 2JEBI 4RHRA 2V1CC 1I3QB 2WV6D 3U9OA 5EPJA 1AZPA 2R7FA 1SSOA 3SR1A 4IFDH 1JE4A 3K0XA 4X66Q 4AM3A 2OWOA 1GXDC 1YJNA 4LF4L 5DEHA 4B3RL 1XNQL 1EY4A 4OGQC 2XRQD 4JI4L 1HZBA 4X64L 1W3SA 4KK7A 4JYAL 2Q8RE 3D0FA 4LFBQ 3V2TA 2N55A 1TWGH 1B3AA 4MIUA 1MJEA 3LX0A 3DWQA 5M5YB 3FDTA 2MHVA 2E2DC 5C4ZA 2OQ0A 1GKHA 3U4ZA 1DONA 3M4OH 1EOVA 1CQVA 3JAME 2RF4A 4A3IG 1F2MA 2CQOA 2JVZA 4KTAA 1UE5A 4A93H 4CJ0B 2R7DA 2L15A 1STNA 4JI3Q 4QL5A 1DD2A 5ELNA 4JYAQ 4DN4M 4B9WA 3FKIB 1H95A 1CA6A 1LT3D 1DOLA 3BYTB 4CJ1B 1FD7D 2XSCA 2BA1A 5JOBA 3S16B 5FJ8H 1PHJA 4TQUS 3VR5A 2ALYB 4DAYB 1BOSA 2CTFA 3I4MG 4KHPL 1V1OA 1EEID 4IALA 4DUZQ 2XNAC 5I6YA 4A3EB 3A55A 1D1KA 1I50H 4DXFA 2NZOA 3CW2C 4C1NI 4L6TB 3BG3A 4ULLA 5M3FB 2DY8A 5JEAG 1PH4A 1JWSD 2NVYH 4JVYA 3TRZA 2ANNA 4ILWA 4YWLA 4CKBA 1DT4A 4DUYL 4DR4L 3HOZB 3D6CA 4Q5VA 2B63G 2M2LA 4HTHA 3A7AB 4ZRZA 2I5MX 4P71A 4B3SQ 1I4HA 1UE1A 2B29A 4KHPQ 5IYCG 4IQZA 2K28A 2X69A 5IGGA 1F9SA 4IOCA 3S17H 3Q0AA 4FF4A 5CV8A 1B1ZA 5KNBA 4OX9Q 4JBWA 5AJ3Q 2JA9A 3PIP3 2LSSA 1VIHA 3D4DA 3L0OA 3NBHB 4WJWA 1FGUA 1STEA 4OL7A 1LLRD 4MNOA 3D8GA 3TZUA 4JI8Q 5FLMG 1VCIA 3D4WA 1VQJA 3HOZG 2NVTH 1KLUD 2PZWA 3M85A 3A5UA 4A3KH 1E1OA 4HJ8A 5H1SE 1GUOA 1Q1EA 5C3EH 2AHOB 5EKLA 2ASBA 3V96A 1S5FD 1VQLA 2UUBL 2RHSB 4A4IA 4HAEA 3ERQA 2AUKA 1Y14B 2KHJA 4A3EH 3PIO3 3BZDB 3L9AX 2JA5B 1B50A 1YHQA 2PO4A 3KOJA 3M4PA 3PO3H 4DK3C 3T1HL 1TWCH 2B2UC 1SDFA 1EQTA 1RTNA 3LWEA 4BBRH 1KD1C 1CHPD 2WKDA 1KHMA 3VYRA 4LF6Q 4OIKA 2CCZA 4PZ8A 3CRKC 4IOAA 4JC0A 4DV6L 1K83B 2MNAA 1JWUD 4GOPC 3OIQA 4YCVA 1X65A 1N32Q 3S1RH 3J7YW 1SE4A 4DV5L 3QOJA 5TSSA 1UNSA 1V43A 2ID0A 2R61A 1Q8KA 2ATWA 1D2BA 3Q24A 4A3DG 1SN8A 3RLNA 1Q1BA 3RD4A 1AW7A 3I90A 5GROA 4RH6A 1G2TA 5E4XA 3MZ5A 2JA7B 1OXTA 2CTEA 1X4MA 4DV3L 5JJKA 5FKAC 1HNZQ 3QJYA 2D9UA 1SNOA 4PMWA 1E0BA 5LL6S 1DOKA 4YY3L 3F8TA 2QNDA 1OXSC 1PH7A 4JG2A 1JORA 1EYCA 4DV1L 4C1NK 5HGQA 3CCSA 3GP7A 2TSSA 1NTGA 1PH6A 4LAAA 3K7UC 3I2ZA 1XPRA 2HIVA 5C4XB 4FP5D 2ANRA 4JI5Q 3PUYA 1EY7A 1CFMA 2EYMA 3P20A 1CM9A 4AQYL 3H3VI 2GVAA 4KKSA 1HRJA 1L1OC 1C7YA 2AQ3B 1O7IA 2KEEA 5C3XA 5GADC 2F0JA 2IHEA 3STBC 3T1YL 1D1IA 1YJ9A 4EX5A 2NBFA 1ASZA 2Q2IA 2YYZA 2PQUA 1ZYRD 4LF8Q 1EZ6A 1U4LA 3K6OA 2DNEA 5JVH3 2K03A 2IL8A 1SYEA 4PZ6A 2VL6A 1S40A 4LF7L 1L1OB 4C3JB 4A3JG 3QWNA 3C1EA 4JBKA 1Y8PB 3BYYB 4QUFA 2AXYA 3GTQB 1K9MC 2A8VA 1LTBD 1LT4D 1KNAA 2EVBA 2H1EA 3GTGH 1PH1A 4HCEA 5FO7B 5I9OA 3S1RB 2BOSA 3I91A 4OWTB 4BY1H 4GOPA 1VQ4A 3UI2A 1KNEA 3I8ZA 1JB3A 4ZUIA 3W5OA 3AQQA 4K0KQ 5I6WA 3H91A 3RZDB 4GLAC 3ERSX 4R4CA 2AQ2B 3I4NB 2O4XA 2E2IB 3HKZE 4X65Q 3PMFA 2IPKD 2NVXH 4A3GH 2F0DA 2Y0SG 4UY8C 1NSNS 4JI6Q 4A3DH 3GTOB 2NZ1D 1BCPF 5C3EB 1Q81C 5CC4A 2UXDL 4L5RC 4K5XA 2PPBC 4KLKA 2K5VA 3OMCA 1L0WA 1QZGA 1ET6A 1EY6A 3BU2A 2JA6H 3I4MB 3HOYH 3ONAB 2DN8A 3SK5A 1PYWD 3SDZA 2VW9A 4CHTB 3OWEB 2F0KA 1DCZA 2A74C 5T1IA 5JAVA 4A3KB 4CJ2C 4A3BB 3R93A 1DOMA 3ZYYX 2KQ3A 4OIJA 3EQLC 1AE3A 4UP9A 1N36Q 1I6VC 4KN4C 3NP8A 1IYUA 2KCTA 1BCPD 1Z7TA 2K5DA 4RA8A 5KNDA 4BA2I 3QOLA 3TS0A 1BDOA 2AKWB 4ZKBB 3HKZG 4YHHL 4KV6A 5GAHC 1Z6HA 4NMZA 2I46A 3NE5B 5LMUQ 4PNYA 3NPPA 2VQEQ 5IWAQ 1SLJA 2DGRA 1ESFA 4DK1A 3S1NH 2WAQG 2N78A 4F87A 3S24A 3AFPA 1HUNA 4LUVA 3K58A 3R2IA 3HOZH 2A73B 4QUCA 4DR6L 2RSNA 2K50A 1GOZA 3OOCA 4IPDA 1EWHA 4LFCL 5K36H 4PZ7A 1X56A 4Y52H 1WYDA 2OPVA 2IX1A 1RL2A 1QZHA 4RGMA 4LF9Q 2EXDA 1Y1VB 1YNNC 1HZ9A 2HUGA 4KKTA 4J1MA 2F4VQ 4O2DA 2EJMA 5EPLA 1E2VA 4YCUA 1K3RA 4MZ9A 2CTLA 2QEJC 1RF2D 2K52A 1I4XA 2PQEA 2O5IC 1HHVA 2HQLA 2IT1A 3PUZA 4GS3A 3HFZB 4NW2A 4NXNL 2E5LQ 4XDXA 2F0MA 1RTOA 2NVXB 1STYA 3MAQA 3M3YH 5J22A 5KNCA 1CKNA 1Q86C 3GTKH 4KN7C 1EQQA 2L12A 1SYGA 1SR3A 4QB4A 2CW0D 1YNJD 1VQKA 2UXDQ 1GVPA 5CORA 2YTVA 2Z4IA 1CSPA 4LW1A 3CCLA 4KJNA 2UUCQ 1E1TA 2SOBA 5JJZA 3MXNA 3CPWA 3KLSA 5M3FG 4A3FB 4L63B 1SYDA 2L9HA 2KEDA 3KBXA 1CHQD 2KHIA 1EEFD 2KBNA 1EFWA 1B9NA 2RKSA 2JXMB 1NJIC 4KJOA 1B44D 1SNMA 2F0GA 2L55A 1EQVA 4GN3B 2Q8IB 1K8GA 1MD2D 3GTMB 4BY7G 1WCMB 4FYDA 3AYHB 1HR0Q 3F2UA 1GD7A 2VZAA 2C5CA 1VQ7A 1QE6A 4FF1A 2D5DA 1YEZA 2PQAA 2RDGA 3HEJA 2WP8J 4HSPA 1TR5A 5LMNQ 1AH9A 4DK0A 2RSOA 3M9BA 1S5CD 2EYHA 1EIHA 4NB3A 1MBYA 1RDPD 1A3VA 2MPMA 5CGKA 1I6HB 3KFUA 5LMUL 5A35A 3BDLA 4A75A 3FKIH 1N33L 3W1BA 1D5XC 1K8MA 2JQOA 1IBLL 2NYZD 3T13A 2B2WA 2K33A 5D65A 3TDQA 2EZVA 2K14A 4J15A 2VNUD 4AQYQ 5T1GA 3I73A 2VUMH 4LMQD 3W3AA 2RVLA 4QCLA 1HQRD 4A3FH 2YTXA 1K83H 4LFAQ 1SE8A 4WJ3M 2A1AA 4EQ5A 2HT1A 1N33Q 1IZ6A 4HMIA 1LABA 2KENA 3J81c 2H5XA 4JI3L 4M1UB 2R7ZB 1IXRA 2NN6G 5IGCA 3CCMA 1T9HA 5CYUA 1HQMC 4ZUJA 5C0XG 3MHBA 1BQQT 2ZJPA 1C0AA 4E6IA 3CAMA 1W2BA 4X6AH 2RCNA 1J5KA 4DAPA 3TEHB 1A15A 5FLXE 3U58A 3S2DB 2NN6I 1JJ2A 1FJGL 2R93G 3TMEA 2KCNA 2D2CC 3FPUB 4HMJA 3PCOB 1DJRD 3A54A 4UP8A 1S3OA 1EYAA 2Z8LA 1V9PA 3OTOQ 2F0UA 1F2LA 4K6DA 4DNRB 5C44H 3SE0A 5BN5A 5JPNC 4A76A 1LACA 4DR7L 2PCFB 4JI4Q 1D5MC 3BDOA 1E3PA 4WFN3 2JA5H 4EVOA 4FVMA 5HGTA 1WE8A 4DV7L 3P1HA 2E2JB 2XN9C 1PFBA 3I70A 3M7GA 1B53A 4POFA 1DXMA 4NKLA 1PA6A 2MQHA 5EKIA 1YNJC 4A3MH 2ZJRA 1TT2A 3QB3A 1TWAH 3QG1A 3MA2B 1RD9D 2OQKA 2B2YC 1BVSA 3T1HQ 4DAYA 3BJUA 1VQOA 1GHJA 2A69D 5JVG3 3A5ZB 1V8QA 3FKIG 1QNUA 1YITA 1XTCD 3O13A 3U1KA 2VY3A 1H9KA 1M4VA 2EQSA 1EFID 2KA7A 1RODA 2CQAA 2ICEC 2R7ZH 4DNTB 2OTJA 1KL9A 1TS2A 1VS0A 3K81C 1R9TB 1EYDA 5ELFA 5IT9c 3C2PA 4LNQA 4WJ4A 2BE5C 1N9WA 2VS1A 1PRTF 5EBDA 3CC4A 4CGYB 4BBRB 1HH2P 4G57A 5E4WC 5EJWA 3VA7A 2YU9B 4P75A 5CBEE 3L2PA 1EIYB 5BR8L 3CMEA 2F0WA 4QY7A 3JAMc 1GUWA 1LM0A 1QVFA 1MI2A 4DR7Q 5D3DA 5CMDA 2UXBQ 4IUTA 1HZAA 3GTOH 3E0EA 4MTNA 1S5DD 1VQ6A 4OX9L 5CV9A 3GTJB 4GLVB 2K5NA 4GNXB 1F9PA 3QIAA 4XYOA 4EGVA 2LXKA 3PUXA 2KJXA 1CQFA 5M5WB 1GHKA 2OF1A 3TN2A 4DV3Q 5C4XH 3S2DH 3GTLH 1PVOA 2WKCA 4BY7H 3E6ZX 1CZWA 5IY0A 2P2RA 5FO8B 3PUWA 3NENA 3BS1A 1S72A 3KF6A 4K5VA 3T56B 2BDOA 1M8AA 2WB1G 2EYFA 3OMGA 2GVBA 3M4OB 1G51A 1EY9A 2JA7G 1I4QA 1YHAA 4V190 3URYA 2NVQH 1H9RA 3OPOA 2E8GA 4IJHA 1TUAA 4U673 1PZJD 3GTMH 2Q2UA 2B8FA 4LJZC 4GNXA 1B8AA 5E1FA 2IJ0A 3K5NA 1VQMA 2BH2A 3I4NG 4A93B 4G7OC 1X3GA 4ZLTF 1GUSA 3AFQA 1J9OA 1ASYA 1PH8A 3NUCA 1N36L 1RKNA 1JCKB 3KYHC 1I94L 2RDHA 3P7JA 4CBVA 2B2VC 1YI2A 5EGTA 2L4NA 2XRSD 2A68D 5IYDH 2Q2HA 5C6AA 4ABNA 1OXUA 2KOLA 3NQIA 3HOUB 4Z9CB 3OTOL 1HXYD 2JA8B 1HA5A 1NCVA 4F88A 4ZYSA 2MP1A 1VIGA 1Y1VH 1HJPA 1UAPA 2UUAQ 4XTCS 1PH5A 2E74C 4ZQ3A 5M5WH 4NP5A 1VQGA 1SMXA 1A6XA 4X65L 2MJ8A 2A69C 1JOKA 3RLFA 4LWCA 3J81j 1CT1D 3FRPB 3SK8A 1XNRL 1OO9B 2XWJB 5KEEA 1ENAA 3T4AC 2UXCQ 1NUCA 3GO5A 2AWNA 4JOIA 2K04A 4GLXA 4A3DB 2K5WA 4DV7Q 2PMZB 4DGZA 2CW0C 1SYBA 3NTIA 3D31A 3DXJC 2K4KA 2ZXPA 4DV2L 3T51B 2OT2A 4DV2Q 5IODA 4B3RQ 4HJAA 1DM0B 2LS01 3K7AB 5DM63 1B7YB 5M5XH 1EYGA 5JPMC 1ET9A 1TIID 4J6HA 1EY5A 2Z1CA 4KHZA 2RHQB 1J6QA 2WFWA 3RZOH 3CRLC 3CCQA 1QOHA 1Z47A 2TMPA 3J7AV 1U4PA 4XQNA 1UE7A 2FXQA 2EXZA 4Y7NH 1WTOA 1O7LA 1R4QB 3I7FA 5I9PA 2UU9L 2EJGC 4DKAC 5C0XI 2PNHA 2UUAL 3OIPA 2NTTA 4GKKL 1X54A 5M3MB 4FXKC