2NN6G

Structure of the human rna exosome composed of rrp41, rrp45, rrp46, rrp43, mtr3, rrp42, csl4, rrp4, and rrp40
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
259
structure length
236
Chain Sequence
ARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymyositis/scleroderma autoantigen 1
publication title Reconstitution, activities, and structure of the eukaryotic RNA exosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/transferase
total genus 33
structure length 236
sequence length 259
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nn6G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nn6G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2nn6G03
4UP9A 3CMEA 1YBYA 2BA1A 1D7QA 3QJYA 2HH2A 3B6YA 1DD2A 2JQOA 3PIPA 3A7AB 1YHAA 3A7LA 2YTVA 4JBKA 1JT8A 5JJIA 3PSIA 1OXVA 1WJJA 3E9IA 3GTOH 1EQRA 1J5KA 1H9MA 4LF4Q 1PHJA 2R7DA 1KXLA 1KHIA 4XIGS 1GKHA 4ALPA 5LMUL 1JJGA 1HH2P 4UY8C 2CCZA 4G7HC 1N9WA 1CTMA 1K8GA 5KNCA 2QF7A 4JI6Q 4JVYA 3I4NG 1FGUA 1MJEA 4PZ7A 3LNNA 1ZZJA 3JAMc 1WCMG 4A3MH 1H95A 4GN5A 3U9SA 5AJ3Q 3ERSX 4GOPB 2FXQA 1G291 1TWGH 4A3LG 1HR0W 3HOZG 3TZUA 4HJ5A 2VNUD 4P72A 3HKSA 1E3PA 2HIVA 1RL2A 1ZZIA 1NE3A 3OW7A 1VQDA 1FJGQ 4GLAC 5A35A 4AYBE 1VQPA 3AEVA 2F52A 1HCZA 2VY3A 2AWNA 1NY4A 3GTGH 3KF6A 4B3SQ 3RR5A 4KI0A 1VQOA 3CRKC 3HOWG 3MFYA 2BE5C 1DGSA 2O5JC 3VDYA 4K0KL 1TWHH 1E1OA 4DNIA 3EN2A 1OXTA 3ND9A 4OONA 3OW2A 3I55A 4DR6L 3AQQA 3SE0A 3T1HL 3HOVH 3S16H 3U4ZA 4AH6A 1I94Q 1YJNA 3GTKH 3RLNA 5JJKA 2A68C 3IKJA 1I3QH 2CTFA 2UU9Q 4DV0Q 2CW0C 1H9KA 4KHPQ 4X6AH 4TKOB 4JI5Q 4LUOA 2LSSA 1B70B 1WOCA 2NN6G 1X3GA 1KAWA 1M1KC 1YNXA 1HQMC 4NBQA 1BDOA 1D8LA 2YYZA 5IYCH 1UWVA 2JA6G 3SGIA 4A3DH 5M3MG 4B3ML 3J7ZC 1TXYA 3VR4A 4B3RL 3PUZA 1UE6A 3L0OA 5C0XH 2EDGA 1K1GA 2K5NA 4OWXB 4YCWA 1S40A 3PO3G 3TQYA 4JI3Q 4AYBG 4NPSA 3CCLA 3BJUA 2BH8A 3CCRA 3CC7A 2K52A 4YY3Q 2ZJQA 1SRUA 2NZOA 1CKMA 2F4VL 1YNNC 2OQKA 1JB7A 3J7A5 3DLLA 4RMFA 2B8FA 3N6RA 3CCMA 4BA2I 2ALYB 5ELNA 3J81j 3AFQA 3A8KE 1EYGA 2ASBA 2WP8J 2VQFL 1E2VA 4AQYQ 5IYBG 1Z6HA 3J80c 4DV4Q 3T56B 2EIFA 2ZTDA 2MO1A 1QUQB 4A3GH 2I5MX 3VKEA 4DV3L 2HQLA 3T51B 2JVZA 3DXJC 1PFSA 1X4NA 4I7ZC 3M4QA 5IYDG 3BZCA 1A0IA 4GKKQ 3M4PA 4YHHL 3IFTA 3M4YA 3G4SA 3VR3A 3LWUA 3HOYH 4MNOA 2R7FA 2E5LL 2F3IA 2NN6I 5M5XH 4G7ZC 1PYSB 5HGQA 2IT1A 3W1BA 4A3EG 1TU2B 2AUJD 3FP9A 4DUYQ 3T1YL 2ZM6L 2K5VA 2K4KA 1QZGA 1Q7YC 1X3FA 4JI7Q 4IPCA 1PVOA 3U1KA 3W3AA 4YCVA 2JZXA 5DLQE 3J81i 3PIOA 2R7ZH 1HZAA 1LABA 3K0XA 3A74A 1MJCA 2KHIA 2ATWA 3M4OH 2A8VA 1R9TH 1HNZL 2JEAI 1K8OA 4LFCQ 3OYYA 3QG1A 3TS0A 2Z6KC 2H5XA 3STBC 2ZJPA 3S24A 3HFZB 5GAGC 5BN3A 2PQAB 4BY7G 2JA8G 5HY6A 5BR8L 1GO3E 4BXXH 4IPDA 5C0XJ 2PNHA 1J6QA 2D5DA 1XPOA 3RNUA 1SMYC 1SLJA 2UXDL 2AKWB 1TUAA 4DNTB 1Y1VH 2K33A 1BKBA 1K0RA 4DR4Q 1EIFA 3CCQA 1VQ9A 3PUWA 5FLMH 3F2BA 4RG1A 4A3FG 1J5EL 1GUSA 3PO2H 2PNRC 3OTOL 4A3BG 1L2FA 4DV7L 1K8AC 4JOIC 1Y1WG 1YIJA 5KNBA 3KF8B 2B63H 4JVHA 2GVAA 3H0GH 1Y8OB 4GN3B 2IHEA 4JI4Q 4UP7A 2KCCA 2ANRA 3CP0A 3I2ZA 1VIHA 2AHOB 3S15H 3BU2A 1EFWA 2CTLA 4IFDI 1IBMQ 2O5IC 1EWIA 4LF4L 1WVNA 1KQSA 4OWWB 1KRTA 1ZTGA 2K7VA 1WE8A 4DK3C 4A3KG 1HNZQ 4B3TQ 2V4DA 3U50C 4DPGA 2KHJA 2OTJA 4YCUA 4JI6L 3HKZE 4DV5Q 3H3VH 3ICEA 2BA0A 3NE5B 1G51A 2R93G 1Q82C 1QVCA 3KDFB 3H3VI 4QL5A 4PG3A 5AJ3L 3S1NH 1E1TA 4A3CG 3I56A 5K36G 1YHQA 4LF8Q 2JJQA 4JI0L 1KHMA 4JOIA 1A6XA 3E0EA 1SR3A 1FJGL 3TRZA 3HOXG 1VQ8A 1B8AA 4A4IA 1B7YB 1VF5C 4IJLA 2DN8A 3L2PA 4B3SL 3NELA 4OO1G 3IRBA 2A69D 1M90C 3M7NA 5GROA 3CQZH 4NB3A 4B8TA 1PH9A 4TVAB 1OTCA 4UPAA 1VQ4A 1EWHA 1H9JA 4EX5A 3K7UC 3S1MH 3CCUA 4DUZQ 1EQQA 4NXNQ 4DR7Q 4R1JA 2FMRA 2OCEA 1GHJA 2R6GA 1DT4A 5IP7H 1YJWA 1I94L 3STBD 4DK1A 1J4WA 3CCEA 1C9OA 2UUBL 1H9RA 1IXRA 5JEAH 4H13C 3HKZG 2ZJRA 1WI5A 4L5TA 1Y8PB 2UU9L 4DV0L 3FKIH 2E76C 5KNDA 3ER0A 4KHPL 4YWMA 1AE2A 4JI5L 1EUJA 3D4RA 4BY1H 4P73A 4GOPC 2RF4A 1VQJA 2D62A 3ULLA 1E2WA 1BBUA 1VQGA 1P16A 3RLFA 4R4QA 1WYDA 2NVQH 1IL2A 1BBWA 4BBRG 4JBWA 2K32A 2OPUA 4A3DG 4G7OC 2RCNA 4JI3L 4OX9Q 3CCVA 4LF6Q 2Q2IA 4JI0Q 1MKHA 3CCSA 3NENA 4YY3L 1ZZKA 4BBSH 1OXXK 3F2CA 2EVBA 2VUMH 1NBWA 1VQNA 2LXJA 2NVTH 1XTDA 2JK8A 1CUKA 3WWVA 1UE5A 3W1GA 2JA7G 3WDNA 3PUVA 4LFBQ 1FL0A 3VA7A 3CCJA 2DUDA 4H44C 4WJ3M 1N32L 1VQ6A 4P75A 2HT1A 4AQYL 1XPUA 3BDOA 1K83H 1QJOA 4DV4L 4JV5Q 2AUKA 3UDGA 1PH7A 3PGZA 4PV1C 3RN5A 2K50A 1X6OA 5FJ8G 3AFPA 3W5OA 2UUBQ 4LIJA 1Q90A 1CKOA 2ZT9C 1PH1A 3ND8A 1CI3M 4GOPA 2MNAA 3UE1A 3NBHB 1ASYA 1VF7A 1IBLL 4GKKL 3F8TA 3S14H 4DV6Q 4X62Q 3I4NH 5LMNQ 4OWTB 1VDZA 4L5QA 2AWOA 1JJCB 2N78A 4JI1Q 3AYHB 1WCMH 1IYJB 3FMCA 1ZKOA 1VQLA 2OTLA 2RHSB 3H94A 2K5HA 1YHBA 3GO5A 3EIVA 1V9PA 4DUYL 3I4OA 2K14A 1KC8C 1ASZA 4JI7L 3I4MH 1YNJC 3KJPA 4A3LH 3HOZH 2CPQA 1UEBA 3JC66 1EOVA 3G71A 3OOCA 1PYBA 2DNCA 4QJFA 5JEAJ 1UE7A 3D0FA 1TWAH 4DV2Q 4HJ9A 2KBNA 4DK0A 4LFCL 3PUXA 4A75A 4IJHA 4L8JA 4R4CA 1AH9A 1Q1BA 1Z7TA 2UUAQ 2PI2E 3HOWH 2JA9A 3CXCA 2UXBQ 1N32Q 3A5ZB 1MIUA 1NTGA 5GAEC 2P2RA 1T9HA 5IP9G 4HIKA 4OXPA 2A6EC 4DR4L 2PPBC 2MQHA 1HR0Q 3MXUA 1HZ9A 2NZHA 1ZYRC 2E2JH 2VQEQ 4IQZA 1IBLQ 1VQMA 1NMFA 1XNRQ 2JA5H 4O0AA 3EQLC 2NN6H 1X65A 1FR3A 4C3JH 4JI4L 1YZ6A 2YQRA 2OWOA 1Q8KA 1V1QA 4HIDA 1QZHA 4IOAA 2YV5A 5JJLA 3H0GG 1RIPA 3RLOA 2A69C 1P8LA 1IBML 4A3JH 5GAHC 1LUZA 1VQIA 5IT9c 2QA4A 3JAMi 4DAMA 3RZDH 3GTJH 3CAMA 3SDZA 4LF5Q 3CC2A 4B3TL 2A19A 5J3BA 2MFIA 2ZTCA 1PH8A 2N3SA 3F2DA 3AB9A 4DV5L 4GNXC 1QUQA 1DTJA 2CWPA 4GNXB 4KMUC 3LGJA 1Y8NB 4X64L 2YTYA 3PCOB 1Q46A 1S72A 4DR3Q 4JYAQ 1Z9FA 5IYBH 1E24A 1LYLA 2AMCB 3I4LA 5IWAQ 4DR1Q 1PMRA 4LF8L 2E2HH 2F1MA 4PMWA 1IYVA 3KLRA 4KKTA 2WAQE 3KYHC 1KD1C 1IYUA 5IY0A 1HTPA 2PCFB 2Q8IB 1T5EA 3RN2A 3PUYA 5IYDH 1CSQA 4JI2Q 1Q12A 3VR2A 1H9SB 2Q2TA 2PMZE 4QIWE 4HIOA 3PF4A 4APVA 1PH2A 4DR5Q 3T53B 2UUCL 1GM5A 1CKNB 2E2IH 1XNQQ 2PQUA 1YEZA 1N36Q 4IFDH 4EQ5A 1VQ5A 1X9NA 4A3EH 4R4IA 4DUZL 4NXMQ 4NXNL 2I0QA 4DR7L 1TKWB 3K81C 2Z6KA 1G6PA 5M3FH 1QVFA 1Z47A 4FDBA 3UE0A 4HJ8A 2PQAA 2BDOA 1K3RA 3EBEA 1L1OC 4WALA 1JMCA 5C4JH 2MJHA 3Q8DA 1SN8A 2B3GA 1PH3A 3KFUA 1EC6A 5IP7G 2B29A 3H15A 1L1OB 2C35B 1O78A 5JEAG 2DGRA 3FKIG 3NEMA 4O2DA 3CF5A 3BG3A 1X54A 4KN7C 4BY1G 2A6ED 1GVPA 1VQEA 4X64Q 4BY7H 4WANA 3KOJA 4A3MG 2L5TA 1VQAA 3CD6A 2CKZB 1DCZA 4LF7Q 3GTPH 2WAQG 4BA1I 2YTXA 4AIMA 4OX9L 4LF6L 1HZBA 5C44H 1W3SA 3HGBA 1XJVA 4GKJQ 2IY5B 4DR2Q 4DV1Q 1L0WA 4RCNA 4A3IH 4A3BH 2AXYA 3J80i 1IW7D 1HNXQ 2CTMA 4X65Q 3HOUH 1Y1WH 4LFBL 2JXMB 5C3EH 1N34Q 4ME3A 2VUMG 2HHHQ 2UUCQ 3PF5A 1VS0A 1A63A 4KKSA 4P71A 4JV5L 1HJPA 1Q86C 1TWCH 1N33Q 1GUNA 3S1QH 2ANNA 1Y69U 1YITA 2DNEA 1NMGA 3A0JA 2CQOA 2NVYH 3M9BA 4GS3A 3KDFA 1HNWL 3VR6A 3AEVB 5FLXc 2Z0SA 3HOVG 3A8IE 3CMAA 5H1SE 3KF6B 3A8JE 4A3KH 4HR7B 1N8RC 4KLKA 1UE1A 2PI2A 2E74C 4DV6L 4X62L 4JK1C 5LMNL 1SFOH 1VQCA 4JI1L 3VR5A 3U58A 2VS1A 2UXCQ 3CPWA 2GVBA 2R93H 3QIAA 3MEFA 3UDXA 2GN5A 3GQBA 4IFDJ 3G6EA 4XTCS 4LF9Q 4LW1A 3J81c 2R92H 4X66Q 3ZJYC 4A3CH 5IYCG 4A93H 1A62A 5K36H 1KRSA 5C4XH 1GUTA 4QGUA 4HJ7A 4DV2L 1XMQQ 3CPFA 3I4MG 5C0XG 4POGA 5M5YH 3E9HA 5GQOA 3PV0A 4LUVA 3HOXH 4AM3A 1DXMA 3F1ZA 4JCVE 4JI8Q 2DGYA 1GD7A 3RZOH 4OO1H 2UUAL 2D0PA 2MO0A 5EAYA 2XTIA 1WFQA 1XMOQ 1OXSC 1SMXA 4OO1I 2ID0A 1IBKL 2UXBL 1Q81C 4IOCA 1PV4A 4OGQC 4QY7A 1PH4A 2VW9A 2Q2HA 1HNWQ 1HR0L 4C2MH 2EJFC 1CSPA 4YWKA 1TWFH 2VQEL 2Y0SE 2N49A 2XGTA 1JJ2A 2JEBI 2N8NA 4A3GG 2I5HA 1KL9A 1Q1EA 1XNRL 1JE5A 1V43A 3CW2C 5LMUQ 4IPGA 1I6HH 1GHKA 2E75C 4H0LC 3A5UA 2JA5G 3HOYG 2B8GA 1B9MA 4BBRH 4HIMA 1C7YA 1O7LA 4DAYB 1XPRA 3GTMH 2K75A 1YI2A 3K80C 4PZ6A 3K7AH 3ULJA 1VCIA 1X56A 4A76A 4A3JG 4LF5L 2V1CC 1SROA 1LTLA 2CFMA 4R4TA 2R7ZG 3MXNB 2OQ0A 5C0XI 1A8VA 2ZTEA 4LNQA 3UDFA 4LK1C 2JA7H 4WJ4A 4QMFB 1X3EA 1E22A 4KHZA 1IBKQ 2KA7A 2VZAA 5IE8A 1X4MA 1VQFA 1B9NA 5E7NA 4DR3L 4JYAL 2EJGC 4GLXA 3L7ZC 1VQBA 5IWAL 4GLVB 4DR1L 2Y0SG 4Y52H 2WFWA 4K0KQ 4BXXG 4LWCA 3TREA 2EJMA 2E3UA 5FJ8H 4KKUA 4HJAA 3TS2A 2JE6I 4IO9A 4DR6Q 1LM0A 3T1HQ 3GTLH 2KCMA 5M5WH 3G48A 1Y1VG 1QVGA 1HPCA 3S17H 4L5SA 3M85A 1HZCA 4JI2L 4JC0A 5FLMG 2YU9H 2QNDA 3PO2G 2A6HC 1FYCA 1E7ZA 4DR5L 4LUZA 4KN4C 2JA6H 1OXUA 1XNQL 3U4VA 4MTNA 1N36L 4LFAL 5M3MH 1IW7C 3OPOA 2B63G 1C0AA 4NXML 2LMCB 2CTKA 2BL5A 2IX1A 4DKAC 1E2ZA 2QEXA 4YWLA 4IFDG 3S2DH 3PO3H 4B3MQ 4JBMA 3M3YH 4B3RQ 2PY9A 4IPHA 1I5FA 5M3FG 1V8QA 1IZ6A 1K73C 4PZ8A 4H02A 1K9MC 2QGQA 2F4VQ 2BE5D 1GUOA 4DNRB 3S1RH 3S2HH 3ULPA 4DK6C 4POFA 2HH3A 4GN4B 4LF7L 1YVCA 2I5LX 4GZYC 3GD7A 2CTJA 5IP9H 4JBJA 2VQFQ 2D0OA 2A68D 4C3IH 1FVIA 4JG2A 3UDIA 3I7FA 1AE3A 4GKJL 4R4OA 4DR2L 4DV1L 3BZKA 1VIGA 5ELOA 1HNXL 4X65L 5C44G 2L15A 3FHWA 2ES2A 1GUGA 1O7IA 4DV3Q 4LJZC 2D2CC 1Y14B 1N34L 3D31A 1U0LA 2HHHL 1I50H 4A3IG 1LACA 1GJXA 2WB1E 1CFMA 4YHHQ 3GDEA 4LFAQ 1EIYB 3HOUG 5C3EG 2LXKA 2E5LQ 1N33L 3I72A 1I6VC 3KLWA 2OPVA 4GNXA 5BN4A 3T1YQ 2ZM6Q 4QQBX 1KIXA 4TQUS 1NJIC 3CC4A 2Q2UA 5GADC 2IX0A 2IHFA 1YJ9A 1PA6A 1PH6A 3KJOA 4MZ9A 2UXCL 3V69A 2RHQB 1PH5A 2JA8H 1VQ7A 2E8GA 4LF9L 1VQKA 4X66L 1H9SA 1X55A 1S3OA 2EQSA 4Y7NH 2EXDA 2NVXH 5BR8Q 3DM3A 2R92G 1XMQL 2A1AA 2HIXA 2A6HD 1CKNA 3P20A 4A93G 4J15A 2VL6A 3K8AA 2CTEA 4P74A 2UXDQ 5C4XG 4A3FH 1W2BA 4JI8L 2KCTA 3I73A 2BH2A 4BBSG 2WB1G 2CWAA 4UP8A 1ONLA 5BN5A 1VQHA 4L5RC 1XMOL 5LMNW 4C3HH 1U5KA 1J5EQ 1K8MA 3OTOQ 3TEHB 1SE8A 3GTQH 4DV7Q 1L1OA 3FPPA 1BVSA 2KENA 3CRLC
chains in the Genus database with same CATH superfamily
4UP9A 4Y7NB 3CMEA 3GABA 3GP7A 4N8X1 1YBYA 2NVXB 3MHBA 2JSOA 2BA1A 1D7QA 1F2LA 3QJYA 1LT3D 2HH2A 3B6YA 1DD2A 2JQOA 1QOHA 4JI3H 3NPPA 3PIPA 3A7AB 5EPKA 4A3FB 1YHAA 1PTOD 2YTVA 3A7LA 4JBKA 2L0CA 1JT8A 5JJIA 1G8ZD 3PSIA 1OXVA 1WJJA 3E9IA 3GTOH 1JWUD 1EY7A 1EQRA 4K2LA 4YY3H 5IIFA 1H9MA 4LF4Q 1PHJA 1J5KA 5DAUA 1I4RA 2NTSA 2R7DA 2PO4A 5IT9W 1KXLA 1JWMD 1KHIA 2Q8TA 4K2KA 4QMGA 4ZYSA 4XIGS 1GKHA 4C3HB 4ALPA 5LMUL 1JJGA 1HH2P 2L9HA 3RMHA 1G2TA 4DXFA 3V2TA 3NUCA 4UY8C 1EQTA 3GTQB 2PQEA 4S3SA 2CCZA 1N9WA 4G7HC 1CTMA 4DA2A 1K8GA 2EYPA 5KNCA 2QF7A 4JI6Q 4JVYA 3I4NG 1FGUA 2X6LA 1MJEA 4O42A 2H1EA 3QD7X 3Q22A 4PZ7A 3LNNA 5I6WA 4F88A 3JAMc 2DJGC 1ZZJA 1WCMG 4X3KA 4A3MH 1H95A 4GN5A 2IPKD 4AQYH 3HEJA 3U9SA 4FO2A 2CVRA 4ULLA 1PRTC 5EBDA 2F0OA 4DV4H 5AJ3Q 3ERSX 4GOPB 2TMPA 2FXQA 4FJUA 1RDPD 3EROA 4KHVA 1WTHA 1KNEA 1G291 1TWGH 4A3LG 1HR0W 3HOZG 3GTOB 3MAQA 3I8ZA 3TZUA 2L1BA 2B2TA 4HJ5A 1KABA 2VNUD 4P72A 4UAIA 3HKSA 1E3PA 2HIVA 1GOZA 1RL2A 1ZZIA 3KBGA 3J81E 1NE3A 3OW7A 1VQDA 1FJGQ 4GLAC 4GKKH 5A35A 4FVMA 4FF3A 4AYBE 1VQPA 3AEVA 2F52A 4OHJA 5IGDA 1HCZA 3A56A 2VY3A 3UOEA 2AWNA 2VB2X 1NY4A 3GTGH 1NCVA 3QR8A 3KF6A 4B3SQ 3RR5A 4KI0A 1VQOA 5D3DA 3CRKC 4A3MB 3HOWG 2PZTA 1STEA 3D4WA 3MFYA 3VA5A 2WAQB 2BE5C 4DUYH 1DGSA 2O5JC 1QWYA 3VDYA 2ZXPA 4K0KL 1WD1A 4JI7H 1TWHH 5ELCA 1E1OA 1BCPD 1TWGB 4DNIA 3R2TA 3EN2A 1OXTA 3ND9A 4OONA 3OW2A 3I55A 4DR6L 3AQQA 3SE0A 5D65A 3T1HL 3HOVH 3S16H 2XRSD 4V190 2PMZB 4QIWB 3K58A 3NK9A 3U4ZA 4DF7A 3EJIA 3CHBD 4AH6A 1I94Q 1YJNA 1K3BC 3GTKH 3RLNA 1JWSD 5JJKA 1O7YA 4KK7A 4QUCA 1B1ZA 2A68C 4LFCH 1VBIA 3IKJA 1JC7A 4RAUC 1QNKA 1I3QH 2CTFA 2UU9Q 1HFGA 4DV0Q 2CW0C 3R2IA 1H9KA 4KHPQ 4X6AH 4TKOB 4ZCKA 4B9WA 2NTTA 4JI5Q 4LUOA 2C9OA 1B2TA 2LSSA 4TRDA 1B70B 2PT7G 1WOCA 2NN6G 1X3GA 1KAWA 2L55A 1M1KC 1YNXA 1HQMC 2HD3A 4J6HA 4NBQA 1U4MA 1C8CA 1WTRA 4XYQA 1BDOA 4ZLTF 1D8LA 2YYZA 5IYCH 1UWVA 2JA6G 3SGIA 2K28A 2ICIA 1TWHB 3K0YA 3UI2A 3QWNA 4A3DH 5M3MG 4B3ML 3J7ZC 1TXYA 5A2QL 3VR4A 1KTKA 1QB5D 1EFID 4EGVA 4B3RL 1A3TA 3HKZB 3HOVB 3S16B 4RA8A 3KBXA 3PUZA 1UE6A 3L0OA 4DR4H 5C0XH 4FYDA 3L9AX 2EDGA 3GTKB 1LTRD 1K1GA 2R3ZA 2K5NA 1TS4A 4OWXB 4YCWA 1S40A 3PO3G 3TQYA 4JI3Q 4AYBG 1SNQA 4NPSA 3CCLA 1LT4D 3SK5A 3BDLA 4QUFA 3BJUA 2BH8A 1I3QB 3CCRA 3ZYYX 3CC7A 4WFN3 2K52A 4YY3Q 3DUZA 1STBA 2ZJQA 1SRUA 2NZOA 1CKMA 1EEID 2F4VL 1CT1D 1YNNC 2OQKA 1JB7A 1HUNA 3J7A5 3DLLA 4RMFA 2B8FA 3N6RA 3CCMA 1RODA 3KDKA 1QILA 4BA2I 1IL8A 2F0IA 2ALYB 2RSNA 5ELNA 4C56C 4JI4H 4KY5A 3J81j 3AFQA 1HUMA 1I6UA 2Z8LA 5T1GA 3A8KE 4OCHA 2F0NA 1EYGA 4Z9CB 2ASBA 4A3DB 1U4LA 1DOKA 2WP8J 1ET9A 4NW2A 4CGYB 5D14A 2VQFL 1E2VA 4JVZA 1IBMH 1U4RA 2KECA 4AQYQ 5IYBG 4NDXA 1Z6HA 3SK6A 3J80c 4DV4Q 3T56B 2EIFA 3K5OA 2ZTDA 2LS01 3TN2A 5ISRA 2MO1A 1QUQB 4IZ8A 5CBEE 2DY8A 3NTHA 1Z2IA 4A3GH 1HNZH 2I5MX 3VKEA 4B3TH 4DAYA 2Q8RE 5E4WC 4DV3L 1ENAA 2FMCA 1JB3A 2HQLA 4K8IA 3GV6A 3H6MA 5FLXW 3T51B 3K5MA 1PXUA 3DXJC 2JVZA 1HTLD 1SBBB 4DV5H 3NSWA 1PFSA 1JCKB 1X4NA 4I7ZC 4OIKA 3M4QA 5IYDG 3BZCA 1A0IA 4GKKQ 2EYOA 4XYOA 1XTCD 3M4PA 1WTPA 4YHHL 5FO7B 3IFTA 3M4YA 1HRJA 2M8WA 3MXGA 3G4SA 3VR3A 3MXNA 1CK1A 3LWUA 4FXGC 3J80E 3HOYH 1SNDA 4MNOA 2R7FA 2MUYA 2E5LL 2F3IA 1S03G 2NN6I 2EYJA 5TSSA 5M5XH 4G7ZC 1STNA 1PYSB 5HGQA 2IT1A 3W1BA 1NAPA 4V0BA 1PRTF 4A3EG 1AW7A 1J8IA 5LL6X 1TU2B 2AUJD 3NQIA 3FP9A 4DUYQ 3T1YL 4LF8H 2ZM6L 2K5VA 2K4KA 1QZGA 1Q7YC 1D5XC 1X3FA 4JI7Q 4IPCA 3J81W 4RHSA 1PVOA 3TBIB 3U1KA 3W3AA 4YCVA 4A3GB 2JZXA 1XWEA 5DLQE 3MA2B 3J81i 3PIOA 2R7ZH 1HZAA 1LABA 1STGA 3K0XA 3A74A 1FNUA 1MJCA 5FO9B 2KHIA 2PW7A 2ATWA 3M4OH 4CJ0B 2A8VA 2K5QA 1R9TH 1HNZL 2JEAI 2I07B 4LFCQ 1K8OA 3OYYA 3VYTA 2ZXOA 1KAAA 3QG1A 3TS0A 2Z6KC 3HOYB 2H5XA 3STBC 2ZJPA 1NXUA 3S24A 2UUCH 3HFZB 5GAGC 1FKAH 2TSSA 3DWPA 5BN3A 4DUZH 1JOQA 2PQAB 5CYUA 2Z4IA 4BY7G 2JA8G 4NXNH 4DR7H 5HY6A 5BR8L 1GO3E 4U68A 4BXXH 1RJTA 4IPDA 3JAML 4WORA 1B50A 4A3JB 2WINB 2N88A 3KK7A 5C0XJ 2PNHA 1J6QA 2D5DA 1XPOA 4IUQA 3RNUA 1SMYC 3TP5A 1SLJA 4R9WA 4HTHA 2UXDL 4QB4A 2AKWB 4KTAA 2R7ZB 4DNTB 1TUAA 2G8YA 4IUVA 1Y1VH 2K33A 1BKBA 2B2WC 5DM63 1K0RA 4DR4Q 4X3TA 1SAPA 1EIFA 1NUCA 1HA5A 3CCQA 1VQ9A 1UG8A 2CH4W 4R8NA 3PUWA 5FLMH 3F2BA 4RG1A 4A3FG 1ILPA 3D6CA 1GUSA 1J5EL 2MGSA 3PO2H 2PNRC 3OTOL 1C4QA 2F0WA 4A3BG 5EPJA 1L2FA 4N9TA 4DV7L 2ENBA 1TS2A 2CPMA 1K8AC 4JOIC 1Y1WG 1YIJA 5KNBA 3KF8B 4L6TB 3SK8A 3T16A 2B63H 4JVHA 2GVAA 4C3HG 5JPMC 3H0GH 1Y8OB 2KEDA 4GN3B 2J4XA 2Y0SB 2IHEA 5CV4A 4UP7A 4JI4Q 1F2MA 4K6DA 3K5NA 2F0DA 3DMUA 2KCCA 1SEBD 5C3XA 4EQPA 1FGBD 1PFNA 2ANRA 3CP0A 3I2ZA 1VIHA 2AHOB 3C3LA 1GUWA 3S15H 3IAYA 3BU2A 1EFWA 3I3CA 4OX9H 4LF6H 2CTLA 4DAPA 4IFDI 4JI0H 1Y1VB 3X3NA 1IBMQ 1MSGA 1EWIA 4HMIA 5C3WA 2O5IC 1LT5D 4WJWA 3DEPA 4LF4L 1WVNA 1KQSA 4OWWB 5A2QE 1KRTA 1ZTGA 1CA5A 2K7VA 5CMDA 1WE8A 1BCPC 3PO2B 4DK3C 4A3KG 3NTKA 1HNZQ 3ONAB 4B3TQ 4DU9A 3BVZA 2V4DA 3U50C 4K5WA 1TT2A 4DPGA 2KHJA 2OTJA 4YCUA 4JI6L 3HKZE 4DV5Q 4LFBH 2B63B 1AZQA 2SNMA 1FNVA 5IGFA 5DNFA 3H3VH 3ICEA 2BA0A 3NE5B 2KVMA 1G51A 2R93G 1BXTA 1Q82C 1QVCA 3TSSA 3KDFB 3H3VI 2FFKB 4QL5A 3X3MA 3CKIB 5I6YA 3NHHA 3NP8A 4JV5H 2FINB 4PG3A 5AJ3L 3OWFA 3S15B 3S1NH 1E1TA 4A3CG 1F2YA 5J22A 4KD3A 2F0GA 3R93A 3I56A 1MHWC 1S5BD 5K36G 2UUBH 1YHQA 3BYYB 4KJNA 1Q8IA 2JJQA 4LF8Q 3FEWX 2F0SA 1JE4A 4KY7A 4JI0L 1KHMA 1ESRA 4JOIA 3E0EA 1A6XA 4PNYA 1SR3A 3GV3A 1FJGL 1ENCA 3TRZA 1BO0A 3HOXG 3SVMA 1IHZA 5I2XA 4HAEA 1VQ8A 4DV6H 4X62H 3IL8A 1B8AA 2E2DC 5T1IA 4A4IA 5LMNH 3G6JB 1B7YB 1VF5C 4IJLA 4JI1H 2DN8A 3L2PA 4B3SL 3NELA 3EZJA 4OO1G 1X32A 3IRBA 2A69D 1M90C 3M7NA 5GROA 3C46A 2VXWA 3CQZH 4NB3A 4B8TA 1PH9A 2X6GA 4TVAB 1OTCA 4UPAA 1VQ4A 1AP0A 2D9UA 1DJRD 1EWHA 4XQJA 1CQVA 3S1NB 4YIJA 5FK9C 1I4GA 3E5SA 1H9JA 4EX5A 1OO9B 3K7UC 3S1MH 3CCUA 3R8BA 4DUZQ 1EQQA 2CHBD 4NXNQ 1D6EC 5KEEA 5KYLA 4DR7Q 4R1JA 2FMRA 2OCEA 1GHJA 2PZWA 2R6GA 1I4QA 1DT4A 5IP7H 5FOBB 4DV2H 1ZEQX 1YJWA 1I94L 4EQNA 2A5HA 3STBD 4DK1A 1J4WA 2F4IA 3CCEA 1C9OA 2JP1A 2UUBL 1H9RA 2OEOA 1IXRA 3J80L 5JEAH 4H13C 3HKZG 2ZJRA 4DN4M 1WI5A 4L5TA 1Y8PB 2UU9L 1PZKD 1SE4A 4DV0L 1EY6A 3FKIH 3J7AF 1AFPA 2E76C 4HCSA 3ER0A 5KNDA 3D6WA 4KHPL 1QCBD 4YWMA 1AE2A 4JI5L 1PTOF 2UUAH 1EUJA 3D4RA 4BY1H 4K14A 2OXPA 3PQIA 3CQZB 3HOUB 3N52A 2UXBH 1SMYD 1N32H 4P73A 1M8AA 4GOPC 5LL6S 3P75A 2RF4A 1VQJA 2D62A 1O80A 3ULLA 3S1MB 1BBUA 1E2WA 1VQGA 1P16A 4IN3A 4R4QA 3RLFA 1WYDA 2NVQH 1IL2A 1BBWA 4BBRG 5HGTA 1WD0A 4JBWA 2K32A 2J7ZA 2F0JA 3AU7A 1EOTA 2OPUA 1S5FD 1HR0H 1JR0D 4A3DG 2RCNA 2EPBA 4G7OC 4JI3L 2VQEH 5NUCA 3CCVA 1T5XD 4LF6Q 4OX9Q 2Q2IA 1TR5A 4HEDA 2A73B 2PZUA 4JI0Q 5C5MA 1XX8A 2LKVA 1IBLH 1MKHA 3JAME 3CCSA 3FKIB 3NENA 4YY3L 3HZXA 1ZZKA 4U673 4BBSH 5DM73 1OXXK 2EY2A 2IL8A 3F2CA 1B4OA 3P1HA 2Y3MA 3U9OA 1FD7D 1XNRH 4BY1B 2EVBA 2VUMH 1NBWA 1VQNA 2RDHA 2LXJA 2NVTH 1ML0D 1XTDA 2JK8A 1CUKA 2WKCA 1UE5A 3WWVA 3W1GA 2JA7G 3WDNA 3NWSA 3PUVA 4LFBQ 1FL0A 3V96A 3VA7A 3CCJA 1WVLA 2DUDA 3I90A 4H44C 2CWFA 4RH6A 4FF4A 1V1OA 4WJ3M 2QDBA 2NVQB 1N32L 5M9OA 4P75A 1VQ6A 2B2VC 3HRZC 2HT1A 1SEIA 1TQOA 2SOBA 4AQYL 1XPUA 3BDOA 1AN7A 1K83H 4A93B 1QJOA 4DV4L 4JV5Q 1SYDA 2AUKA 3UDGA 4DGZA 1PH7A 1F0XA 3PGZA 4PV1C 3RN5A 1K28A 2AQ1B 2K50A 1X6OA 5FJ8G 4ZKCB 3AFPA 2SEBD 4LF5H 3W5OA 2UUBQ 4BBSB 4LIJA 4UHVA 1CKOA 1Q90A 2ZT9C 3C1EA 3ND8A 1ZXTA 1PH1A 1CI3M 4GOPA 1BCPF 2PYKA 2MNAA 4HSVA 3UE1A 3NBHB 2VUMB 1ASYA 1VF7A 2NVTB 3T4AC 1IBLL 1AZPA 4J8QA 2NUCA 4GKKL 4LAAA 3RZOB 3F8TA 3S14H 4DV6Q 4X62Q 2M00A 3I4NH 1NR4A 5LMNQ 4OWTB 1VDZA 4L5QA 2AWOA 1JJCB 2N78A 4EVOA 3MFGA 4QCLA 4JI1Q 3AYHB 1EU4A 1HQRD 1WCMH 2K01A 1IYJB 5EKIA 4EC5A 4DFAA 3FMCA 1HA6A 4DR3H 1ZKOA 1VQLA 4JYAH 2OTLA 2X06A 2RHSB 2K5HA 3H94A 1YHBA 1K83B 3GO5A 5EJWA 3EIVA 1V9PA 1V9NA 5IWAH 1DOMA 2Z1CA 4DUYL 4DR1H 3I4OA 2K14A 3OHXC 1LT6D 4CKBA 1KC8C 3NCVA 1ASZA 1DYQA 4JI7L 3E6ZX 3I4MH 1YNJC 3KJPA 4MTKA 4A3LH 3HOZH 2CPQA 3RF2A 1UEBA 3JC66 4I7AA 2PW5A 1EOVA 3G71A 3OOCA 1PYBA 2DNCA 4QJFA 4BS9A 1UUPA 5JEAJ 1UE7A 3D0FA 1TWAH 2C5CA 4DV2Q 4HJ9A 2WACA 3EFXD 4KV6A 4FP5D 2KBNA 4DK0A 1EL0A 4JI2H 4LFCL 3PUXA 3OIPA 4A75A 4IJHA 3S14B 4L8JA 4R4CA 1V1PB 2F0KA 5IGCA 3I4NB 1BF4A 3J7YW 1AH9A 5EBCA 3BS1A 1Q1BA 1S5CD 1Z7TA 4ME5A 1U4PA 4DR5H 1WCMB 2UUAQ 2PI2E 3E0JA 2D9IA 2F0VA 1XNQH 3HOWH 2JA9A 3NXWA 1N36H 1IKLA 3PMFA 3KLSA 4HCEA 3WOFA 1F2ZA 3CXCA 4NXMH 2UXBQ 1N32Q 3A5ZB 2LTMA 4OELB 3I4MB 4G4KA 3FVQA 1MIUA 3OETA 5CV8A 3P7JA 3HOZB 3G7LA 1NTGA 4FXKC 3WOEA 5GAEC 2P2RA 1WTQA 1T9HA 5IP9G 4HIKA 4C3IG 4OXPA 1TWAB 2A6EC 4DR4L 2PPBC 2MQHA 1HR0Q 2G9DA 3MXUA 1HZ9A 2NZHA 1ZYRC 2E2JH 4RGMA 5CR3A 4IQZA 2VQEQ 4XQNA 5JVH3 1IBLQ 1VQMA 1NMFA 2F0PA 2QW7A 2XWJB 1QG7A 1EWCA 5E4XA 2SDFA 3PIO3 1PQXA 2XWBB 2XIWA 2LY7A 1XNRQ 2JA5H 4O0AA 4L63B 1MD2D 3EQLC 2NN6H 3HOWB 3D4DA 1PLFA 5J39A 3SB1A 1X65A 2B2UC 1FR3A 4CKEA 3ITPA 4X64H 3SK4A 4C3JH 4JI4L 1YZ6A 2YQRA 2OWOA 1Q8KA 1V1QA 2EYLA 2BCOA 4MIUA 2RQXA 5JVG3 1SNMA 4HIDA 1QZHA 4IOAA 4LF7H 1MI2A 2YV5A 5JJLA 3H0GG 1RIPA 3RLOA 2A69C 4F8MA 1P8LA 1IBML 2QDLA 4A3JH 1A2UA 3JAMW 4PDBA 5GAHC 1LUZA 1VQIA 5IT9c 1LO5D 2OT2A 4R8IA 2QA4A 5DEHA 3JAMi 1MSZA 2E2JB 4DAMA 4WRDA 3RZDH 1AN8A 4GKJH 3GTJH 4EQOA 4DR2H 3CAMA 4DV1H 3SDZA 5C4HA 3K57A 4LF5Q 2EYFA 3CC2A 4B3TL 3R3OA 1RKNA 1HNXH 1X0AA 4X65H 2A19A 5J3BA 2MFIA 2ZTCA 3DWAA 1TY2A 1PH8A 2N3SA 5J1ZA 3F2DA 2JA5B 2EZVA 3C2PA 3OSSD 2HDMA 3AB9A 4DV5L 1SYEA 4P2CB 1N34H 4GNXC 1QUQA 5FLXL 4RGTA 2HHHH 1DTJA 2CWPA 2M9VA 4C3JB 4K5VA 5ELDA 1SJED 3TDQA 2F0LA 4CDEC 1RCVD 4GNXB 5IT9E 2K04A 2JA6B 4KMUC 4HMJA 1VMCA 1WTJA 2R61A 3LGJA 4MN3A 2F0FA 1F9QA 1Y8NB 4X64L 2YTYA 2A74C 1N33H 3PCOB 1Q46A 5K5PA 1S72A 4DR3Q 4OIJA 4E9JA 2ICEC 4JYAQ 1Z9FA 5IYBH 1E24A 2EYHA 1LYLA 2AMCB 3I4LA 5IWAQ 4DR1Q 1PMRA 4LF8L 1JOOA 2E2HH 1CQFA 3RZDB 3GTJB 2F1MA 4PMWA 1AEXA 1IYVA 3KLRA 4KKTA 1G2SA 2NZ1D 4RFBA 2WAQE 3KYHC 1CZWA 1KD1C 4CDCC 1ODHA 1IYUA 5IY0A 1HTPA 2PCFB 2Q8IB 1T5EA 3RN2A 1WTWA 5EPLA 3PUYA 5IOCA 3EA6A 5IYDH 1A3UA 1CSQA 4JI2Q 1Q12A 3VR2A 2UXCH 1H9SB 4KD4A 4ZQ3A 2Q2TA 4BWGB 2PMZE 4QIWE 1YNJD 4HIOA 3PF4A 1RTOA 3MEHA 5DT9A 4APVA 3O13A 4LF9H 1PH2A 4DR5Q 3T53B 3H91A 2UUCL 1GM5A 1CKNB 2E2IH 1XNQQ 4X66H 4B08A 5JOBA 2PQUA 1YEZA 4ABNA 4G08A 1N36Q 4EQ5A 4IFDH 1VQ5A 1X9NA 4A3EH 3J7AK 4R4IA 1R4PB 4DUZL 4NXMQ 4NXNL 4RCOA 3M7GA 2I0QA 4DR7L 2MJ8A 1TKWB 3SEBA 2E2HB 3K81C 4N9PA 2RCFA 4ZAIA 2Z6KA 1XMQH 1DONA 1G6PA 1NNXA 2M6QA 2XN9C 2RDFA 5M3FH 5KRUA 1QVFA 1Z47A 4FDBA 3UE0A 4HJ8A 2PQAA 2VB3X 2BDOA 1K3RA 3EBEA 1L1OC 3BVMA 1KLGD 4WALA 1JMCA 5C4JH 4H7BA 2MJHA 3Q8DA 1SN8A 2B3GA 2EE1A 3DHQA 5FO8B 4DAVA 1PH3A 2F0QA 3KFUA 5IP7G 1EC6A 4JI8H 1E0BA 2B29A 1S5DD 3H15A 3MWYW 2FPHX 1L1OB 2C35B 1RHPA 5KIXA 1O78A 1LTSD 1PFBA 1XMOH 5JEAG 3NTIA 3TMEA 4XT3B 2G5DA 3E3XA 2DGRA 3FKIG 3NEMA 2XRQD 2AQ2B 4O2DA 1S20A 3CF5A 3FRPB 3BG3A 2E2IB 1X54A 2B2WA 2MPMA 1G6ZA 4KN7C 2F0HA 3MTSA 4BY1G 2FFMA 2A6ED 4A3EB 1GVPA 4ZK9B 1VQEA 1II3A 4X64Q 4BY7H 4WANA 3KOJA 4LMQD 1ZYRD 3FPUB 1ICFB 2EXZA 1I4PA 4CBVA 4A3MG 2L5TA 1VQAA 3CD6A 3RUZA 1HNWH 5M3FB 2CKZB 4C1NK 1DCZA 3BYTB 4LF7Q 3KF8A 3GTPH 3FDTA 2WAQG 4BA1I 2YTXA 4AIMA 1WTOA 4OX9L 4LF6L 1HZBA 3SHLA 5C4JB 3A55A 1X3PA 4N8FA 5C44H 2K1HA 1W3SA 3A54A 3PIP3 2Z6BA 2CQAA 3HGBA 1XJVA 3H3VC 3J80W 4GKJQ 2IY5B 4DR2Q 4DV1Q 4XDXA 1L0WA 4RCNA 4A3IH 4A3BH 2AXYA 1EYAA 3J80i 1IW7D 5LMUH 1HNXQ 1PZJD 2N55A 4X65Q 2CTMA 3OMGA 1F9RA 5CV6A 3FAUA 1SE2A 1BNZA 5F2DA 3HOUH 1Y1WH 1XXGA 2G9HD 1F9PA 4LFBL 2JXMB 5C3EH 1N34Q 4ME3A 2F3VA 2VUMG 2HHHQ 4BY7B 2UUCQ 3DWQA 3K6OA 3PF5A 2B2TC 1VS0A 1A63A 2F03A 4KKSA 5D3IB 4M1UB 2KUMA 4P71A 1F9SA 1SYCA 4JV5L 1HJPA 4RWSC 1Q86C 2A1SA 3GTPB 2QKIC 1QNUA 1TWCH 2GA4B 2K03A 1N33Q 1MBYA 2NBFA 3VYRA 3OIQA 1GUNA 3S1QH 2ANNA 1NMGA 2DNEA 3A0JA 1YITA 1Y69U 3Q0AA 1KDCA 2CQOA 2NVYH 3M9BA 5C44B 4GS3A 3KDFA 4JPBW 1HNWL 1BUVT 3VR6A 1LV9A 1STAA 1DZ1A 2MP1A 5FLXc 1K0SA 3AEVB 5I4DA 2Z0SA 3HOVG 3A8IE 3CMAA 1DOLA 5I9OA 3I0PA 2Z4HA 5JAVA 5H1SE 3IFDA 3KF6B 4FNFA 3A8JE 4A3KH 4A3IB 4A3BB 4HR7B 1N8RC 4KLKA 1D1KA 4XQQA 1UNSA 1DM0B 4RGNA 4O1NA 1UE1A 2PI2A 5IGGA 2E74C 1LLRD 4DV6L 4X62L 2L11A 4JK1C 1Y1WB 5LMNL 3SR1A 1Q3LA 5C3EB 1SFOH 5I9PA 1VQCA 4JI1L 1IBKH 3VR5A 3U58A 1EY8A 2QILA 2VS1A 2UXCQ 3CPWA 2GVBA 2R93H 3QIAA 3MEFA 2HUGA 4M8AA 1STHA 3UDXA 1RF2D 1SXTA 2GN5A 3GQBA 4IFDJ 4MHEA 4CKCA 1TVXA 4XT1B 1W6JA 3G6EA 4XTCS 1EYCA 3L3OC 4RGOS 3TP8A 4LW1A 5FLXE 4LF9Q 1TWCB 5KGUA 1EEFD 1B3AA 3J81c 2R92H 3Q23A 4X66Q 4B8CD 3ZJYC 4A3CH 4K0KH 5IYCG 3S1QB 2SNSA 4A93H 1A62A 1FNWA 1HFNA 2O2LD 2NVYB 5K36H 3QO2A 1ICWA 1KRSA 1ET6A 4KJOA 5C4XH 4DR6H 1JORA 1GUTA 4QGUA 5JJZA 3T1HH 3HS0C 1SYBA 2EY6A 4HJ7A 4DV2L 2DY7A 1XMQQ 3CPFA 3I4MG 1PRTB 5C0XG 4A3KB 4POGA 1V8CA 1EIGA 2J0TD 5M5YH 3E9HA 5GQOA 4FF2A 1BOSA 5IT9L 1TY0A 3PV0A 4LUVA 4QF4A 3HOXH 1DXMA 4AM3A 3F1ZA 5L37A 4JCVE 4RHRA 1M4VA 1SFOB 4JI8Q 2DGYA 2RVLA 1GD7A 3RZOH 4OO1H 2UUAL 2D0PA 2MO0A 3EVQA 2R93B 4X3SA 5EAYA 2XTIA 1WFQA 1XMOQ 1OXSC 1SMXA 4OO1I 1WHRA 1CA6A 2XVSA 1X3QA 2ID0A 1IBKL 2UXBL 3GKUA 1Q81C 5I2YA 2NB0A 4IOCA 2FJ2A 2R92B 2F0EA 1PV4A 2NWGA 1L0YB 1RD9D 4OGQC 1PDQA 5G3LD 1STYA 2KEEA 4G57A 4QY7A 5A2QW 4B3MH 1B44D 1UAPA 2NYZD 5C4XB 1PH4A 4B3RH 1JICA 2VW9A 1BQQT 2Q2HA 2CWHA 1HNWQ 1HR0L 4E6IA 2L12A 4C2MH 2EJFC 2WB1B 2B39A 4PQXA 1CSPA 1NR2A 1S5ED 4YWKA 5M5YB 5ELBA 1TWFH 4OL7A 2VQEL 2Y0SE 3HOXB 2N49A 2XGTA 1LTGD 1JJ2A 2IX3A 4Q5VA 5G3LF 1EZ6A 1MGSA 2JEBI 2N8NA 2RBMA 4A3GG 1EY4A 3V05A 2I5HA 4CJ1B 1KL9A 4NKLA 2VKCA 1Q1EA 3ERQA 2F4VH 1XNRL 4ZUJA 4ZRZA 1JE5A 1V43A 3CW2C 1SYFA 5IGEA 3S9WA 5LMUQ 4IPGA 1I6HH 1GHKA 3GTGB 4ZUIA 1CHQD 4F7XA 1D1IA 2E75C 4H0LC 3A5UA 2JA5G 2KCNA 2QCPX 3HOYG 2LTLA 1EY0A 3OWEB 2IWHA 2B8GA 2K05A 1B9MA 3MXPA 4PMBA 4FXDA 5COYA 4BBRH 2RSOA 5EGTA 4C3JG 1O7LA 2I46A 4HIMA 1C7YA 2VQFH 5C4ZA 2QEJC 4DAYB 1XPRA 1WTVA 2K75A 3GTMH 1YI2A 3K80C 1U9RA 2F0MA 3QOJA 4C2MB 2BOSA 4PZ6A 2WV6D 3K7AH 3ULJA 1TWFB 1VCIA 3HP3A 1X56A 4A76A 4J1MA 5IGBA 4A3JG 4LF5L 1SNCA 2V1CC 1SROA 1RTNA 1LTLA 3J7AV 3Q6SA 2CFMA 4ID6A 4R4TA 1B53A 4DV3H 2R7ZG 3MXNB 2B2VA 2OQ0A 1L0XB 5C0XI 2LF0A 1A8VA 2ZTEA 5JPNC 3URYA 4LNQA 3D3RA 3UDFA 1D2BA 2K5WA 2O4XA 1I6HB 2KQ3A 4LK1C 2JA7H 4WJ4A 4QMFB 4YHHH 3LX0A 1X3EA 1E22A 4LFAH 5HURA 4KHZA 4NZRM 4PMCA 3NBHA 2FHTA 2KA7A 2EYMA 1IBKQ 1EIHA 3DM1A 2VZAA 5CV5A 2E5LH 1LTAD 2XNAC 5IE8A 1X4MA 1GXDC 4BBRB 1VQFA 2M2LA 1B9NA 5E7NA 3T13A 4DR3L 1CM9A 4JYAL 2EJGC 3NQTA 1TS3A 4K5XA 4GLXA 1EYDA 3L7ZC 3GTMB 1A3VA 4Q0FA 1VQBA 5IWAL 1D5ZC 4GLVB 4DR1L 2MHVA 3K7AB 2Y0SG 5CORA 2KHSA 5IODA 2ZM6H 4Y52H 3T1YH 2WFWA 1PZID 2WKDA 4K0KQ 4BXXG 4LWCA 3TREA 1XYIA 2EJMA 2E3UA 5FJ8H 4KKUA 4HJAA 3TS2A 2JE6I 4IO9A 1A2TA 3BDCA 4DR6Q 5CV9A 1LM0A 3T1HQ 3GTLH 2KCMA 4UDUC 4OD6A 5M5WH 3G48A 1Y1VG 1QVGA 1SDFA 4IUTA 1HPCA 3MZ5A 2JN4A 4FJSA 3S17H 4L5SA 4RKLA 1HZCA 4KY6A 3M85A 1ENFA 4JI2L 1KDAA 4NMZA 4JC0A 2JA7B 5FLMG 2KOLA 2YU9H 2ZQEA 2QNDA 2FMMA 1PYWD 3PO2G 2A6HC 1FYCA 1E7ZA 4DR5L 4LUZA 4KN4C 1PRTD 3TP7A 1MSHA 5E1FA 4HN7A 2JA6H 1OXUA 1XNQL 3U4VA 2F3WA 2HCIA 4MTNA 1N36L 2EY1A 4LFAL 5M3MH 1IW7C 3OPOA 2B63G 3BVGA 1C0AA 1V1PA 4NXML 2LMCB 2CTKA 2BL5A 1SSOA 3DEOA 1PTOH 1EY5A 2IX1A 1A15A 5BR8H 1I4HA 4DKAC 3D8GA 1E2ZA 2QEXA 4YWLA 4IFDG 3S2DH 3PO3H 3Q24A 4B3MQ 4JBMA 2DJFC 5ELFA 3M3YH 4B3RQ 2UXDH 3GTLB 1X9ZA 5AFWA 5M5WB 2PY9A 4IPHA 1I5FA 1TS5A 1W6KA 1J9OA 5EQ0A 2P5ZX 5CGKA 3TP6A 3S17B 5M3FG 1KDBA 1V8QA 1IZ6A 1K73C 2YU9B 4PZ8A 1EZ8A 1J5EH 2EY5A 3OTOH 4H02A 1K9MC 3C1FA 2QGQA 2K6AA 4DV7H 2F4VQ 2BE5D 2IJ0A 4NP5A 1GUOA 1PTOC 4DNRB 2F0TA 3QOLA 1G91A 3S1RH 5M3MB 3S2HH 1PTOB 3ULPA 4DK6C 4OEMB 1LTID 4POFA 3CU7A 3H09A 4I65A 5LHY1 4K8JA 5M5XB 2HH3A 5EKLA 4GN4B 3TZDA 4B9XA 1B3QA 4LF7L 1YVCA 2RDGA 2I5LX 3PO3B 4IURA 3S2DB 4AYBB 4GZYC 2HCCA 3GD7A 4C1NI 2CTJA 3M3YB 5IP9H 1JQYD 4JBJA 2VQFQ 2D0OA 2A68D 1EU3A 3KUPA 3F2UA 4C3IH 1FVIA 2B2YC 3J81L 4JG2A 3UDIA 4CJ2C 2B2UA 2K5DA 3I7FA 2CW0D 4CDDC 1NSNS 1TIID 2WIIB 5ELEA 4LF4H 1AE3A 4GKJL 3BZDB 4R4OA 4DR2L 1KLUD 4DV1L 3BZKA 1VIGA 5ELOA 3M4OB 1S4ZA 4H8AA 1HNXL 4X65L 5C44G 2L15A 2LFNA 3FHWA 1R9TB 2ES2A 1EY9A 1GUGA 1O7IA 4TSSA 4DV3Q 4LJZC 4JI6H 2D2CC 1Y14B 1N34L 2EOTA 3S1RB 4X3UA 3D31A 1U0LA 3S2HB 2HHHL 1I50H 4A3IG 1IKMA 1LACA 4DXGA 1GJXA 2WB1E 2F0UA 1CFMA 4YHHQ 3GDEA 2RKSA 4LFAQ 1JOKA 3OSOA 5CC4A 1EIYB 3HOUG 2RA4A 1I4XA 1QE6A 5C3EG 2LXKA 2E5LQ 1N33L 1C48A 3I72A 1KNAA 1LTBD 4IUUA 1I6VC 3KLWA 4CDFC 2OPVA 2K1BA 4C3IB 1HXYD 3LWEA 4GNXA 3MVVA 2BDNA 3NBIA 5BN4A 2Z9HA 3T1YQ 2ZM6Q 4QQBX 1KIXA 1YNND 4ZKBB 4F87A 2ZXRA 1VMPA 2H4OA 4TQUS 1FJGH 1NJIC 3MC0B 3CC4A 2Q2UA 2HDLA 5GADC 4IALA 4XXEA 4K6LA 5CV7A 3QB3A 2IX0A 2IHFA 1YJ9A 1R4QB 3HG9A 1I50B 1PA6A 1PH6A 3GR5A 3KJOA 4MZ9A 4B3SH 2UXCL 4RKBA 4NZTM 1BCPB 3V69A 4ILWA 1CHPD 2RHQB 1PH5A 2LRRA 2B2YA 2JA8H 5C5LA 1VQ7A 2E8GA 4LF9L 1O7ZA 4CHTB 2AQ3B 2XSCA 3H0GB 1CZGA 1D5MC 1VQKA 2KJXA 1BR9A 5EKKA 4X66L 3W2DA 5C6AA 5E3FA 1SE3A 4IUNA 1H9SA 1X55A 5KYIA 3K59A 1S3OA 2EQSA 1BBXC 2X69A 4Y7NH 1ILQA 1HHVA 4HSPA 2EXDA 2NVXH 1LTTD 3I91A 3DM3A 5BR8Q 2O4CA 3KDGA 4IUPA 2R92G 1SNOA 1XMQL 2A1AA 2HIXA 1CKNA 2A6HD 3P20A 1I94H 3NWTA 4A93G 2OF1A 4J15A 2VL6A 1SJHD 3K8AA 2CTEA 2L4NA 5FKAC 4P74A 2UXDQ 5C4XG 4A3FH 3I70A 1SYGA 5CBAE 2UU9H 1W2BA 4DV0H 4JI8L 3AMUA 2KCTA 3RD4A 3I73A 2BH2A 3VYUA 4BBSG 4KHPH 1SNPA 1ESFA 2WB1G 2CWAA 4JI5H 1WTXA 4UP8A 1ONLA 1VQHA 5BN5A 4L5RC 5LL6b 2JYOA 4JW0A 1F77A 3K5LA 1XRHA 1XMOL 2CH4A 4C3HH 1U5KA 2HQEA 1K8MA 5LMNW 3SXHA 1J5EQ 3OMCA 3OTOQ 3KLSX 2JA8B 3TEHB 3VYSA 4ODGA 1SE8A 3GTQH 4DV7Q 4FF1A 1L1OA 2IW3A 1EQVA 1BVSA 2KENA 3FPPA 1PFMA 3CRLC 1UEAB
chains in the Genus database with same CATH topology
4UP9A 4Y7NB 3CMEA 3GP7A 2NVXB 1YBYA 3MHBA 2JSOA 2BA1A 1D7QA 1F2LA 3QJYA 1LT3D 2HH2A 3B6YA 1DD2A 2JQOA 1QOHA 3NPPA 3PIPA 3A7AB 5EPKA 4A3FB 1YHAA 1PTOD 3A7LA 2YTVA 4JBKA 2L0CA 1JT8A 5JJIA 1G8ZD 3PSIA 1OXVA 1WJJA 3E9IA 3GTOH 1JWUD 1EY7A 4K2LA 1EQRA 5IIFA 1H9MA 4LF4Q 1PHJA 1J5KA 5DAUA 1I4RA 2NTSA 2R7DA 2PO4A 1KXLA 1JWMD 1KHIA 2Q8TA 4K2KA 4QMGA 4ZYSA 4XIGS 1GKHA 4C3HB 4ALPA 5LMUL 1JJGA 1G2TA 2L9HA 3RMHA 1HH2P 4DXFA 3V2TA 3NUCA 3GTQB 1EQTA 4UY8C 2PQEA 4S3SA 2CCZA 4G7HC 1N9WA 1CTMA 4DA2A 1K8GA 2EYPA 5KNCA 2QF7A 4JI6Q 4JVYA 3I4NG 1FGUA 2X6LA 1MJEA 4O42A 2H1EA 3Q22A 4PZ7A 3LNNA 5I6WA 4F88A 3JAMc 1ZZJA 1WCMG 4X3KA 4A3MH 1H95A 4GN5A 2IPKD 3HEJA 3U9SA 4FO2A 2CVRA 4ULLA 1PRTC 5EBDA 2F0OA 5AJ3Q 3ERSX 4GOPB 2TMPA 2FXQA 1RDPD 3EROA 4KHVA 1KNEA 1G291 1TWGH 4A3LG 1HR0W 3HOZG 3GTOB 3MAQA 3I8ZA 3TZUA 2L1BA 2B2TA 4HJ5A 1KABA 2VNUD 4P72A 4UAIA 3HKSA 1E3PA 2HIVA 1GOZA 1RL2A 1ZZIA 3KBGA 3J81E 1NE3A 3OW7A 1VQDA 1FJGQ 4GLAC 5A35A 4FVMA 4FF3A 4AYBE 1VQPA 3AEVA 2F52A 4OHJA 5IGDA 1HCZA 3A56A 2VY3A 2AWNA 2VB2X 1NY4A 3GTGH 1NCVA 3KF6A 4B3SQ 3RR5A 4KI0A 1VQOA 5D3DA 3CRKC 4A3MB 3HOWG 2PZTA 1STEA 3D4WA 3MFYA 3VA5A 2WAQB 2BE5C 1DGSA 2O5JC 1QWYA 3VDYA 2ZXPA 4K0KL 1WD1A 1TWHH 5ELCA 1E1OA 1BCPD 1TWGB 4DNIA 3R2TA 3EN2A 1OXTA 3ND9A 4OONA 3OW2A 3I55A 4DR6L 3AQQA 3SE0A 5D65A 3T1HL 3HOVH 3S16H 2XRSD 4V190 2PMZB 4QIWB 3K58A 3NK9A 3U4ZA 4DF7A 3EJIA 3CHBD 4AH6A 1I94Q 1YJNA 3GTKH 3RLNA 1JWSD 5JJKA 1O7YA 4KK7A 4QUCA 1B1ZA 2A68C 3IKJA 1JC7A 4RAUC 1QNKA 1I3QH 2CTFA 2UU9Q 1HFGA 4DV0Q 2CW0C 3R2IA 1H9KA 4KHPQ 4X6AH 4TKOB 4B9WA 2NTTA 4JI5Q 4LUOA 2C9OA 1B2TA 2LSSA 4TRDA 1B70B 1WOCA 2NN6G 1X3GA 1KAWA 2L55A 1M1KC 1YNXA 1HQMC 4J6HA 4NBQA 1U4MA 1C8CA 1WTRA 4XYQA 1BDOA 4ZLTF 1D8LA 2YYZA 5IYCH 1UWVA 2JA6G 3SGIA 2K28A 2ICIA 1TWHB 3K0YA 3UI2A 3QWNA 4A3DH 5M3MG 4B3ML 3J7ZC 1TXYA 5A2QL 3VR4A 1KTKA 1QB5D 1EFID 4EGVA 4B3RL 1A3TA 3HKZB 3HOVB 3S16B 4RA8A 3KBXA 3PUZA 1UE6A 3L0OA 5C0XH 4FYDA 3L9AX 2EDGA 3GTKB 1LTRD 1K1GA 2R3ZA 2K5NA 1TS4A 4OWXB 4YCWA 1S40A 3PO3G 3TQYA 4JI3Q 4AYBG 1SNQA 4NPSA 3CCLA 1LT4D 3SK5A 3BDLA 4QUFA 3BJUA 2BH8A 1I3QB 3CCRA 3ZYYX 3CC7A 4WFN3 2K52A 4YY3Q 3DUZA 1STBA 2ZJQA 1SRUA 2NZOA 1EEID 1CKMA 2F4VL 1CT1D 1YNNC 2OQKA 1JB7A 1HUNA 3J7A5 3DLLA 4RMFA 2B8FA 3N6RA 3CCMA 1RODA 1QILA 4BA2I 1IL8A 2F0IA 2ALYB 2RSNA 5ELNA 4C56C 4KY5A 3J81j 3AFQA 1HUMA 2Z8LA 5T1GA 3A8KE 2F0NA 1EYGA 4Z9CB 2ASBA 4A3DB 1U4LA 1DOKA 2WP8J 1ET9A 4NW2A 4CGYB 5D14A 2VQFL 1E2VA 1U4RA 2KECA 4AQYQ 5IYBG 4NDXA 1Z6HA 3SK6A 3J80c 4DV4Q 3T56B 2EIFA 3K5OA 2ZTDA 2LS01 3TN2A 5ISRA 2MO1A 1QUQB 4IZ8A 5CBEE 2DY8A 3NTHA 4A3GH 2I5MX 3VKEA 4DAYA 2Q8RE 5E4WC 4DV3L 1ENAA 2FMCA 1JB3A 2HQLA 4K8IA 3GV6A 3H6MA 3T51B 3K5MA 1PXUA 3DXJC 2JVZA 1HTLD 1SBBB 3NSWA 1PFSA 1JCKB 1X4NA 4I7ZC 4OIKA 3M4QA 5IYDG 3BZCA 1A0IA 4GKKQ 2EYOA 4XYOA 1XTCD 1WTPA 3M4PA 4YHHL 5FO7B 3IFTA 3M4YA 1HRJA 3MXGA 3G4SA 3VR3A 3MXNA 1CK1A 3LWUA 4FXGC 3J80E 3HOYH 1SNDA 4MNOA 2R7FA 2MUYA 2E5LL 2F3IA 2NN6I 2EYJA 5TSSA 4G7ZC 5M5XH 1STNA 1PYSB 5HGQA 2IT1A 3W1BA 1NAPA 4V0BA 1PRTF 1J8IA 1AW7A 4A3EG 5LL6X 1TU2B 2AUJD 3NQIA 3FP9A 4DUYQ 3T1YL 2ZM6L 2K5VA 2K4KA 1QZGA 1Q7YC 1D5XC 1X3FA 4JI7Q 4IPCA 4RHSA 1PVOA 3TBIB 3U1KA 3W3AA 4A3GB 4YCVA 2JZXA 1XWEA 5DLQE 3MA2B 3J81i 3PIOA 2R7ZH 1HZAA 1LABA 1STGA 3K0XA 3A74A 1FNUA 5FO9B 1MJCA 2PW7A 2KHIA 2ATWA 3M4OH 4CJ0B 2A8VA 2K5QA 1R9TH 1HNZL 2JEAI 2I07B 1K8OA 4LFCQ 3OYYA 3VYTA 2ZXOA 1KAAA 3QG1A 3TS0A 2Z6KC 3HOYB 2H5XA 3STBC 2ZJPA 3S24A 3HFZB 5GAGC 2TSSA 3DWPA 5BN3A 1JOQA 2PQAB 5CYUA 2Z4IA 4BY7G 2JA8G 5HY6A 5BR8L 4U68A 1GO3E 4BXXH 1RJTA 4IPDA 3JAML 4WORA 1B50A 4A3JB 2WINB 2N88A 3KK7A 5C0XJ 2PNHA 1J6QA 2D5DA 1XPOA 4IUQA 3RNUA 1SMYC 3TP5A 1SLJA 4R9WA 4HTHA 2UXDL 4QB4A 2R7ZB 4KTAA 2AKWB 4DNTB 1TUAA 4IUVA 1Y1VH 2K33A 1BKBA 2B2WC 5DM63 1K0RA 4DR4Q 4X3TA 1SAPA 1EIFA 1NUCA 1HA5A 3CCQA 1VQ9A 4R8NA 3PUWA 5FLMH 3F2BA 1ILPA 4RG1A 4A3FG 3D6CA 1GUSA 1J5EL 2MGSA 3PO2H 2PNRC 3OTOL 1C4QA 2F0WA 4A3BG 5EPJA 1L2FA 4N9TA 4DV7L 2ENBA 1TS2A 1K8AC 4JOIC 1Y1WG 1YIJA 5KNBA 3KF8B 4L6TB 3SK8A 3T16A 2B63H 4JVHA 2GVAA 4C3HG 5JPMC 3H0GH 1Y8OB 2KEDA 4GN3B 2J4XA 2Y0SB 5CV4A 2IHEA 4UP7A 4JI4Q 1F2MA 4K6DA 3K5NA 2F0DA 3DMUA 2KCCA 1SEBD 5C3XA 4EQPA 1FGBD 1PFNA 2ANRA 3CP0A 3I2ZA 1VIHA 2AHOB 3C3LA 1GUWA 3S15H 3IAYA 3BU2A 1EFWA 3I3CA 2CTLA 4DAPA 4IFDI 1Y1VB 3X3NA 1IBMQ 1MSGA 4HMIA 2O5IC 5C3WA 1EWIA 1LT5D 4WJWA 3DEPA 4LF4L 1WVNA 1KQSA 4OWWB 5A2QE 1KRTA 1ZTGA 1CA5A 2K7VA 5CMDA 1WE8A 1BCPC 3PO2B 4DK3C 4A3KG 3NTKA 1HNZQ 3ONAB 4B3TQ 4DU9A 3BVZA 2V4DA 3U50C 4K5WA 1TT2A 4DPGA 2KHJA 2OTJA 4YCUA 4JI6L 3HKZE 4DV5Q 2B63B 1AZQA 2SNMA 1FNVA 5IGFA 5DNFA 3H3VH 3ICEA 2BA0A 3NE5B 2KVMA 1G51A 2R93G 1BXTA 1Q82C 1QVCA 3TSSA 3KDFB 3H3VI 2FFKB 4QL5A 3X3MA 3CKIB 5I6YA 3NHHA 3NP8A 2FINB 4PG3A 5AJ3L 3OWFA 3S15B 3S1NH 1E1TA 4A3CG 1F2YA 5J22A 4KD3A 2F0GA 3R93A 3I56A 1S5BD 5K36G 1YHQA 3BYYB 4KJNA 1Q8IA 2JJQA 4LF8Q 3FEWX 2F0SA 1JE4A 4KY7A 4JI0L 1KHMA 1ESRA 4JOIA 1A6XA 3E0EA 4PNYA 3GV3A 1SR3A 1FJGL 1ENCA 3TRZA 1BO0A 3HOXG 3SVMA 1IHZA 5I2XA 4HAEA 1VQ8A 3IL8A 1B8AA 2E2DC 5T1IA 4A4IA 3G6JB 1B7YB 1VF5C 4IJLA 2DN8A 3L2PA 4B3SL 3NELA 4OO1G 1X32A 3IRBA 2A69D 1M90C 3M7NA 5GROA 3C46A 2VXWA 3CQZH 4NB3A 4B8TA 1PH9A 2X6GA 4TVAB 1OTCA 4UPAA 1AP0A 1VQ4A 2D9UA 1DJRD 1EWHA 4XQJA 1CQVA 3S1NB 4YIJA 5FK9C 1I4GA 3E5SA 1H9JA 4EX5A 1OO9B 3K7UC 3S1MH 3CCUA 3R8BA 4DUZQ 1EQQA 2CHBD 4NXNQ 1D6EC 5KEEA 5KYLA 4DR7Q 4R1JA 2FMRA 2OCEA 1GHJA 2PZWA 2R6GA 1I4QA 1DT4A 5IP7H 5FOBB 1ZEQX 1YJWA 1I94L 4EQNA 2A5HA 3STBD 4DK1A 1J4WA 2F4IA 3CCEA 2JP1A 1C9OA 2UUBL 1H9RA 2OEOA 1IXRA 3J80L 5JEAH 4H13C 3HKZG 2ZJRA 4DN4M 1WI5A 4L5TA 1Y8PB 2UU9L 1PZKD 1SE4A 3J7AF 1EY6A 1AFPA 3FKIH 4DV0L 2E76C 4HCSA 5KNDA 3ER0A 3D6WA 4KHPL 1QCBD 4YWMA 1AE2A 4JI5L 1PTOF 1EUJA 3D4RA 4BY1H 4K14A 2OXPA 3CQZB 3HOUB 3N52A 1SMYD 4P73A 1M8AA 4GOPC 5LL6S 3P75A 2RF4A 1VQJA 2D62A 1O80A 3ULLA 3S1MB 1E2WA 1BBUA 1VQGA 1P16A 4IN3A 3RLFA 4R4QA 1WYDA 2NVQH 1IL2A 1BBWA 4BBRG 5HGTA 1WD0A 4JBWA 2K32A 2J7ZA 2F0JA 3AU7A 1EOTA 2OPUA 1S5FD 1JR0D 4A3DG 4G7OC 2EPBA 2RCNA 4JI3L 5NUCA 3CCVA 1T5XD 4LF6Q 4OX9Q 4HEDA 1TR5A 2Q2IA 2A73B 2PZUA 4JI0Q 5C5MA 1XX8A 2LKVA 3JAME 1MKHA 3CCSA 3FKIB 3NENA 4YY3L 3HZXA 1ZZKA 4U673 4BBSH 5DM73 1OXXK 2EY2A 2IL8A 3F2CA 1B4OA 3P1HA 3U9OA 1FD7D 4BY1B 2EVBA 2VUMH 1NBWA 1VQNA 2RDHA 2LXJA 2NVTH 1ML0D 1XTDA 2JK8A 1CUKA 2WKCA 1UE5A 3WWVA 3W1GA 2JA7G 3WDNA 3NWSA 3PUVA 4LFBQ 1FL0A 3V96A 3VA7A 3CCJA 1WVLA 2DUDA 3I90A 4H44C 4RH6A 4FF4A 1V1OA 4WJ3M 2QDBA 2NVQB 1N32L 5M9OA 4P75A 1VQ6A 2B2VC 3HRZC 2HT1A 1TQOA 2SOBA 4AQYL 1XPUA 3BDOA 1K83H 4A93B 1QJOA 4DV4L 4JV5Q 1SYDA 2AUKA 3UDGA 4DGZA 1PH7A 3PGZA 4PV1C 3RN5A 2AQ1B 2K50A 1X6OA 5FJ8G 4ZKCB 3AFPA 2SEBD 3W5OA 2UUBQ 4BBSB 4LIJA 1Q90A 1CKOA 2ZT9C 3C1EA 1ZXTA 3ND8A 1PH1A 1CI3M 4GOPA 1BCPF 2PYKA 2MNAA 4HSVA 3UE1A 2VUMB 3NBHB 1ASYA 1VF7A 2NVTB 3T4AC 1IBLL 1AZPA 4J8QA 2NUCA 4GKKL 4LAAA 3RZOB 3F8TA 3S14H 4DV6Q 4X62Q 2M00A 3I4NH 1NR4A 5LMNQ 4OWTB 1VDZA 4L5QA 2AWOA 1JJCB 4EVOA 2N78A 3MFGA 4QCLA 4JI1Q 3AYHB 1EU4A 1HQRD 2K01A 1WCMH 1IYJB 5EKIA 4DFAA 3FMCA 1HA6A 1ZKOA 1VQLA 2OTLA 2RHSB 3H94A 2K5HA 1YHBA 1K83B 3GO5A 5EJWA 3EIVA 1V9PA 1DOMA 2Z1CA 4DUYL 3I4OA 2K14A 3OHXC 1LT6D 4CKBA 1KC8C 1ASZA 1DYQA 4JI7L 3E6ZX 3I4MH 1YNJC 3KJPA 4A3LH 3HOZH 2CPQA 1UEBA 3JC66 2PW5A 1EOVA 3G71A 3OOCA 1PYBA 2DNCA 4QJFA 4BS9A 1UUPA 5JEAJ 1UE7A 3D0FA 1TWAH 2C5CA 4DV2Q 4HJ9A 2WACA 3EFXD 4KV6A 4FP5D 2KBNA 4DK0A 1EL0A 4LFCL 3PUXA 3OIPA 4A75A 4IJHA 3S14B 4L8JA 4R4CA 1V1PB 2F0KA 5IGCA 3I4NB 1BF4A 3J7YW 1AH9A 5EBCA 3BS1A 1Q1BA 1S5CD 1Z7TA 4ME5A 1U4PA 1WCMB 2UUAQ 2PI2E 3E0JA 2F0VA 3HOWH 2JA9A 3NXWA 1IKLA 3PMFA 3KLSA 4HCEA 3WOFA 1F2ZA 3CXCA 2UXBQ 1N32Q 3A5ZB 3I4MB 4G4KA 3FVQA 1MIUA 5CV8A 3P7JA 3HOZB 3G7LA 4FXKC 1NTGA 3WOEA 5GAEC 2P2RA 1WTQA 1T9HA 5IP9G 4HIKA 4C3IG 4OXPA 1TWAB 2A6EC 4DR4L 2PPBC 2MQHA 1HR0Q 2G9DA 3MXUA 1HZ9A 2NZHA 1ZYRC 2E2JH 4RGMA 5CR3A 4IQZA 2VQEQ 4XQNA 5JVH3 1IBLQ 1VQMA 1NMFA 2F0PA 2XWJB 1QG7A 1EWCA 5E4XA 2SDFA 3PIO3 2XWBB 2XIWA 2LY7A 1XNRQ 2JA5H 4O0AA 4L63B 1MD2D 3EQLC 2NN6H 3HOWB 3D4DA 1PLFA 5J39A 1X65A 2B2UC 1FR3A 4CKEA 3ITPA 3SK4A 4C3JH 4JI4L 1YZ6A 2YQRA 2OWOA 1Q8KA 1V1QA 2EYLA 2BCOA 4MIUA 2RQXA 5JVG3 1SNMA 4HIDA 1QZHA 4IOAA 1MI2A 2YV5A 5JJLA 3H0GG 4F8MA 1RIPA 2A69C 3RLOA 1P8LA 1IBML 4A3JH 1A2UA 5GAHC 1LUZA 1VQIA 5IT9c 1LO5D 2OT2A 4R8IA 2QA4A 5DEHA 3JAMi 2E2JB 4DAMA 4WRDA 3RZDH 1AN8A 3GTJH 4EQOA 3CAMA 3SDZA 5C4HA 3K57A 4LF5Q 2EYFA 3CC2A 4B3TL 3R3OA 1RKNA 2A19A 5J3BA 2MFIA 3DWAA 2ZTCA 1TY2A 1PH8A 2N3SA 5J1ZA 2JA5B 3F2DA 2EZVA 3C2PA 2HDMA 3AB9A 4DV5L 1SYEA 4P2CB 4GNXC 1QUQA 5FLXL 4RGTA 1DTJA 2CWPA 2M9VA 4C3JB 4K5VA 5ELDA 1SJED 3TDQA 2F0LA 1RCVD 4GNXB 5IT9E 2K04A 2JA6B 4KMUC 4HMJA 1VMCA 2R61A 3LGJA 4MN3A 2F0FA 1F9QA 1Y8NB 4X64L 2YTYA 2A74C 3PCOB 1Q46A 5K5PA 1S72A 4DR3Q 4OIJA 2ICEC 4JYAQ 1Z9FA 5IYBH 2EYHA 1E24A 1LYLA 2AMCB 3I4LA 5IWAQ 4DR1Q 1PMRA 4LF8L 1JOOA 2E2HH 1CQFA 3RZDB 3GTJB 2F1MA 4PMWA 1AEXA 1IYVA 3KLRA 4KKTA 1G2SA 2NZ1D 4RFBA 2WAQE 3KYHC 1CZWA 1KD1C 1IYUA 5IY0A 1HTPA 2PCFB 2Q8IB 1T5EA 3RN2A 1WTWA 5EPLA 3PUYA 5IOCA 3EA6A 5IYDH 1A3UA 1CSQA 4JI2Q 1Q12A 3VR2A 1H9SB 4KD4A 4ZQ3A 2Q2TA 4BWGB 2PMZE 4QIWE 1YNJD 4HIOA 3PF4A 1RTOA 3MEHA 4APVA 3O13A 1PH2A 4DR5Q 3T53B 3H91A 2UUCL 1GM5A 1CKNB 2E2IH 1XNQQ 4B08A 5JOBA 2PQUA 4ABNA 1YEZA 1N36Q 4IFDH 4EQ5A 1VQ5A 1X9NA 4A3EH 4R4IA 1R4PB 4DUZL 4NXMQ 4NXNL 4RCOA 3M7GA 2I0QA 4DR7L 2MJ8A 1TKWB 3SEBA 2E2HB 3K81C 4N9PA 4ZAIA 2Z6KA 1DONA 1G6PA 2XN9C 2RDFA 5M3FH 5KRUA 1QVFA 1Z47A 4FDBA 3UE0A 4HJ8A 2PQAA 2VB3X 2BDOA 1K3RA 3EBEA 1L1OC 3BVMA 1KLGD 4WALA 1JMCA 5C4JH 4H7BA 2MJHA 3Q8DA 3DHQA 2EE1A 1SN8A 2B3GA 5FO8B 4DAVA 1PH3A 2F0QA 3KFUA 5IP7G 1EC6A 1E0BA 2B29A 1S5DD 3H15A 3MWYW 1L1OB 2C35B 1RHPA 5KIXA 1O78A 1LTSD 1PFBA 5JEAG 3NTIA 3TMEA 4XT3B 2DGRA 3FKIG 3NEMA 2XRQD 2AQ2B 4O2DA 3CF5A 3FRPB 3BG3A 2E2IB 2B2WA 2MPMA 1G6ZA 1X54A 4KN7C 2F0HA 3MTSA 4BY1G 2A6ED 4A3EB 1GVPA 4ZK9B 1VQEA 1II3A 4X64Q 4BY7H 4WANA 4LMQD 3KOJA 1ZYRD 3FPUB 2EXZA 1I4PA 4CBVA 4A3MG 2L5TA 1VQAA 3CD6A 3RUZA 5M3FB 4C1NK 2CKZB 1DCZA 3BYTB 4LF7Q 3KF8A 3GTPH 3FDTA 2WAQG 4BA1I 1WTOA 2YTXA 4AIMA 4OX9L 4LF6L 1HZBA 3SHLA 5C4JB 3A55A 1X3PA 5C44H 3A54A 1W3SA 3PIP3 2CQAA 3HGBA 1XJVA 3H3VC 4GKJQ 2IY5B 4DR2Q 4DV1Q 4XDXA 1L0WA 4RCNA 4A3IH 4A3BH 2AXYA 1EYAA 3J80i 1IW7D 1HNXQ 1PZJD 2N55A 4X65Q 2CTMA 3OMGA 1F9RA 5CV6A 1SE2A 1BNZA 5F2DA 3HOUH 1Y1WH 1XXGA 2G9HD 1F9PA 4LFBL 2JXMB 5C3EH 1N34Q 4ME3A 2F3VA 2VUMG 2HHHQ 4BY7B 2UUCQ 3DWQA 3K6OA 3PF5A 2B2TC 1VS0A 1A63A 2F03A 4KKSA 5D3IB 4M1UB 2KUMA 4P71A 1F9SA 1SYCA 4JV5L 4RWSC 1HJPA 1Q86C 3GTPB 2QKIC 1QNUA 1TWCH 2GA4B 2K03A 1N33Q 1MBYA 2NBFA 3VYRA 3OIQA 1GUNA 3S1QH 2ANNA 1Y69U 2DNEA 1NMGA 3A0JA 1YITA 3Q0AA 1KDCA 2CQOA 5C44B 2NVYH 3M9BA 4GS3A 3KDFA 1HNWL 1BUVT 3VR6A 1LV9A 1STAA 1DZ1A 2MP1A 5FLXc 3AEVB 5I4DA 2Z0SA 3HOVG 3A8IE 3CMAA 1DOLA 5I9OA 2Z4HA 5JAVA 5H1SE 3IFDA 3KF6B 4FNFA 3A8JE 4A3KH 4A3IB 4A3BB 4HR7B 1N8RC 4KLKA 1D1KA 4XQQA 1UNSA 1DM0B 4RGNA 4O1NA 1UE1A 5IGGA 2PI2A 2E74C 1LLRD 4DV6L 4X62L 2L11A 4JK1C 1Y1WB 5LMNL 3SR1A 1Q3LA 5C3EB 1SFOH 5I9PA 1VQCA 4JI1L 3VR5A 3U58A 1EY8A 2QILA 2VS1A 2UXCQ 3CPWA 2GVBA 2R93H 3QIAA 3MEFA 2HUGA 4M8AA 1STHA 3UDXA 1RF2D 1SXTA 2GN5A 3GQBA 4IFDJ 4MHEA 4CKCA 1TVXA 4XT1B 1W6JA 3G6EA 4XTCS 1EYCA 3L3OC 4RGOS 3TP8A 5FLXE 4LW1A 4LF9Q 1TWCB 5KGUA 1EEFD 1B3AA 3J81c 2R92H 3Q23A 4X66Q 3ZJYC 4A3CH 5IYCG 3S1QB 2SNSA 4A93H 1FNWA 1A62A 1HFNA 2O2LD 2NVYB 5K36H 1ICWA 3QO2A 1KRSA 1ET6A 4KJOA 5C4XH 1JORA 1GUTA 4QGUA 5JJZA 3HS0C 1SYBA 2EY6A 4HJ7A 4DV2L 2DY7A 1XMQQ 3CPFA 3I4MG 1PRTB 5C0XG 4A3KB 4POGA 1EIGA 2J0TD 5M5YH 3E9HA 4FF2A 5GQOA 1BOSA 5IT9L 1TY0A 3PV0A 4QF4A 4LUVA 3HOXH 1DXMA 4AM3A 3F1ZA 4RHRA 4JCVE 1M4VA 1SFOB 4JI8Q 2DGYA 2RVLA 1GD7A 3RZOH 4OO1H 2UUAL 2D0PA 2MO0A 3EVQA 2R93B 4X3SA 5EAYA 2XTIA 1WFQA 1XMOQ 1OXSC 4OO1I 1SMXA 1CA6A 2XVSA 1X3QA 2ID0A 1IBKL 2UXBL 1Q81C 5I2YA 2NB0A 4IOCA 2FJ2A 2R92B 2F0EA 1PV4A 2NWGA 1L0YB 1RD9D 4OGQC 1PDQA 5G3LD 1STYA 2KEEA 4G57A 4QY7A 1B44D 1UAPA 2NYZD 5C4XB 1PH4A 1JICA 2VW9A 1BQQT 2Q2HA 1HNWQ 1HR0L 4E6IA 2L12A 4C2MH 2EJFC 2WB1B 2B39A 4PQXA 1S5ED 1NR2A 1CSPA 5M5YB 4YWKA 5ELBA 4OL7A 1TWFH 2VQEL 3HOXB 2Y0SE 2N49A 2XGTA 1LTGD 1JJ2A 2IX3A 4Q5VA 5G3LF 1EZ6A 1MGSA 2JEBI 2N8NA 2RBMA 4A3GG 1EY4A 3V05A 2I5HA 4CJ1B 1KL9A 4NKLA 1Q1EA 3ERQA 1XNRL 4ZUJA 4ZRZA 1JE5A 1V43A 3CW2C 1SYFA 5IGEA 3S9WA 5LMUQ 4IPGA 1I6HH 1GHKA 3GTGB 4ZUIA 1CHQD 4F7XA 1D1IA 2E75C 4H0LC 3A5UA 2JA5G 2KCNA 2QCPX 3HOYG 1EY0A 3OWEB 2IWHA 2B8GA 2K05A 1B9MA 3MXPA 4PMBA 4FXDA 5COYA 4BBRH 2RSOA 5EGTA 4C3JG 1O7LA 2I46A 4HIMA 1C7YA 5C4ZA 2QEJC 4DAYB 1XPRA 1WTVA 2K75A 3GTMH 1YI2A 3K80C 1U9RA 2F0MA 3QOJA 4C2MB 2BOSA 4PZ6A 2WV6D 3K7AH 3ULJA 1TWFB 1VCIA 3HP3A 1X56A 4A76A 4J1MA 5IGBA 4A3JG 4LF5L 1SNCA 2V1CC 1SROA 1RTNA 1LTLA 3J7AV 3Q6SA 2CFMA 4ID6A 4R4TA 1B53A 2R7ZG 3MXNB 2B2VA 2OQ0A 1L0XB 5C0XI 5JPNC 1A8VA 2ZTEA 3URYA 4LNQA 3D3RA 3UDFA 1D2BA 2K5WA 2O4XA 1I6HB 2KQ3A 4LK1C 2JA7H 4WJ4A 4QMFB 3LX0A 1X3EA 1E22A 5HURA 4KHZA 4PMCA 3NBHA 2FHTA 2KA7A 2EYMA 1IBKQ 1EIHA 3DM1A 5CV5A 2VZAA 1LTAD 2XNAC 5IE8A 1X4MA 1GXDC 4BBRB 1VQFA 2M2LA 1B9NA 3T13A 5E7NA 4DR3L 1CM9A 4JYAL 2EJGC 3NQTA 1TS3A 4K5XA 4GLXA 1EYDA 3L7ZC 3GTMB 1A3VA 4Q0FA 1VQBA 5IWAL 1D5ZC 4GLVB 4DR1L 2MHVA 3K7AB 2Y0SG 5CORA 2KHSA 5IODA 4Y52H 2WKDA 1PZID 2WFWA 4K0KQ 4BXXG 4LWCA 3TREA 1XYIA 2EJMA 2E3UA 5FJ8H 4KKUA 4HJAA 3TS2A 2JE6I 4IO9A 1A2TA 3BDCA 4DR6Q 5CV9A 1LM0A 3T1HQ 3GTLH 4UDUC 2KCMA 5M5WH 3G48A 1Y1VG 1QVGA 1SDFA 4IUTA 1HPCA 3MZ5A 3S17H 4L5SA 4RKLA 3M85A 4KY6A 1HZCA 1ENFA 4JI2L 1KDAA 4NMZA 4JC0A 2JA7B 5FLMG 2KOLA 2YU9H 2QNDA 2FMMA 1PYWD 3PO2G 2A6HC 1FYCA 1E7ZA 4DR5L 4LUZA 4KN4C 1PRTD 3TP7A 1MSHA 5E1FA 4HN7A 2JA6H 1OXUA 1XNQL 3U4VA 2F3WA 2HCIA 4MTNA 1N36L 2EY1A 4LFAL 5M3MH 1IW7C 3OPOA 2B63G 3BVGA 1C0AA 1V1PA 4NXML 2LMCB 2CTKA 2BL5A 1SSOA 3DEOA 1PTOH 1EY5A 2IX1A 1A15A 1I4HA 4DKAC 3D8GA 1E2ZA 2QEXA 4YWLA 4IFDG 3S2DH 3PO3H 3Q24A 4B3MQ 4JBMA 5ELFA 3M3YH 4B3RQ 3GTLB 5AFWA 5M5WB 2PY9A 4IPHA 1I5FA 1TS5A 1W6KA 1J9OA 5EQ0A 5CGKA 3TP6A 3S17B 5M3FG 1KDBA 1V8QA 1IZ6A 1K73C 2YU9B 4PZ8A 1EZ8A 2EY5A 4H02A 1K9MC 3C1FA 2QGQA 2K6AA 2F4VQ 2BE5D 2IJ0A 4NP5A 1GUOA 1PTOC 4DNRB 2F0TA 3QOLA 1G91A 3S1RH 5M3MB 3S2HH 1PTOB 3ULPA 4DK6C 1LTID 4POFA 3CU7A 3H09A 4I65A 5LHY1 4K8JA 5M5XB 2HH3A 5EKLA