2NN6G

Structure of the human rna exosome composed of rrp41, rrp45, rrp46, rrp43, mtr3, rrp42, csl4, rrp4, and rrp40
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
259
structure length
236
Chain Sequence
ARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transferase
molecule keywords Polymyositis/scleroderma autoantigen 1
publication title Reconstitution, activities, and structure of the eukaryotic RNA exosome.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 236
sequence length 259
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nn6G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nn6G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2nn6G03
3J7ZC 1PH9A 5IP7H 2E5LL 2BA1A 4IJHA 2F3IA 2K5HA 2VS1A 1LTLA 4XIGS 3JAMc 4OWTB 5M3FH 2PCFB 2ZTCA 1U0LA 3M9BA 4JI5Q 1MJCA 1J6QA 1D7QA 3VR6A 4JI6L 1C9OA 2JK8A 4IPGA 4YY3Q 2UU9L 2P2RA 2WAQE 3GDEA 1VQNA 2CWAA 1EIFA 4GNXB 1N32L 4GLVB 3CMAA 3PF4A 2QGQA 3FPPA 4DR4L 1RIPA 3QIAA 2KHIA 2DNEA 1XTDA 2K32A 2L5TA 2K5NA 1V43A 3TEHB 3F2DA 1I94Q 2JJQA 1BVSA 4X62L 4R4QA 1CTMA 3GQBA 1Y1VG 4HJ5A 1VQOA 1VQAA 3S16H 4X66Q 1Y1WH 1K73C 5JJKA 2E76C 3UE1A 2CKZB 2Q2IA 3EQLC 2UUAQ 3E0EA 1GUGA 3PUVA 1Y8OB 4KHPL 1KRSA 1SFOH 2FXQA 2HIXA 4JG2A 1H9SB 1SR3A 3S1NH 4HIMA 4DR3L 1UE1A 5FLMH 3MXNB 3MXUA 1K9MC 1K3RA 2A6EC 1UE7A 3F2BA 2KBNA 4OX9L 1EFWA 4YWMA 4A3IG 2DN8A 1VCIA 2Y0SE 2HH3A 2R7DA 2VUMG 4LF9L 4YWLA 3M85A 2E75C 1Q1EA 3GTKH 2JE6I 1K0RA 4PV1C 1FGUA 2VQEL 5IYDH 3M4OH 1XNRL 4LF7L 3SGIA 2UUCQ 2A6HD 4BBRG 4KKTA 1NJIC 4DR6L 2RHQB 2ZTEA 1CUKA 3Q8DA 2AUJD 4RCNA 2PI2E 1HCZA 3K8AA 4IOCA 2YV5A 4HJ9A 4DR1Q 1X4NA 2CW0C 3RZDH 2A19A 1K1GA 1DD2A 3CC4A 1BBUA 1HTPA 1HPCA 4LF5Q 3KLWA 4NPSA 1XMOQ 4H02A 3LNNA 1HZ9A 3HOXH 1GD7A 3JAMi 1KHIA 3M7NA 1PH7A 3T53B 3PUWA 1VQ9A 1FJGL 2I5HA 1DT4A 1YJWA 3PIOA 3L7ZC 3BZKA 1VQ5A 4L5SA 2ANNA 1VQDA 1SROA 4DV3L 4AM3A 3GO5A 1VQBA 1VQFA 1M90C 1K8OA 4H0LC 1VDZA 2HHHQ 3H3VH 2N49A 2LMCB 2BDOA 1TWCH 4JI4L 1B9NA 1Z6HA 3I72A 3I4MH 2RF4A 3HOVG 4HJ7A 1LYLA 1E3PA 1G6PA 4JBJA 3A8IE 1P8LA 1E7ZA 4DV4Q 1YNXA 1KIXA 3A5UA 2Q8IB 5JEAH 3LGJA 1KL9A 2ATWA 2GN5A 1OXSC 2DGRA 1TXYA 1GO3E 1VQ7A 4A3LH 3AB9A 3I4LA 2EDGA 4POFA 3NELA 3TREA 2PPBC 4BA1I 2NN6G 3CCUA 1FL0A 4MTNA 4DV7Q 2EJFC 4HJAA 3I55A 2B8GA 1YVCA 2GVBA 1J5KA 2R93H 1SMYC 3CRLC 4FDBA 4WJ3M 1TU2B 2Q2TA 4C2MH 1VQ8A 4DUYQ 4Y52H 3A7LA 4B3TQ 4HIOA 3PO3H 5H1SE 3HKSA 4C3IH 1CI3M 3KFUA 4DK0A 4MZ9A 3STBD 5GROA 4GLAC 2E5LQ 4IFDI 3W1GA 2LXJA 2YQRA 1HR0W 1X9NA 1HNWL 2H5XA 2ALYB 1SMXA 1GUNA 3VDYA 3RNUA 1TUAA 4R4IA 4YWKA 3ND8A 2CQOA 4DKAC 2B63H 2YTYA 3MEFA 4HR7B 5C4XH 1E1OA 4GN3B 1I50H 5C44H 4JI6Q 4BXXG 1X6OA 2UXDL 3RLNA 3CCVA 2UU9Q 3KJOA 1VQ4A 4KN4C 3S2HH 1Q7YC 1N32Q 3QJYA 4DR4Q 4LIJA 1CSPA 4PZ6A 1Q90A 3AQQA 4JBMA 1B9MA 4GKKL 1CKNA 1L1OB 2ES2A 3CCLA 4NB3A 1H9JA 1DXMA 4H13C 1PH2A 5EAYA 1CSQA 1PV4A 1VQHA 4KHZA 2N3SA 1VIGA 5FJ8G 3RR5A 2CTFA 1M1KC 4AQYL 3TRZA 5JJIA 2CTEA 4KLKA 3VA7A 1E1TA 1JE5A 5JEAJ 5LMUQ 4UPAA 3M3YH 5FLXc 4R4OA 4X65L 4KHPQ 4DV6L 3K81C 1JB7A 4BBSH 3KYHC 4JI3L 1GM5A 3S17H 3G48A 4GN5A 2E3UA 3ULPA 2EJGC 1GKHA 4KMUC 3K7AH 2EVBA 4DR3Q 2I5LX 5M3MG 4A3BH 1AE3A 1H9KA 1YHBA 3CPFA 5GQOA 4O2DA 2B29A 3U50C 2OTLA 1R9TH 4OO1I 1Q12A 2BH2A 3OYYA 3S24A 1XJVA 3L2PA 1G51A 3TS0A 1ZKOA 4LF9Q 1DGSA 5BN5A 5LMNL 4LF8L 1VQMA 2A8VA 3GTPH 4KKUA 5JJLA 1LM0A 4AYBE 3ULJA 3F1ZA 1E2ZA 1G291 1IYVA 4DR6Q 1ZYRC 5C0XG 1XMQL 1L2FA 2EIFA 1ZTGA 4A3GH 4DNTB 2NVQH 1JJGA 1V8QA 2JA5H 1GVPA 1GUTA 3BG3A 3KF8B 3UDIA 2IY5B 1WCMH 1X3EA 2K14A 2E8GA 1L1OC 4B3ML 3PIPA 2DNCA 1PYSB 4A3KH 3FP9A 2B63G 1H9RA 2WB1G 2CFMA 1QUQA 4JI7L 1E2VA 5K36H 2EJMA 4LF4Q 2ZM6L 4B3SQ 1FJGQ 4IO9A 1HQMC 3A8JE 3CC7A 2MQHA 4NXNL 4A3EH 4A3CH 4JI0Q 1B7YB 2NZOA 3DXJC 2CWPA 4A3MG 3DM3A 1CFMA 4P74A 5ELNA 2IHFA 3HOUG 3CQZH 1XPRA 2UXCL 2JA8H 1PH5A 4DV3Q 4QQBX 4WALA 1XPUA 1ZZIA 5DLQE 1Y8NB 2JA6H 1TKWB 4GOPC 1A62A 4A76A 5AJ3L 3TS2A 2ZT9C 1P16A 3CCSA 4NBQA 2OTJA 1NBWA 1I6VC 4JI4Q 5C4JH 1IBML 3E9IA 5IP9H 1IBLL 4L8JA 4HIKA 3AEVA 4GLXA 3STBC 2K4KA 4JI2L 5KNCA 4IPHA 1LACA 1B70B 2MFIA 3PO2H 1J5EL 3RLOA 2WFWA 2LSSA 4L5TA 3HKZE 1KRTA 5IYBH 2VL6A 2OQKA 1V9PA 5J3BA 5IYCH 2K50A 4LWCA 5BR8L 4DR5L 1PH4A 1ASZA 3FHWA 4OWWB 4O0AA 4LW1A 4DUZL 4DV1Q 3EBEA 4JI8L 1BKBA 1W3SA 1XPOA 3ERSX 4LFBL 1PVOA 2AUKA 1VF5C 3W3AA 1HJPA 4DAMA 3KJPA 2KA7A 3D4RA 2BE5D 2BH8A 5M5XH 1SRUA 1GUSA 5HY6A 1LUZA 1Z7TA 2F4VQ 3L0OA 4BY7H 1O78A 1YITA 2Z6KC 2I5MX 3A7AB 2Z0SA 1PFSA 1K8GA 1Q81C 4JBKA 4BY1H 2RHSB 5IP7G 4G7HC 4GNXC 1UE6A 1HNWQ 2JA5G 3OPOA 2UUBQ 1QVGA 1YEZA 3KF6B 5M3FG 4C3HH 2BL5A 3A8KE 3UDXA 3V69A 4IJLA 4LJZC 3VR5A 3I4NH 2UXDQ 4DV5Q 4A3FH 2JXMB 2CTMA 3S1QH 4DK6C 3QG1A 5IWAQ 2C35B 2KHJA 3HOYH 4BA2I 1RL2A 3G71A 2OPUA 2MJHA 3PV0A 4GKKQ 1HNXQ 1X3GA 2WP8J 4B8TA 2R6GA 2WAQG 3NENA 1SE8A 1EWHA 4JI1Q 3TZUA 4Y7NH 3PUYA 1WVNA 4OO1H 4JOIC 1QZGA 1KHMA 4WJ4A 2HH2A 1QZHA 1Y1WG 2AMCB 4JYAL 1X3FA 4X65Q 4HIDA 4DV2L 4DV6Q 2XTIA 2D5DA 3GTGH 1PH8A 4JI3Q 1X65A 1N34Q 2PMZE 2B8FA 4ME3A 3N6RA 3PCOB 2UUAL 5IYCG 1IW7D 5FLMG 1JMCA 3NE5B 2E2IH 1WJJA 3D0FA 4IOAA 3H0GH 1PMRA 2ASBA 1CKNB 1NMFA 4QY7A 1QVCA 2ZJQA 3AFQA 3HGBA 2PI2A 2A69D 2VW9A 3BDOA 3BJUA 5LMNQ 4LF8Q 4A3DH 2I0QA 1AH9A 1VQLA 1YZ6A 3I7FA 5GAEC 4BY7G 2K7VA 5IYDG 3IKJA 4JVHA 2ID0A 1JT8A 2AWNA 1A63A 1ZZJA 4TQUS 4LUOA 3K80C 5C3EH 4L5QA 1NY4A 2NVXH 3S1MH 4OGQC 3CRKC 4I7ZC 4B3MQ 2IHEA 1YI2A 2JEBI 4H44C 3S15H 5M5WH 1EQQA 3KDFA 2NN6I 2PQAA 4DR1L 3HOXG 5IE8A 2YU9H 2PY9A 2ZM6Q 3BU2A 4IQZA 3RLFA 2CCZA 4NXNQ 1Q8KA 2PQUA 4B3RL 3T51B 5HGQA 2K5VA 2F52A 1HR0L 5KNBA 4JV5L 1D8LA 4L5RC 3OTOL 4DR2L 1UEBA 1W2BA 1VQEA 2BE5C 2FMRA 4X62Q 1JJ2A 5AJ3Q 2VZAA 2R7ZH 2JA7H 3CXCA 1IBMQ 1FVIA 1IBLQ 2N8NA 1EOVA 4DV0L 1UWVA 3VR4A 3WDNA 2MO0A 3CC2A 3KOJA 4JI2Q 3I4MG 1Y1VH 4EQ5A 3GTMH 3CCJA 1UE5A 3H94A 2DGYA 3K7UC 3T1HL 1J5EQ 3FMCA 3RZOH 4A93H 3HFZB 4GS3A 1IL2A 4R1JA 1QUQB 1DTJA 2KCMA 5JEAG 4DNRB 2YTXA 4DR5Q 1PA6A 3JC66 4HJ8A 4LFAL 4A3LG 2QA4A 3E9HA 1YIJA 1EIYB 4UP8A 4DV4L 4DUZQ 3IRBA 2R7FA 3I73A 4OX9Q 1K8AC 4JI8Q 4P72A 2D2CC 4QIWE 3CP0A 2AXYA 4LFBQ 1MKHA 1HH2P 2AHOB 2R93G 3CD6A 4WANA 1N36L 3H15A 4LF6L 4POGA 1VQCA 1BDOA 3PO3G 4JK1C 1IXRA 1TWGH 1CKMA 4A3IH 2VQEQ 3VR2A 1XNRQ 2YTVA 1IYUA 1GUOA 4QJFA 4LF7Q 3T1YL 2VUMH 3UDFA 3KLRA 4DUYL 3AEVB 2D62A 5KNDA 2ZJPA 1GJXA 1AE2A 3D31A 4LFCL 1E2WA 4DK3C 1YJ9A 1FYCA 1I5FA 3CCQA 2R92H 3NBHB 1N33L 1ASYA 2EXDA 3OW2A 3GTOH 1YHAA 2B3GA 3W5OA 4NXML 2VQFL 3CAMA 5C4XG 2NVYH 4LK1C 1KD1C 1IBKL 1TWAH 2O5IC 3U58A 4TVAB 1KAWA 5C44G 1OXXK 4UP9A 1IW7C 1VQKA 1H95A 1S40A 1J4WA 2XGTA 3ER0A 1K8MA 1Q82C 1VQGA 1H9MA 4X6AH 4GOPA 4A75A 4RMFA 2JVZA 2F1MA 1KQSA 1OXUA 1B8AA 2UXBL 2A69C 5C0XI 4GKJL 3EIVA 1DCZA 1JJCB 5GAHC 3CCEA 1HNZL 1SLJA 1IYJB 2R7ZG 1A0IA 2JA7G 3PGZA 3T56B 3M4PA 1S3OA 4R4TA 1S72A 5ELOA 4YCVA 3TQYA 4JYAQ 2L15A 2VNUD 1A8VA 3W1BA 1E24A 2CTJA 2K33A 4DV2Q 5E7NA 2BA0A 1N9WA 1VQ6A 4P71A 4A93G 1FR3A 3HOVH 4BBSG 1Y14B 1PH6A 1U5KA 4IPCA 4IFDH 1C0AA 5LMUL 4TKOB 1XNQL 4A3BG 2JA9A 5BN3A 3NEMA 4DPGA 2LXKA 2QNDA 2Q2HA 2PNRC 4AIMA 2A68C 3I56A 3A5ZB 3U1KA 4KI0A 4J15A 2IX1A 4YHHL 4APVA 4X64L 2E2JH 1WE8A 3J80c 2NN6H 1HZCA 2Z6KA 2O5JC 2HQLA 3ZJYC 4GNXA 2AWOA 1OXVA 2K75A 2MO1A 4K0KL 2IT1A 4PG3A 3PUXA 2HT1A 1PHJA 4A3GG 1EWIA 3MFYA 3G6EA 3CPWA 4DR7L 3WWVA 1WCMG 3F8TA 4DAYB 4AYBG 3PF5A 3U4ZA 2NZHA 1HZAA 4YCWA 2R92G 1YBYA 3M4QA 1MJEA 1O7LA 3BZCA 2QF7A 4A3KG 3J81c 4P73A 4JBWA 4C3JH 5K36G 4G7ZC 2OPVA 1VQPA 5BN4A 1GHJA 4A3CG 4A3EG 4B3RQ 2IX0A 1HR0Q 4JI5L 1H9SA 4BXXH 4JV5Q 4QL5A 3VR3A 4LF4L 1I6HH 3OTOQ 1C7YA 3J81j 5IY0A 4YY3L 4DR2Q 3IFTA 4B3SL 2JA8G 4JI0L 4JOIA 4R4CA 4XTCS 2JA6G 1EUJA 1MIUA 3U9SA 2VY3A 3M4YA 1YNNC 4KN7C 1VQJA 4IPDA 2ANRA 4AQYQ 4DV0Q 5IP9G 1I94L 3FKIH 2NVTH 1VF7A 3EN2A 1ONLA 4QMFB 5FJ8H 3T1HQ 4IFDJ 1VIHA 3CF5A 2PNHA 5GAGC 3PO2G 3KDFB 3S1RH 2PQAB 4X66L 1WYDA 5IYBG 4IFDG 4LFAQ 4A3JH 5M5YH 4JCVE 4YCUA 2DUDA 3S2DH 2RCNA 3G4SA 4ALPA 2V1CC 1Y8PB 3KF6A 2KCCA 1QJOA 2GVAA 5M3MH 3HKZG 1IZ6A 2OCEA 1T5EA 1N36Q 4LF6Q 4DK1A 2V4DA 3I2ZA 4DV1L 3HOZH 2OQ0A 3ICEA 3CW2C 3AFPA 2D0OA 3HOWH 4OWXB 4A4IA 3J7A5 3T1YQ 3PUZA 3J80i 2JEAI 3RN2A 1VQIA 1XMQQ 4PZ7A 3S14H 2E74C 2Y0SG 4RG1A 4EX5A 1TWFH 4LFCQ 2E2HH 2F4VL 1QVFA 4BY1G 2K52A 2CTLA 4PZ8A 4KKSA 1YJNA 1LABA 5C0XH 5IT9c 1VS0A 3A74A 2MNAA 1N33Q 2UUCL 1NE3A 1NTGA 4LUVA 4MNOA 1Q1BA 2N78A 2WB1E 1Q86C 3GD7A 4NXMQ 4JVYA 2VQFQ 4JI7Q 2QEXA 1WOCA 1IBKQ 2A68D 2UUBL 2CTKA 1Y69U 2EQSA 2CPQA 3I4NG 4GZYC 1O7IA 4LF5L 1XMOL 4DNIA 3PSIA 4A3FG 3OW7A 4UY8C 2A6ED 3CCRA 1YHQA 1T9HA 4G7OC 2OWOA 5A35A 3J81i 3HOYG 1WI5A 4JC0A 1K83H 2UXCQ 3B6YA 4DV5L 3SE0A 1KC8C 1NMGA 1X54A 2AKWB 1WFQA 3SDZA 2UXBQ 5IWAL 4A3MH 4GKJQ 4PMWA 3DLLA 4AH6A 1HNZQ 3OOCA 3HOUH 2ZTDA 3F2CA 1HNXL 4OO1G 2YYZA 2HIVA 1ZZKA 1PH1A 1Z47A 3CCMA 4JI1L 3FKIG 4OONA 3GTLH 1EQRA 2HHHL 2A1AA 3GTJH 3AYHB 3P20A 2KCTA 2A6HC 1Q46A 3UDGA 3ND9A 3A0JA 3UE0A 1OXTA 5BR8Q 4QGUA 1YNJC 1XNQQ 3ULLA 4A3JG 3CMEA 5LMNW 1HZBA 3I4OA 1BBWA 1PYBA 2D0PA 1OTCA 1X55A 1N34L 1N8RC 2ZJRA 1X4MA 2KENA 1SN8A 1GHKA 3H0GG 2Q2UA 4YHHQ 4X64Q 4GN4B 4GOPB 1KXLA 4LNQA 1A6XA 2JQOA 1I3QH 3K0XA 4UP7A 4DV7L 1E22A 3HOZG 3H3VI 4A3DG 1EYGA 4P75A 1PH3A 4OXPA 1CKOA 3HOWG 3VKEA 1L0WA 3LWUA 1TWHH 4LUZA 3GTQH 3RN5A 4B3TL 5C0XJ 4K0KQ 2JZXA 1L1OA 1V1QA 1EC6A 1X56A 5GADC 1Z9FA 3U4VA 5C3EG 4DR7Q 4BBRH
chains in the Genus database with same CATH superfamily
2LY7A 3J7ZC 1AW7A 3FAUA 5EBCA 4KD4A 1PH9A 4B3SH 3L3OC 1FJGH 5IP7H 3K5OA 2VUMB 2E5LL 1CA5A 4JI0H 2F0LA 3SK6A 5IGBA 2BA1A 4IJHA 2F3IA 2KEDA 2K5HA 2VS1A 5IT9L 1LTLA 4XIGS 3JAMc 1JICA 1KDBA 2EY2A 4ZQ3A 4OWTB 2LTLA 4FJUA 2EY1A 5M3FH 2L4NA 1TY2A 4IUTA 4KD3A 1ODHA 3K0YA 2E2DC 4DV3H 3DWQA 4AYBB 2PCFB 1VBIA 3OIQA 2ZTCA 3AMUA 2R92B 3BDLA 3GTOB 3MEHA 2OF1A 1U0LA 3M9BA 4JI5Q 1MJCA 1J6QA 1CK1A 1D7QA 3VR6A 5KYLA 4OIJA 3C3LA 4JI6L 1C9OA 1E0BA 2JK8A 2QDLA 4IPGA 4YY3Q 2UU9L 2P2RA 4JI4H 2NVYB 2WAQE 4CHTB 3GDEA 1VQNA 1TWAB 2CWAA 1NR2A 2XVSA 2KOLA 1EIFA 1G2SA 4GNXB 1LT5D 1N32L 4GLVB 3CMAA 3PF4A 4IUUA 2QGQA 3FPPA 4DR4L 4WJWA 3M7GA 5CV8A 1RIPA 3QIAA 3DWPA 2KHIA 3EA6A 1O7ZA 1EL0A 2DNEA 1XTDA 2OEOA 3D4WA 2K32A 2K5NA 2L5TA 5EKIA 1V43A 3TEHB 4N8X1 3F2DA 1I94Q 2JJQA 3FDTA 3D6CA 1BVSA 4X62L 4R4QA 3K5LA 1CTMA 3DUZA 3GQBA 1Y1VG 4HJ5A 1VQOA 5KEEA 4TSSA 1VQAA 1RD9D 4DV1H 3S16H 2FJ2A 4X66Q 1Y1WH 1K73C 5JJKA 2E76C 2RVLA 3UE1A 2CKZB 3J7AK 2Q2IA 3EQLC 2UUAQ 3E0EA 1GUGA 1D1KA 3PUVA 4FJSA 2AQ2B 2EZVA 5I6YA 1Y8OB 4KHPL 1KRSA 3KK7A 3A55A 2F4VH 1SFOH 4DN4M 2FXQA 5FLXL 2HIXA 4JG2A 1H9SB 1RHPA 3HZXA 1SR3A 3S1NH 4HIMA 4DR3L 1EOTA 3KDGA 1UE1A 5FLMH 3GV6A 3MXNB 3MXUA 1K9MC 2RDHA 2VKCA 1K3RA 1I4HA 4IUNA 4DAVA 2A6EC 1UE7A 5D14A 1WTJA 3F2BA 2KBNA 4OX9L 3TP7A 1EFWA 4UAIA 1PRTD 1HNWH 4YWMA 2F0QA 3OWEB 4A3IG 1I4RA 3MVVA 2DN8A 1VCIA 2Y0SE 3HKZB 4X3UA 2UUBH 2HH3A 4ZKBB 2R7DA 3VYRA 2VUMG 4LF9L 1EFID 4LF5H 4YWLA 5FK9C 3M85A 2E75C 1Q1EA 3GTKH 2JE6I 1QOHA 1K0RA 1EQTA 4PV1C 1SDFA 3I3CA 1FGUA 3K5NA 2VQEL 2B39A 5IYDH 3M4OH 1XNRL 1RJTA 4LF7L 4MHEA 2RDGA 2MGSA 3SGIA 1WTRA 1S5CD 2UUCQ 2UXDH 4DV5H 2A6HD 4BBRG 4KKTA 1NJIC 4ZKCB 4DR6L 4OL7A 2F3VA 2RHQB 2ZTEA 1CUKA 3Q8DA 2G9HD 2AUJD 3K8AA 2PI2E 1HCZA 4RCNA 5IWAH 4EQNA 3PIP3 4IOCA 2YV5A 1FNUA 1W6JA 4HJ9A 1Z2IA 4DR1Q 1X4NA 2BCOA 4BBRH 2CW0C 5IGCA 2A19A 3RZDH 4BY1B 1AN8A 1K1GA 1PZID 1DD2A 1C8CA 3CC4A 2B2WC 3V05A 1HNXH 4WORA 1BBUA 1HTPA 1HPCA 4LF5Q 3KLWA 4NPSA 3T4AC 1XMOQ 2PO4A 4H02A 5DM63 3LNNA 1HZ9A 4RGNA 3JAML 3HOXH 1X9ZA 1GD7A 5JOBA 4C3HB 4JI1H 1HA5A 5DT9A 1D5XC 3SHLA 3JAMi 1KHIA 3M7NA 2CH4W 1PH7A 2WIIB 3T53B 3PUWA 1O7YA 1VQ9A 1SYBA 2RBMA 1FJGL 2I5HA 2NZ1D 4RHRA 1TY0A 1DT4A 2F0EA 1YJWA 3TMEA 3PIOA 1B2TA 1HXYD 1LO5D 4RWSC 1TT2A 2FINB 3L7ZC 3BZKA 1VQ5A 4X65H 2FFKB 4L5SA 3SR1A 2ANNA 5M9OA 3RUZA 4DV6H 1VQDA 1SROA 4DV3L 4JI3H 4AM3A 1ILQA 1LTBD 1N34H 3GO5A 2HDMA 1X3PA 1VQBA 4U68A 1VQFA 1M90C 1K8OA 5T1GA 4H0LC 1XRHA 2LTMA 1VDZA 1PDQA 5ELBA 2HHHQ 3OHXC 3H3VH 2N49A 4Y7NB 2LMCB 1DOLA 2BDOA 1TWCH 4JI4L 1LT6D 1STEA 1B9NA 1Z6HA 3I72A 3I4MH 2RF4A 3HOVG 4HJ7A 1LYLA 1E3PA 2QKIC 2ZXOA 1QWYA 1XTCD 1G6PA 2K28A 4JBJA 2VB2X 1P8LA 3A8IE 3FKIB 2NVTB 1RODA 1E7ZA 1I4PA 4DV4Q 1YNXA 2M6QA 1EY9A 2PT7G 1KIXA 1F77A 4DXFA 2G9DA 5LMNH 4LF8H 3A5UA 2Q8IB 5JEAH 3LGJA 1KL9A 2ATWA 2B2VA 2GN5A 1EYDA 1OXSC 2KJXA 2DGRA 1TXYA 1EY4A 1GO3E 3S1RB 1TS5A 1VQ7A 4A3LH 3AB9A 1D5MC 1JE4A 2X6GA 3I4LA 5G3LF 2EDGA 4POFA 1DONA 3NELA 3TREA 2PPBC 4BA1I 2NN6G 3CCUA 3IFDA 3NQIA 4JW0A 1FL0A 4MTNA 4A3JB 4DV7Q 4S3SA 5M5YB 2EJFC 3MFGA 4HJAA 3EVQA 3S2DB 3I55A 2B8GA 2M2LA 1WTOA 4PMBA 2QDBA 1YVCA 5LL6S 2NUCA 3MTSA 2F0WA 5EQ0A 2GVBA 1J5KA 2R93H 1ICFB 1SMYC 3CRLC 4FDBA 4WJ3M 1TU2B 2PMZB 2Q2TA 5M3MB 4C2MH 5I6WA 1VQ8A 1V1PB 4DUYQ 1DOMA 5F2DA 4P2CB 4Y52H 3A7LA 4B3MH 4B3TQ 4HIOA 3PO3H 5H1SE 3HKSA 2P5ZX 4C3IH 2LRRA 4FXKC 1CI3M 3KFUA 1BXTA 3HOZB 4DK0A 4MZ9A 1NXUA 1MHWC 5LL6b 3S9WA 2IW3A 3STBD 2ZM6H 3HOWB 4ID6A 2PW7A 5GROA 1DJRD 2IX3A 1B53A 2PZTA 3ONAB 4GLAC 1LT4D 2E5LQ 4IFDI 4NXNH 2N88A 3W1GA 2LXJA 4RH6A 2YQRA 3T16A 1HR0W 3S14B 2EPBA 1X9NA 1UAPA 1TWFB 2L55A 4ODGA 1HNWL 2E2HB 2H5XA 2ALYB 1SMXA 1GUNA 5A2QW 1C48A 2SNMA 1CT1D 3VDYA 4RGMA 4C3JG 3Q22A 3RNUA 3DHQA 1TUAA 3U9OA 4R4IA 4YWKA 3ND8A 2CQOA 1MSGA 4DKAC 2B63H 2WKCA 2YTYA 3MEFA 1TIID 4HR7B 4X62H 5C4XH 1A3TA 1E1OA 4GN3B 4F8MA 1I50H 5C44H 4JI6Q 4BXXG 1X6OA 2UXDL 1UG8A 3RLNA 3CCVA 2UU9Q 4QUCA 3KJOA 1IBMH 4YIJA 3P1HA 5D65A 4ZAIA 1VQ4A 5IGEA 4KN4C 1EY7A 3S2HH 1SNCA 1Q7YC 1N32Q 2QEJC 3QJYA 1HFNA 1SE2A 4JI2H 2IWHA 4DR4Q 5CBAE 1BOSA 1CSPA 1STAA 4PZ6A 4LIJA 1Q90A 3A56A 3AQQA 4JBMA 1B9MA 1PRTC 5CORA 4GKKL 1CKNA 1L1OB 1WD1A 1J5EH 4CBVA 2ES2A 3CCLA 1K83B 4NB3A 5CV5A 2FFMA 1PLFA 4CDDC 1H9JA 1DXMA 1LTAD 4CKBA 1EY5A 4H13C 1BCPB 5KYIA 4DR3H 2CHBD 1PH2A 5EAYA 2XWJB 1CSQA 3W2DA 4EVOA 1PV4A 4DR5H 1VQHA 4KHZA 1HFGA 1ENFA 2N3SA 2XRQD 1VIGA 1D5ZC 4DUZH 4Q0FA 1II3A 5FJ8G 3RR5A 3ERQA 1U4MA 2CW0D 2CTFA 1M1KC 4AQYL 4JI8H 4OX9H 2J0TD 2XRSD 3TRZA 5JJIA 2CTEA 4KLKA 3VA7A 4LFBH 1CHPD 5JPMC 1E1TA 1JE5A 2MPMA 1EY8A 5JEAJ 5LMUQ 4UPAA 5FLXc 3M3YH 4R4OA 4ZK9B 4X65L 4JVZA 4X3KA 2EYOA 5EJWA 4KHPQ 4NZRM 4DV6L 1Y1VB 3K81C 1JB7A 5I9OA 3GTLB 1EYAA 4BBSH 1F2LA 3KYHC 4JI3L 1GM5A 3S17H 3OWFA 3G48A 3GTJB 4GN5A 1SE3A 2E3UA 4K2KA 3ULPA 4RHSA 4FXDA 4NW2A 2EJGC 1GKHA 1JC7A 4KMUC 2KUMA 3K7AH 4RAUC 2VQEH 2DJGC 2EVBA 4DR3Q 5L37A 1XNRH 2I5LX 5M3MG 4A3BH 1AE3A 1CZGA 4LF7H 5J39A 1H9KA 4FNFA 4ZYSA 1PTOC 1YHBA 3CPFA 1RKNA 1RF2D 2KHSA 2NTTA 5GQOA 4XQQA 2A1SA 2K5WA 4DAPA 4O2DA 4DU9A 2B29A 1EU3A 2R3ZA 1LTID 4HMIA 4KY5A 3U50C 1SJED 5KRUA 1WTXA 2OTLA 5DEHA 1R9TH 4OO1I 2MUYA 1Q12A 2BH2A 1ET6A 3OYYA 3S24A 1XJVA 4B9XA 3L2PA 1G51A 2JP1A 1SEIA 5HURA 2K05A 4O42A 3TS0A 1LTTD 1ZKOA 4LF9Q 1DGSA 5BN5A 5LMNL 4LF8L 2Z4HA 4M1UB 1VQMA 3MXGA 1K0SA 2A8VA 1JOKA 3GTPH 1I3QB 4KKUA 3C46A 5JJLA 1LM0A 2N55A 4AYBE 3ULJA 3F1ZA 1U4RA 4QIWB 1E2ZA 1G291 1IYVA 1MBYA 4A3IB 4DR6Q 1ZYRC 5C0XG 1XMQL 1L2FA 2CWHA 2EIFA 1EQVA 3V96A 1ZTGA 4A3GH 4DNTB 2NVQH 1TWHB 2Q8RE 1C4QA 3GTQB 1JJGA 1V8QA 2JA5H 1GVPA 5DAUA 4G4KA 1GUTA 3BG3A 3P75A 3KF8B 3UDIA 2IY5B 1WCMH 2EXZA 1WTPA 4HCEA 3TZDA 1X3EA 2K14A 4TRDA 2E8GA 4CGYB 3MA2B 4J8QA 1L1OC 1KLGD 5I2YA 2RQXA 2PYKA 4B3ML 4BBRB 1ICWA 4FF4A 5FO7B 5ELDA 3PIPA 2JN4A 2DNCA 1PYSB 2QILA 4A3KH 3FP9A 2B63G 1H9RA 2WB1G 2CFMA 1QUQA 2LFNA 5LL6X 3SB1A 4JI7L 4F88A 1E2VA 5K36H 2EJMA 4LF4Q 2F0SA 1G6ZA 2WACA 3C1FA 2ZM6L 1QG7A 3I70A 1PRTF 1AN7A 4B3SQ 1FJGQ 4IO9A 1HQMC 1SMYD 3A8JE 3CC7A 2MQHA 4NXNL 4A3EH 1EIGA 4A3CH 4JI0Q 1B7YB 4MN3A 1DM0B 1SBBB 3AU7A 2NZOA 4JYAH 3DXJC 2CWPA 4A3MG 3DM3A 1CFMA 1XXGA 4P74A 2XSCA 4OHJA 5ELNA 2IHFA 3HOUG 4EQOA 3CQZH 2H4OA 1XPRA 2UXCL 2JA8H 1PH5A 1F9RA 4DV3Q 2L12A 3H91A 2EOTA 3FVQA 4QQBX 4WALA 1XPUA 1ZZIA 5CV6A 1WTHA 5DLQE 1XX8A 5CV4A 1Y8NB 3I90A 2JA6H 1TKWB 4GOPC 1A62A 4A76A 1F2MA 5AJ3L 3TS2A 1S5ED 2ZT9C 3WOFA 1P16A 3CCSA 2JYOA 4NBQA 2OTJA 1JR0D 1I6VC 1M4VA 1NBWA 4JI4Q 3T13A 5C4JH 2C5CA 3E9IA 1IBML 5IP9H 1IBLL 4L8JA 5C3WA 3QO2A 4HIKA 3AEVA 3K58A 4GLXA 2F0HA 3STBC 3J80E 2K4KA 5EPJA 5NUCA 3KBGA 4JI2L 1SSOA 3VYTA 5KNCA 4IPHA 3QB3A 1LACA 5KIXA 3QOLA 1B70B 2MFIA 3PO2H 4WFN3 1X0AA 4KY6A 1J5EL 3EROA 3KBXA 2WKDA 3RLOA 1PTOF 1U4LA 2CQAA 2WFWA 3NBHA 2LSSA 1JB3A 4L5TA 3HKZE 1KRTA 5IYBH 2VL6A 3MXPA 3BDCA 2OQKA 3NUCA 4OD6A 1V9PA 3S16B 3HOVB 5J3BA 5IYCH 2K50A 2F03A 1Y1WB 4LWCA 5BR8L 4DR5L 1PH4A 1ASZA 3G7LA 3FHWA 4OWWB 4O0AA 1L0YB 4LW1A 1TR5A 1I6UA 4MIUA 4DUZL 4DV1Q 3EBEA 4C1NK 4RA8A 4JI8L 1MD2D 1KLUD 1MSZA 1BKBA 1W3SA 1X32A 2K1HA 1XPOA 3ERSX 4LFBL 1PVOA 2AUKA 4PMCA 4K8JA 1SFOB 3I0PA 2DY8A 2L11A 3W3AA 1HJPA 1VF5C 1QNKA 1AEXA 5J22A 3Q0AA 4DAMA 3KJPA 2KA7A 3D4RA 3S1NB 2BE5D 3D6WA 2BH8A 5M5XH 1SRUA 1GUSA 2Z1CA 3SXHA 5E1FA 1DZ1A 2E2JB 5EPKA 5HY6A 3BZDB 1JOQA 1LUZA 1Z7TA 2F4VQ 3L0OA 2G5DA 1A2TA 2J4XA 3J81E 1F9QA 1XYIA 1RCVD 4KV6A 4BY7H 1O78A 2CH4A 1YITA 1LTGD 2Z6KC 3R8BA 2HUGA 2I5MX 3A7AB 1S5DD 4F7XA 5A2QE 1L0XB 1EIHA 2Z0SA 1PFSA 1K8GA 2B2WA 1T5XD 1Q81C 4BY1H 4JBKA 1PQXA 2RHSB 3NXWA 5IP7G 4GNXC 4G7HC 1UE6A 4B3RH 1HNWQ 2KECA 2JA5G 3P7JA 2HDLA 3OPOA 4RCOA 1NR4A 4CKCA 1HR0H 1QNUA 3GTKB 4JV5H 4XXEA 2UUBQ 3CKIB 3OTOH 4GKKH 1QVGA 1EYCA 1YEZA 3KF6B 1NSNS 5M3FG 2FMMA 4C3HH 2BL5A 1ESFA 1CQVA 3A8KE 2IPKD 3UDXA 3V69A 1RDPD 1AZQA 4IJLA 4LJZC 5IGFA 1PTOD 2O4XA 3K59A 2VXWA 3VR5A 2RSNA 3I4NH 1AP0A 2UXDQ 4DV5Q 1J8IA 2X69A 4A3FH 2JXMB 2CTMA 4AQYH 3S1QH 4DK6C 4DV0H 4C3JB 4K14A 3QG1A 5IWAQ 2C35B 3NK9A 2KHJA 3HOYH 4BA2I 1RL2A 1LLRD 3G71A 2OPUA 2CVRA 4FVMA 2MJHA 3PV0A 2I46A 4GKKQ 3T1HH 3TP5A 1HNXQ 1J9OA 1X3GA 2WP8J 4G57A 4XQJA 4B8TA 1I6HB 2R6GA 2WAQG 4V0BA 4B9WA 3NENA 1SE8A 1ZYRD 1EWHA 4JI1Q 3TZUA 4Y7NH 3PUYA 1WVNA 1RTNA 4LFAH 1EY0A 4OO1H 1Q8IA 4ABNA 1GOZA 4XQNA 3E3XA 4JOIC 1QZGA 2KCNA 3NTHA 4DFAA 1KHMA 1LTRD 4WJ4A 2HH2A 1QZHA 3DWAA 1Y1WG 2AMCB 4JYAL 1EWCA 1X3FA 1I4GA 3NPPA 4X65Q 4K5XA 4HIDA 1N36H 1TS2A 3H09A 5C4HA 4DV2L 4KJOA 4DV6Q 4LF6H 4Z9CB 1FNVA 2XTIA 1BCPD 2D5DA 3GTGH 1PH8A 4DAYA 3F2UA 4JI3Q 1B1ZA 4K6LA 1X65A 3J80W 1N34Q 2D9UA 1G2TA 2PMZE 2M8WA 2B8FA 4ME3A 3N6RA 3TDQA 4Q5VA 3PCOB 3TBIB 2UUAL 3T1YH 3I4MB 5IYCG 1IW7D 5FLMG 1XMQH 1ET9A 1JMCA 3NE5B 4NDXA 4EQPA 4LFCH 2K03A 5JJZA 3WOEA 2E2IH 1WJJA 3E6ZX 2MHVA 3D0FA 4IOAA 3H0GH 3OSOA 5IT9E 1CHQD 2CPMA 1PMRA 2OT2A 2ASBA 2PZWA 4FF1A 1CKNB 2F0OA 5AFWA 1NMFA 4QY7A 1QVCA 2ZJQA 1CM9A 3AFQA 3HGBA 2PI2A 2A69D 2K5DA 4OEMB 5E4WC 2VW9A 4RKLA 3BDOA 3BJUA 5LMNQ 4LF8Q 2F0DA 5IGGA 4A3DH 2I0QA 1AH9A 2EY5A 4NXMH 2EYLA 1VQLA 2VQFH 4JI7H 1YZ6A 1PTOH 3I7FA 5GAEC 4BY7G 2K7VA 2NBFA 5IYDG 1IBKH 3IKJA 3SVMA 1M8AA 1GXDC 4JVHA 4FF3A 4HMJA 4B08A 5CC4A 4HSPA 2J7ZA 2R93B 2F0JA 5FO8B 3O13A 3J81W 2ID0A 1JT8A 2AWNA 4J6HA 4C2MB 1A63A 1ZZJA 2ZXPA 3J7AF 3OSSD 4LUOA 4TQUS 5CR3A 3PO3B 3K80C 4L63B 5C3EH 4L5QA 2VB3X 1LV9A 1NY4A 4C3IB 2NVXH 3S1MH 1WTVA 1KABA 1AZPA 1V8CA 1B3QA 1NCVA 3CRKC 3HRZC 4KY7A 4OGQC 2K01A 4I7ZC 2UXCH 4HSVA 1VMCA 3KLSX 4B3MQ 2IHEA 1YI2A 2KQ3A 5COYA 1EZ8A 2JEBI 2L9HA 4H44C 3NCVA 3S15H 4C56C 5M5WH 5CV9A 1EQQA 2EYHA 3Q24A 3KDFA 3FEWX 4GKJH 5C5MA 3DMUA 2NN6I 2PQAA 4DR1L 3HOXG 1HNZH 5IE8A 4PQXA 3FPUB 4ME5A 2YU9H 2PY9A 1TVXA 2ZM6Q 3BU2A 2RSOA 4IQZA 4EGVA 3RLFA 2CCZA 3I91A 2D9IA 1IBLH 4OCHA 4NXNQ 5LHY1 2CWFA 4DGZA 1Q8KA 2PQUA 3N52A 1TQOA 5K5PA 1FNWA 4B3RL 3ITPA 3T51B 5HGQA 2K5VA 2M9VA 1DOKA 3K6OA 2B63B 2F52A 1HR0L 2WB1B 5KNBA 4JV5L 4QMGA 1NAPA 1XWEA 1D8LA 4HAEA 4L5RC 3OTOL 5A2QL 1HQRD 2HQEA 4DR2L 2HCIA 1I50B 1UEBA 5C44B 5IOCA 1W2BA 1VQEA 2KEEA 2BE5C 1F9PA 2FMRA 4X62Q 3GKUA 3HS0C 4IUPA 3UI2A 5AJ3Q 1JJ2A 5BR8H 1XNQH 2VZAA 2R7ZH 4A3MB 2ICEC 2JA7H 3CXCA 3HOUB 1IBMQ 2QW7A 1FVIA 1IBLQ 2N8NA 4BS9A 2SEBD 1EOVA 1LTSD 4DV0L 3NSWA 1UWVA 3VR4A 3WDNA 2MO0A 3CC2A 1CZWA 3KOJA 4JI2Q 5ELCA 3I4MG 1Y1VH 4EQ5A 4YHHH 3GTMH 5I9PA 3CCJA 4X64H 5JPNC 1UE5A 3H94A 2DGYA 1UEAB 3K7UC 3T1HL 1J5EQ 2B2TC 3FMCA 3RZOH 4A93H 3HFZB 4GS3A 1IL2A 2M00A 4R1JA 1QUQB 2Z6BA 1DTJA 2KCMA 5JEAG 4DNRB 2YTXA 3TP8A 4DR5Q 1PA6A 3JC66 4HJ8A 2BDNA 4LFAL 3GR5A 4A3LG 2PQEA 2QA4A 3E9HA 1YIJA 1EIYB 4UP8A 4DV4L 4DUZQ 3IRBA 4F87A 3M3YB 4CDEC 2R7FA 5EBDA 3I73A 4OX9Q 1K8AC 4JI8Q 4P72A 2D2CC 4QIWE 3GV3A 3CP0A 1PFMA 2AXYA 4LFBQ 4BBSB 1MKHA 2RDFA 3S17B 1HH2P 3BYYB 2AHOB 2AQ1B 3SK8A 2R93G 3CD6A 2MJ8A 4WANA 3DEPA 3K7AB 4ZUIA 1N36L 1B4OA 3NBIA 3H15A 4LF6L 3E0JA 4POGA 4A3BB 1EEFD 3QWNA 1VQCA 5IT9W 1BDOA 3PO3G 4JK1C 1A3VA 1IXRA 3JAME 1TWGH 1CKMA 1TS4A 2F0UA 1A15A 4A3IH 4C3IG 2VQEQ 3VR2A 1XNRQ 2YTVA 1IYUA 1GUOA 1PFNA 4QJFA 4LF7Q 4O1NA 1R9TB 1F0XA 3T1YL 4PNYA 1KTKA 3UDFA 2VUMH 3KLRA 4RFBA 2H1EA 3VYSA 4DUYL 2K5QA 2ZQEA 3AEVB 1QE6A 5EKLA 2D62A 5KNDA 2ZJPA 1AE2A 1GJXA 3D31A 4LFCL 5DNFA 1E2WA 4DK3C 3K5MA 1BNZA 1U4PA 1YJ9A 4JI5H 1FYCA 1I5FA 1KDAA 3CCQA 3RF2A 1FKAH 1WTQA 2R92H 3GTPB 3NBHB 1N33L 1ASYA 2EXDA 3OW2A 1BBXC 3GTOH 4YY3H 1YHAA 1S5FD 2B3GA 2B2UC 1S03G 4FF2A 3W5OA 2B2YC 3G6JB 1JOOA 1BCPC 1ML0D 1NUCA 4NXML 1HA6A 5D3IB 4KK7A 3EFXD 3MC0B 2VQFL 4H8AA 4A3GB 3A54A 3CAMA 2NVQB 1PZJD 5C4XG 1KNEA 2NVYH 1S5BD 4LK1C 2JA5B 1KD1C 1IBKL 1TWAH 4RGTA 1STHA 2K6AA 2O5IC 4XYQA 4FP5D 1WCMB 3U58A 4TVAB 1KAWA 5C44G 3R2IA 1OXXK 1CA6A 5M3FB 4UP9A 4XT1B 1IW7C 4CDFC 1VQKA 1H95A 1S40A 1I94H 1J4WA 4X3SA 5FKAC 2XGTA 3ER0A 1K8MA 1MGSA 2EY6A 1Q82C 2L1BA 3KUPA 1VQGA 1H9MA 1K28A 1PXUA 4A3KB 4DV2H 4X6AH 4GOPA 4A75A 4RMFA 2JVZA 1IHZA 2F1MA 2K04A 1KQSA 1V1OA 3BVZA 1OXUA 1B8AA 4X66H 2UXBL 2F0MA 4LMQD 2A69C 5C0XI 5FO9B 5IIFA 4GKJL 2AQ3B 3EIVA 1DCZA 1JJCB 5GAHC 4A3EB 3CCEA 4ILWA 2UUAH 1HNZL 1ILPA 4HN7A 4RGOS 5T1IA 1SE4A 1SLJA 5C6AA 2LF0A 1IYJB 2R7ZG 1A0IA 5FLXW 2JA7G 4XT3B 3HP3A 3PGZA 5D3DA 3CQZB 3M4PA 3T56B 1S3OA 2JA8B 4R4TA 1S72A 5ELOA 5CMDA 4ZLTF 1ENAA 4YCVA 2WV6D 3TQYA 4JYAQ 2K1BA 2WAQB 2L15A 2G8YA 2VNUD 1A8VA 3R3OA 3BS1A 3W1BA 2LS01 1E24A 2CTJA 2K33A 4DV2Q 5IGDA 1F2YA 4IN3A 2JA6B 5E7NA 4U673 2BA0A 1A3UA 1N9WA 4CDCC 1VQ6A 1PYWD 4P71A 3Q6SA 1QCBD 3BVMA 1FR3A 4A93G 3HOVH 4BBSG 1EU4A 1STBA 1Y14B 1PH6A 1U5KA 5C4JB 4IPCA 4IFDH 1C0AA 3TP6A 2TSSA 5LMUL 3KF8A 4TKOB 1XNQL 4A3BG 1STNA 2JA9A 5BN3A 1RTOA 4NZTM 3NEMA 3MHBA 2LXKA 4DPGA 2QNDA 2F0TA 2Q2HA 1WTWA 1ZXTA 2PNRC 2F0NA 4E9JA 3MWYW 4AIMA 3PO2B 2A68C 3I56A 2L0CA 1F9SA 3A5ZB 1WD0A 3D3RA 2I07B 3LWEA 3U1KA 4KI0A 2A5HA 4J15A 3OMGA 2IX1A 4YHHL 5EGTA 4APVA 4X64L 2E2JH 1WE8A 3J80c 2NN6H 2UUCH 3K57A 1IL8A 1HZCA 2X6LA 2Z6KA 2DJFC 1AFPA 2FMCA 1PFBA 2O5JC 2HQLA 3SK4A 3ZJYC 1MI2A 4FYDA 4DR1H 3SK5A 4N9TA 4GNXA 5J1ZA 2NB0A 2AWOA 3VA5A 2GA4B 1OXVA 2SOBA 1SYCA 4NP5A 1XMOH 3JAMW 4RKBA 2XWBB 2K75A 2MO1A 4K0KL 4OIKA 2IT1A 5CBEE 4PG3A 3CHBD 3PUXA 1F2ZA 2HT1A 1SYDA 1PHJA 5M5XB 4A3GG 1SYGA 2SNSA 4K5VA 5CV7A 1EWIA 4IURA 1BCPF 4HTHA 1QILA 3MFYA 4R8IA 3G6EA 3QR8A 3CPWA 5KGUA 4DR7L 3WWVA 1WCMG 5JVG3 3F8TA 4DAYB 4AYBG 4BY7B 4LAAA 1IKMA 5JVH3 3PF5A 3M4OB 3D8GA 2NZHA 3U4ZA 1HZAA 2F0FA 4YCWA 3VYUA 2R92G 4DR2H 2PZUA 1YBYA 3M4QA 2Y0SB 1MJEA 1SJHD 1YNJD 1O7LA 1ENCA 1KDCA 3BZCA 1R4QB 2F0GA 2QF7A 3J7AV 2A74C 2KVMA 1GUWA 4A3KG 5E3FA 3J81c 1ESRA 2DY7A 4I7AA 3OIPA 4P73A 4JBWA 4C3JH 1JWSD 5K36G 3H6MA 1SNMA 4K5WA 3RZDB 4G7ZC 1O80A 4H7BA 2OPVA 1VMPA 1SNDA 1PZKD 2MP1A 1VQPA 5BN4A 1GHJA 5E4XA 4A3EG 4A3CG 4QUFA 4B3RQ 3EZJA 2IX0A 5ELEA 2OXPA 1HR0Q 4JI5L 1H9SA 4BXXH 4JV5Q 4QL5A 2HHHH 3VR3A 4LF4L 2SDFA 3HOXB 4NKLA 1I6HH 3OTOQ 1C7YA 3J81j 5IY0A 1V9NA 3MXNA 2F0KA 4YY3L 4BWGB 4DR2Q 3IFTA 4B3SL 2JA8G 3I4NB 4XYOA 1B50A 4JI0L 4CJ1B 4A3FB 4JOIA 4DA2A 3S1QB 2NWGA 4R4CA 2TMPA 4I65A 4XTCS 2JA6G 1EUJA 1BO0A 3TSSA 1B44D 1MIUA 3U9SA 2VY3A 4DV4H 3M4YA 3HOYB 1U9RA 1YNNC 4KN7C 1VQJA 4IPDA 2ANRA 4AQYQ 3UOEA 4DV0Q 3NWTA 2Y3MA 5IP9G 2Q8TA 4ULLA 4IZ8A 1I94L 3FKIH 4HEDA 2NVTH 1JORA 1VF7A 3EN2A 3X3NA 1ONLA 3KLSA 4QMFB 1D6EC 5FJ8H 5ISRA 3T1HQ 4IFDJ 1SNOA 4FO2A 1VIHA 3GP7A 2PNHA 3CF5A 5GAGC 3PO2G 4IUVA 4DV7H 3KDFB 4QF4A 3S1RH 4EC5A 3J7YW 2PQAB 4X66L 1WYDA 3NWSA 1Q3LA 4OELB 1TWCB 2EE1A 4MTKA 5IYBG 2XN9C 1MSHA 4LFAQ 4IFDG 4A3JH 5M5YH 4JCVE 4YCUA 2DUDA 3S2DH 1PRTB 2RCNA 4KJNA 3G4SA 4ALPA 4DUYH 1SYEA 4B3TH 1B3AA 2V1CC 5C4ZA 1K3BC 4UDUC 1Y8PB 3KF6A 1I4XA 5EKKA 2KCCA 1QJOA 1S4ZA 5DM73 3GTGB 4N9PA 2GVAA 5M3MH 3HKZG 3PMFA 2RCFA 4QB4A 5C5LA 1IZ6A 2OCEA 4NMZA 2WINB 3PQIA 1HHVA 1T5EA 1N36Q 4LF6Q 1N33H 2R61A 3FRPB 4DK1A 2V4DA 4C1NI 2B2VC 4KHVA 2NYZD 4XDXA 1UNSA 4PDBA 3I2ZA 4J1MA 4DV1L 2E5LH 4K8IA 3HOZH 4X3TA 1LT3D 3QD7X 1EEID 2OQ0A 3ICEA 4K6DA 3CW2C 3AFPA 2BOSA 1SEBD 2D0OA 3HOWH 4OWXB 3J80L 4A4IA 4QCLA 3J7A5 2E2IB 3IAYA 4IALA 1A2UA 1BUVT 3T1YQ 4CJ0B 3H0GB 3PUZA 3J80i 1G8ZD 1WHRA 2JEAI 3RN2A 1VQIA 2NTSA 1XMQQ 4PZ7A 3S14H 2F0VA 2E74C 2Y0SG 4RG1A 4EX5A 1TWFH 1OO9B 4LFCQ 1JCKB 2HCCA 2E2HH 2RKSA 2F4VL 1QVFA 1KNAA 2JSOA 4BY1G 4E6IA 1WVLA 2K52A 1HRJA 3OETA 1FD7D 1SNPA 3MZ5A 2CTLA 4K2LA 4PZ8A 4KKSA 2A73B 1YJNA 4A3DB 1LABA 5C0XH 5IT9c 1VS0A 1CQFA 3A74A 4JI6H 2MNAA 1N33Q 2ENBA 2UUCL 1NE3A 1NTGA 4KTAA 1PTOB 2UU9H 1SXTA 4UHVA 3BVGA 4LUVA 4R8NA 1X3QA 4MNOA 2XNAC 1Q1BA 4R9WA 2N78A 3NTKA 4C3HG 2UXBH 2WB1E 2LKVA 1IKLA 1N32H 1Q86C 3GD7A 2QCPX 2RA4A 5JAVA 4FXGC 4NXMQ 4DXGA 4JVYA 2VQFQ 4JI7Q 4DR4H 2QEXA 4LF4H 1WOCA 1IBKQ 3NHHA 3NP8A 2A68D 5C3EB 2UUBL 2CTKA 1Y69U 5IODA 2EQSA 3NTIA 2CPQA 3V2TA 3I4NG 3DM1A 3S1MB 2NVXB 2O2LD 1O7IA 4LF5L 4GZYC 1XMOL 5ELFA 5I2XA 2IJ0A 4DNIA 3PSIA 4A3FG 3OW7A 4JPBW 3I8ZA 4UY8C 3LX0A 2FHTA 2EYMA 2Z8LA 3J81L 2A6ED 3CCRA 1YHQA 1T9HA 3S15B 1I4QA 2F3WA 5M5WB 4G7OC 2OWOA 5A35A 3J81i 3OMCA 3HOYG 3MAQA 4ZRZA 1WI5A 4JC0A 1EZ6A 5TSSA 3PIO3 1K83H 2UXCQ 3B6YA 4DV5L 5C4XB 3SE0A 3TN2A 1KC8C 1S20A 3H3VC 5CYUA 5G3LD 2YU9B 1NMGA 1JWUD 1X54A 2AKWB 3L9AX 1WFQA 3SDZA 2UXBQ 5FLXE 4WRDA 4ZUJA 5IWAL 2EYJA 4A3MH 4GKJQ 5FOBB 4PMWA 3URYA 3DLLA 4AH6A 1HNZQ 3S2HB 3OOCA 3HOUH 5LMUH 3C2PA 3SEBA 1W6KA 2ZTDA 3F2CA 2PW5A 1JQYD 4KHPH 1HNXL 4V190 1QB5D 4OO1G 2YYZA 3D4DA 1V1PA 2HIVA 3HG9A 3KDKA 1ZZKA 3BYTB 2B2TA 2Z4IA 1PH1A 3GABA 1Z47A 4M8AA 1SNQA 3CCMA 4N8FA 1HUMA 4JI1L 1BR9A 3FKIG 4OONA 3GTLH 4HCSA 3QOJA 1EQRA 2HHHL 2A1AA 3R2TA 1BF4A 3GTJH 5C3XA 3AYHB 3P20A 5I4DA 3RD4A 2R7ZB 2F4IA 2KCTA 3CU7A 2A6HC 1Q46A 3UDGA 2F0PA 1JWMD 2JA7B 2F0IA 3ND9A 1D2BA 2HD3A 3A0JA 3UE0A 1OXTA 5BR8Q 4QGUA 1YNJC 1XNQQ 2O4CA 1HUNA 1FGBD 3ZYYX 3ULLA 2FPHX 4A3JG 3CMEA 4LF9H 5LMNW 3GTMB 1HZBA 3I4OA 1BBWA 4K0KH 1PYBA 1SAPA 3R93A 3Q23A 2D0PA 4L6TB 1OTCA 1X55A 1N34L 4DF7A 1N8RC 3RZOB 4A93B 2ZJRA 1X4MA 2KENA 3EJIA 1SN8A 3DEOA 2EYPA 1GHKA 3H0GG 2ICIA 2IL8A 2Z9HA 4YHHQ 2Q2UA 4X64Q 1STYA 4GN4B 4GOPB 4DR7H 4ZCKA 5CGKA 3IL8A 4DR6H 3C1EA 3RMHA 1KXLA 4LNQA 1A6XA 2C9OA 1D1IA 2EYFA 2JQOA 1I3QH 3K0XA 4IUQA 4UP7A 4DV7L 1ZEQX 1R4PB 2X06A 2ZXRA 1E22A 1G91A 3HOZG 3H3VI 4A3DG 1EYGA 1STGA 1YNND 4P75A 1UUPA 1PH3A 4CKEA 4OXPA 1CKOA 3HOWG 1KAAA 3E5SA 3VKEA 1L0WA 4CJ2C 3LWUA 1TS3A 1TWHH 5HGTA 4LUZA 3GTQH 4G08A 5EPLA 3RN5A 4B3TL 5C0XJ 4K0KQ 2JZXA 1DYQA 1BQQT 3NQTA 1L1OA 1V1QA 1EC6A 2XIWA 3HEJA 1X56A 5GADC 2B2UA 4B8CD 1NNXA 3X3MA 1SYFA 1Z9FA 2B2YA 3U4VA 5C3EG 4DR7Q 1HTLD 1EY6A 1TWGB
chains in the Genus database with same CATH topology
2LY7A 3J7ZC 1AW7A 5EBCA 4KD4A 1PH9A 3L3OC 5IP7H 3K5OA 2VUMB 2E5LL 1CA5A 2F0LA 3SK6A 5IGBA 2BA1A 4IJHA 2KEDA 2F3IA 2K5HA 5IT9L 2VS1A 1LTLA 4XIGS 3JAMc 1JICA 1KDBA 2EY2A 4ZQ3A 4OWTB 2EY1A 5M3FH 2L4NA 1TY2A 4IUTA 4KD3A 3K0YA 2E2DC 3DWQA 4AYBB 2PCFB 3OIQA 2ZTCA 3AMUA 2R92B 3BDLA 3GTOB 3MEHA 2OF1A 1U0LA 3M9BA 4JI5Q 1MJCA 1J6QA 1CK1A 1D7QA 3VR6A 5KYLA 4OIJA 3C3LA 4JI6L 1E0BA 1C9OA 2JK8A 4IPGA 4YY3Q 2UU9L 2P2RA 2NVYB 2WAQE 4CHTB 3GDEA 1VQNA 1TWAB 2CWAA 1NR2A 2XVSA 2KOLA 1EIFA 1G2SA 4GNXB 1LT5D 1N32L 4GLVB 3CMAA 3PF4A 4IUUA 2QGQA 3FPPA 4DR4L 4WJWA 3M7GA 5CV8A 1RIPA 3QIAA 3DWPA 2KHIA 3EA6A 1O7ZA 1EL0A 2DNEA 3D4WA 2OEOA 1XTDA 2K32A 2L5TA 2K5NA 5EKIA 1V43A 3TEHB 3F2DA 1I94Q 2JJQA 3FDTA 3D6CA 1BVSA 3K5LA 4R4QA 4X62L 1CTMA 3DUZA 3GQBA 1Y1VG 4HJ5A 1VQOA 5KEEA 4TSSA 1VQAA 1RD9D 3S16H 2FJ2A 4X66Q 1Y1WH 1K73C 5JJKA 2E76C 2RVLA 3UE1A 2CKZB 2Q2IA 3EQLC 2UUAQ 3E0EA 1GUGA 1D1KA 3PUVA 2AQ2B 2EZVA 5I6YA 1Y8OB 4KHPL 3KK7A 1KRSA 3A55A 1SFOH 4DN4M 2FXQA 5FLXL 2HIXA 4JG2A 1H9SB 1RHPA 3HZXA 1SR3A 3S1NH 4HIMA 4DR3L 1EOTA 1UE1A 5FLMH 3GV6A 3MXNB 3MXUA 1K9MC 2RDHA 1K3RA 1I4HA 4IUNA 4DAVA 2A6EC 1UE7A 5D14A 3F2BA 2KBNA 4OX9L 3TP7A 1EFWA 4UAIA 1PRTD 4YWMA 2F0QA 3OWEB 4A3IG 1I4RA 3MVVA 2DN8A 1VCIA 3HKZB 4X3UA 2Y0SE 2HH3A 4ZKBB 2R7DA 3VYRA 2VUMG 4LF9L 1EFID 4YWLA 5FK9C 3M85A 2E75C 1Q1EA 3GTKH 2JE6I 1QOHA 1K0RA 1EQTA 4PV1C 1SDFA 3I3CA 3K5NA 1FGUA 2VQEL 2B39A 5IYDH 3M4OH 1XNRL 1RJTA 4LF7L 4MHEA 2RDGA 2MGSA 1WTRA 3SGIA 1S5CD 2UUCQ 2A6HD 4BBRG 4KKTA 1NJIC 4ZKCB 4DR6L 4OL7A 2F3VA 2RHQB 2ZTEA 1CUKA 3Q8DA 2G9HD 2AUJD 4RCNA 2PI2E 1HCZA 3K8AA 4EQNA 3PIP3 4IOCA 2YV5A 1FNUA 1W6JA 4HJ9A 4DR1Q 1X4NA 2BCOA 4BBRH 2CW0C 5IGCA 4BY1B 2A19A 3RZDH 1AN8A 1K1GA 1PZID 1DD2A 1C8CA 3CC4A 2B2WC 3V05A 4WORA 1BBUA 1HTPA 1HPCA 4LF5Q 3KLWA 4NPSA 3T4AC 1XMOQ 2PO4A 4H02A 5DM63 3LNNA 4RGNA 3JAML 1HZ9A 3HOXH 4C3HB 5JOBA 1GD7A 1HA5A 1D5XC 3SHLA 3JAMi 1KHIA 3M7NA 1PH7A 2WIIB 3T53B 3PUWA 1O7YA 1VQ9A 1SYBA 2RBMA 1FJGL 2I5HA 2NZ1D 4RHRA 1TY0A 1DT4A 2F0EA 1YJWA 3TMEA 3PIOA 1B2TA 1HXYD 1LO5D 4RWSC 1TT2A 2FINB 3L7ZC 3BZKA 1VQ5A 2FFKB 4L5SA 3SR1A 2ANNA 5M9OA 3RUZA 1VQDA 1SROA 4DV3L 4AM3A 1ILQA 1LTBD 2HDMA 1X3PA 3GO5A 4U68A 1VQBA 1VQFA 1M90C 1K8OA 5T1GA 4H0LC 1VDZA 1PDQA 5ELBA 2HHHQ 3OHXC 3H3VH 2N49A 4Y7NB 2LMCB 1DOLA 2BDOA 1TWCH 4JI4L 1LT6D 1STEA 1B9NA 1Z6HA 3I72A 3I4MH 2RF4A 3HOVG 4HJ7A 1LYLA 1E3PA 2QKIC 2ZXOA 1QWYA 1XTCD 1G6PA 2K28A 4JBJA 2VB2X 3A8IE 1P8LA 3FKIB 2NVTB 1RODA 1E7ZA 1I4PA 4DV4Q 1YNXA 1EY9A 1KIXA 1F77A 4DXFA 2G9DA 3A5UA 2Q8IB 5JEAH 3LGJA 1KL9A 2ATWA 2B2VA 2GN5A 1EYDA 1OXSC 2KJXA 2DGRA 1TXYA 1EY4A 1GO3E 3S1RB 1TS5A 1VQ7A 4A3LH 3AB9A 1D5MC 1JE4A 2X6GA 3I4LA 5G3LF 2EDGA 4POFA 1DONA 3NELA 3TREA 2PPBC 4BA1I 2NN6G 3CCUA 3IFDA 3NQIA 1FL0A 4A3JB 4MTNA 4DV7Q 4S3SA 5M5YB 2EJFC 3MFGA 4HJAA 3EVQA 3S2DB 3I55A 2B8GA 2M2LA 1WTOA 4PMBA 2QDBA 1YVCA 5LL6S 2NUCA 3MTSA 2F0WA 5EQ0A 2GVBA 1J5KA 2R93H 1SMYC 3CRLC 4FDBA 4WJ3M 1TU2B 2PMZB 2Q2TA 5M3MB 4C2MH 5I6WA 1VQ8A 1V1PB 4DUYQ 1DOMA 5F2DA 4P2CB 4Y52H 3A7LA 4B3TQ 4HIOA 3PO3H 5H1SE 3HKSA 4C3IH 4FXKC 1CI3M 3KFUA 1BXTA 3HOZB 4DK0A 4MZ9A 3S9WA 2IW3A 3STBD 3HOWB 4ID6A 2PW7A 5GROA 1DJRD 2IX3A 1B53A 2PZTA 3ONAB 4GLAC 1LT4D 2E5LQ 4IFDI 2N88A 3W1GA 2LXJA 4RH6A 2YQRA 3T16A 3S14B 1HR0W 2EPBA 1X9NA 1UAPA 1TWFB 2L55A 4ODGA 1HNWL 2E2HB 2H5XA 2ALYB 1SMXA 1GUNA 1C48A 2SNMA 1CT1D 3VDYA 4RGMA 4C3JG 3Q22A 3RNUA 3DHQA 1TUAA 3U9OA 4R4IA 4YWKA 3ND8A 2CQOA 1MSGA 4DKAC 2B63H 2WKCA 2YTYA 3MEFA 1TIID 4HR7B 5C4XH 1A3TA 1E1OA 4GN3B 4F8MA 1I50H 5C44H 4JI6Q 4BXXG 1X6OA 2UXDL 3RLNA 3CCVA 2UU9Q 4QUCA 3KJOA 4YIJA 3P1HA 5D65A 4ZAIA 1VQ4A 5IGEA 4KN4C 1EY7A 3S2HH 1SNCA 1Q7YC 1N32Q 2QEJC 3QJYA 1HFNA 1SE2A 2IWHA 4DR4Q 5CBAE 1BOSA 1STAA 1CSPA 4PZ6A 4LIJA 1Q90A 3A56A 3AQQA 4JBMA 1B9MA 1PRTC 5CORA 4GKKL 1CKNA 1L1OB 1WD1A 4CBVA 2ES2A 3CCLA 1K83B 4NB3A 5CV5A 1PLFA 1H9JA 1DXMA 1LTAD 4CKBA 1EY5A 4H13C 1BCPB 5KYIA 2CHBD 1PH2A 5EAYA 2XWJB 4EVOA 3W2DA 1CSQA 1PV4A 1VQHA 4KHZA 1HFGA 1ENFA 2N3SA 2XRQD 1VIGA 1D5ZC 4Q0FA 1II3A 5FJ8G 3RR5A 3ERQA 1U4MA 2CW0D 2CTFA 1M1KC 4AQYL 2J0TD 2XRSD 3TRZA 5JJIA 2CTEA 4KLKA 3VA7A 1CHPD 5JPMC 2MPMA 1E1TA 1JE5A 1EY8A 5JEAJ 5LMUQ 4UPAA 5FLXc 3M3YH 4ZK9B 4R4OA 4X65L 4X3KA 2EYOA 5EJWA 4KHPQ 4DV6L 1Y1VB 3K81C 1JB7A 5I9OA 3GTLB 1EYAA 4BBSH 1F2LA 3KYHC 4JI3L 1GM5A 3S17H 3OWFA 3G48A 3GTJB 4GN5A 1SE3A 2E3UA 4K2KA 3ULPA 4RHSA 4FXDA 4NW2A 2EJGC 1GKHA 1JC7A 4KMUC 2KUMA 3K7AH 4RAUC 2EVBA 4DR3Q 2I5LX 5M3MG 4A3BH 1AE3A 1CZGA 5J39A 1H9KA 4FNFA 4ZYSA 1PTOC 1YHBA 3CPFA 1RKNA 1RF2D 2KHSA 2NTTA 5GQOA 4XQQA 2K5WA 4DAPA 4DU9A 4O2DA 2B29A 1EU3A 2R3ZA 1LTID 4HMIA 4KY5A 5KRUA 1SJED 1WTXA 3U50C 2OTLA 5DEHA 1R9TH 4OO1I 2MUYA 1Q12A 2BH2A 1ET6A 3OYYA 3S24A 1XJVA 4B9XA 3L2PA 2JP1A 1G51A 5HURA 2K05A 4O42A 3TS0A 1LTTD 1ZKOA 4LF9Q 1DGSA 5BN5A 5LMNL 4LF8L 2Z4HA 4M1UB 1VQMA 3MXGA 2A8VA 1JOKA 3GTPH 1I3QB 4KKUA 3C46A 5JJLA 1LM0A 2N55A 4AYBE 3ULJA 4QIWB 1U4RA 3F1ZA 1E2ZA 1G291 1IYVA 1MBYA 4A3IB 4DR6Q 1ZYRC 5C0XG 1XMQL 1L2FA 2EIFA 1EQVA 3V96A 1ZTGA 4A3GH 4DNTB 2NVQH 1TWHB 2Q8RE 1C4QA 3GTQB 1JJGA 1V8QA 2JA5H 5DAUA 1GVPA 4G4KA 1GUTA 3BG3A 3P75A 3KF8B 3UDIA 2IY5B 1WCMH 2EXZA 1WTPA 4HCEA 3TZDA 1X3EA 2K14A 4TRDA 4CGYB 2E8GA 3MA2B 4J8QA 1L1OC 1KLGD 5I2YA 2RQXA 2PYKA 4B3ML 4BBRB 1ICWA 4FF4A 5FO7B 5ELDA 3PIPA 2DNCA 1PYSB 2QILA 4A3KH 3FP9A 2B63G 1H9RA 2WB1G 2CFMA 1QUQA 2LFNA 5LL6X 4JI7L 4F88A 1E2VA 5K36H 2EJMA 4LF4Q 2F0SA 1G6ZA 2WACA 3C1FA 2ZM6L 1QG7A 3I70A 1PRTF 4B3SQ 1FJGQ 4IO9A 1HQMC 1SMYD 3A8JE 3CC7A 2MQHA 4NXNL 4A3EH 1EIGA 4A3CH 4JI0Q 1B7YB 4MN3A 1DM0B 1SBBB 3AU7A 2NZOA 3DXJC 2CWPA 4A3MG 3DM3A 1CFMA 1XXGA 4P74A 2XSCA 4OHJA 5ELNA 2IHFA 3HOUG 4EQOA 3CQZH 2H4OA 1XPRA 2UXCL 2JA8H 1PH5A 1F9RA 4DV3Q 2L12A 3H91A 2EOTA 3FVQA 4QQBX 4WALA 1XPUA 1ZZIA 5CV6A 5DLQE 1XX8A 5CV4A 1Y8NB 3I90A 2JA6H 1TKWB 4GOPC 1A62A 4A76A 1F2MA 5AJ3L 3TS2A 1S5ED 2ZT9C 3WOFA 1P16A 3CCSA 2JYOA 4NBQA 2OTJA 1JR0D 1I6VC 1M4VA 1NBWA 4JI4Q 3T13A 5C4JH 2C5CA 3E9IA 1IBML 5IP9H 1IBLL 4L8JA 5C3WA 3QO2A 4HIKA 3AEVA 3K58A 4GLXA 2F0HA 3STBC 3J80E 2K4KA 5EPJA 5NUCA 3KBGA 4JI2L 1SSOA 3VYTA 5KNCA 4IPHA 3QB3A 1LACA 5KIXA 3QOLA 1B70B 2MFIA 3PO2H 4WFN3 4KY6A 1J5EL 3EROA 3KBXA 2WKDA 3RLOA 1PTOF 1U4LA 2CQAA 2WFWA 3NBHA 2LSSA 1JB3A 4L5TA 3HKZE 1KRTA 5IYBH 3MXPA 2VL6A 3BDCA 2OQKA 3NUCA 1V9PA 3S16B 3HOVB 5J3BA 5IYCH 2K50A 2F03A 1Y1WB 4LWCA 5BR8L 4DR5L 1PH4A 1ASZA 3G7LA 3FHWA 4OWWB 4O0AA 1L0YB 4LW1A 1TR5A 4MIUA 4DUZL 4DV1Q 3EBEA 4C1NK 4RA8A 4JI8L 1MD2D 1KLUD 1BKBA 1W3SA 1X32A 1XPOA 3ERSX 4LFBL 1PVOA 2AUKA 4PMCA 4K8JA 1SFOB 2DY8A 2L11A 1VF5C 3W3AA 1HJPA 1QNKA 1AEXA 5J22A 3Q0AA 4DAMA 3KJPA 2KA7A 3D4RA 3S1NB 2BE5D 3D6WA 2BH8A 5M5XH 1SRUA 1GUSA 2Z1CA 3SXHA 5E1FA 1DZ1A 2E2JB 5EPKA 5HY6A 3BZDB 1JOQA 1LUZA 1Z7TA 2F4VQ 3L0OA 1A2TA 2J4XA 3J81E 1F9QA 1XYIA 1RCVD 4KV6A 4BY7H 1O78A 1YITA 1LTGD 3R8BA 2Z6KC 2HUGA 2I5MX 3A7AB 1S5DD 4F7XA 5A2QE 1L0XB 1EIHA 2Z0SA 1PFSA 1K8GA 2B2WA 1T5XD 1Q81C 4BY1H 4JBKA 2RHSB 3NXWA 5IP7G 4G7HC 4GNXC 1UE6A 1HNWQ 2KECA 2JA5G 3P7JA 2HDLA 3OPOA 4RCOA 1NR4A 4CKCA 1QNUA 3GTKB 4XXEA 2UUBQ 3CKIB 1QVGA 1EYCA 1YEZA 3KF6B 1NSNS 5M3FG 2FMMA 4C3HH 2BL5A 1ESFA 1CQVA 3A8KE 2IPKD 3UDXA 3V69A 1RDPD 1AZQA 4IJLA 4LJZC 5IGFA 1PTOD 2O4XA 3K59A 2VXWA 3VR5A 2RSNA 3I4NH 1AP0A 1J8IA 4DV5Q 2UXDQ 2X69A 4A3FH 2JXMB 2CTMA 3S1QH 4DK6C 4C3JB 4K14A 3QG1A 5IWAQ 2C35B 3NK9A 2KHJA 3HOYH 4BA2I 1RL2A 1LLRD 3G71A 2OPUA 2CVRA 4FVMA 2MJHA 3PV0A 2I46A 4GKKQ 3TP5A 1HNXQ 1J9OA 1X3GA 2WP8J 4G57A 4XQJA 4B8TA 1I6HB 2R6GA 2WAQG 4V0BA 4B9WA 3NENA 1SE8A 1ZYRD 1EWHA 4JI1Q 3TZUA 4Y7NH 3PUYA 1WVNA 1RTNA 1EY0A 4OO1H 1Q8IA 4ABNA 1GOZA 4XQNA 4JOIC 1QZGA 2KCNA 3NTHA 4DFAA 1KHMA 1LTRD 4WJ4A 2HH2A 1QZHA 3DWAA 1Y1WG 2AMCB 4JYAL 1EWCA 1X3FA 1I4GA 3NPPA 4X65Q 4K5XA 4HIDA 1TS2A 3H09A 5C4HA 4DV2L 4KJOA 4DV6Q 4Z9CB 1FNVA 2XTIA 1BCPD 2D5DA 3GTGH 1PH8A 4DAYA 3F2UA 4JI3Q 1B1ZA 4K6LA 1X65A 1N34Q 2D9UA 1G2TA 2PMZE 2B8FA 4ME3A 3N6RA 3TDQA 4Q5VA 3TBIB 3PCOB 2UUAL 3I4MB 5IYCG 1IW7D 5FLMG 1ET9A 1JMCA 3NE5B 4NDXA 4EQPA 2K03A 5JJZA 3WOEA 2E2IH 1WJJA 3E6ZX 2MHVA 3D0FA 4IOAA 3H0GH 3OSOA 5IT9E 1CHQD 1PMRA 2OT2A 2ASBA 2PZWA 4FF1A 5AFWA 2F0OA 1CKNB 1NMFA 4QY7A 1QVCA 2ZJQA 1CM9A 3AFQA 3HGBA 2PI2A 2A69D 2K5DA 5E4WC 2VW9A 4RKLA 3BDOA 3BJUA 5LMNQ 4LF8Q 2F0DA 5IGGA 4A3DH 2I0QA 1AH9A 2EY5A 2EYLA 1VQLA 1YZ6A 1PTOH 3I7FA 5GAEC 4BY7G 2K7VA 2NBFA 5IYDG 3IKJA 3SVMA 1M8AA 1GXDC 4JVHA 4FF3A 4HMJA 4B08A 5CC4A 4HSPA 2J7ZA 2R93B 2F0JA 5FO8B 3O13A 2ID0A 1JT8A 2AWNA 4J6HA 4C2MB 1A63A 1ZZJA 2ZXPA 3J7AF 4TQUS 4LUOA 5CR3A 3PO3B 4L63B 3K80C 5C3EH 4L5QA 2VB3X 1LV9A 1NY4A 4C3IB 2NVXH 3S1MH 1WTVA 1KABA 1AZPA 1NCVA 3CRKC 3HRZC 4KY7A 4OGQC 2K01A 4I7ZC 4HSVA 1VMCA 3KLSX 4B3MQ 2IHEA 1YI2A 2KQ3A 5COYA 1EZ8A 2JEBI 2L9HA 4H44C 3S15H 4C56C 5M5WH 5CV9A 1EQQA 2EYHA 3Q24A 3KDFA 3FEWX 5C5MA 3DMUA 2NN6I 2PQAA 4DR1L 3HOXG 5IE8A 4PQXA 3FPUB 4ME5A 2YU9H 2PY9A 1TVXA 2ZM6Q 3BU2A 2RSOA 4IQZA 4EGVA 3RLFA 2CCZA 3I91A 4NXNQ 5LHY1 4DGZA 1Q8KA 2PQUA 3N52A 1TQOA 5K5PA 1FNWA 4B3RL 3ITPA 3T51B 5HGQA 2K5VA 2M9VA 1DOKA 3K6OA 2B63B 2F52A 1HR0L 2WB1B 5KNBA 4JV5L 4QMGA 1NAPA 1XWEA 1D8LA 4HAEA 4L5RC 3OTOL 5A2QL 1HQRD 2HQEA 4DR2L 2HCIA 1I50B 1UEBA 5C44B 5IOCA 1W2BA 1VQEA 2KEEA 2BE5C 1F9PA 2FMRA 4X62Q 3HS0C 4IUPA 3UI2A 5AJ3Q 1JJ2A 2VZAA 2R7ZH 4A3MB 2ICEC 2JA7H 3CXCA 3HOUB 1IBMQ 1FVIA 1IBLQ 2N8NA 4BS9A 2SEBD 1EOVA 1LTSD 4DV0L 3NSWA 1UWVA 3VR4A 3WDNA 2MO0A 3CC2A 1CZWA 3KOJA 4JI2Q 5ELCA 3I4MG 1Y1VH 4EQ5A 3GTMH 5I9PA 3CCJA 5JPNC 1UE5A 3H94A 2DGYA 1UEAB 3K7UC 3T1HL 1J5EQ 2B2TC 3FMCA 3RZOH 4A93H 3HFZB 4GS3A 1IL2A 2M00A 4R1JA 1QUQB 1DTJA 2KCMA 5JEAG 4DNRB 2YTXA 3TP8A 4DR5Q 1PA6A 3JC66 4HJ8A 2BDNA 4LFAL 4A3LG 2PQEA 2QA4A 3E9HA 1YIJA 1EIYB 4UP8A 4DV4L 4DUZQ 3IRBA 4F87A 3M3YB 2R7FA 5EBDA 3I73A 4OX9Q 1K8AC 4JI8Q 4P72A 2D2CC 4QIWE 3GV3A 3CP0A 1PFMA 2AXYA 4LFBQ 4BBSB 1MKHA 2RDFA 3S17B 3BYYB 1HH2P 2AHOB 2AQ1B 3SK8A 2R93G 3CD6A 2MJ8A 4WANA 3DEPA 3K7AB 4ZUIA 1N36L 1B4OA 3NBIA 3H15A 4LF6L 3E0JA 4POGA 4A3BB 1EEFD 3QWNA 1VQCA 1BDOA 3PO3G 4JK1C 1A3VA 3JAME 1IXRA 1TWGH 1CKMA 1TS4A 2F0UA 1A15A 4A3IH 4C3IG 2VQEQ 3VR2A 1XNRQ 2YTVA 1IYUA 1GUOA 1PFNA 4QJFA 4LF7Q 4O1NA 1R9TB 3T1YL 4PNYA 1KTKA 3UDFA 2VUMH 3KLRA 4RFBA 2H1EA 3VYSA 4DUYL 2K5QA 3AEVB 1QE6A 5EKLA 2D62A 5KNDA 2ZJPA 1GJXA 1AE2A 3D31A 4LFCL 5DNFA 1E2WA 4DK3C 3K5MA 1BNZA 1U4PA 1YJ9A 1FYCA 1I5FA 1KDAA 3CCQA 1WTQA 2R92H 3GTPB 3NBHB 1N33L 1ASYA 2EXDA 3OW2A 1BBXC 3GTOH 1YHAA 1S5FD 2B3GA 2B2UC 4FF2A 3W5OA 2B2YC 3G6JB 1JOOA 1BCPC 1ML0D 1NUCA 4NXML 1HA6A 5D3IB 4KK7A 3EFXD 3MC0B 2VQFL 4A3GB 3A54A 2NVQB 3CAMA 1PZJD 5C4XG 1KNEA 2NVYH 1S5BD 4LK1C 2JA5B 1KD1C 1IBKL 1TWAH 4RGTA 1STHA 2K6AA 2O5IC 4XYQA 4FP5D 1WCMB 3U58A 4TVAB 1KAWA 5C44G 1OXXK 3R2IA 1CA6A 5M3FB 4UP9A 4XT1B 1IW7C 1VQKA 1H95A 1S40A 1J4WA 4X3SA 5FKAC 2XGTA 3ER0A 1K8MA 1MGSA 2EY6A 1Q82C 2L1BA 3KUPA 1VQGA 1H9MA 1PXUA 4A3KB 4X6AH 4GOPA 4A75A 4RMFA 2JVZA 1IHZA 2F1MA 2K04A 1KQSA 1V1OA 3BVZA 1OXUA 1B8AA 2UXBL 2F0MA 4LMQD 2A69C 5C0XI 5FO9B 5IIFA 4GKJL 2AQ3B 3EIVA 1DCZA 1JJCB 4A3EB 5GAHC 3CCEA 4ILWA 1ILPA 1HNZL 4HN7A 4RGOS 5T1IA 1SE4A 5C6AA 1SLJA 1IYJB 2R7ZG 1A0IA 2JA7G 4XT3B 3HP3A 5D3DA 3PGZA 3CQZB 3T56B 3M4PA 1S3OA 2JA8B 4R4TA 1S72A 5ELOA 5CMDA 4ZLTF 1ENAA 4YCVA 2WV6D 3TQYA 4JYAQ 2K1BA 2WAQB 2L15A 2VNUD 1A8VA 3R3OA 3BS1A 3W1BA 2LS01 1E24A 2CTJA 2K33A 4DV2Q 5IGDA 1F2YA 4IN3A 2JA6B 5E7NA 4U673 2BA0A 1A3UA 1N9WA 1VQ6A 1PYWD 4P71A 3Q6SA 1QCBD 3BVMA 1FR3A 4A93G 3HOVH 4BBSG 1EU4A 1STBA 1Y14B 1PH6A 1U5KA 5C4JB 4IPCA 4IFDH 1C0AA 3TP6A 2TSSA 5LMUL 3KF8A 4TKOB 1XNQL 4A3BG 1STNA 2JA9A 5BN3A 1RTOA 3NEMA 3MHBA 2LXKA 4DPGA 2QNDA 2F0TA 2Q2HA 1WTWA 1ZXTA 2PNRC 2F0NA 3MWYW 4AIMA 3PO2B 2A68C 3I56A 2L0CA 1F9SA 1WD0A 3A5ZB 3D3RA 2I07B 3LWEA 3U1KA 4KI0A 2A5HA 4J15A 3OMGA 2IX1A 4YHHL 5EGTA 4APVA 4X64L 2E2JH 1WE8A 3J80c 2NN6H 3K57A 1IL8A 2X6LA 1HZCA 2Z6KA 1AFPA 2FMCA 1PFBA 2O5JC 2HQLA 3SK4A 3ZJYC 1MI2A 4FYDA 3SK5A 4N9TA 4GNXA 5J1ZA 2NB0A 2AWOA 3VA5A 2GA4B 1OXVA 2SOBA 1SYCA 4NP5A 4RKBA 2XWBB 2K75A 2MO1A 4K0KL 4OIKA 2IT1A 5CBEE 4PG3A 3CHBD 3PUXA 1F2ZA 2HT1A 1SYDA 1PHJA 5M5XB 4A3GG 1SYGA 2SNSA 4K5VA 5CV7A 1EWIA 4IURA 1BCPF 4HTHA 1QILA 3MFYA 4R8IA 3G6EA 3CPWA 5KGUA 4DR7L 3WWVA 1WCMG 5JVG3 3F8TA 4DAYB 4AYBG 4BY7B 4LAAA 1IKMA 5JVH3 3M4OB 3PF5A 3D8GA 2NZHA 3VYUA 2F0FA 1HZAA 4YCWA 3U4ZA 2R92G 2PZUA 1YBYA 3M4QA 2Y0SB 1MJEA 1SJHD 1YNJD 1O7LA 1ENCA 1KDCA 3BZCA 1R4QB 2F0GA 2QF7A 3J7AV 2A74C 2KVMA 1GUWA 4A3KG 5E3FA 3J81c 1ESRA 2DY7A 3OIPA 4P73A 4JBWA 4C3JH 1JWSD 5K36G 3H6MA 1SNMA 4K5WA 3RZDB 4G7ZC 1O80A 4H7BA 2OPVA 1VMPA 1SNDA 1PZKD 2MP1A 1VQPA 5BN4A 1GHJA 5E4XA 4A3EG 4A3CG 4QUFA 4B3RQ 2IX0A 5ELEA 2OXPA 1HR0Q 4JI5L 1H9SA 4BXXH 4JV5Q 4QL5A 3VR3A 4LF4L 2SDFA 3HOXB 4NKLA 1I6HH 3OTOQ 1C7YA 3J81j 5IY0A 3MXNA 2F0KA 4YY3L 4BWGB 4DR2Q 3IFTA 4B3SL 2JA8G 3I4NB 4XYOA 1B50A 4JI0L 4CJ1B 4A3FB 4JOIA 4DA2A 3S1QB 2NWGA 4R4CA 2TMPA 4I65A 4XTCS 2JA6G 1EUJA 1BO0A 3TSSA 1B44D 1MIUA 3U9SA 2VY3A 3M4YA 3HOYB 1U9RA 1YNNC 4KN7C 1VQJA 4IPDA 2ANRA 4AQYQ 4DV0Q 3NWTA 5IP9G 2Q8TA 4ULLA 4IZ8A 1I94L 4HEDA 3FKIH 2NVTH 1JORA 1VF7A 3EN2A 3X3NA 1ONLA 3KLSA 4QMFB 1D6EC 5ISRA 5FJ8H 3T1HQ 4IFDJ 1SNOA 4FO2A 1VIHA 3GP7A 2PNHA 3CF5A 5GAGC 3PO2G 4IUVA 3KDFB 4QF4A 3S1RH 3J7YW 2PQAB 4X66L 3NWSA 1WYDA 1Q3LA 1TWCB 2EE1A 5IYBG 2XN9C 1MSHA 4IFDG 4LFAQ 4A3JH 5M5YH 4JCVE 4YCUA 2DUDA 3S2DH 1PRTB 4KJNA 2RCNA 3G4SA 4ALPA 1SYEA 1B3AA 2V1CC 5C4ZA 4UDUC 1Y8PB 3KF6A 1I4XA 5EKKA 2KCCA 1QJOA 1S4ZA 5DM73 3GTGB 4N9PA 2GVAA 5M3MH 3HKZG 3PMFA 4QB4A 5C5LA 1IZ6A 2OCEA 4NMZA 2WINB 1HHVA 1T5EA 1N36Q 4LF6Q 2R61A 3FRPB 4DK1A 2V4DA 4C1NI 2B2VC 4KHVA 2NYZD 4XDXA 1UNSA 3I2ZA 4J1MA 4DV1L 4K8IA 3HOZH 4X3TA 1LT3D 1EEID 2OQ0A 3ICEA 4K6DA 3CW2C 3AFPA 2BOSA 1SEBD 2D0OA 3HOWH 3J80L 4OWXB 4A4IA 4QCLA 2E2IB 3J7A5 3IAYA 4IALA 1A2UA 1BUVT 3T1YQ 4CJ0B 3H0GB 3PUZA 3J80i 1G8ZD 2JEAI 3RN2A 1VQIA 2NTSA 1XMQQ 4PZ7A 3S14H 2F0VA 2E74C 2Y0SG 4RG1A 4EX5A 1TWFH 1OO9B 4LFCQ 1JCKB 2HCCA 2E2HH 2RKSA 2F4VL 1QVFA 1KNAA 2JSOA 4BY1G 4E6IA 1WVLA 1HRJA 2K52A 1FD7D 1SNPA 3MZ5A 2CTLA 4K2LA 4PZ8A 4KKSA 2A73B 1YJNA 4A3DB 1LABA 5C0XH 5IT9c 1VS0A 1CQFA 3A74A 2MNAA 1N33Q 2ENBA 2UUCL 1NE3A 1NTGA 4KTAA 1PTOB 1SXTA 3BVGA 4R8NA 4LUVA 1X3QA 4MNOA 2XNAC 1Q1BA 4R9WA 3NTKA 2N78A 4C3HG 2WB1E 2LKVA 1IKLA 1Q86C 3GD7A 2QCPX 2RA4A 5JAVA 4FXGC 4NXMQ