2NN6G

Structure of the human rna exosome composed of rrp41, rrp45, rrp46, rrp43, mtr3, rrp42, csl4, rrp4, and rrp40
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
259
structure length
236
Chain Sequence
ARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymyositis/scleroderma autoantigen 1
publication title Reconstitution, activities, and structure of the eukaryotic RNA exosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/transferase
total genus 33
structure length 236
sequence length 259
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nn6G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nn6G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2nn6G03
3AQQA 1RIPA 3BZCA 4DNIA 1VS0A 2YQRA 1N36L 1I5FA 3PCOB 4KI0A 2R92G 5C0XJ 4GKKQ 1K1GA 4BBSH 2RHSB 2AXYA 2QF7A 1Y8PB 2VQFL 1H9SB 2EDGA 5GAGC 2L15A 3M7NA 4A3LG 2EQSA 1J5EQ 4DUZL 3HOWG 3ULLA 4QL5A 2PQAB 1EUJA 3HOZH 4DV1Q 5C0XG 5JJIA 3M4PA 2JA9A 3VR5A 4DR1Q 4DV3Q 1MKHA 4KHZA 1YJ9A 2AUJD 3PF5A 3G71A 2YTXA 4LF6Q 2BE5C 2AMCB 3GDEA 1X55A 4KLKA 3OOCA 1TWFH 3K7UC 4UP7A 2R92H 1HNWQ 5GQOA 2A6HD 4LF9Q 1Y8NB 2UUAL 3CCQA 3S17H 1CTMA 3M9BA 1WJJA 4IFDI 2ALYB 5LMUQ 4KKSA 1SFOH 1H9SA 1A62A 2ZTDA 3L7ZC 4TQUS 4NB3A 1IYJB 4B3TQ 1QZGA 3CPWA 4JI4L 4C2MH 1H9JA 3V69A 2ZJPA 1YJWA 2KHJA 1E1OA 2KHIA 4DV7Q 1H9MA 4K0KL 5KNDA 1FL0A 4KKUA 4JI3Q 1WE8A 4DR2L 3BG3A 1ASZA 3UDFA 1XMQL 2OTJA 5C3EG 1PFSA 1P16A 2PI2E 4C3HH 3A5ZB 1CUKA 4DAYB 1RL2A 2IX0A 1PMRA 1HNZQ 4YHHQ 4YWMA 2NN6I 4DKAC 4A3CG 2DNCA 1X9NA 1EC6A 3A5UA 1G51A 1YBYA 4A3EH 1N32L 2ATWA 2D2CC 4HIMA 4A76A 2R6GA 1XNRQ 3B6YA 3KFUA 4IQZA 3CW2C 3KYHC 5C3EH 3KLWA 2GVAA 1IBKL 3S1QH 1Y1VG 2WAQG 2ID0A 3HKZG 5HGQA 1VQBA 4IJHA 2ES2A 1Q7YC 4JI5Q 1FJGL 4B3RQ 4HJ5A 2I0QA 3VR6A 3IKJA 3P20A 1VQFA 3A8KE 3CF5A 4JI7Q 3FP9A 1N34L 3KOJA 5E7NA 1O78A 5HY6A 3OTOQ 4BY1G 3VA7A 1A6XA 1YHAA 2E2IH 3RLOA 1VQ8A 3G6EA 3H3VI 4HJ7A 3I56A 3GTOH 2A19A 4O2DA 1VQCA 3W3AA 1A0IA 1I6VC 2CTLA 1E2ZA 1YZ6A 4DR7Q 4WALA 4LF7Q 4LFCL 1JE5A 1TWCH 1DGSA 2JEBI 1KAWA 2N3SA 3GTLH 5GADC 1XNQL 4R4QA 4A3DG 3NELA 5C4XH 4GKJL 4A3BH 2OQKA 2B63G 1DTJA 2IT1A 2JXMB 2GN5A 3CCUA 1K9MC 4QJFA 1VIHA 2VZAA 3MXNB 3RZDH 1EWIA 1T9HA 1S3OA 1TU2B 2UUCQ 1Q1BA 5A35A 2WB1G 2K4KA 4DV2Q 3U58A 4ALPA 3F2CA 1BBWA 2A6HC 1DXMA 2CTFA 3MEFA 2ZT9C 3I55A 1R9TH 3CCSA 2NVXH 3LWUA 1YHQA 1QUQB 3WWVA 3T1HL 2F3IA 3HOXG 4DV4Q 3HOYG 3A74A 3S2DH 3CPFA 2YTYA 1T5EA 5GAEC 2JA8H 4X66L 2MNAA 1N33L 3HKSA 2JA5G 2VQEQ 2UUBL 2VNUD 2AUKA 1MIUA 3TS0A 1KRTA 4JI6Q 2AWOA 1CKNB 1K83H 5JJKA 1E2WA 2R7ZH 1PH3A 5K36G 3A7LA 1PH8A 1O7LA 3NENA 5M5YH 4GOPC 5IP9G 4DR5Q 1ASYA 3K80C 4B3ML 2HT1A 3HOYH 1KIXA 3BZKA 3SDZA 4G7ZC 1SMXA 4HIOA 1N36Q 3CRLC 3GD7A 2NZHA 4A3IG 4GN5A 4DUYL 2VQFQ 3PUXA 1X4NA 1UE6A 4YCUA 5KNCA 3J81i 3VDYA 2PMZE 3HOUG 1X3FA 2PNHA 1VDZA 4DUZQ 5K36H 3T1YL 3CCVA 4DR4Q 1UE7A 4POGA 5IP9H 3TRZA 4H02A 2WAQE 4GOPB 1LUZA 3HKZE 1OXXK 4DNTB 3MXUA 3ICEA 5FLXc 1QVGA 3KJPA 2UUAQ 4JBKA 1K8MA 3VR3A 4LW1A 4KKTA 2CTKA 1VQ9A 1SN8A 1EWHA 1KXLA 3I4MG 1VQ4A 1VQDA 2MO1A 4QGUA 4DNRB 4JBJA 2UU9L 4APVA 3OW7A 1B8AA 1Q46A 4AYBE 4JI4Q 4JCVE 4A93G 1QJOA 2I5HA 3PO2G 1NTGA 3VR2A 2CTEA 4GOPA 5IYBH 3RLNA 4DV6L 4K0KQ 1B70B 1Q8KA 2V4DA 2FXQA 1YIJA 1VQPA 4BBRH 2QEXA 1AE3A 3UDIA 1PH5A 3D4RA 1AH9A 1XMQQ 1WOCA 4A4IA 3IFTA 3UE1A 3FHWA 1ZZJA 3NEMA 3QIAA 3I4MH 2ZM6L 3E9IA 1A8VA 4YCVA 1VQ5A 3GTMH 3BU2A 4JC0A 3VR4A 1VQ6A 1GUOA 3CMEA 2PNRC 3CCEA 4HJ9A 1GUGA 3PF4A 1K3RA 4A93H 1GM5A 1C9OA 3RN2A 1IZ6A 3CCJA 4AM3A 1VCIA 3HOZG 4KHPL 1YNXA 1N32Q 2A68C 3KF6B 4G7HC 1GJXA 5IWAQ 1CKOA 4R4IA 2BH2A 3MFYA 1K73C 2NVQH 1M90C 1J4WA 4DK6C 2CKZB 3A0JA 1LABA 1IBKQ 1GUTA 3I2ZA 2Z6KC 2LSSA 3M3YH 4AQYL 4R4CA 1E24A 3U1KA 1K0RA 2JK8A 3A8IE 2E76C 5IP7H 1BKBA 1N34Q 3CMAA 1KHIA 2LXKA 1J5KA 1XJVA 2UXCL 4A75A 3S1RH 1EQRA 1PH4A 1G291 1HZAA 4XIGS 2DUDA 3KF6A 1HNXL 4B3SL 2NN6H 2B8FA 4YY3L 3TREA 5IYDG 1ZTGA 2DGYA 1YVCA 2CWAA 5ELOA 1S40A 2EIFA 5IT9c 3U4VA 4LFCQ 2VL6A 1SE8A 1V9PA 4C3IH 2AHOB 1XNQQ 1FVIA 5FLMH 4JYAL 1BBUA 4GKJQ 4OWWB 2CTJA 4WANA 3TS2A 4QIWE 1QVCA 2PCFB 1M1KC 1L1OC 2D0PA 1SRUA 2I5MX 4OXPA 1B9MA 3J81c 2VY3A 2CW0C 3G4SA 4A3EG 4TVAB 5IYDH 1YEZA 1PA6A 3D0FA 3AFPA 1LYLA 3QG1A 1X6OA 3H15A 2Q2UA 1HH2P 2N8NA 1QZHA 1X4MA 3H3VH 1K8OA 2Z6KA 5M5XH 1TXYA 3GQBA 5BN4A 3T1HQ 3E9HA 2BL5A 1VQMA 1XPUA 2K75A 3DM3A 2GVBA 3RLFA 3PGZA 4P71A 1GVPA 3PUVA 2A69D 3ULJA 2VW9A 1OXVA 4PZ8A 4QQBX 3PIOA 1N33Q 1Z6HA 4G7OC 4LUOA 3RNUA 2UUBQ 1E1TA 3JC66 4DV5L 4DAMA 4A3MH 1WVNA 1I94L 4H0LC 1EIYB 1V8QA 5EAYA 3JAMi 1GKHA 5M3MH 1KRSA 3CC2A 3AFQA 2EJGC 1V1QA 2E2HH 4B3MQ 5FJ8G 4LJZC 1EYGA 1CKMA 1HZCA 2IX1A 5C4XG 2ANRA 4OO1G 4UPAA 4A3BG 5BN3A 4GN3B 1TUAA 1VQHA 1XMOL 3J7A5 4PG3A 4DUYQ 1EIFA 1OXUA 1L1OA 5C0XI 4DV0L 2JE6I 3EBEA 1UE5A 2WP8J 2Q2HA 1B7YB 1OXSC 3ND8A 1J6QA 3T1YQ 4JOIC 4GLXA 4AYBG 1Y1WH 4LUZA 3K0XA 3FKIG 3OW2A 2R93G 3GTQH 5FJ8H 1IBLL 4HJ8A 4LF6L 2C35B 3CD6A 3OPOA 3H0GH 4OO1H 4IPGA 2D5DA 3LGJA 3L2PA 3J80i 2PQUA 1PHJA 3I73A 2MQHA 1NE3A 2JA7G 2JA8G 1GD7A 1KQSA 3AEVA 1H9RA 1IL2A 1DCZA 3M85A 1PH6A 4LFBL 4O0AA 2UU9Q 3CQZH 1X3EA 2R7DA 3FKIH 2VS1A 4NXML 2LMCB 1JMCA 4DK1A 2R93H 4BY7G 1HTPA 2R7ZG 4TKOB 3T51B 5BR8L 2K5HA 2D0OA 4RG1A 2EJFC 3HFZB 4UP8A 4L8JA 2O5JC 2E5LL 4GLAC 2JA7H 3SE0A 3N6RA 1JJGA 4PZ7A 4A3FH 1VQAA 2ZM6Q 4BA2I 1YNJC 2HHHL 3GTJH 4GLVB 1PV4A 1Q1EA 2Q2TA 5BN5A 4IPDA 3W1GA 1D8LA 1SROA 4JOIA 4LFAL 1H95A 1Z7TA 2K7VA 3BDOA 4BY7H 4JV5L 1IBML 5H1SE 3J7ZC 3GTKH 1CFMA 4OX9L 4KHPQ 2NVTH 4WJ3M 2UXBL 1Q12A 4LF5L 1HCZA 3AYHB 3F2DA 1HZBA 3PUZA 2RF4A 1Q82C 2BDOA 2E8GA 2K5NA 3GTPH 3M4YA 1PH7A 2CQOA 4R1JA 2A69C 2YTVA 1TWHH 4L5RC 4JI1L 5AJ3L 1FR3A 4HJAA 1W2BA 3WDNA 5IE8A 3CC7A 1GUSA 3LNNA 4JI0L 2KA7A 4DK3C 3HGBA 3F1ZA 2UXCQ 3RN5A 2EVBA 2N49A 1HNXQ 1GHJA 4B3SQ 2DGRA 5IYBG 4X62L 3ERSX 4YY3Q 1WFQA 4BBRG 4IFDJ 4EQ5A 2NZOA 4BXXG 4OWTB 1FGUA 3JAMc 1Y69U 2HIVA 2B29A 4JYAQ 2DNEA 2Y0SE 2Q8IB 3ZJYC 1MJCA 1E2VA 3G48A 4RMFA 2JA6G 4IFDG 2K33A 1ONLA 3L0OA 1JB7A 3ULPA 3U9SA 3PV0A 5IYCH 1C0AA 2CFMA 2VUMG 4WJ4A 4JVHA 1Q86C 2NVYH 5KNBA 3FPPA 2E2JH 4BXXH 3OYYA 4DR2Q 2F4VL 1Z9FA 4GS3A 1PH9A 2IHFA 3PIPA 2QGQA 1TKWB 1OTCA 3S15H 5IY0A 3I7FA 3TZUA 2JA6H 4IFDH 2YU9H 4NXNL 1HR0L 3KDFA 1ZKOA 2E3UA 3J80c 5IP7G 1WCMH 4IOAA 4YCWA 3CP0A 4X65L 2VUMH 4EX5A 2ZTCA 2BA0A 3VKEA 3KLRA 2F52A 4DV5Q 4P75A 1I94Q 1WYDA 1N8RC 2NN6G 4DK0A 3F2BA 4JI6L 1VF7A 1YITA 4J15A 1IW7D 4ME3A 2CCZA 1VQIA 4H13C 2UXDL 4A3KH 4LNQA 1DT4A 5J3BA 5JJLA 1GUNA 1ZZIA 3DLLA 4DPGA 3T56B 1FJGQ 1UWVA 5FLMG 2A1AA 2Q2IA 4JVYA 5GAHC 1KC8C 1HR0W 5LMNL 1XMOQ 2KENA 3GO5A 4POFA 4DR3L 3EIVA 5DLQE 4IO9A 4DV0Q 5C44H 2PPBC 2AKWB 2HIXA 1SMYC 1N9WA 2KBNA 3UDXA 2HQLA 1EQQA 3AB9A 3CXCA 4DR4L 2I5LX 2CWPA 2BA1A 4DR6L 1HQMC 1Y14B 1V43A 1HJPA 2ANNA 1LACA 3CC4A 1VQLA 4IJLA 1IBLQ 1Z47A 2CPQA 2IY5B 4LK1C 2A8VA 3DXJC 3STBD 2MFIA 1I6HH 3FMCA 1KL9A 5LMNW 4UP9A 1YI2A 4LF4L 2O5IC 2N78A 2KCMA 2KCCA 3S16H 4X6AH 3D31A 1YJNA 4UY8C 4LFBQ 4L5TA 1FYCA 1SLJA 4PZ6A 1CSQA 2DN8A 2XGTA 4A3LH 1O7IA 4GZYC 1S72A 1A63A 3HOWH 4A3MG 2RCNA 2PQAA 4NXMQ 4GN4B 5C0XH 3K8AA 5C4JH 4X64L 5BR8Q 2OQ0A 5M3MG 4NPSA 2OTLA 3T53B 2CTMA 1NJIC 1EFWA 1VQJA 1L0WA 2E5LQ 1G6PA 1PH2A 3A8JE 4X66Q 4A3JG 2ZTEA 4JI8L 3EN2A 2HHHQ 4PV1C 3PUYA 4R4OA 4JI2L 4LF8L 4MZ9A 1PYSB 1L1OB 1TWGH 4LFAQ 3CCLA 4LIJA 2WFWA 4P74A 2EJMA 1E3PA 4JV5Q 1IBMQ 1BDOA 2OPUA 3TEHB 2HH2A 3A7AB 1Y1WG 4OX9Q 2UXBQ 3UDGA 2PI2A 1JJ2A 4C3JH 3S24A 4LF5Q 5IWAL 4OWXB 2K52A 4H44C 3H0GG 4HR7B 4A3JH 4GKKL 1D7QA 1K8GA 1IXRA 4P72A 2Y0SG 4JI1Q 5AJ3Q 4JK1C 3AEVB 1GHKA 4KN7C 1MJEA 3RR5A 3I4NG 1VF5C 4JI0Q 4A3CH 1J5EL 3CCRA 3CRKC 2FMRA 1KHMA 1IW7C 4DV1L 4MTNA 4DR1L 3NE5B 4DV3L 2MO0A 3HOVG 4X62Q 1IYUA 3W5OA 4KN4C 1VQOA 1JJCB 3I72A 2JJQA 1P8LA 3I4OA 1L2FA 1VIGA 2JZXA 1HNWL 1PYBA 1Y1VH 4LF9L 3ER0A 1X65A 1NMGA 1LTLA 5LMUL 2B8GA 4AIMA 4A3FG 2V1CC 2F1MA 2XTIA 3I4NH 2A6ED 1VQKA 2MJHA 1EOVA 4RCNA 2EXDA 4QMFB 1C7YA 3EQLC 4B3TL 2B3GA 4LWCA 1CI3M 4BY1H 2PY9A 4JBWA 3HOVH 4DV6Q 1UE1A 2ZJQA 4DV7L 1B9NA 3U4ZA 4QY7A 5M3FG 4JI3L 1K8AC 2K14A 3J81j 2F4VQ 3STBC 1X54A 1UEBA 4PMWA 4A3DH 2A68D 2K50A 2B63H 1VQEA 3TQYA 2ASBA 3Q8DA 4B8TA 1HNZL 4R4TA 4GNXC 1HR0Q 4NXNQ 4YHHL 1ZYRC 2HH3A 4X65Q 1I3QH 4MNOA 1VQGA 1DD2A 4FDBA 2QNDA 1E7ZA 4KMUC 3M4OH 5M3FH 1GO3E 2JVZA 4YWLA 1ZZKA 1U5KA 4JG2A 1XPRA 4YWKA 4HIDA 1NY4A 1XNRL 1PH1A 3NBHB 2YYZA 3PUWA 4OGQC 3RZOH 4OO1I 2UXDQ 3IRBA 3K81C 1HZ9A 1QUQA 2H5XA 4JBMA 3HOXH 4AQYQ 2BE5D 4JI5L 4B3RL 3KJOA 3CAMA 2AWNA 4L5QA 4GNXB 5LMNQ 4JI7L 3QJYA 2Z0SA 1X56A 1H9KA 4DR3Q 2L5TA 2JA5H 3S14H 2E75C 3K7AH 3OTOL 1LM0A 1NBWA 5IYCG 1Q90A 2K32A 1CKNA 1VQ7A 3M4QA 2JQOA 4HIKA 4DR6Q 4OONA 2OCEA 3BJUA 3PO3G 4DR7L 4LF7L 4IPHA 1OXTA 3KF8B 2KCTA 1PVOA 4A3GG 2BH8A 2RHQB 1VQNA 1U0LA 4GNXA 1QVFA 3S1NH 1BVSA 4A3IH 2E74C 3S2HH 3ND9A 3KDFB 4LF4Q 2ZJRA 4NBQA 1WCMG 1X3GA 3F8TA 1HPCA 2UUCL 1W3SA 3U50C 2D62A 3S1MH 3HOUH 2OPVA 1WI5A 4IOCA 5JEAJ 3PSIA 4DV2L 1CSPA 3E0EA 4I7ZC 1IYVA 1KD1C 3PO3H 2IHEA 4L5SA 5ELNA 4A3GH 4Y52H 4X64Q 1I50H 3SGIA 4A3KG 1NMFA 1E22A 2R7FA 2LXJA 3UE0A 4P73A 5JEAG 1Q81C 4AH6A 4DV4L 1SR3A 4IPCA 2OWOA 5GROA 3GTGH 2A6EC 2K5VA 1YHBA 4Y7NH 3W1BA 4JI8Q 4LUVA 4BBSG 4JI2Q 4XTCS 2WB1E 4LF8Q 2VQEL 3H94A 5C44G 1Y8OB 1JT8A 1AE2A 3PO2H 5M5WH 1TWAH 3I4LA 4BA1I 1XTDA 2YV5A 2QA4A 1XPOA 2JEAI 2P2RA 1YNNC 4DR5L 3CCMA 5JEAH
chains in the Genus database with same CATH superfamily
4X62H 3AQQA 1RIPA 1RHPA 3BZCA 3MVVA 4DNIA 4QUFA 1X9ZA 1VS0A 2YQRA 3S14B 1N36L 1I5FA 2KHSA 1BOSA 1J9OA 4NDXA 3PCOB 5IGCA 4KI0A 4FF4A 1SE4A 3DMUA 4WFN3 2R92G 3V05A 5C0XJ 4GKKQ 2MGSA 1K1GA 5C5MA 1SYFA 1DONA 4BBSH 2RHSB 2AXYA 2QF7A 1Y8PB 2EE1A 2VQFL 5DT9A 1H9SB 2RSOA 4KJNA 2F0VA 5DNFA 2EDGA 5GAGC 2XRQD 2L15A 4ID6A 4BWGB 3SK5A 1WHRA 1SDFA 4KV6A 3IAYA 3M7NA 4A3LG 4WJWA 2EQSA 2PYKA 1J5EQ 4DUZL 1SEIA 3HOWG 3ULLA 4QL5A 2PQAB 2Z8LA 1EUJA 2X6GA 3HOZH 4DV1Q 5C0XG 5JJIA 3M4PA 1VBIA 2JA9A 3VR5A 4DR1Q 4RGNA 4DV3Q 2UUCH 1MKHA 3S1NB 4KHZA 1YJ9A 2AUJD 3PF5A 3G71A 5IGDA 2YTXA 1SAPA 4LF6Q 2HQEA 2BE5C 2AMCB 4DV2H 3S2HB 2Z4IA 3GDEA 1X55A 2XRSD 4KLKA 3KBXA 5LL6X 1J8IA 1B3QA 1TWFH 3K7UC 3OOCA 4UP7A 2R92H 1HNWQ 1CQVA 5CV6A 2A6HD 5GQOA 4LF9Q 1Y8NB 2UUAL 3CCQA 2B2TC 1CTMA 3S17H 2F4VH 2EYMA 3J7YW 3M9BA 1F2YA 1WJJA 1PTOF 3HOUB 3S1MB 2ALYB 4IFDI 3NXWA 4KKSA 5LMUQ 1SFOH 1B4OA 1CA5A 1NR4A 2F4IA 1H9SA 3K5MA 4C3HG 1GUWA 1A62A 3VYTA 4E6IA 3AU7A 1EZ6A 2K03A 1JICA 2KECA 3OHXC 3NUCA 2ZTDA 2CPMA 1JWMD 3L7ZC 4TQUS 4Q0FA 2WV6D 4C1NK 4NB3A 1IYJB 1I50B 1HR0H 4NXNH 4B3TQ 1QZGA 3TP8A 3CPWA 4FO2A 4JI4L 4C2MH 1H9JA 3UI2A 3V69A 2ZJPA 4XYOA 1YJWA 4X65H 4CHTB 2KHJA 1I4RA 5J1ZA 1E1OA 2KHIA 1KLUD 2L11A 4DV7Q 1KTKA 1H9MA 4K0KL 3QO2A 2VQEH 1AZPA 1PRTC 5HGTA 5KNDA 1FL0A 4KKUA 3FEWX 2IX3A 4JI3Q 1WE8A 1QNKA 4C3JG 1TS2A 4B8CD 4DR2L 3BG3A 3I4MB 1STEA 4JI6H 2PW7A 1ASZA 3UDFA 1RD9D 1XMQL 2RCFA 2VB3X 1CA6A 2OTJA 3GTMB 5G3LD 1CQFA 1R4PB 5C3EG 1PFSA 1P16A 4RA8A 2PI2E 4G08A 2UXDH 4C3HH 2ENBA 3A5ZB 4FVMA 3TP5A 4JVZA 1AZQA 2IJ0A 1CUKA 2O4CA 4A93B 3BZDB 4DAYB 1HHVA 5M5WB 3BYYB 1RL2A 2IX0A 2K04A 1PMRA 4G57A 1HNZQ 1STAA 2TMPA 4YHHQ 1S03G 1N36H 5J39A 1LTBD 2XSCA 1R4QB 4YWMA 2NN6I 4B9XA 5LMNH 2Z6BA 4DKAC 5I6YA 3D8GA 1ICFB 2FFMA 1BNZA 2DNCA 4A3CG 2K1HA 1X9NA 4DR3H 1EC6A 1F2MA 1EY7A 2XVSA 3A5UA 4NW2A 5EKKA 1G51A 1YBYA 4A3EH 1N32L 2ATWA 4HMJA 3WOEA 1JOQA 2D2CC 3VYRA 2H1EA 4HIMA 4A76A 2R6GA 1XNRQ 3B6YA 3KFUA 2QW7A 2F0DA 4IQZA 3CW2C 3D3RA 3KYHC 2KQ3A 1WTOA 2K5QA 2B2TA 4DUZH 3M3YB 5C3EH 1FGBD 3KLWA 4DR4H 2GVAA 1IBKL 3DM1A 1T5XD 1HTLD 3S1QH 1Y1VG 2WAQG 1I4GA 2ID0A 3HKZG 3URYA 5NUCA 3QOJA 5HGQA 1VQBA 1I4XA 4IJHA 4DAYA 5F2DA 2ES2A 2F0QA 3MZ5A 1Q7YC 4JI5Q 1FJGL 4B3RQ 4HJ5A 2I0QA 2K6AA 5AFWA 4KTAA 3SHLA 3VR6A 3IKJA 5KEEA 1VQFA 3P20A 3A8KE 3CF5A 3S1RB 5D3IB 4JI7Q 3FP9A 1PFBA 1N34L 1U4MA 3KOJA 5E7NA 1O78A 5FO8B 5HY6A 3OTOQ 2IL8A 2M00A 1K3BC 4BY1G 3VA7A 1YHAA 1A6XA 2E2IH 3RLOA 4CDFC 1TWFB 1VQ8A 3SVMA 4F88A 3G6EA 5EJWA 3H3VI 2N88A 1EY5A 4HJ7A 3I56A 3GTOH 2A19A 3H3VC 3S17B 1DJRD 4O2DA 4C3IB 1VQCA 3W3AA 1A0IA 1I6VC 3R2IA 1QCBD 2CTLA 1E2ZA 1YZ6A 4DR7Q 4WALA 4KK7A 4LF7Q 4LFCL 1JE5A 4KHVA 1TWCH 1DGSA 2JEBI 3FRPB 1KAWA 2N3SA 5GADC 3GTLH 1XNQL 4R4QA 4A3DG 4RWSC 3J7AK 3NELA 1PRTF 5C4XH 3K5NA 4GKJL 4A3BH 2OQKA 1Z2IA 1IL8A 2B63G 4M1UB 2P5ZX 4EQOA 1DTJA 2PW5A 2IT1A 3LX0A 2JXMB 1IKLA 2GN5A 3C1FA 3OIPA 3CCUA 1K9MC 3H91A 4QJFA 2EY1A 1VIHA 2VZAA 2FMCA 3QB3A 3K57A 1XMQH 2IWHA 3MXNB 3RZDH 2FHTA 1EWIA 1T9HA 1S3OA 1TU2B 3MWYW 2UUCQ 3K59A 1S5ED 1EQTA 3L3OC 4J1MA 1Q1BA 4JI8H 5CV7A 5A35A 2WB1G 2K4KA 3JAME 1MSGA 4JI2H 4LF8H 4DV2Q 3U58A 1STYA 2F3VA 1TVXA 3SK6A 4ALPA 3F2CA 1CT1D 1QWYA 1BBWA 2A73B 3A55A 2A6HC 2BDNA 1DXMA 1PZKD 2CTFA 3MEFA 2ZT9C 1QNUA 3I55A 4PMCA 1R9TH 3CCSA 2NVXH 3LWUA 4N8FA 1YHQA 1IHZA 1QUQB 4JPBW 3WWVA 2SEBD 3T1HL 1N32H 2F3IA 3T16A 3HOXG 4DV4Q 3HOYG 1K0SA 2LTLA 5IWAH 1GXDC 3A74A 3S2DH 3OMCA 5TSSA 1ENFA 4C1NI 3CHBD 2F0WA 2CWHA 3CPFA 4LAAA 2YTYA 1T5EA 5GAEC 2JA8H 4X66L 1SYEA 2MNAA 4RAUC 1BBXC 2F0IA 1N33L 3HKSA 2JA5G 2VQEQ 2ZXPA 4IN3A 2UUBL 2VNUD 3G6JB 2AUKA 4H8AA 2B2YC 2CVRA 1D5XC 1MIUA 3TS0A 1KRTA 5M3MB 2ZXOA 3S1QB 4FXKC 4JI6Q 1NAPA 2AWOA 1CKNB 1K83H 2E2HB 5JJKA 1J5EH 1E2WA 2R7ZH 5C5LA 1PH3A 5K36G 3A7LA 1PH8A 2M9VA 1O7LA 3NENA 5M5YH 5CMDA 3J80E 4DV1H 2F0FA 5IP9G 4DR5Q 4GOPC 4DR1H 1O7ZA 1ASYA 3K80C 4B3ML 4DV3H 1DOKA 1SNDA 2HT1A 1JE4A 1KIXA 3BZKA 3HOYH 1PTOH 3GABA 2F3WA 5J22A 3SDZA 4DXGA 1C48A 4G7ZC 1SMXA 4DXFA 4HIOA 1JORA 1N36Q 3TP7A 2KCNA 3CRLC 2PMZB 4U68A 1HNWH 3HS0C 4QF4A 4X3UA 4HTHA 5C6AA 2E2IB 4LF9H 4K2KA 3GD7A 2NZHA 5CV8A 4A3IG 4GN5A 3BDCA 4DUYL 3RD4A 2VQFQ 5LMUH 1X32A 3PUXA 1X4NA 1UE6A 4YCUA 5KNCA 3J81i 3VDYA 2PMZE 4ZUIA 1MSZA 3HOUG 4CDEC 1X3FA 1ICWA 4QMGA 2PNHA 1VDZA 5I9PA 3GTQB 3OSSD 4DUZQ 2ICEC 1D2BA 5K36H 3T1YL 3CCVA 4DR4Q 3MEHA 1UE7A 4NKLA 4POGA 3DWPA 4CBVA 5IP9H 3TRZA 3H0GB 4H02A 2WAQE 4GOPB 1LUZA 4CDDC 3HKZE 1OXXK 2CW0D 4DNTB 3WOFA 3MXUA 4DV7H 3C3LA 3ICEA 3OMGA 4IURA 5FLXc 1A3UA 2EXZA 1QVGA 5JAVA 3NTHA 3GV6A 2RSNA 3RZDB 1U4LA 3KJPA 2Y0SB 3I70A 1AP0A 1LLRD 2CHBD 1ZXTA 1HRJA 1PLFA 2UUAQ 1A2UA 2EYJA 4JBKA 2KOLA 1NSNS 1K8MA 1RJTA 4LW1A 3VR3A 4KKTA 4K6LA 4I65A 3PIP3 2CTKA 1VQ9A 1RTNA 1SN8A 3A54A 4FNFA 4R8NA 4B9WA 1A3VA 1EWHA 1KXLA 3I4MG 3DEOA 1L0YB 2OF1A 1VQ4A 3NWSA 1VQDA 3FKIB 2B2YA 2MO1A 4QGUA 4DNRB 4H7BA 4JBJA 2UU9L 1II3A 2R93B 4APVA 3OW7A 1B8AA 1EOTA 1Q46A 4RGTA 1HNZH 2DY8A 1SYBA 2NVXB 4AYBE 4JI4Q 1MGSA 4JCVE 2X06A 4A93G 1QJOA 2I5HA 3PO2G 1NTGA 3VR2A 2CTEA 4GOPA 3QD7X 1EY9A 5IYBH 3RLNA 2ZQEA 1N33H 4DV6L 4K0KQ 5FO7B 1B70B 1Q8KA 3BVGA 4G4KA 2G9HD 2F0NA 2V4DA 1PDQA 2FXQA 3NQIA 1LT6D 1YIJA 1VQPA 4BBRH 1D5ZC 2JA7B 1KDBA 2QEXA 1AE3A 2JA8B 3UDIA 1PH5A 3D4RA 3EA6A 4WRDA 2O4XA 1AH9A 1XNRH 1XMQQ 1F0XA 1WOCA 4A4IA 4Z9CB 3HEJA 3GTJB 3IFTA 3UE1A 3FHWA 1LTGD 1ZZJA 5EBDA 3NEMA 1PXUA 3QIAA 3I4MH 1WTQA 2ZM6L 3E9IA 1A8VA 1STNA 4YCVA 1VQ5A 3GTMH 3BU2A 4BY7B 4JC0A 2WKCA 3VR4A 3F2UA 2B2VC 4L6TB 5IIFA 1VQ6A 4JI5H 1GUOA 3CMEA 1XXGA 5KIXA 2PNRC 3CCEA 1EZ8A 3GTKB 4HJ9A 1GUGA 3PF4A 1K3RA 4A93H 1GM5A 2NVTB 2BOSA 5CV5A 1C9OA 3K0YA 3RN2A 2OEOA 3OWEB 1IZ6A 3CCJA 4AM3A 4K14A 3QWNA 1VCIA 4OEMB 3HOZG 4KHPL 1YNXA 3OTOH 1N32Q 2A68C 3KF6B 4HSVA 3SXHA 4G7HC 1GJXA 1JC7A 5IWAQ 4CKEA 4EC5A 1CK1A 1CKOA 2D9UA 4R4IA 4BS9A 5JVH3 2BH2A 3MFYA 1K73C 2NVQH 1M90C 1J4WA 3NPPA 4DK6C 2CKZB 3A0JA 2PQEA 4R8IA 2XWJB 1LABA 1IBKQ 2F0OA 1GUTA 2QEJC 4DR7H 3I2ZA 3R3OA 1D5MC 4LF7H 4WORA 2JN4A 2Z6KC 2LSSA 3M3YH 4AQYL 4R4CA 3NSWA 1E24A 3U1KA 4DU9A 1K0RA 2JK8A 3A8IE 2E76C 5KGUA 4O1NA 5IP7H 2F0EA 2I07B 1G6ZA 4X3TA 1BKBA 1N34Q 3CMAA 4FP5D 1KHIA 3G7LA 2LXKA 4OD6A 1J5KA 1XJVA 2EYOA 2UXCL 4A75A 1KDCA 3S1RH 1EQRA 3BDLA 1PH4A 1G291 1HZAA 2DUDA 4XIGS 2RVLA 3OSOA 3KF6A 1HNXL 1KDAA 4HEDA 4B08A 2SOBA 4B3SL 3NP8A 1UUPA 4KY7A 2NN6H 2B8FA 4N8X1 3EFXD 2RA4A 4YY3L 3TREA 3FAUA 1ZEQX 2FFKB 3RUZA 3FVQA 3BVMA 5IYDG 1ZTGA 2DGYA 1YVCA 2CWAA 5ELOA 2F0HA 2WIIB 1S40A 2EIFA 5IT9c 3U4VA 2XN9C 4LFCQ 5CV4A 2Z4HA 3T13A 5DEHA 5EKLA 2VL6A 1SE8A 1V9PA 4C3IH 4RFBA 2F0KA 2AHOB 1XNQQ 4RGOS 1G2SA 1FVIA 3HP3A 5FLMH 1TIID 2L0CA 4PNYA 1CZGA 3EVQA 1EWCA 4JYAL 2B2VA 1BBUA 4FF3A 4QIWB 4GKJQ 1RTOA 3J7AF 4DFAA 2JYOA 4DV4H 2F0SA 4OWWB 2CTJA 1W6JA 4WANA 3TS2A 4ZKCB 1YNJD 4QIWE 4BBRB 2NVYB 2B39A 1I4HA 2E2JB 1QVCA 2PCFB 2ZM6H 1M1KC 3EROA 1WTHA 1BF4A 1L1OC 2D0PA 1SRUA 2I5MX 3MC0B 1B9MA 1TQOA 4OXPA 1TR5A 1ZYRD 2VY3A 3J81c 2CW0C 3G4SA 4A3EG 4TVAB 5IYDH 1FNUA 3KUPA 1YEZA 1PA6A 3D0FA 3AFPA 1LYLA 3QG1A 1X6OA 3H15A 1SNOA 2Q2UA 2M8WA 1HH2P 3K5OA 1VMCA 3MHBA 2N8NA 1QZHA 2LFNA 3D4DA 4ILWA 1X4MA 3E6ZX 3H3VH 1K8OA 2Z6KA 5M5XH 1TXYA 2JA6B 2XNAC 2M6QA 1ENAA 3GQBA 5BN4A 1U4RA 4IUNA 3T1HQ 3E9HA 2BL5A 4DR5H 1VQMA 1XPUA 4K5VA 3OIQA 1WCMB 1BO0A 2K75A 3DM3A 1TT2A 2VUMB 2GVBA 3PGZA 4P71A 3RLFA 1GVPA 3PUVA 1XWEA 4F7XA 1EYAA 2A69D 3ULJA 2VW9A 1OXVA 4PZ8A 4QQBX 3PIOA 1N33Q 1Z6HA 2K5WA 4G7OC 3KDKA 4LUOA 1V1OA 1BCPF 2MUYA 3RNUA 4RKBA 2NVQB 3GR5A 2UUBQ 2VQFH 1E1TA 3JC66 1G8ZD 5C4HA 1LTID 4DV5L 1PRTB 4DAMA 5M9OA 4A3MH 1WVNA 4UAIA 4H0LC 5I6WA 1I94L 1EIYB 1S20A 4A3KB 1V8QA 3D4WA 1GOZA 5EAYA 1PZJD 1ILQA 2PO4A 4MTKA 2RKSA 5E1FA 3JAMi 4X3SA 1I6UA 4DA2A 1GKHA 5I2YA 5M3MH 1KRSA 3CC2A 3AFQA 2EJGC 1V1QA 2E2HH 4B3MQ 5FJ8G 4LJZC 4B3SH 1KNAA 1TS4A 3BVZA 3J81L 2QKIC 1EYGA 1STHA 1CKMA 4YY3H 1HZCA 5CGKA 2IX1A 5C4XG 2ANRA 2MPMA 4OO1G 4UPAA 1M4VA 4A3BG 3E0JA 4CJ0B 5BN3A 5C44B 4GN3B 1TUAA 4LMQD 4UHVA 1VQHA 1XMOL 3J7A5 2UUAH 2X6LA 4PG3A 1TY2A 4DUYQ 5IGFA 1OO9B 1EIFA 1OXUA 1L1OA 5C0XI 4DV0L 2JE6I 1S5BD 3EBEA 4PQXA 1UE5A 2WP8J 2Q2HA 4IUPA 1B7YB 2NTTA 1OXSC 3ND8A 1STBA 2M2LA 1EY0A 5I9OA 2NBFA 2H4OA 2LKVA 4CKCA 1J6QA 2EYHA 3T1YQ 4JOIC 4GLXA 4AYBG 3FDTA 1Y1WH 4LUZA 3K0XA 3FKIG 1JR0D 4JI4H 2PZTA 3OW2A 2R93G 2A5HA 3GTQH 5FJ8H 2L4NA 1IBLL 5CR3A 4HJ8A 4K2LA 1I6HB 4K0KH 4YIJA 4LF6L 2C35B 3J81W 3CD6A 3OPOA 5T1IA 3H0GH 4XQQA 4IPGA 4OO1H 1MBYA 2D5DA 3S16B 3T4AC 3LGJA 4DR2H 3L2PA 1B2TA 3J80i 2PQUA 2Z1CA 3P7JA 1PHJA 1B1ZA 2SNMA 3I73A 2MQHA 1NE3A 2JA7G 2RQXA 2JA8G 1GD7A 1KQSA 3AEVA 1H9RA 3HOWB 1V9NA 1IL2A 1DCZA 3M85A 4U673 1PH6A 4LFBL 4O0AA 4OCHA 2UU9Q 1AFPA 1C4QA 1WVLA 5C4JB 4KJOA 4F87A 3CQZH 4CGYB 1X3EA 2NWGA 2R7DA 5M5XB 1V1PB 1B44D 3FKIH 2VS1A 4NXML 1KLGD 2LMCB 1KAAA 2HD3A 5IODA 1TY0A 3K58A 3H09A 1JMCA 4DK1A 5DM73 1WTJA 1FKAH 1TS3A 2R93H 4BY7G 1HTPA 2R7ZG 4TKOB 3FPUB 3T51B 5IGGA 2K05A 1ENCA 5BR8L 3UOEA 2K5HA 1TS5A 2A74C 5LL6b 5CBAE 2D0OA 1SJED 1SYCA 3DHQA 4RG1A 3HZXA 2EJFC 3HFZB 1SBBB 4UP8A 1QG7A 4L8JA 2O5JC 2QCPX 5KRUA 4Q5VA 2E5LL 5ELDA 4GLAC 2JA7H 3SE0A 1JCKB 1TWGB 1BCPD 3N6RA 1JJGA 2A1SA 1IBKH 4A3MB 2JP1A 4PZ7A 4A3FH 1VQAA 4ME5A 5DM63 2ZM6Q 4BA2I 1YNJC 1SYDA 4JW0A 2HHHL 3GTJH 4GLVB 1PV4A 1Q1EA 2Q2TA 5BN5A 4XT1B 1FJGH 3GP7A 4IPDA 3W1GA 2AQ3B 4K5XA 1HUMA 1D8LA 1SROA 1V1PA 2G5DA 4JOIA 4LFAL 1H95A 1Z7TA 5IGEA 2K7VA 3BDOA 2B2WC 1DM0B 1EY8A 4BY7H 5ELBA 4JV5L 1N34H 3S9WA 4OIKA 1XMOH 4NP5A 5ELCA 1IBML 5H1SE 3J7ZC 1QB5D 3GTKH 1CFMA 3PMFA 4OX9L 4KHPQ 2NVTH 1UAPA 1SMYD 4WJ3M 4DV0H 1AN7A 4FJSA 2UXBL 1NXUA 2MP1A 4TRDA 1BQQT 4ZRZA 4N9PA 3ONAB 4A3JB 1Q12A 4LF5L 1HQRD 3K5LA 1PQXA 1HCZA 1SE3A 2GA4B 3AYHB 3F2DA 1HZBA 4HCEA 3PUZA 2RF4A 1D1IA 1Q82C 1EY6A 2BDOA 5CV9A 1B50A 2E8GA 2K5NA 3GTPH 4K6DA 5IGBA 3M4YA 1PH7A 4DN4M 2CQOA 1W6KA 1JWSD 2A69C 2YTVA 4R1JA 4DAVA 4AQYH 3EZJA 4LFCH 3NQTA 2FJ2A 2J4XA 3W2DA 2K5DA 1TWHH 4L5RC 1EU4A 3RMHA 1XNQH 5KYLA 4JI1L 4XT3B 5AJ3L 2K28A 1FR3A 4HJAA 1S4ZA 1W2BA 1Y1WB 3C2PA 3WDNA 3SK4A 5IE8A 3Q22A 3CC7A 2PT7G 4GKJH 1GUSA 1B53A 3LNNA 3M7GA 4JI0L 1A2TA 2FMMA 2KA7A 4DK3C 4ZLTF 3HGBA 1WTWA 3F1ZA 2UXCQ 1SYGA 3RN5A 4RHSA 2EVBA 2N49A 2WINB 2L1BA 1HNXQ 1GHJA 4B3SQ 2DGRA 3PQIA 1RKNA 3R8BA 5IYBG 1STGA 4X62L 1Y1VB 3ERSX 4YY3Q 1LTAD 1WFQA 3TSSA 3C1EA 5FKAC 3KLSA 4FYDA 4BBRG 3ERQA 1A15A 4IFDJ 4EQ5A 2NZOA 4BXXG 1EU3A 4OWTB 4NXMH 1FGUA 3JAMc 1SJHD 1Y69U 2E2DC 2HIVA 3I4NB 2B29A 2I46A 3CQZB 4JYAQ 5JJZA 2DNEA 2Y0SE 4CJ2C 1IKMA 2Q8IB 5C3WA 3T1HH 3MTSA 1F9QA 3ZJYC 1F9PA 2B2WA 1DYQA 1MJCA 1E2VA 3HOVB 3G48A 4RMFA 2JA6G 5CBEE 4IFDG 2K33A 1ET9A 1ONLA 3L0OA 4ZYSA 1XYIA 1EIGA 4CKBA 1JB7A 3ULPA 4X66H 3U9SA 3PV0A 5IYCH 2KVMA 1C0AA 1F9SA 2CFMA 2LTMA 2VUMG 1DZ1A 2DJFC 2Y3MA 4WJ4A 1HXYD 4JVHA 2UUBH 1FNVA 1Q86C 1LTSD 2NVYH 5KNBA 3FPPA 2E2JH 4BXXH 2CH4W 3OYYA 4DR2Q 4A3FB 2L55A 2F4VL 1Z9FA 4GS3A 1PH9A 4JV5H 2IHFA 3PIPA 2QGQA 1TKWB 1F2ZA 1ET6A 3V2TA 1PFNA 1OTCA 4OX9H 5CORA 2LY7A 1WD0A 1WTVA 4B3MH 1V8CA 3S15H 3I91A 3OWFA 4LF5H 3CU7A 5IY0A 3I7FA 3TZUA 1B3AA 2D9IA 5FLXL 2WB1B 2JA6H 4IFDH 2YU9H 1I3QB 4NXNL 1HR0L 3KDFA 3J7AV 1MSHA 1ZKOA 2C9OA 2E3UA 3J80c 5IP7G 1WCMH 5M3FB 1A3TA 4IUUA 4IOAA 4YCWA 2VB2X 1RDPD 4X3KA 3CP0A 4X65L 3JAML 4V0BA 2VUMH 4EX5A 2ZTCA 3R93A 4DUYH 2BA0A 4RKLA 3VKEA 2F52A 3KLRA 4DV5Q 3RZOB 4P75A 3NTKA 1I94Q 1EQVA 1JOOA 1WYDA 1I4PA 3GTPB 1RF2D 3V96A 4QCLA 1N8RC 2EPBA 2NN6G 4DK0A 5CC4A 4RCOA 3F2BA 4JI6L 1VF7A 1YITA 2L9HA 4J15A 1IW7D 1TWHB 4ME3A 2CCZA 1VQIA 2Z9HA 4H13C 3T1YH 1EY4A 2UXDL 2JSOA 4A3KH 4K5WA 4LNQA 1DT4A 5J3BA 5JJLA 1GUNA 4HSPA 4OL7A 1ZZIA 4TSSA 3DLLA 1BCPC 4DPGA 3NWTA 1F9RA 3T56B 4C3IG 1UEAB 3KLSX 1FJGQ 1UWVA 5FLMG 2RDFA 2A1AA 2Q2IA 2CWFA 1U9RA 4JVYA 1JWUD 5GAHC 2JA5B 1KC8C 5FLXW 3X3MA 3K7AB 3Q0AA 3U9OA 1HR0W 5LMNL 1DOLA 1DOMA 3C46A 1ML0D 2K01A 1XMOQ 2KENA 3GO5A 4POFA 3ZYYX 4DR3L 3EIVA 2F0MA 3JAMW 5DLQE 2PZWA 1G2TA 2XIWA 4IO9A 4DV0Q 1NUCA 5C44H 3KDGA 2PPBC 1SNCA 2EYFA 2AKWB 2HIXA 1SMYC 2L12A 1N9WA 4F8MA 2KBNA 3UDXA 2UU9H 2DY7A 2HQLA 4RH6A 2EY5A 1EQQA 1LTTD 2MJ8A 4IUTA 3AB9A 3CXCA 2J7ZA 2EOTA 4DR4L 2I5LX 3J80L 2CWPA 2BA1A 1G91A 4DR6L 1HQMC 1Y14B 1V43A 1HJPA 2ANNA 1LACA 3CC4A 4V190 3KBGA 1VQLA 4IJLA 1FNWA 1BCPB 3DWAA 1IBLQ 1Z47A 4DV6H 2CPQA 2R61A 4A3IB 2IY5B 3NHHA 2X69A 4LK1C 1LT3D 4DAPA 4QB4A 2A8VA 1Q8IA 3DXJC 3STBD 3VA5A 2MFIA 3MA2B 1S5CD 1HFNA 1I6HH 3FMCA 1CZWA 1KL9A 2R3ZA 4PMBA 5FO9B 5LMNW 4UP9A 1YI2A 4LF4L 4K8IA 2N78A 2O5IC 2KCMA 2KCCA 3S16H 4X6AH 3D31A 1YJNA 3DUZA 4MHEA 3QR8A 1QE6A 4UY8C 4LFBQ 4L5TA 1FYCA 1SLJA 3TP6A 3PO3B 4PZ6A 1CSQA 2DN8A 2XGTA 4A3LH 1QILA 4A3GB 5C3XA 1O7IA 4FJUA 4GZYC 1S72A 1A63A 3HOWH 4A3MG 2RCNA 2PQAA 1CHQD 5E3FA 3SK8A 4NXMQ 4GN4B 5C0XH 3I3CA 3K8AA 4ZCKA 1UG8A 3J80W 4ODGA 5C4JH 3K6OA 3PIO3 4OHJA 1ESFA 1U4PA 3S15B 4RHRA 4X64L 1X3QA 5BR8Q 3D6WA 2OQ0A 4RGMA 5M3MG 4NPSA 2OTLA 2YU9B 3GTGB 4KHPH 3T53B 2CTMA 3HRZC 2EY6A 1NJIC 5D65A 1MHWC 4KY6A 1EFWA 4Y7NB 1D6EC 1SE2A 4FXDA 1VQJA 4ZK9B 1HA5A 4KD3A 1L0WA 2E5LQ 1KNEA 1NR2A 1G6PA 1PH2A 3A8JE 5IT9L 2N55A 4X66Q 4A3JG 2RDGA 2ZTEA 1F2LA 1RODA 4JI8L 5JOBA 3EN2A 2HHHQ 4PV1C 3PUYA 3PO2B 4R4OA 4JI2L 1TWAB 4LF8L 4MZ9A 2HDLA 2G8YA 1PYSB 3MFGA 4J8QA 1L1OB 4FXGC 3MAQA 3HG9A 3E3XA 1K28A 4XQJA 1TWGH 4LFAQ 3Q23A 1AEXA 3CCLA 4LIJA 2WFWA 4P74A 1SNPA 2EJMA 3A56A 1O7YA 1E3PA 4JV5Q 2VXWA 3BS1A 1IBMQ 1BDOA 5D3DA 2OPUA 2B2UC 3TEHB 2HH2A 3A7AB 1Y1WG 3N52A 4OX9Q 2EY2A 2J0TD 1RCVD 2UXCH 2UXBQ 3UDGA 2PI2A 1JJ2A 4C3JH 3S24A 1HNXH 1QOHA 4LF5Q 5IWAL 4OWXB 2K52A 4H44C 1LT4D 4BBSB 4IUVA 1NNXA 5FK9C 3H0GG 4HR7B 3LWEA 2KEDA 4MIUA 4HAEA 4A3JH 4DR6H 1S5FD 4ZUJA 1AN8A 2NB0A 4GKKL 5IT9W 2OT2A 1D7QA 4FF2A 1K8GA 3GKUA 1IXRA 4P72A 2Y0SG 4JI1Q 5AJ3Q 4JK1C 2BCOA 4ABNA 3AEVB 4KY5A 4JYAH 3SEBA 4NZTM 1GHKA 4KN7C 5A2QL 1MJEA 3HOZB 3RR5A 2LRRA 3D6CA 3I4NG 1VF5C 5EKIA 4JI0Q 1J5EL 4A3CH 3CCRA 5ISRA 3CRKC 2FMRA 1KHMA 1O80A 1IW7C 2QDBA 4LF4H 3RF2A 4DV1L 2CH4A 5E4WC 4XDXA 4MTNA 4DR1L 3NE5B 4DV3L 2MO0A 5EPKA 3HOVG 2NUCA 2R92B 4X62Q 1IYUA 3AMUA 3W5OA 4KN4C 4EVOA 1VQOA 1SSOA 1JJCB 5C4ZA 3I72A 5I2XA 2FINB 5E4XA 2JJQA 1P8LA 3I4OA 1L2FA 4L63B 1SFOB 1VIGA 1WTXA 2EZVA 2TSSA 2JZXA 1EYDA 2F0PA 1PTOD 5JVG3 1HNWL 1PYBA 1Y1VH 4LF9L 3ER0A 1X65A 5LL6S 1NMGA 1LTLA 5LMUL 4X64H 4XQNA 2B8GA 1EL0A 5COYA 4AIMA 3VYUA 4A3FG 3NTIA 4C2MB 2V1CC 2F0UA 2F1MA 5T1GA 1VMPA 4ZKBB 2XTIA 4E9JA 3I4NH 2A6ED 1VQKA 5A2QW 2MJHA 1EOVA 2Q8TA 4RCNA 2EXDA 4QMFB 4FF1A 5IOCA 1C7YA 1HUNA 4QUCA 3EQLC 5FLXE 4B3TL 2B3GA 2B2UA 3Q6SA 1BUVT 4LWCA 1CI3M 4BY1H 4DGZA 3GV3A 2PY9A 4JBWA 3HOVH 5EGTA 1EEFD 4DV6Q 1UE1A 2ZJQA 4DV7L 2WACA 1B9NA 1M8AA 1WTPA 3U4ZA 4QY7A 5M3FG 2F03A 4DV5H 1HFGA 3I8ZA 3KK7A 4JI3L 1I94H 2NTSA 1K8AC 2K1BA 2K14A 4C3HB 3J81j 2F4VQ 3STBC 4EGVA 2AQ1B 1EIHA 3QOLA 1ODHA 1X54A 1UEBA 4K8JA 5HURA 4PMWA 1YNND 4A3DH 3DEPA 2A68D 3TBIB 2K50A 1D1KA 4HMIA 1FD7D 4DF7A 2B63H 2QDLA 1VQEA 3TQYA 2XWBB 2ASBA 3Q8DA 4B8TA 4EQPA 3NCVA 1HNZL 4R4TA 4GNXC 3I90A 1HR0Q 4NXNQ 4YHHL 1ZYRC 1XRHA 2DJGC 4PDBA 3MXNA 2HH3A 5EPJA 1HA6A 4I7AA 4A3EB 4X65Q 5JPNC 4C3JB 4N9TA 1MD2D 4GKKH 4C56C 4M8AA 3TMEA 1I3QH 4MNOA 1VQGA 3X3NA 1DD2A 3CKIB 3VYSA 4XXEA 4FDBA 2QNDA 1E7ZA 2F0GA 4KMUC 5M3FH 3M4OH 1GO3E 1X0AA 4R9WA 2JVZA 5C3EB 3P1HA 4YWLA 1ZZKA 1XX8A 1U5KA 4JG2A 1XPRA 4YWKA 4HIDA 3MXPA 1NY4A 1XNRL 1PH1A 3NBHB 2YYZA 4HN7A 2PZUA 3PUWA 2QILA 4HCSA 4OGQC 3RZOH 1EYCA 1L0XB 4OO1I 2UXDQ 3IRBA 3Q24A 1EFID 3K81C 4ULLA 1HZ9A 1QUQA 1S5DD 4XYQA 4O42A 2H5XA 4JBMA 3HOXH 2WKDA 4ZQ3A 4AQYQ 2BE5D 4S3SA 4JI5L 1LV9A 1IBLH 4B3RL 3KJOA 4OELB 5LHY1 4LF6H 3CAMA 2AWNA 2SNSA 4L5QA 4GNXB 2KJXA 3P75A 4UDUC 3TN2A 5LMNQ 1BXTA 2LS01 3H6MA 4JI7L 3QJYA 2Z0SA 1X56A 2EYLA 1H9KA 3BYTB 2O2LD 4DR3Q 2LF0A 5FOBB 2L5TA 2JA5H 3S14H 3GTOB 1Q3LA 2E75C 3K7AH 1PZID 4IUQA 3OTOL 4IALA 2VKCA 1LM0A 1NBWA 2CQAA 5IYCG 4LFBH 1Q90A 2WAQB 2K32A 3NBHA 1CKNA 3HKZB 1PYWD 2IW3A 1VQ7A 5K5PA 3M4QA 1TWCB 2JQOA 3GTLB 5EPLA 3DWQA 1UNSA 3TZDA 5EBCA 4HIKA 4DR6Q 4OONA 4B3TH 2OCEA 3BJUA 3PO3G 4DR7L 5D14A 4KD4A 4LF7L 5C4XB 3E5SA 4IPHA 1OXTA 3KF8B 2KCTA 2C5CA 1PVOA 4A3BB 4A3GG 2BH8A 2RHQB 1SNMA 5CYUA 2ICIA 3ITPA 5ELEA 1VQNA 1PRTD 1U0LA 2HCCA 1BR9A 4EQNA 3NK9A 5BR8H 1CM9A 1F77A 2KEEA 4GNXA 4CJ1B 2NZ1D 2G9DA 2HDMA 1QVFA 4JI3H 4BY1B 3S1NH 2MHVA 4NMZA 1BVSA 1LT5D 4A3IH 2E74C 2F0TA 3S2HH 3KDFB 2Q8RE 3ND9A 2E5LH 4LF4Q 5DAUA 2ZJRA 3NBIA 1WCMG 4NBQA 1X3GA 2F0LA 3F8TA 4AYBB 1JOKA 1HPCA 5IT9E 2UUCL 1W3SA 3U50C 3R2TA 1CHPD 1JB3A 1LTRD 1ESRA 2D62A 3S1MH 3HOUH 2F0JA 1WI5A 2OPVA 4IOCA 4NZRM 2HHHH 5JEAJ 2IPKD 3PSIA 3OETA 1MI2A 4DV2L 1CSPA 2HCIA 3E0EA 2KUMA 4I7ZC 1IYVA 4YHHH 2RBMA 1KD1C 1R9TB 3TDQA 4J6HA 4A3DB 4LFAH 3PO3H 2IHEA 4L5SA 5ELNA 5JPMC 1PTOC 3KF8A 1SNQA 4A3GH 4Y52H 1WTRA 4X64Q 2B63B 1SXTA 1IBMH 1I50H 5I4DA 3SGIA 4A3KG 3S2DB 3IFDA 2OXPA 1NMFA 1WD1A 1AW7A 1E22A 1XTCD 2FPHX 2R7FA 2LXJA 2UXBH 3UE0A 4P73A 4CDCC 5JEAG 2HUGA 1Q81C 4IZ8A 4AH6A 4DV4L 1SR3A 4IPCA 3IL8A 4ZAIA 2OWOA 5GROA 3J81E 2A6EC 3GTGH 2AQ2B 1JQYD 1LO5D 2K5VA 2EYPA 1YHBA 3M4OB 4MN3A 4Y7NH 3W1BA 4JI8Q 1PFMA 5G3LF 4LUVA 4BBSG 5KYIA 2NYZD 4JI2Q 2WB1E 3L9AX 4XTCS 2RDHA 4LF8Q 2VQEL 1K83B 4P2CB 3H94A 4B3RH 2R7ZB 3O13A 5C44G 4JI1H 1Y8OB 5M5YB 1JT8A 2SDFA 1AE2A 1C8CA 1X3PA 3PO2H 5M5WH 1TWAH 5EQ0A 5A2QE 3I4LA 1EEID 1SEBD 4JI7H 3HOXB 4JI0H 3HOYB 1PTOB 4BA1I 1XTDA 3SR1A 1NCVA 2YV5A 2QA4A 2ZXRA 3MXGA 1XPOA 5L37A 5ELFA 2JEAI 2P2RA 1YNNC 4DR5L 3I0PA 1E0BA 1KABA 1ILPA 1I4QA 4OIJA 3CCMA 3EJIA 5JEAH 3SB1A
chains in the Genus database with same CATH topology
3AQQA 1RIPA 1RHPA 3BZCA 3MVVA 4DNIA 4QUFA 1VS0A 2YQRA 3S14B 1N36L 1I5FA 2KHSA 1BOSA 1J9OA 4NDXA 4FF4A 5IGCA 4KI0A 3PCOB 1SE4A 3DMUA 4WFN3 2R92G 3V05A 5C0XJ 4GKKQ 2MGSA 1K1GA 5C5MA 1SYFA 1DONA 4BBSH 2RHSB 2AXYA 2QF7A 1Y8PB 2EE1A 2VQFL 1H9SB 2RSOA 4KJNA 2F0VA 5DNFA 2EDGA 5GAGC 2XRQD 4ID6A 4BWGB 2L15A 3SK5A 1SDFA 4KV6A 3IAYA 3M7NA 4A3LG 4WJWA 2EQSA 2PYKA 1J5EQ 4DUZL 3HOWG 3ULLA 4QL5A 2PQAB 2Z8LA 1EUJA 2X6GA 3HOZH 4DV1Q 5C0XG 5JJIA 3M4PA 2JA9A 3VR5A 4DR1Q 4RGNA 4DV3Q 1MKHA 3S1NB 4KHZA 1YJ9A 2AUJD 3PF5A 3G71A 5IGDA 2YTXA 1SAPA 4LF6Q 2HQEA 2BE5C 2AMCB 3S2HB 2Z4IA 3GDEA 1X55A 2XRSD 4KLKA 3KBXA 5LL6X 1J8IA 3OOCA 1TWFH 3K7UC 4UP7A 2R92H 1HNWQ 1CQVA 5CV6A 2A6HD 5GQOA 4LF9Q 1Y8NB 2UUAL 3CCQA 2B2TC 1CTMA 3S17H 2EYMA 3J7YW 3S1MB 1F2YA 3HOUB 1PTOF 4IFDI 1WJJA 2ALYB 3M9BA 3NXWA 4KKSA 5LMUQ 1SFOH 1B4OA 1CA5A 1NR4A 2F4IA 1H9SA 3K5MA 4C3HG 1GUWA 1A62A 3VYTA 4E6IA 3AU7A 1EZ6A 2K03A 1JICA 2KECA 3OHXC 3NUCA 2ZTDA 1JWMD 3L7ZC 4TQUS 4Q0FA 2WV6D 4C1NK 4NB3A 1IYJB 1I50B 4B3TQ 1QZGA 3TP8A 3CPWA 4FO2A 4JI4L 4C2MH 1H9JA 3UI2A 3V69A 2ZJPA 4XYOA 1YJWA 4CHTB 5J1ZA 1I4RA 2KHJA 1E1OA 2KHIA 1KLUD 2L11A 4DV7Q 1KTKA 1H9MA 4K0KL 3QO2A 1AZPA 1PRTC 5HGTA 5KNDA 1FL0A 4KKUA 3FEWX 2IX3A 4JI3Q 1WE8A 1QNKA 4C3JG 1TS2A 4DR2L 3BG3A 3I4MB 1STEA 2PW7A 1ASZA 1CA6A 1RD9D 3UDFA 1XMQL 2VB3X 2OTJA 3GTMB 5G3LD 1CQFA 1R4PB 5C3EG 1PFSA 1P16A 4RA8A 2PI2E 4C3HH 2ENBA 4FVMA 3A5ZB 3TP5A 1AZQA 2IJ0A 1CUKA 4A93B 3BZDB 1HHVA 4DAYB 5M5WB 3BYYB 1RL2A 2IX0A 2K04A 1PMRA 4G57A 1HNZQ 1STAA 2TMPA 4YHHQ 5J39A 1LTBD 2XSCA 1R4QB 4YWMA 2NN6I 4B9XA 4DKAC 5I6YA 3D8GA 1BNZA 2DNCA 4A3CG 1X9NA 1EC6A 1F2MA 1EY7A 2XVSA 3A5UA 4NW2A 5EKKA 1G51A 1YBYA 4A3EH 1N32L 2ATWA 4HMJA 3WOEA 1JOQA 2D2CC 3VYRA 2H1EA 4HIMA 4A76A 2R6GA 1XNRQ 3B6YA 3KFUA 2F0DA 4IQZA 3CW2C 3D3RA 3KYHC 2KQ3A 1WTOA 2K5QA 2B2TA 3M3YB 5C3EH 1FGBD 3KLWA 2GVAA 1IBKL 3DM1A 1T5XD 1HTLD 3S1QH 1Y1VG 2WAQG 1I4GA 2ID0A 3HKZG 3URYA 5NUCA 3QOJA 5HGQA 1VQBA 1I4XA 4IJHA 4DAYA 5F2DA 2ES2A 2F0QA 3MZ5A 1Q7YC 4JI5Q 1FJGL 4B3RQ 4HJ5A 2I0QA 2K6AA 5AFWA 4KTAA 3SHLA 3VR6A 3IKJA 5KEEA 3P20A 1VQFA 3A8KE 3S1RB 3CF5A 5D3IB 4JI7Q 3FP9A 1PFBA 1N34L 1U4MA 3KOJA 5E7NA 1O78A 5FO8B 5HY6A 3OTOQ 2IL8A 2M00A 4BY1G 3VA7A 1A6XA 1YHAA 2E2IH 3RLOA 1TWFB 1VQ8A 3SVMA 4F88A 3G6EA 5EJWA 3H3VI 2N88A 1EY5A 3S17B 3I56A 4HJ7A 2A19A 3H3VC 3GTOH 1DJRD 4O2DA 4C3IB 1VQCA 3W3AA 1A0IA 1I6VC 3R2IA 1QCBD 2CTLA 1E2ZA 1YZ6A 4DR7Q 4WALA 4KK7A 4LF7Q 4LFCL 1JE5A 4KHVA 1TWCH 1DGSA 2JEBI 3FRPB 1KAWA 2N3SA 5GADC 3GTLH 1XNQL 4R4QA 4A3DG 4RWSC 3NELA 1PRTF 5C4XH 3K5NA 4GKJL 4A3BH 2OQKA 1IL8A 2B63G 4M1UB 4EQOA 1DTJA 2PW5A 2IT1A 2JXMB 3LX0A 1IKLA 3C1FA 3OIPA 2GN5A 3CCUA 1K9MC 3H91A 4QJFA 2EY1A 1VIHA 2VZAA 2FMCA 3QB3A 3K57A 2IWHA 3MXNB 3RZDH 2FHTA 1EWIA 1T9HA 1S3OA 1TU2B 3MWYW 2UUCQ 3K59A 1S5ED 1EQTA 3L3OC 4J1MA 1Q1BA 5A35A 5CV7A 2WB1G 2K4KA 3JAME 1MSGA 4DV2Q 3U58A 1STYA 2F3VA 1TVXA 3SK6A 4ALPA 3F2CA 1CT1D 1QWYA 2A73B 1BBWA 3A55A 2A6HC 2BDNA 1DXMA 1PZKD 2CTFA 3MEFA 2ZT9C 1QNUA 3I55A 4PMCA 1R9TH 3CCSA 2NVXH 3LWUA 1YHQA 1IHZA 1QUQB 3WWVA 2SEBD 3T1HL 2F3IA 3T16A 3HOXG 4DV4Q 3HOYG 1GXDC 3A74A 3S2DH 3OMCA 5TSSA 1ENFA 4C1NI 3CHBD 2F0WA 3CPFA 4LAAA 2YTYA 1T5EA 5GAEC 2JA8H 4X66L 1SYEA 2MNAA 4RAUC 1BBXC 2F0IA 1N33L 3HKSA 2JA5G 2VQEQ 2ZXPA 4IN3A 2UUBL 2VNUD 3G6JB 2AUKA 2B2YC 2CVRA 1D5XC 1MIUA 3TS0A 1KRTA 5M3MB 2ZXOA 3S1QB 4FXKC 4JI6Q 1NAPA 2AWOA 1CKNB 1K83H 2E2HB 5JJKA 1E2WA 2R7ZH 5C5LA 1PH3A 5K36G 3A7LA 1PH8A 2M9VA 1O7LA 3NENA 5M5YH 5CMDA 3J80E 2F0FA 5IP9G 4DR5Q 4GOPC 1O7ZA 1ASYA 3K80C 4B3ML 1DOKA 1SNDA 2HT1A 1JE4A 1KIXA 3BZKA 3HOYH 1PTOH 2F3WA 5J22A 3SDZA 4DXGA 1C48A 4G7ZC 4DXFA 1SMXA 4HIOA 1JORA 1N36Q 3TP7A 2KCNA 3CRLC 2PMZB 4U68A 3HS0C 4QF4A 4X3UA 4HTHA 5C6AA 2E2IB 4K2KA 3GD7A 5CV8A 2NZHA 4A3IG 4GN5A 3BDCA 4DUYL 3RD4A 2VQFQ 1X32A 3PUXA 1X4NA 1UE6A 4YCUA 5KNCA 3J81i 3VDYA 2PMZE 4ZUIA 3HOUG 1X3FA 1ICWA 4QMGA 2PNHA 1VDZA 5I9PA 3GTQB 4DUZQ 2ICEC 1D2BA 5K36H 3T1YL 3CCVA 4DR4Q 3MEHA 1UE7A 4NKLA 4POGA 3DWPA 4CBVA 5IP9H 3TRZA 3H0GB 4H02A 2WAQE 4GOPB 1LUZA 3HKZE 1OXXK 2CW0D 4DNTB 3WOFA 3MXUA 3C3LA 3ICEA 3OMGA 4IURA 5FLXc 1A3UA 2EXZA 1QVGA 5JAVA 3NTHA 3GV6A 2RSNA 3RZDB 1U4LA 3KJPA 2Y0SB 3I70A 1AP0A 1LLRD 2CHBD 1ZXTA 1HRJA 1PLFA 2UUAQ 1A2UA 2EYJA 4JBKA 2KOLA 1NSNS 1K8MA 1RJTA 3VR3A 4LW1A 4KKTA 4K6LA 4I65A 3PIP3 2CTKA 1VQ9A 1RTNA 3A54A 1SN8A 4FNFA 4R8NA 4B9WA 1A3VA 1EWHA 1KXLA 3I4MG 3DEOA 1L0YB 2OF1A 1VQ4A 3NWSA 1VQDA 3FKIB 2B2YA 2MO1A 4QGUA 4DNRB 4H7BA 4JBJA 2UU9L 1II3A 2R93B 4APVA 3OW7A 1B8AA 1EOTA 1Q46A 4RGTA 2DY8A 1SYBA 2NVXB 4AYBE 4JI4Q 1MGSA 4JCVE 4A93G 1QJOA 2I5HA 3PO2G 1NTGA 3VR2A 2CTEA 4GOPA 1EY9A 5IYBH 3RLNA 4DV6L 4K0KQ 5FO7B 1B70B 1Q8KA 3BVGA 4G4KA 2G9HD 2F0NA 2V4DA 1PDQA 2FXQA 3NQIA 1LT6D 1YIJA 1VQPA 4BBRH 1D5ZC 2JA7B 1KDBA 2QEXA 1AE3A 2JA8B 3UDIA 1PH5A 3D4RA 3EA6A 4WRDA 2O4XA 1AH9A 1XMQQ 1WOCA 4A4IA 4Z9CB 3HEJA 3GTJB 3IFTA 3UE1A 3FHWA 1LTGD 1ZZJA 5EBDA 3NEMA 1PXUA 3QIAA 3I4MH 1WTQA 2ZM6L 3E9IA 1A8VA 1STNA 4YCVA 1VQ5A 3GTMH 3BU2A 4BY7B 4JC0A 2WKCA 3VR4A 3F2UA 2B2VC 4L6TB 5IIFA 1VQ6A 1GUOA 3CMEA 1XXGA 5KIXA 2PNRC 3CCEA 1EZ8A 3GTKB 4HJ9A 1GUGA 2NVTB 1K3RA 3PF4A 1GM5A 4A93H 2BOSA 5CV5A 3K0YA 1C9OA 3RN2A 2OEOA 3OWEB 1IZ6A 3CCJA 4AM3A 4K14A 3QWNA 1VCIA 3HOZG 4KHPL 1YNXA 1N32Q 2A68C 3KF6B 4HSVA 3SXHA 4G7HC 1GJXA 1JC7A 5IWAQ 4CKEA 1CK1A 2D9UA 1CKOA 4R4IA 4BS9A 5JVH3 2BH2A 3MFYA 1K73C 2NVQH 1M90C 1J4WA 3NPPA 4DK6C 2CKZB 3A0JA 2PQEA 4R8IA 2XWJB 1LABA 1IBKQ 2F0OA 1GUTA 2QEJC 3I2ZA 3R3OA 1D5MC 4WORA 2Z6KC 2LSSA 3M3YH 4AQYL 4R4CA 3NSWA 1E24A 3U1KA 4DU9A 1K0RA 2JK8A 3A8IE 2E76C 5KGUA 4O1NA 5IP7H 2F0EA 2I07B 1G6ZA 4X3TA 1BKBA 1N34Q 3CMAA 4FP5D 3G7LA 1KHIA 2LXKA 1J5KA 1XJVA 2EYOA 2UXCL 4A75A 1KDCA 3S1RH 1EQRA 3BDLA 1PH4A 1G291 1HZAA 4XIGS 2DUDA 2RVLA 3OSOA 3KF6A 1HNXL 1KDAA 4HEDA 4B08A 2SOBA 4B3SL 3NP8A 1UUPA 4KY7A 2NN6H 2B8FA 3EFXD 2RA4A 4YY3L 3TREA 1ZEQX 2FFKB 3RUZA 3FVQA 3BVMA 5IYDG 1ZTGA 2DGYA 1YVCA 2CWAA 5ELOA 2F0HA 2WIIB 1S40A 2EIFA 5IT9c 3U4VA 2XN9C 4LFCQ 5CV4A 2Z4HA 3T13A 5DEHA 5EKLA 2VL6A 1SE8A 1V9PA 4C3IH 4RFBA 2F0KA 2AHOB 1XNQQ 4RGOS 1G2SA 1FVIA 3HP3A 5FLMH 1TIID 2L0CA 4PNYA 1CZGA 3EVQA 1EWCA 4JYAL 2B2VA 1BBUA 4FF3A 4QIWB 4GKJQ 1RTOA 3J7AF 4DFAA 2JYOA 2F0SA 4OWWB 2CTJA 1W6JA 4WANA 3TS2A 4ZKCB 1YNJD 4BBRB 4QIWE 2NVYB 2B39A 1I4HA 2E2JB 1QVCA 2PCFB 1M1KC 3EROA 1BF4A 1L1OC 2D0PA 1SRUA 2I5MX 3MC0B 1B9MA 1TQOA 4OXPA 1TR5A 1ZYRD 2VY3A 3J81c 2CW0C 3G4SA 4A3EG 4TVAB 5IYDH 1FNUA 3KUPA 1YEZA 1PA6A 3D0FA 3AFPA 1LYLA 3QG1A 1X6OA 3H15A 1SNOA 2Q2UA 1HH2P 3K5OA 1VMCA 3MHBA 2N8NA 1QZHA 2LFNA 3D4DA 4ILWA 1X4MA 3E6ZX 3H3VH 1K8OA 2Z6KA 5M5XH 1TXYA 2JA6B 2XNAC 1ENAA 3GQBA 5BN4A 1U4RA 4IUNA 3T1HQ 3E9HA 2BL5A 1VQMA 1XPUA 4K5VA 3OIQA 1WCMB 1BO0A 2K75A 3DM3A 1TT2A 2VUMB 2GVBA 3RLFA 3PGZA 4P71A 1GVPA 3PUVA 1XWEA 4F7XA 1EYAA 2A69D 3ULJA 2VW9A 1OXVA 4PZ8A 4QQBX 3PIOA 1N33Q 1Z6HA 2K5WA 4G7OC 4LUOA 1V1OA 1BCPF 2MUYA 2NVQB 4RKBA 3RNUA 2UUBQ 1E1TA 3JC66 1G8ZD 5C4HA 1LTID 4DV5L 1PRTB 5M9OA 4DAMA 4A3MH 1WVNA 4UAIA 4H0LC 5I6WA 1I94L 1EIYB 4A3KB 1V8QA 3D4WA 1GOZA 5EAYA 1PZJD 1ILQA 2PO4A 2RKSA 5E1FA 3JAMi 4X3SA 4DA2A 1GKHA 5I2YA 5M3MH 1KRSA 3CC2A 3AFQA 2EJGC 1V1QA 2E2HH 4B3MQ 5FJ8G 4LJZC 1KNAA 1TS4A 3BVZA 3J81L 2QKIC 1EYGA 1STHA 1CKMA 1HZCA 5CGKA 2IX1A 5C4XG 2ANRA 2MPMA 4OO1G 4UPAA 1M4VA 4A3BG 3E0JA 4CJ0B 5BN3A 5C44B 4GN3B 1TUAA 4LMQD 1VQHA 1XMOL 3J7A5 2X6LA 4PG3A 1TY2A 4DUYQ 5IGFA 1OO9B 1EIFA 1OXUA 1L1OA 5C0XI 4DV0L 2JE6I 1S5BD 3EBEA 4PQXA 2WP8J 1UE5A 2Q2HA 4IUPA 1B7YB 2NTTA 1OXSC 1STBA 3ND8A 2M2LA 1EY0A 5I9OA 2NBFA 2H4OA 2LKVA 4CKCA 2EYHA 1J6QA 3T1YQ 4JOIC 4GLXA 4AYBG 3FDTA 1Y1WH 4LUZA 3K0XA 3FKIG 1JR0D 2PZTA 3OW2A 2R93G 2A5HA 3GTQH 5FJ8H 2L4NA 1IBLL 5CR3A 4HJ8A 4K2LA 1I6HB 4YIJA 4LF6L 2C35B 3CD6A 3OPOA 5T1IA 3H0GH 4XQQA 4OO1H 4IPGA 1MBYA 2D5DA 3S16B 3T4AC 3LGJA 3L2PA 1B2TA 3J80i 2PQUA 2Z1CA 3P7JA 1PHJA 1B1ZA 2SNMA 3I73A 2MQHA 1NE3A 2JA7G 2RQXA 2JA8G 1GD7A 1KQSA 3AEVA 1H9RA 3HOWB 1IL2A 1DCZA 3M85A 4U673 1PH6A 4LFBL 4O0AA 2UU9Q 1AFPA 1C4QA 1WVLA 5C4JB 4KJOA 4F87A 3CQZH 4CGYB 1X3EA 2NWGA 2R7DA 5M5XB 1V1PB 1B44D 3FKIH 2VS1A 4NXML 1KLGD 2LMCB 1KAAA 5IODA 1TY0A 3K58A 3H09A 1JMCA 4DK1A 5DM73 1TS3A 2R93H 4BY7G 1HTPA 2R7ZG 4TKOB 3FPUB 3T51B 5IGGA 2K05A 1ENCA 5BR8L 2K5HA 1TS5A 2A74C 5CBAE 2D0OA 1SJED 1SYCA 3DHQA 4RG1A 3HZXA 2EJFC 3HFZB 1SBBB 4UP8A 1QG7A 4L8JA 2O5JC 2QCPX 5KRUA 4Q5VA 2E5LL 5ELDA 4GLAC 2JA7H 3SE0A 1JCKB 1TWGB 1BCPD 3N6RA 1JJGA 4A3MB 2JP1A 4PZ7A 4A3FH 4ME5A 5DM63 1VQAA 2ZM6Q 4BA2I 1YNJC 1SYDA 2HHHL 3GTJH 4GLVB 1PV4A 1Q1EA 2Q2TA 5BN5A 4XT1B 3GP7A 4IPDA 3W1GA 2AQ3B 4K5XA 1HUMA 1D8LA 1SROA 1V1PA 4JOIA 4LFAL 1H95A 1Z7TA 5IGEA 2K7VA 3BDOA 2B2WC 1DM0B 1EY8A 4BY7H 5ELBA 4JV5L 3S9WA 4OIKA 4NP5A 5ELCA 1IBML 5H1SE 3J7ZC 1QB5D 3GTKH 1CFMA 3PMFA 4OX9L 4KHPQ 2NVTH 1UAPA 1SMYD 4WJ3M 2UXBL 2MP1A 4TRDA 1BQQT 4ZRZA 4N9PA 3ONAB 4A3JB 1Q12A 4LF5L 1HQRD 3K5LA 1HCZA 1SE3A 2GA4B 3AYHB 3F2DA 4HCEA 1HZBA 3PUZA 2RF4A 1D1IA 1Q82C 1EY6A 2BDOA 5CV9A 1B50A 2E8GA 2K5NA 3GTPH 4K6DA 5IGBA 3M4YA 1PH7A 4DN4M 2CQOA 1W6KA 1JWSD 2A69C 4DAVA 2YTVA 4R1JA 3NQTA 2FJ2A 2J4XA 3W2DA 2K5DA 1TWHH 4L5RC 1EU4A 3RMHA 5KYLA 4JI1L 4XT3B 5AJ3L 2K28A 1FR3A 1Y1WB 1S4ZA 4HJAA 1W2BA 3C2PA 3WDNA 3SK4A 5IE8A 3Q22A 3CC7A 1GUSA 1B53A 3LNNA 3M7GA 4JI0L 1A2TA 2FMMA 2KA7A 4DK3C 4ZLTF 3HGBA 1WTWA 3F1ZA 2UXCQ 1SYGA 3RN5A 4RHSA 2EVBA 2N49A 2WINB 2L1BA 1HNXQ 1GHJA 4B3SQ 2DGRA 1RKNA 3R8BA 5IYBG 1STGA 4X62L 1Y1VB 3ERSX 4YY3Q 1LTAD 3TSSA 1WFQA 3C1EA 5FKAC 3KLSA 4FYDA 4BBRG 3ERQA 1A15A 4IFDJ 4EQ5A 2NZOA 4BXXG 1EU3A 4OWTB 1FGUA 3JAMc 1SJHD 1Y69U 2E2DC 2HIVA 3I4NB 2B29A 2I46A 3CQZB 4JYAQ 5JJZA 2DNEA 2Y0SE 4CJ2C 1IKMA 2Q8IB 5C3WA 3MTSA 1F9QA 3ZJYC 1F9PA 2B2WA 1DYQA 3HOVB 1E2VA 1MJCA 3G48A 4RMFA 2JA6G 5CBEE 4IFDG 2K33A 1ET9A 1ONLA 3L0OA 4ZYSA 1XYIA 1EIGA 4CKBA 1JB7A 3ULPA 3U9SA 3PV0A 5IYCH 2KVMA 1C0AA 1F9SA 2CFMA 2VUMG 1DZ1A 4WJ4A 1HXYD 4JVHA 1FNVA 1Q86C 1LTSD 2NVYH 5KNBA 3FPPA 2E2JH 4BXXH 3OYYA 4DR2Q 4A3FB 2L55A 2F4VL 1Z9FA 4GS3A 1PH9A 2IHFA 3PIPA 2QGQA 1TKWB 1F2ZA 1ET6A 3V2TA 1PFNA 1OTCA 5CORA 2LY7A 1WD0A 1WTVA 3S15H 3I91A 3OWFA 3CU7A 5IY0A 3I7FA 3TZUA 1B3AA 5FLXL 2WB1B 2JA6H 4IFDH 2YU9H 1I3QB 4NXNL 1HR0L 3KDFA 3J7AV 1MSHA 1ZKOA 2C9OA 2E3UA 3J80c 5IP7G 1WCMH 5M3FB 1A3TA 4IUUA 4IOAA 4YCWA 2VB2X 1RDPD 4X3KA 3CP0A 3JAML 4X65L 4V0BA 2VUMH 4EX5A 2ZTCA 3R93A 2BA0A 4RKLA 3VKEA 3KLRA 2F52A 4DV5Q 3RZOB 4P75A 3NTKA 1I94Q 1EQVA 1JOOA 1WYDA 1I4PA 3GTPB 1RF2D 3V96A 4QCLA 1N8RC 2EPBA 2NN6G 4DK0A 5CC4A 4RCOA 3F2BA 4JI6L 1VF7A 1YITA 2L9HA 4J15A 1IW7D 1TWHB 4ME3A 2CCZA 1VQIA 4H13C 1EY4A 2UXDL 2JSOA 4A3KH 4K5WA 4LNQA 1DT4A 5J3BA 5JJLA 1GUNA 4HSPA 4OL7A 1ZZIA 4TSSA 3DLLA 1BCPC 4DPGA 3NWTA 1F9RA 3T56B 4C3IG 1UEAB 3KLSX 1FJGQ 1UWVA 5FLMG 2RDFA 2A1AA 2Q2IA 1U9RA 4JVYA 1JWUD 5GAHC 2JA5B 1KC8C 3X3MA 3K7AB 3Q0AA 3U9OA 1HR0W 5LMNL 1DOLA 1DOMA 3C46A 1ML0D 2K01A 1XMOQ 2KENA 3GO5A 4POFA 3ZYYX 4DR3L 3EIVA 2F0MA 5DLQE 2PZWA 1G2TA 2XIWA 4IO9A 4DV0Q 1NUCA 5C44H 2PPBC 1SNCA 2EYFA 2AKWB 2HIXA 1SMYC 2L12A 1N9WA 4F8MA 2KBNA 3UDXA 2DY7A 4RH6A 2HQLA 2EY5A 1EQQA 1LTTD 2MJ8A 4IUTA 3AB9A 3CXCA 2J7ZA 2EOTA 4DR4L 2I5LX 3J80L 1G91A 2BA1A 2CWPA 4DR6L 1HQMC 1Y14B 1V43A 1HJPA 2ANNA 1LACA 4V190 3CC4A 3KBGA 1VQLA 4IJLA 1FNWA 1BCPB 3DWAA 1IBLQ 1Z47A 2CPQA 2R61A 4A3IB 2IY5B 3NHHA 2X69A 4LK1C 1LT3D 4DAPA 4QB4A 2A8VA 1Q8IA 3DXJC 3STBD 3VA5A 2MFIA 3MA2B 1S5CD 1HFNA 1I6HH 1CZWA 3FMCA 5FO9B 2R3ZA 4PMBA 1KL9A 5LMNW 4UP9A 1YI2A 4LF4L 4K8IA 2O5IC 2N78A 2KCMA 2KCCA 3S16H 4X6AH 3D31A 1YJNA 3DUZA 4MHEA 1QE6A 4UY8C 4LFBQ 4L5TA 1FYCA 3TP6A 1SLJA 3PO3B 4PZ6A 1CSQA 2DN8A 2XGTA 4A3LH 1QILA 4A3GB 5C3XA 1O7IA 4GZYC 1S72A 1A63A 3HOWH 4A3MG 2RCNA 2PQAA 1CHQD 5E3FA 3SK8A 4NXMQ 4GN4B 5C0XH 3I3CA 3K8AA 4ODGA 3PIO3 3K6OA 5C4JH 4OHJA 1ESFA 1U4PA 3S15B 4RHRA 4X64L 1X3QA 5BR8Q 3D6WA 2OQ0A 4RGMA 5M3MG 4NPSA 2YU9B 2OTLA 3GTGB 3T53B 2CTMA 3HRZC 2EY6A 1NJIC 5D65A 4KY6A 1EFWA 4Y7NB 1D6EC 1SE2A 4FXDA 1VQJA 4ZK9B 1HA5A 4KD3A 1L0WA 2E5LQ 1KNEA 1NR2A 1G6PA 1PH2A 3A8JE 5IT9L 2N55A 4X66Q 4A3JG 2RDGA 2ZTEA 1F2LA 1RODA 4JI8L 5JOBA 3EN2A 2HHHQ 4PV1C 3PUYA 3PO2B 4R4OA 4JI2L 1TWAB 4LF8L 4MZ9A 2HDLA 4J8QA 3MFGA 3MAQA 4FXGC 1L1OB 1PYSB 3HG9A 4XQJA 1TWGH 4LFAQ 3Q23A 1AEXA 3CCLA 4LIJA 2WFWA 4P74A 1SNPA 2EJMA 3A56A 1O7YA 1E3PA 4JV5Q 2VXWA 3BS1A 1IBMQ 1BDOA 5D3DA 2OPUA 2B2UC 3TEHB 2HH2A 3A7AB 1Y1WG 3N52A 4OX9Q 2EY2A 2J0TD 1RCVD 2UXBQ 3UDGA 2PI2A 1JJ2A 4C3JH 3S24A 1QOHA 4LF5Q 5IWAL 4OWXB 2K52A 4H44C 1LT4D 4BBSB 4IUVA 5FK9C 3H0GG 4HR7B 3LWEA 2KEDA 4MIUA 4HAEA 4A3JH 1S5FD 4ZUJA 1AN8A 2NB0A 4GKKL 2OT2A 1D7QA 4FF2A 1K8GA 1IXRA 4P72A 2Y0SG 4JI1Q 5AJ3Q 4JK1C 2BCOA 4ABNA 3AEVB 4KY5A 3SEBA 1GHKA 4KN7C 5A2QL 3HOZB 1MJEA 3RR5A 3D6CA 3I4NG 1VF5C 5EKIA 4JI0Q 1J5EL 4A3CH 3CCRA 5ISRA 3CRKC 2FMRA 1KHMA 1O80A 1IW7C 2QDBA 4DV1L 5E4WC 4XDXA 4MTNA 4DR1L 3NE5B 4DV3L 5EPKA 2R92B 2MO0A 2NUCA 3HOVG 4X62Q 1IYUA 3AMUA 4EVOA 4KN4C 3W5OA 1VQOA 1SSOA 5C4ZA 1JJCB 3I72A 5I2XA 2FINB 5E4XA 2JJQA 1P8LA 3I4OA 4L63B 1SFOB 1L2FA 1VIGA 1WTXA 2EZVA 2TSSA 2JZXA 1EYDA 2F0PA 1PTOD 5JVG3 1HNWL 1PYBA 1Y1VH 4LF9L 3ER0A 1X65A 5LL6S 1NMGA 1LTLA 5LMUL 4XQNA 2B8GA 1EL0A 5COYA 4AIMA 3VYUA 4A3FG 3NTIA 4C2MB 2V1CC 2F0UA 2F1MA 5T1GA 1VMPA 4ZKBB 2XTIA 3I4NH 2A6ED 1VQKA 2MJHA 1EOVA 2Q8TA 4RCNA 2EXDA 4QMFB 4FF1A 5IOCA 1HUNA 1C7YA 4QUCA 3EQLC 5FLXE 4B3TL 2B3GA 2B2UA 3Q6SA 1BUVT 4LWCA 1CI3M 4BY1H 4DGZA 3GV3A 2PY9A 4JBWA 3HOVH 5EGTA 1EEFD 4DV6Q 1UE1A 2ZJQA 4DV7L 2WACA 1B9NA 1M8AA 1WTPA 3U4ZA 4QY7A 5M3FG 2F03A 1HFGA 3I8ZA 3KK7A 4JI3L 2NTSA 1K8AC 2K1BA 2K14A 4C3HB 3J81j 2F4VQ 3STBC 4EGVA 2AQ1B 1EIHA 3QOLA 1X54A 4K8JA 5HURA 1UEBA 4PMWA 1YNND 4A3DH 3DEPA 2A68D 3TBIB 2K50A 1D1KA 4HMIA 1FD7D 4DF7A 2B63H 1VQEA 3TQYA 2XWBB 2ASBA 3Q8DA 4B8TA 4EQPA 1HNZL 4R4TA 4GNXC 3I90A 1HR0Q 4NXNQ 4YHHL 1ZYRC 3MXNA 2HH3A 5EPJA 1HA6A 4A3EB 4X65Q 5JPNC 4C3JB 4N9TA 1MD2D 4C56C 4M8AA 3TMEA 1I3QH 4MNOA 1VQGA 3X3NA 1DD2A 3CKIB 3VYSA 4XXEA 4FDBA 2QNDA 1E7ZA 2F0GA 4KMUC 5M3FH 3M4OH 1GO3E 4R9WA 2JVZA 5C3EB 3P1HA 4YWLA 1ZZKA 1XX8A 1U5KA 4JG2A 1XPRA 4YWKA 4HIDA 3MXPA 1NY4A 1XNRL 1PH1A 3NBHB 2YYZA 4HN7A 2PZUA 3PUWA 2QILA 4HCSA 4OGQC 3RZOH 1EYCA 1L0XB 4OO1I 2UXDQ 3IRBA 3Q24A 1EFID 4ULLA 3K81C 1HZ9A 1S5DD 1QUQA 4XYQA 4O42A 2H5XA 4JBMA 3HOXH 2WKDA 4ZQ3A 4AQYQ 2BE5D 4S3SA 4JI5L 1LV9A