1ODHA

Structure of the gcm domain bound to dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
157
structure length
157
Chain Sequence
b'LSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCSRDCSTEEGRKIYLRPAICDKARQKQQRKSCPNCNGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPRPETKLEAEARRAMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MGCM1
publication title Crystal Structure of the Gcm Domain-DNA Complex: A DNA-Binding Domain with a Novel Fold and Mode of Target Site Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription factor/dna
total genus 27
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2003-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03615 GCM GCM motif protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.80 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1odhA02
3.30.1370.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 1odhA01
1ODHA
chains in the Genus database with same CATH superfamily
4X66H 3LNLA 2JEAI 1ZTGA 1IBMH 2R92L 4TVMA 4NZTM 1NXEA 2HR5A 3PKIA 3MPSA 3PO3L 2V3BB 4OD6A 4A3FL 1YUXA 2BE5D 1X4NA 4AI2A 2YU9L 2M8WA 4DR1H 2M6QA 5AI2A 5GAHc 1ZZKA 2LTLA 1NXUA 4B3RH 4GKJH 2YQRA 4A3GL 2CPMA 1EC6A 4JVHA 1J4WA 4A3EL 2JA7L 2UUCH 2V0FA 2GMGA 3HOXL 4QMFB 2MJHA 1SFOL 1Y1VL 3KYYA 3GTGL 5M3ML 2WB1P 4G6BA 4Y52L 5M5YL 3KYXA 4C2M1 7RXNA 4X62H 1R9TL 5IYDL 1BQ9A 3I4ML 2B5ID 5M5XL 1LKMA 4IFDG 3WWNB 1SMUA 4DR2H 3PO2L 2A6HD 2EY4E 3SS2A 1CADA 2R93L 1ZZIA 4GKKH 2E2JL 4RXNA 4TPUA 3P8BA 1R0FA 1BQ8A 2JEBI 1DT4A 2Z0SA 3S16L 3PIO1 3RZOL 3S2HL 2JI3A 4JAFA 2VQEH 2OPUA 4NXMH 3H9CA 4LHNA 4OX9H 4JI3H 2O5JD 3PL5A 1T9OA 4DV1H 5JVG1 1TWHL 4NBQA 4AR4A 1RWDA 3GTPL 5DM71 1R0HA 3RZDL 3H99A 2LRRA 1IBKH 3KYWA 4ZN1B 5C44L 4LFAH 2B63L 2E3UA 3RZ6A 4AR3A 1I94H 2ANRA 1PQXA 3HJYB 2A69D 2JA6L 2CTEA 5K36G 3S2DL 1PFWA 4JAEA 1FHHA 2APOB 3J81W 3NCVA 4DV4H 1NNQA 2A68D 4DV5H 4OCHA 4A93L 2DGRA 2NVTL 2JZXA 5FLXW 4JI7H 2C6AA 5IYBL 5C0XG 3MQKB 2CTLA 3OTOH 2XJQA 5AI3A 1PZXA 2L0ZA 1TWGL 1WJVA 1YK4A 3GTKL 1B71A 3B08B 4ME3A 1CAAA 1T9QA 4G08A 2HHHH 2UXBH 4JVYA 3WWLA 1R0JA 4DV0H 2JI1A 2K1HA 5IT9W 2CTJA 2Z3QB 4JI0H 4AR6A 3GR5A 3VPBE 4A3JL 4JAGA 2PQUA 2CR8A 4LF6H 4LFCH 3QVDA 2UUBH 4OO1G 5A2QW 1X4MA 4X64H 2XJPA 2ZIXA 3FKIL 1QYBA 4AHXA 2Z3RB 2C6BA 2NYDA 4BY7L 2AUSB 2CPQA 1K83L 2HH2A 5C4JL 2ANNA 2RDVA 2D9IA 4DR6H 2JA8L 2HH3A 2XJSA 5JVH1 3LWRB 2AXYA 3HOVL 1YV1A 3GTLL 4NZRM 2JVZA 1TWFL 2CKAA 5MFZA 1XNQH 4JI5H 3PZAA 2FFMA 5LMNH 5MFPA 4XGHA 4WALA 3LWQB 1S24A 4EC5A 4DR3H 2QL0A 2RFKB 1B2OA 5JEAG 1XMOH 2UXCH 1H7VA 5IY0A 2OPVA 1YUZA 1N32H 5GADc 4PDBA 4BBSL 3S15L 2VKCA 4YWMA 4AI0A 2V0EA 3FDJA 3MSUA 2LTMA 2ERSA 2WAQP 4FJSA 3A44A 5IYCL 1LKPA 2A6ED 5GAGc 1HNXH 5IWAH 4AI1A 2PVXA 4A3DL 1FJGH 3B0AB 5K2ME 4FJUA 3PWFA 3ZG6A 1IROA 1B13A 4JYAH 3GKUA 4LIJA 2QNDA 1I6HL 3I4NL 2MS3A 3HAXC 4DV7H 2BL5A 4H8AA 3HOYL 2CWFA 3RZTA 4BA2I 3S1RL 1UG8A 3EZJA 5LL6b 2XJRA 2G8YA 4LF4H 1N33H 3JAMW 4JI6H 1RB9A 3PKJA 4BXXL 5H1Sc 2A1SA 1WHRA 1VZGA 1HNWH 2PPTA 2VQFH 1VIGA 4WFN1 3H9BA 1TWAL 4JV5H 2UXDH 1RDGA 4A3LL 3J80W 1K1GA 3S17L 2NN6G 1S2ZA 2JA9A 1WTJA 1BFYA 4AHZA 2BA0A 3FAUA 1ZRPA 4AYBP 5GAEc 4DV6H 3K7AL 2XJTA 1TWCL 1XMQH 2LF0A 1I3QL 4V196 4BY1L 4A3CL 1Z2IA 1Z92B 2UUAH 3KDKA 1E8JA 2PSMC 2PMZP 2NVQL 4AI3A 2FPHX 3AEVB 2NVXL 2K2DA 8RXNA 1V8CA 4DV3H 2FMRA 3U1KA 4C3HL 4DR7H 3T1HH 1ZZJA 1WCML 4AR5A 1FKAH 3GTML 4DUYH 4LF8H 3PIP1 2J9UB 2PYAA 4B8TA 2X06A 5EINC 4DV2H 1WVNA 3LWOB 3JR7A 2AYJA 5BR8H 4AM3A 4AIMA 2VUML 1YK5A 3HKZP 4YWLA 4JADA 2Y0SP 4LF7H 4AHWA 4POGA 2M4VA 4POFA 1DVBA 3SB1A 2AQCA 5FLML 1DX8A 1XRHA 1R0IA 1V9NA 2XJVA 3J7Y1 5FJ8L 4JI8H 1Y1WL 2VL6A 4DUZH 4AHYA 3S14L 1I50L 2ZQEA 5MF6A 4X65H 4JI4H 5EIOC 4LF9H 1I6UA 1XNRH 2PY9A 1S20A 2KKDA 1F4LA 4A3KL 4KHPH 2Y3MA 1OWBA 1RYTA 1VZIA 1JYBA 3I0PA 5M3FL 3OETA 3UOEA 2JE6I 3M3YL 4B8CD 2F4VH 3KYUA 3K35A 2HVYC 4DR4H 1VCXA 3P2AA 2E2HL 3QD7X 2PT7G 3GTQL 1C09A 3GTOL 3OSSD 5DT9A 4K0KH 4JI1H 1QQTA 3H97A 3GTJL 4X6AL 3VKEA 1DTJA 4C3JL 3LWVB 4A3BL 3CQZL 1RDVA 2H12A 5C3EL 5MGNA 1VZHA 2NVYL 2PVEA 4B3MH 2E2IL 2UU9H 4A3ML 1OWCA 4LHLA 1SMWA 4QIWP 1SEIA 5C4XL 2CTKA 4U671 5AN9H 1FHMA 3J7Z1 1P7PA 4BA1I 3H0GL 4XXBB 3KYVA 1J5KA 3HOZL 3HOWL 1S03G 1X9ZA 1HR0H 5IP9L 4DR5H 1IRNA 3S1ML 2E5LH 4B3SH 2JA5L 1TUAA 4B3TH 4JI2H 3RYGA 4YY3H 2JI2A 1S30A 1MSZA 4YHHH 4A3IL 1VIHA 1ODHA 1X0AA 5DM61 3LWPB 3GABA 1NXGA 2CTFA 3QQCE 1PFYA 5M5WL 1R0GA 2KN9A 3S1QL 2ERJA 3L7ZC 1IU6A 3LPEB 1N34H 1WE8A 3H3VM 1PFVA 5RXNA 1F0XA 4LF5H 1BE7A 3NFPI 2M6OA 3M4OL 4E9JA 2DSXA 1SMMA 4NXNH 4ZN3B 3S1NL 1B2JA 6RXNA 1AN7A 2XJUA 2CKCA 3T1YH 4WANA 4C3IL 4Y7NL 1RYQA 4BBRL 5LMUH 4K9FA 3KDGA 2P2RA 3J7AK 4E6YA 2O4CA 3HJWB 1HNZH 1LTLA 2M4YA 2ZM6H 2M6PA 1IW7D 1QCVA 5MLC3 1IU5A 3IU3I 2CTMA 1N36H 3HOUL 1J5EH 2R7ZL 3RF2A 4AQYH 1T9PA 2CWHA 1PFUA 1KHMA 1LKOA 2LCQA 1BRFA 1IBLH 4LFBH 3V69A 4UY81 5IP7L 4GS7D 1VBIA
chains in the Genus database with same CATH topology
4X66H 3LNLA 1IBMH 4TVMA 4NZTM 1NXEA 2HR5A 3PKIA 3MPSA 4OD6A 2V3BB 1YUXA 2BE5D 4AI2A 4DR1H 5AI2A 5GAHc 4B3RH 4GKJH 2UUCH 2V0FA 2GMGA 3KYYA 4X62H 4G6BA 3KYXA 7RXNA 1BQ9A 2B5ID 1LKMA 3WWNB 1SMUA 4DR2H 2A6HD 3SS2A 1CADA 4GKKH 4RXNA 4TPUA 3P8BA 1R0FA 1BQ8A 3PIO1 2JI3A 4JAFA 2VQEH 4NXMH 4LHNA 4OX9H 4JI3H 2O5JD 1T9OA 4DV1H 5JVG1 4AR4A 1RWDA 5DM71 1R0HA 1IBKH 3KYWA 4ZN1B 4LFAH 1I94H 3RZ6A 4AR3A 2A69D 4JAEA 1FHHA 3J81W 3NCVA 4DV4H 1NNQA 2A68D 4DV5H 4OCHA 5FLXW 4JI7H 2C6AA 3OTOH 2XJQA 5AI3A 2L0ZA 1WJVA 1YK4A 1B71A 3B08B 4ME3A 1CAAA 1T9QA 4G08A 2UXBH 3WWLA 1R0JA 4DV0H 2JI1A 5IT9W 2Z3QB 4JI0H 4AR6A 3GR5A 3VPBE 4JAGA 2CR8A 4LF6H 4LFCH 3QVDA 2UUBH 5A2QW 4X64H 2XJPA 2ZIXA 1QYBA 4AHXA 2Z3RB 2C6BA 2NYDA 2RDVA 2D9IA 4DR6H 2XJSA 5JVH1 1YV1A 4NZRM 2CKAA 5MFZA 1XNQH 4JI5H 3PZAA 5LMNH 5MFPA 4XGHA 1S24A 4EC5A 4DR3H 2QL0A 1B2OA 1XMOH 2UXCH 1H7VA 5IY0A 1YUZA 1N32H 5GADc 4PDBA 2VKCA 4YWMA 4AI0A 2V0EA 3MSUA 2ERSA 3A44A 1LKPA 2A6ED 5GAGc 1HNXH 5IWAH 4AI1A 2PVXA 1FJGH 3B0AB 5K2ME 3PWFA 3ZG6A 1IROA 1B13A 4JYAH 2MS3A 4DV7H 3RZTA 3EZJA 5LL6b 2XJRA 4LF4H 1N33H 3JAMW 4JI6H 1RB9A 3PKJA 5H1Sc 1VZGA 1HNWH 2PPTA 2VQFH 4WFN1 4JV5H 2UXDH 1RDGA 3J80W 1S2ZA 1BFYA 4AHZA 3FAUA 1ZRPA 5GAEc 4DV6H 2XJTA 1XMQH 2LF0A 4V196 1Z92B 2UUAH 3KDKA 1E8JA 2PSMC 2FPHX 4AI3A 2K2DA 8RXNA 4DV3H 4DR7H 3T1HH 4AR5A 1FKAH 4DUYH 4LF8H 3PIP1 2J9UB 2PYAA 5EINC 4DV2H 2AYJA 5BR8H 1YK5A 4YWLA 4JADA 4LF7H 4AHWA 4POGA 2M4VA 4POFA 1DVBA 3SB1A 1DX8A 1R0IA 2XJVA 3J7Y1 4JI8H 2VL6A 4DUZH 4AHYA 2ZQEA 5MF6A 4X65H 4JI4H 5EIOC 4LF9H 1I6UA 1XNRH 2KKDA 4KHPH 2Y3MA 1OWBA 1RYTA 1VZIA 1JYBA 3OETA 4B8CD 2F4VH 3KYUA 3K35A 4DR4H 1VCXA 3P2AA 3QD7X 2PT7G 1C09A 5DT9A 3OSSD 4K0KH 4JI1H 1RDVA 2H12A 5MGNA 1VZHA 2PVEA 4B3MH 2UU9H 1OWCA 4LHLA 1SMWA 1SEIA 4U671 5AN9H 1FHMA 3J7Z1 4XXBB 3KYVA 1S03G 1X9ZA 1HR0H 4DR5H 1IRNA 2E5LH 4B3SH 4B3TH 4JI2H 3RYGA 4YY3H 2JI2A 1S30A 4YHHH 1ODHA 5DM61 3GABA 1NXGA 3QQCE 1R0GA 2KN9A 2ERJA 1IU6A 3LPEB 1N34H 5RXNA 1F0XA 4LF5H 1BE7A 3NFPI 2M6OA 4E9JA 2DSXA 1SMMA 4NXNH 4ZN3B 1B2JA 6RXNA 1AN7A 2XJUA 2CKCA 3T1YH 1RYQA 5LMUH 4K9FA 3KDGA 3J7AK 4E6YA 2O4CA 1HNZH 1LTLA 2M4YA 2ZM6H 2M6PA 1IW7D 1QCVA 5MLC3 1IU5A 3IU3I 1N36H 1J5EH 3RF2A 4AQYH 1T9PA 1LKOA 2LCQA 1BRFA 1IBLH 4LFBH 2HHHH 4UY81 4GS7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ODH A; 
#chains in the Genus database with same CATH topology
 4X66 H;  3LNL A;  2JEA I;  1ZTG A;  1IBM H;  2R92 L;  4TVM A;  4NZT M;  1NXE A;  2HR5 A;  3PKI A;  3MPS A;  3PO3 L;  2V3B B;  4OD6 A;  4A3F L;  1YUX A;  2BE5 D;  1X4N A;  4AI2 A;  2YU9 L;  2M8W A;  4DR1 H;  2M6Q A;  5AI2 A;  5GAH c;  1ZZK A;  2LTL A;  1NXU A;  4B3R H;  4GKJ H;  2YQR A;  4A3G L;  2CPM A;  1EC6 A;  4JVH A;  1J4W A;  4A3E L;  2JA7 L;  2UUC H;  2V0F A;  2GMG A;  3HOX L;  4QMF B;  2MJH A;  1SFO L;  1Y1V L;  3KYY A;  3GTG L;  5M3M L;  2WB1 P;  4G6B A;  4Y52 L;  5M5Y L;  3KYX A;  4C2M 1;  7RXN A;  4X62 H;  1R9T L;  5IYD L;  1BQ9 A;  3I4M L;  2B5I D;  5M5X L;  1LKM A;  4IFD G;  3WWN B;  1SMU A;  4DR2 H;  3PO2 L;  2A6H D;  2EY4 E;  3SS2 A;  1CAD A;  2R93 L;  1ZZI A;  4GKK H;  2E2J L;  4RXN A;  4TPU A;  3P8B A;  1R0F A;  1BQ8 A;  2JEB I;  1DT4 A;  2Z0S A;  3S16 L;  3PIO 1;  3RZO L;  3S2H L;  2JI3 A;  4JAF A;  2VQE H;  2OPU A;  4NXM H;  3H9C A;  4LHN A;  4OX9 H;  4JI3 H;  2O5J D;  3PL5 A;  1T9O A;  4DV1 H;  5JVG 1;  1TWH L;  4NBQ A;  4AR4 A;  1RWD A;  3GTP L;  5DM7 1;  1R0H A;  3RZD L;  3H99 A;  2LRR A;  1IBK H;  3KYW A;  4ZN1 B;  5C44 L;  4LFA H;  2B63 L;  2E3U A;  3RZ6 A;  4AR3 A;  1I94 H;  2ANR A;  1PQX A;  3HJY B;  2A69 D;  2JA6 L;  2CTE A;  5K36 G;  3S2D L;  1PFW A;  4JAE A;  1FHH A;  2APO B;  3J81 W;  3NCV A;  4DV4 H;  1NNQ A;  2A68 D;  4DV5 H;  4OCH A;  4A93 L;  2DGR A;  2NVT L;  2JZX A;  5FLX W;  4JI7 H;  2C6A A;  5IYB L;  5C0X G;  3MQK B;  2CTL A;  3OTO H;  2XJQ A;  5AI3 A;  1PZX A;  2L0Z A;  1TWG L;  1WJV A;  1YK4 A;  3GTK L;  1B71 A;  3B08 B;  4ME3 A;  1CAA A;  1T9Q A;  4G08 A;  2HHH H;  2UXB H;  4JVY A;  3WWL A;  1R0J A;  4DV0 H;  2JI1 A;  2K1H A;  5IT9 W;  2CTJ A;  2Z3Q B;  4JI0 H;  4AR6 A;  3GR5 A;  3VPB E;  4A3J L;  4JAG A;  2PQU A;  2CR8 A;  4LF6 H;  4LFC H;  3QVD A;  2UUB H;  4OO1 G;  5A2Q W;  1X4M A;  4X64 H;  2XJP A;  2ZIX A;  3FKI L;  1QYB A;  4AHX A;  2Z3R B;  2C6B A;  2NYD A;  4BY7 L;  2AUS B;  2CPQ A;  1K83 L;  2HH2 A;  5C4J L;  2ANN A;  2RDV A;  2D9I A;  4DR6 H;  2JA8 L;  2HH3 A;  2XJS A;  5JVH 1;  3LWR B;  2AXY A;  3HOV L;  1YV1 A;  3GTL L;  4NZR M;  2JVZ A;  1TWF L;  2CKA A;  5MFZ A;  1XNQ H;  4JI5 H;  3PZA A;  2FFM A;  5LMN H;  5MFP A;  4XGH A;  4WAL A;  3LWQ B;  1S24 A;  4EC5 A;  4DR3 H;  2QL0 A;  2RFK B;  1B2O A;  5JEA G;  1XMO H;  2UXC H;  1H7V A;  5IY0 A;  2OPV A;  1YUZ A;  1N32 H;  5GAD c;  4PDB A;  4BBS L;  3S15 L;  2VKC A;  4YWM A;  4AI0 A;  2V0E A;  3FDJ A;  3MSU A;  2LTM A;  2ERS A;  2WAQ P;  4FJS A;  3A44 A;  5IYC L;  1LKP A;  2A6E D;  5GAG c;  1HNX H;  5IWA H;  4AI1 A;  2PVX A;  4A3D L;  1FJG H;  3B0A B;  5K2M E;  4FJU A;  3PWF A;  3ZG6 A;  1IRO A;  1B13 A;  4JYA H;  3GKU A;  4LIJ A;  2QND A;  1I6H L;  3I4N L;  2MS3 A;  3HAX C;  4DV7 H;  2BL5 A;  4H8A A;  3HOY L;  2CWF A;  3RZT A;  4BA2 I;  3S1R L;  1UG8 A;  3EZJ A;  5LL6 b;  2XJR A;  2G8Y A;  4LF4 H;  1N33 H;  3JAM W;  4JI6 H;  1RB9 A;  3PKJ A;  4BXX L;  5H1S c;  2A1S A;  1WHR A;  1VZG A;  1HNW H;  2PPT A;  2VQF H;  1VIG A;  4WFN 1;  3H9B A;  1TWA L;  4JV5 H;  2UXD H;  1RDG A;  4A3L L;  3J80 W;  1K1G A;  3S17 L;  2NN6 G;  1S2Z A;  2JA9 A;  1WTJ A;  1BFY A;  4AHZ A;  2BA0 A;  3FAU A;  1ZRP A;  4AYB P;  5GAE c;  4DV6 H;  3K7A L;  2XJT A;  1TWC L;  1XMQ H;  2LF0 A;  1I3Q L;  4V19 6;  4BY1 L;  4A3C L;  1Z2I A;  1Z92 B;  2UUA H;  3KDK A;  1E8J A;  2PSM C;  2PMZ P;  2NVQ L;  4AI3 A;  2FPH X;  3AEV B;  2NVX L;  2K2D A;  8RXN A;  1V8C A;  4DV3 H;  2FMR A;  3U1K A;  4C3H L;  4DR7 H;  3T1H H;  1ZZJ A;  1WCM L;  4AR5 A;  1FKA H;  3GTM L;  4DUY H;  4LF8 H;  3PIP 1;  2J9U B;  2PYA A;  4B8T A;  2X06 A;  5EIN C;  4DV2 H;  1WVN A;  3LWO B;  3JR7 A;  2AYJ A;  5BR8 H;  4AM3 A;  4AIM A;  2VUM L;  1YK5 A;  3HKZ P;  4YWL A;  4JAD A;  2Y0S P;  4LF7 H;  4AHW A;  4POG A;  2M4V A;  4POF A;  1DVB A;  3SB1 A;  2AQC A;  5FLM L;  1DX8 A;  1XRH A;  1R0I A;  1V9N A;  2XJV A;  3J7Y 1;  5FJ8 L;  4JI8 H;  1Y1W L;  2VL6 A;  4DUZ H;  4AHY A;  3S14 L;  1I50 L;  2ZQE A;  5MF6 A;  4X65 H;  4JI4 H;  5EIO C;  4LF9 H;  1I6U A;  1XNR H;  2PY9 A;  1S20 A;  2KKD A;  1F4L A;  4A3K L;  4KHP H;  2Y3M A;  1OWB A;  1RYT A;  1VZI A;  1JYB A;  3I0P A;  5M3F L;  3OET A;  3UOE A;  2JE6 I;  3M3Y L;  4B8C D;  2F4V H;  3KYU A;  3K35 A;  2HVY C;  4DR4 H;  1VCX A;  3P2A A;  2E2H L;  3QD7 X;  2PT7 G;  3GTQ L;  1C09 A;  3GTO L;  3OSS D;  5DT9 A;  4K0K H;  4JI1 H;  1QQT A;  3H97 A;  3GTJ L;  4X6A L;  3VKE A;  1DTJ A;  4C3J L;  3LWV B;  4A3B L;  3CQZ L;  1RDV A;  2H12 A;  5C3E L;  5MGN A;  1VZH A;  2NVY L;  2PVE A;  4B3M H;  2E2I L;  2UU9 H;  4A3M L;  1OWC A;  4LHL A;  1SMW A;  4QIW P;  1SEI A;  5C4X L;  2CTK A;  4U67 1;  5AN9 H;  1FHM A;  3J7Z 1;  1P7P A;  4BA1 I;  3H0G L;  4XXB B;  3KYV A;  1J5K A;  3HOZ L;  3HOW L;  1S03 G;  1X9Z A;  1HR0 H;  5IP9 L;  4DR5 H;  1IRN A;  3S1M L;  2E5L H;  4B3S H;  2JA5 L;  1TUA A;  4B3T H;  4JI2 H;  3RYG A;  4YY3 H;  2JI2 A;  1S30 A;  1MSZ A;  4YHH H;  4A3I L;  1VIH A;  1ODH A;  1X0A A;  5DM6 1;  3LWP B;  3GAB A;  1NXG A;  2CTF A;  3QQC E;  1PFY A;  5M5W L;  1R0G A;  2KN9 A;  3S1Q L;  2ERJ A;  3L7Z C;  1IU6 A;  3LPE B;  1N34 H;  1WE8 A;  3H3V M;  1PFV A;  5RXN A;  1F0X A;  4LF5 H;  1BE7 A;  3NFP I;  2M6O A;  3M4O L;  4E9J A;  2DSX A;  1SMM A;  4NXN H;  4ZN3 B;  3S1N L;  1B2J A;  6RXN A;  1AN7 A;  2XJU A;  2CKC A;  3T1Y H;  4WAN A;  4C3I L;  4Y7N L;  1RYQ A;  4BBR L;  5LMU H;  4K9F A;  3KDG A;  2P2R A;  3J7A K;  4E6Y A;  2O4C A;  3HJW B;  1HNZ H;  1LTL A;  2M4Y A;  2ZM6 H;  2M6P A;  1IW7 D;  1QCV A;  5MLC 3;  1IU5 A;  3IU3 I;  2CTM A;  1N36 H;  3HOU L;  1J5E H;  2R7Z L;  3RF2 A;  4AQY H;  1T9P A;  2CWH A;  1PFU A;  1KHM A;  1LKO A;  2LCQ A;  1BRF A;  1IBL H;  4LFB H;  3V69 A;  4UY8 1;  5IP7 L;  4GS7 D;  1VBI A; 
#chains in the Genus database with same CATH homology
 4X66 H;  3LNL A;  1IBM H;  4TVM A;  4NZT M;  1NXE A;  2HR5 A;  3PKI A;  3MPS A;  4OD6 A;  2V3B B;  1YUX A;  2BE5 D;  4AI2 A;  4DR1 H;  5AI2 A;  5GAH c;  4B3R H;  4GKJ H;  2UUC H;  2V0F A;  2GMG A;  3KYY A;  4X62 H;  4G6B A;  3KYX A;  7RXN A;  1BQ9 A;  2B5I D;  1LKM A;  3WWN B;  1SMU A;  4DR2 H;  2A6H D;  3SS2 A;  1CAD A;  4GKK H;  4RXN A;  4TPU A;  3P8B A;  1R0F A;  1BQ8 A;  3PIO 1;  2JI3 A;  4JAF A;  2VQE H;  4NXM H;  4LHN A;  4OX9 H;  4JI3 H;  2O5J D;  1T9O A;  4DV1 H;  5JVG 1;  4AR4 A;  1RWD A;  5DM7 1;  1R0H A;  1IBK H;  3KYW A;  4ZN1 B;  4LFA H;  1I94 H;  3RZ6 A;  4AR3 A;  2A69 D;  4JAE A;  1FHH A;  3J81 W;  3NCV A;  4DV4 H;  1NNQ A;  2A68 D;  4DV5 H;  4OCH A;  5FLX W;  4JI7 H;  2C6A A;  3OTO H;  2XJQ A;  5AI3 A;  2L0Z A;  1WJV A;  1YK4 A;  1B71 A;  3B08 B;  4ME3 A;  1CAA A;  1T9Q A;  4G08 A;  2UXB H;  3WWL A;  1R0J A;  4DV0 H;  2JI1 A;  5IT9 W;  2Z3Q B;  4JI0 H;  4AR6 A;  3GR5 A;  3VPB E;  4JAG A;  2CR8 A;  4LF6 H;  4LFC H;  3QVD A;  2UUB H;  5A2Q W;  4X64 H;  2XJP A;  2ZIX A;  1QYB A;  4AHX A;  2Z3R B;  2C6B A;  2NYD A;  2RDV A;  2D9I A;  4DR6 H;  2XJS A;  5JVH 1;  1YV1 A;  4NZR M;  2CKA A;  5MFZ A;  1XNQ H;  4JI5 H;  3PZA A;  5LMN H;  5MFP A;  4XGH A;  1S24 A;  4EC5 A;  4DR3 H;  2QL0 A;  1B2O A;  1XMO H;  2UXC H;  1H7V A;  5IY0 A;  1YUZ A;  1N32 H;  5GAD c;  4PDB A;  2VKC A;  4YWM A;  4AI0 A;  2V0E A;  3MSU A;  2ERS A;  3A44 A;  1LKP A;  2A6E D;  5GAG c;  1HNX H;  5IWA H;  4AI1 A;  2PVX A;  1FJG H;  3B0A B;  5K2M E;  3PWF A;  3ZG6 A;  1IRO A;  1B13 A;  4JYA H;  2MS3 A;  4DV7 H;  3RZT A;  3EZJ A;  5LL6 b;  2XJR A;  4LF4 H;  1N33 H;  3JAM W;  4JI6 H;  1RB9 A;  3PKJ A;  5H1S c;  1VZG A;  1HNW H;  2PPT A;  2VQF H;  4WFN 1;  4JV5 H;  2UXD H;  1RDG A;  3J80 W;  1S2Z A;  1BFY A;  4AHZ A;  3FAU A;  1ZRP A;  5GAE c;  4DV6 H;  2XJT A;  1XMQ H;  2LF0 A;  4V19 6;  1Z92 B;  2UUA H;  3KDK A;  1E8J A;  2PSM C;  2FPH X;  4AI3 A;  2K2D A;  8RXN A;  4DV3 H;  4DR7 H;  3T1H H;  4AR5 A;  1FKA H;  4DUY H;  4LF8 H;  3PIP 1;  2J9U B;  2PYA A;  5EIN C;  4DV2 H;  2AYJ A;  5BR8 H;  1YK5 A;  4YWL A;  4JAD A;  4LF7 H;  4AHW A;  4POG A;  2M4V A;  4POF A;  1DVB A;  3SB1 A;  1DX8 A;  1R0I A;  2XJV A;  3J7Y 1;  4JI8 H;  2VL6 A;  4DUZ H;  4AHY A;  2ZQE A;  5MF6 A;  4X65 H;  4JI4 H;  5EIO C;  4LF9 H;  1I6U A;  1XNR H;  2KKD A;  4KHP H;  2Y3M A;  1OWB A;  1RYT A;  1VZI A;  1JYB A;  3OET A;  4B8C D;  2F4V H;  3KYU A;  3K35 A;  4DR4 H;  1VCX A;  3P2A A;  3QD7 X;  2PT7 G;  1C09 A;  5DT9 A;  3OSS D;  4K0K H;  4JI1 H;  1RDV A;  2H12 A;  5MGN A;  1VZH A;  2PVE A;  4B3M H;  2UU9 H;  1OWC A;  4LHL A;  1SMW A;  1SEI A;  4U67 1;  5AN9 H;  1FHM A;  3J7Z 1;  4XXB B;  3KYV A;  1S03 G;  1X9Z A;  1HR0 H;  4DR5 H;  1IRN A;  2E5L H;  4B3S H;  4B3T H;  4JI2 H;  3RYG A;  4YY3 H;  2JI2 A;  1S30 A;  4YHH H;  1ODH A;  5DM6 1;  3GAB A;  1NXG A;  3QQC E;  1R0G A;  2KN9 A;  2ERJ A;  1IU6 A;  3LPE B;  1N34 H;  5RXN A;  1F0X A;  4LF5 H;  1BE7 A;  3NFP I;  2M6O A;  4E9J A;  2DSX A;  1SMM A;  4NXN H;  4ZN3 B;  1B2J A;  6RXN A;  1AN7 A;  2XJU A;  2CKC A;  3T1Y H;  1RYQ A;  5LMU H;  4K9F A;  3KDG A;  3J7A K;  4E6Y A;  2O4C A;  1HNZ H;  1LTL A;  2M4Y A;  2ZM6 H;  2M6P A;  1IW7 D;  1QCV A;  5MLC 3;  1IU5 A;  3IU3 I;  1N36 H;  1J5E H;  3RF2 A;  4AQY H;  1T9P A;  1LKO A;  2LCQ A;  1BRF A;  1IBL H;  4LFB H;  2HHH H;  4UY8 1;  4GS7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...