1ODHA

Structure of the gcm domain bound to dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
157
structure length
157
Chain Sequence
LSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCSRDCSTEEGRKIYLRPAICDKARQKQQRKSCPNCNGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPRPETKLEAEARRAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Gcm Domain-DNA Complex: A DNA-Binding Domain with a Novel Fold and Mode of Target Site Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription factor/dna
molecule keywords MGCM1
total genus 27
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2003-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03615 GCM GCM motif protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.80 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1odhA02
3.30.1370.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 1odhA01
1ODHA
chains in the Genus database with same CATH superfamily
1P7PA 1YUXA 1RWDA 3ZG6A 1T9PA 4C2M1 2UXCH 4JI1H 2M4YA 4DV1H 4AI1A 2Z3RB 3KYYA 2A6ED 5LL6b 4EC5A 5K36G 2HH2A 3T1HH 3HOWL 2Z0SA 2K2DA 1VZIA 4B3SH 1T9OA 5MFZA 3S1ML 1B71A 1ZZKA 4AR3A 2PY9A 4B8CD 2RFKB 1VZHA 1PFWA 2KKDA 1EC6A 4JADA 4JI2H 4IFDG 5H1Sc 1V9NA 4JI3H 3T1YH 1N34H 3JAMW 3B08B 4JAEA 4LHNA 1FHHA 4XGHA 2PT7G 3H3VM 3PKJA 4X65H 3EZJA 2AQCA 5MFPA 3H9CA 4AR5A 2JEAI 4E9JA 2XJQA 2ANRA 5IP7L 5BR8H 2PMZP 1IBLH 2XJTA 4U671 4JVYA 1S30A 2YU9L 1XMQH 1X0AA 4AHZA 3I4NL 3QQCE 1SMWA 4LF8H 4C3IL 3FDJA 4FJSA 3GTML 4QIWP 1X9ZA 1K83L 3H0GL 5C44L 1S24A 3WWLA 4WANA 2GMGA 2VQFH 2BL5A 4AYBP 1TWCL 4XXBB 3HOZL 3M4OL 2M4VA 3GTGL 6RXNA 1WTJA 4AI0A 2LTLA 2M8WA 2NVXL 2DSXA 1R9TL 2ANNA 2KN9A 2EY4E 3H99A 1N32H 2K1HA 5LMUH 1YK5A 2NVYL 3GTPL 2RDVA 3J81W 3I4ML 2JA9A 2NYDA 3IU3I 1I94H 3KDKA 2FMRA 3S2HL 1SMMA 1WJVA 5JVG1 1ZRPA 2ERJA 2G8YA 1ODHA 4JVHA 4JAGA 2A1SA 2BE5D 5M3ML 1Z92B 5IWAH 4LF4H 3GTJL 4AR6A 2X06A 3S1NL 3RZOL 1NXUA 4A3LL 3AEVB 4ZN3B 2VL6A 1XMOH 2ZIXA 4NBQA 2HHHH 3HKZP 5GADc 4A3GL 1LKPA 2VQEH 3KYXA 4K0KH 1MSZA 1DTJA 1BE7A 4WFN1 5M5YL 1WE8A 3UOEA 4DR3H 1PFVA 1TWAL 1YUZA 2PQUA 1RDGA 1F4LA 1K1GA 3P2AA 1TUAA 2E3UA 5IP9L 1R0IA 2HR5A 4OX9H 1IROA 4JI4H 5FLML 3SS2A 5C3EL 5JVH1 3FAUA 2E2HL 3LWOB 3SB1A 3I0PA 3S2DL 3J7Y1 4A3KL 1NXGA 1KHMA 5FJ8L 3GTLL 2D9IA 1HNZH 5C4JL 1WHRA 2UUBH 5DM71 2UUCH 2ERSA 2O5JD 1I6HL 1HNWH 5RXNA 4YWLA 5DT9A 3A44A 2OPVA 1Y1WL 3KYVA 1UG8A 3PZAA 1H7VA 5EIOC 2V0FA 3V69A 4C3JL 1IBKH 2UXBH 1PFYA 2XJVA 3HOXL 4DUZH 3PO3L 5MF6A 3RZTA 1IU6A 3JR7A 3S1QL 2UUAH 2O4CA 3LNLA 1RDVA 4X62H 1OWBA 1TWHL 3J80W 2VKCA 3U1KA 5DM61 4B3MH 3KYUA 1CAAA 4TPUA 4ME3A 3J7Z1 2AYJA 3PL5A 1DX8A 1R0HA 2LF0A 1N36H 1RB9A 2JA6L 2OPUA 3MPSA 2C6AA 1S20A 4B3TH 1XRHA 5LMNH 1S03G 1YV1A 1T9QA 5C4XL 1CADA 4TVMA 4AI2A 2M6PA 4GKKH 1IU5A 1Z2IA 3OSSD 5JEAG 2JA7L 4DR7H 2VUML 3LWRB 4Y7NL 2R93L 2R7ZL 2Y3MA 3FKIL 4AHWA 5GAEc 4BBSL 1NXEA 1XNRH 2ZM6H 2A69D 4Y52L 1VZGA 4DR1H 4DV4H 1RYQA 4JI0H 5C0XG 4PDBA 7RXNA 4JAFA 2C6BA 5EINC 4JI8H 2LCQA 4A3DL 4GS7D 4LFAH 5M3FL 2XJSA 1V8CA 2XJRA 3RZDL 3J7AK 4C3HL 1SFOL 1TWFL 3MQKB 5K2ME 2M6OA 4FJUA 3HOUL 2JA5L 4X64H 3L7ZC 4G08A 1BQ8A 4DV6H 5GAHc 2E2JL 1F0XA 2PVXA 1PQXA 4BXXL 2QNDA 1X4NA 4AR4A 4POGA 1VIHA 3GTKL 2XJPA 1E8JA 4LF7H 1WCML 1DT4A 5AI2A 2BA0A 3PO2L 4B3RH 1N33H 4A3FL 3S1RL 3S15L 4X66H 3OTOH 2JVZA 3HOVL 1QQTA 4V196 3LWPB 1I3QL 2CKAA 4LF9H 1SMUA 2A68D 2LRRA 2PSMC 2H12A 4DR6H 3LWQB 3GTQL 2JE6I 1TWGL 2CKCA 1C09A 3NCVA 3K7AL 2MS3A 2Z3QB 1PZXA 1IW7D 3RZ6A 2P2RA 3VKEA 5IT9W 4LHLA 2AUSB 2AXYA 3HJWB 1R0JA 2JA8L 2APOB 2J9UB 2WB1P 1AN7A 4OO1G 3K35A 1I50L 2R92L 4BY7L 5MGNA 4OD6A 1X4MA 1VCXA 2CPQA 5IYCL 4LIJA 1HNXH 1JYBA 2L0ZA 1ZTGA 1OWCA 3RF2A 2PVEA 4DR2H 4KHPH 4JI6H 2PYAA 4G6BA 5GAGc 3MSUA 2CWHA 4DV0H 4K9FA 3PKIA 2V0EA 2CTEA 3VPBE 2YQRA 3M3YL 3HJYB 4NXMH 2CTFA 4E6YA 1DVBA 1FKAH 5IY0A 1B2OA 3CQZL 3S16L 1IBMH 4A3ML 4LF6H 4GKJH 2JI2A 3GKUA 4JI5H 4AIMA 1FJGH 2NN6G 2CTMA 1S2ZA 2PPTA 4AM3A 4LFBH 4JV5H 3KYWA 4B8TA 4RXNA 3PWFA 2JZXA 1PFUA 1J4WA 2B5ID 3RYGA 4DUYH 1VBIA 3LPEB 1ZZJA 1QCVA 3KDGA 3S14L 4JI7H 4UY81 1HR0H 4H8AA 1NNQA 4JYAH 4DV5H 4DR5H 2ZQEA 1J5KA 3HOYL 1J5EH 4BY1L 3GABA 5M5XL 2CPMA 3LWVB 1YK4A 4A3EL 4AI3A 2CTJA 4BA2I 4BA1I 4ZN1B 4AHYA 4YWMA 3WWNB 3GTOL 2CTKA 2JEBI 5MLC3 4DV7H 5AN9H 3GR5A 4OCHA 1I6UA 1QYBA 5IYDL 2XJUA 4DV3H 4BBRL 4A3JL 3NFPI 5A2QW 2MJHA 5IYBL 4X6AL 1BFYA 2JI3A 1BRFA 2F4VH 3OETA 2E5LH 8RXNA 1BQ9A 4YY3H 3B0AB 2DGRA 4QMFB 3P8BA 4LFCH 1R0GA 1LKMA 1WVNA 2JI1A 3H9BA 4YHHH 4A3IL 2FPHX 1R0FA 5AI3A 2A6HD 2FFMA 4WALA 2UU9H 4A93L 1ZZIA 1B13A 4DR4H 4NXNH 2CWFA 3QVDA 4POFA 2V3BB 4A3BL 4AQYH 1XNQH 2Y0SP 1IRNA 4A3CL 1Y1VL 2LTMA 2M6QA 1LTLA 4AHXA 1VIGA 3S17L 2HH3A 3QD7X 2E2IL 4DV2H 2NVTL 2CTLA 5M5WL 2QL0A 1LKOA 2WAQP 3HAXC 5FLXW 4NZRM 3PIO1 1FHMA 2UXDH 1B2JA 2B63L 4LF5H 3PIP1 2CR8A 1SEIA 2NVQL 1RYTA 4NZTM 3H97A 2HVYC
chains in the Genus database with same CATH topology
1YUXA 1RWDA 3ZG6A 1T9PA 2UXCH 4JI1H 2M4YA 4DV1H 4AI1A 2Z3RB 3KYYA 2A6ED 5LL6b 4EC5A 3T1HH 2K2DA 1VZIA 4B3SH 1T9OA 5MFZA 1B71A 4AR3A 4B8CD 1VZHA 2KKDA 4JADA 4JI2H 5H1Sc 4JI3H 3T1YH 1N34H 3JAMW 3B08B 4JAEA 4LHNA 1FHHA 4XGHA 2PT7G 3PKJA 4X65H 3EZJA 5MFPA 4AR5A 4E9JA 2XJQA 5BR8H 1IBLH 2XJTA 4U671 1S30A 1XMQH 4AHZA 3QQCE 1SMWA 4LF8H 1X9ZA 1S24A 3WWLA 2GMGA 2VQFH 4XXBB 2M4VA 6RXNA 4AI0A 2DSXA 2KN9A 1N32H 5LMUH 1YK5A 2RDVA 3J81W 2NYDA 3IU3I 1I94H 3KDKA 1SMMA 1WJVA 5JVG1 1ZRPA 2ERJA 1ODHA 4JAGA 2BE5D 1Z92B 5IWAH 4LF4H 4AR6A 4ZN3B 2VL6A 1XMOH 2ZIXA 2HHHH 5GADc 1LKPA 2VQEH 3KYXA 4K0KH 1BE7A 4WFN1 4DR3H 1YUZA 1RDGA 3P2AA 1R0IA 2HR5A 4OX9H 1IROA 4JI4H 3SS2A 5JVH1 3FAUA 3SB1A 3J7Y1 1NXGA 2D9IA 1HNZH 2UUBH 5DM71 2UUCH 2ERSA 2O5JD 1HNWH 5RXNA 4YWLA 5DT9A 3A44A 3KYVA 3PZAA 1H7VA 5EIOC 2V0FA 1IBKH 2UXBH 2XJVA 4DUZH 5MF6A 1IU6A 3RZTA 2UUAH 2O4CA 3LNLA 1RDVA 4X62H 1OWBA 3J80W 2VKCA 5DM61 4B3MH 3KYUA 1CAAA 4TPUA 4ME3A 3J7Z1 2AYJA 1DX8A 1R0HA 2LF0A 1N36H 1RB9A 3MPSA 2C6AA 4B3TH 5LMNH 1S03G 1YV1A 1T9QA 1CADA 4TVMA 4AI2A 2M6PA 4GKKH 1IU5A 3OSSD 4DR7H 2Y3MA 4AHWA 5GAEc 1NXEA 1XNRH 2ZM6H 2A69D 1VZGA 4DR1H 4DV4H 1RYQA 4JI0H 4PDBA 7RXNA 4JAFA 2C6BA 5EINC 4JI8H 2LCQA 4GS7D 4LFAH 2XJSA 2XJRA 3J7AK 5K2ME 2M6OA 4X64H 4G08A 1BQ8A 4DV6H 5GAHc 1F0XA 2PVXA 4AR4A 4POGA 2XJPA 1E8JA 4LF7H 5AI2A 1N33H 4B3RH 4X66H 3OTOH 4V196 2CKAA 4LF9H 1SMUA 2A68D 2PSMC 2H12A 4DR6H 2CKCA 1C09A 3NCVA 2MS3A 2Z3QB 1IW7D 3RZ6A 5IT9W 4LHLA 1R0JA 2J9UB 1AN7A 3K35A 5MGNA 4OD6A 1VCXA 1HNXH 1JYBA 2L0ZA 1OWCA 3RF2A 2PVEA 4DR2H 4KHPH 4JI6H 2PYAA 4G6BA 5GAGc 3MSUA 4DV0H 4K9FA 3PKIA 2V0EA 3VPBE 4NXMH 4E6YA 1DVBA 1FKAH 5IY0A 1B2OA 1IBMH 4LF6H 4GKJH 2JI2A 4JI5H 1FJGH 1S2ZA 2PPTA 4LFBH 4JV5H 3KYWA 4RXNA 3PWFA 2B5ID 3RYGA 4DUYH 3LPEB 1QCVA 3KDGA 4JI7H 4UY81 1HR0H 1NNQA 4JYAH 4DV5H 4DR5H 2ZQEA 1J5EH 3GABA 1YK4A 4AI3A 4ZN1B 4AHYA 4YWMA 3WWNB 5MLC3 4DV7H 5AN9H 3GR5A 4OCHA 1I6UA 1QYBA 2XJUA 4DV3H 3NFPI 5A2QW 1BFYA 2JI3A 1BRFA 2F4VH 3OETA 2E5LH 8RXNA 1BQ9A 4YY3H 3B0AB 3P8BA 4LFCH 1R0GA 1LKMA 4YHHH 2JI1A 2FPHX 1R0FA 5AI3A 2A6HD 2UU9H 1B13A 4DR4H 4NXNH 3QVDA 4POFA 2V3BB 4AQYH 1XNQH 1IRNA 1LTLA 4AHXA 3QD7X 4DV2H 2QL0A 1LKOA 5FLXW 4NZRM 3PIO1 1FHMA 2UXDH 1B2JA 4LF5H 3PIP1 2CR8A 1SEIA 1RYTA 4NZTM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ODH A; 
#chains in the Genus database with same CATH topology
 1P7P A;  1YUX A;  1RWD A;  3ZG6 A;  1T9P A;  4C2M 1;  2UXC H;  4JI1 H;  2M4Y A;  4DV1 H;  4AI1 A;  2Z3R B;  3KYY A;  2A6E D;  5LL6 b;  4EC5 A;  5K36 G;  2HH2 A;  3T1H H;  3HOW L;  2Z0S A;  2K2D A;  1VZI A;  4B3S H;  1T9O A;  5MFZ A;  3S1M L;  1B71 A;  1ZZK A;  4AR3 A;  2PY9 A;  4B8C D;  2RFK B;  1VZH A;  1PFW A;  2KKD A;  1EC6 A;  4JAD A;  4JI2 H;  4IFD G;  5H1S c;  1V9N A;  4JI3 H;  3T1Y H;  1N34 H;  3JAM W;  3B08 B;  4JAE A;  4LHN A;  1FHH A;  4XGH A;  2PT7 G;  3H3V M;  3PKJ A;  4X65 H;  3EZJ A;  2AQC A;  5MFP A;  3H9C A;  4AR5 A;  2JEA I;  4E9J A;  2XJQ A;  2ANR A;  5IP7 L;  5BR8 H;  2PMZ P;  1IBL H;  2XJT A;  4U67 1;  4JVY A;  1S30 A;  2YU9 L;  1XMQ H;  1X0A A;  4AHZ A;  3I4N L;  3QQC E;  1SMW A;  4LF8 H;  4C3I L;  3FDJ A;  4FJS A;  3GTM L;  4QIW P;  1X9Z A;  1K83 L;  3H0G L;  5C44 L;  1S24 A;  3WWL A;  4WAN A;  2GMG A;  2VQF H;  2BL5 A;  4AYB P;  1TWC L;  4XXB B;  3HOZ L;  3M4O L;  2M4V A;  3GTG L;  6RXN A;  1WTJ A;  4AI0 A;  2LTL A;  2M8W A;  2NVX L;  2DSX A;  1R9T L;  2ANN A;  2KN9 A;  2EY4 E;  3H99 A;  1N32 H;  2K1H A;  5LMU H;  1YK5 A;  2NVY L;  3GTP L;  2RDV A;  3J81 W;  3I4M L;  2JA9 A;  2NYD A;  3IU3 I;  1I94 H;  3KDK A;  2FMR A;  3S2H L;  1SMM A;  1WJV A;  5JVG 1;  1ZRP A;  2ERJ A;  2G8Y A;  1ODH A;  4JVH A;  4JAG A;  2A1S A;  2BE5 D;  5M3M L;  1Z92 B;  5IWA H;  4LF4 H;  3GTJ L;  4AR6 A;  2X06 A;  3S1N L;  3RZO L;  1NXU A;  4A3L L;  3AEV B;  4ZN3 B;  2VL6 A;  1XMO H;  2ZIX A;  4NBQ A;  2HHH H;  3HKZ P;  5GAD c;  4A3G L;  1LKP A;  2VQE H;  3KYX A;  4K0K H;  1MSZ A;  1DTJ A;  1BE7 A;  4WFN 1;  5M5Y L;  1WE8 A;  3UOE A;  4DR3 H;  1PFV A;  1TWA L;  1YUZ A;  2PQU A;  1RDG A;  1F4L A;  1K1G A;  3P2A A;  1TUA A;  2E3U A;  5IP9 L;  1R0I A;  2HR5 A;  4OX9 H;  1IRO A;  4JI4 H;  5FLM L;  3SS2 A;  5C3E L;  5JVH 1;  3FAU A;  2E2H L;  3LWO B;  3SB1 A;  3I0P A;  3S2D L;  3J7Y 1;  4A3K L;  1NXG A;  1KHM A;  5FJ8 L;  3GTL L;  2D9I A;  1HNZ H;  5C4J L;  1WHR A;  2UUB H;  5DM7 1;  2UUC H;  2ERS A;  2O5J D;  1I6H L;  1HNW H;  5RXN A;  4YWL A;  5DT9 A;  3A44 A;  2OPV A;  1Y1W L;  3KYV A;  1UG8 A;  3PZA A;  1H7V A;  5EIO C;  2V0F A;  3V69 A;  4C3J L;  1IBK H;  2UXB H;  1PFY A;  2XJV A;  3HOX L;  4DUZ H;  3PO3 L;  5MF6 A;  3RZT A;  1IU6 A;  3JR7 A;  3S1Q L;  2UUA H;  2O4C A;  3LNL A;  1RDV A;  4X62 H;  1OWB A;  1TWH L;  3J80 W;  2VKC A;  3U1K A;  5DM6 1;  4B3M H;  3KYU A;  1CAA A;  4TPU A;  4ME3 A;  3J7Z 1;  2AYJ A;  3PL5 A;  1DX8 A;  1R0H A;  2LF0 A;  1N36 H;  1RB9 A;  2JA6 L;  2OPU A;  3MPS A;  2C6A A;  1S20 A;  4B3T H;  1XRH A;  5LMN H;  1S03 G;  1YV1 A;  1T9Q A;  5C4X L;  1CAD A;  4TVM A;  4AI2 A;  2M6P A;  4GKK H;  1IU5 A;  1Z2I A;  3OSS D;  5JEA G;  2JA7 L;  4DR7 H;  2VUM L;  3LWR B;  4Y7N L;  2R93 L;  2R7Z L;  2Y3M A;  3FKI L;  4AHW A;  5GAE c;  4BBS L;  1NXE A;  1XNR H;  2ZM6 H;  2A69 D;  4Y52 L;  1VZG A;  4DR1 H;  4DV4 H;  1RYQ A;  4JI0 H;  5C0X G;  4PDB A;  7RXN A;  4JAF A;  2C6B A;  5EIN C;  4JI8 H;  2LCQ A;  4A3D L;  4GS7 D;  4LFA H;  5M3F L;  2XJS A;  1V8C A;  2XJR A;  3RZD L;  3J7A K;  4C3H L;  1SFO L;  1TWF L;  3MQK B;  5K2M E;  2M6O A;  4FJU A;  3HOU L;  2JA5 L;  4X64 H;  3L7Z C;  4G08 A;  1BQ8 A;  4DV6 H;  5GAH c;  2E2J L;  1F0X A;  2PVX A;  1PQX A;  4BXX L;  2QND A;  1X4N A;  4AR4 A;  4POG A;  1VIH A;  3GTK L;  2XJP A;  1E8J A;  4LF7 H;  1WCM L;  1DT4 A;  5AI2 A;  2BA0 A;  3PO2 L;  4B3R H;  1N33 H;  4A3F L;  3S1R L;  3S15 L;  4X66 H;  3OTO H;  2JVZ A;  3HOV L;  1QQT A;  4V19 6;  3LWP B;  1I3Q L;  2CKA A;  4LF9 H;  1SMU A;  2A68 D;  2LRR A;  2PSM C;  2H12 A;  4DR6 H;  3LWQ B;  3GTQ L;  2JE6 I;  1TWG L;  2CKC A;  1C09 A;  3NCV A;  3K7A L;  2MS3 A;  2Z3Q B;  1PZX A;  1IW7 D;  3RZ6 A;  2P2R A;  3VKE A;  5IT9 W;  4LHL A;  2AUS B;  2AXY A;  3HJW B;  1R0J A;  2JA8 L;  2APO B;  2J9U B;  2WB1 P;  1AN7 A;  4OO1 G;  3K35 A;  1I50 L;  2R92 L;  4BY7 L;  5MGN A;  4OD6 A;  1X4M A;  1VCX A;  2CPQ A;  5IYC L;  4LIJ A;  1HNX H;  1JYB A;  2L0Z A;  1ZTG A;  1OWC A;  3RF2 A;  2PVE A;  4DR2 H;  4KHP H;  4JI6 H;  2PYA A;  4G6B A;  5GAG c;  3MSU A;  2CWH A;  4DV0 H;  4K9F A;  3PKI A;  2V0E A;  2CTE A;  3VPB E;  2YQR A;  3M3Y L;  3HJY B;  4NXM H;  2CTF A;  4E6Y A;  1DVB A;  1FKA H;  5IY0 A;  1B2O A;  3CQZ L;  3S16 L;  1IBM H;  4A3M L;  4LF6 H;  4GKJ H;  2JI2 A;  3GKU A;  4JI5 H;  4AIM A;  1FJG H;  2NN6 G;  2CTM A;  1S2Z A;  2PPT A;  4AM3 A;  4LFB H;  4JV5 H;  3KYW A;  4B8T A;  4RXN A;  3PWF A;  2JZX A;  1PFU A;  1J4W A;  2B5I D;  3RYG A;  4DUY H;  1VBI A;  3LPE B;  1ZZJ A;  1QCV A;  3KDG A;  3S14 L;  4JI7 H;  4UY8 1;  1HR0 H;  4H8A A;  1NNQ A;  4JYA H;  4DV5 H;  4DR5 H;  2ZQE A;  1J5K A;  3HOY L;  1J5E H;  4BY1 L;  3GAB A;  5M5X L;  2CPM A;  3LWV B;  1YK4 A;  4A3E L;  4AI3 A;  2CTJ A;  4BA2 I;  4BA1 I;  4ZN1 B;  4AHY A;  4YWM A;  3WWN B;  3GTO L;  2CTK A;  2JEB I;  5MLC 3;  4DV7 H;  5AN9 H;  3GR5 A;  4OCH A;  1I6U A;  1QYB A;  5IYD L;  2XJU A;  4DV3 H;  4BBR L;  4A3J L;  3NFP I;  5A2Q W;  2MJH A;  5IYB L;  4X6A L;  1BFY A;  2JI3 A;  1BRF A;  2F4V H;  3OET A;  2E5L H;  8RXN A;  1BQ9 A;  4YY3 H;  3B0A B;  2DGR A;  4QMF B;  3P8B A;  4LFC H;  1R0G A;  1LKM A;  1WVN A;  2JI1 A;  3H9B A;  4YHH H;  4A3I L;  2FPH X;  1R0F A;  5AI3 A;  2A6H D;  2FFM A;  4WAL A;  2UU9 H;  4A93 L;  1ZZI A;  1B13 A;  4DR4 H;  4NXN H;  2CWF A;  3QVD A;  4POF A;  2V3B B;  4A3B L;  4AQY H;  1XNQ H;  2Y0S P;  1IRN A;  4A3C L;  1Y1V L;  2LTM A;  2M6Q A;  1LTL A;  4AHX A;  1VIG A;  3S17 L;  2HH3 A;  3QD7 X;  2E2I L;  4DV2 H;  2NVT L;  2CTL A;  5M5W L;  2QL0 A;  1LKO A;  2WAQ P;  3HAX C;  5FLX W;  4NZR M;  3PIO 1;  1FHM A;  2UXD H;  1B2J A;  2B63 L;  4LF5 H;  3PIP 1;  2CR8 A;  1SEI A;  2NVQ L;  1RYT A;  4NZT M;  3H97 A;  2HVY C; 
#chains in the Genus database with same CATH homology
 1YUX A;  1RWD A;  3ZG6 A;  1T9P A;  2UXC H;  4JI1 H;  2M4Y A;  4DV1 H;  4AI1 A;  2Z3R B;  3KYY A;  2A6E D;  5LL6 b;  4EC5 A;  3T1H H;  2K2D A;  1VZI A;  4B3S H;  1T9O A;  5MFZ A;  1B71 A;  4AR3 A;  4B8C D;  1VZH A;  2KKD A;  4JAD A;  4JI2 H;  5H1S c;  4JI3 H;  3T1Y H;  1N34 H;  3JAM W;  3B08 B;  4JAE A;  4LHN A;  1FHH A;  4XGH A;  2PT7 G;  3PKJ A;  4X65 H;  3EZJ A;  5MFP A;  4AR5 A;  4E9J A;  2XJQ A;  5BR8 H;  1IBL H;  2XJT A;  4U67 1;  1S30 A;  1XMQ H;  4AHZ A;  3QQC E;  1SMW A;  4LF8 H;  1X9Z A;  1S24 A;  3WWL A;  2GMG A;  2VQF H;  4XXB B;  2M4V A;  6RXN A;  4AI0 A;  2DSX A;  2KN9 A;  1N32 H;  5LMU H;  1YK5 A;  2RDV A;  3J81 W;  2NYD A;  3IU3 I;  1I94 H;  3KDK A;  1SMM A;  1WJV A;  5JVG 1;  1ZRP A;  2ERJ A;  1ODH A;  4JAG A;  2BE5 D;  1Z92 B;  5IWA H;  4LF4 H;  4AR6 A;  4ZN3 B;  2VL6 A;  1XMO H;  2ZIX A;  2HHH H;  5GAD c;  1LKP A;  2VQE H;  3KYX A;  4K0K H;  1BE7 A;  4WFN 1;  4DR3 H;  1YUZ A;  1RDG A;  3P2A A;  1R0I A;  2HR5 A;  4OX9 H;  1IRO A;  4JI4 H;  3SS2 A;  5JVH 1;  3FAU A;  3SB1 A;  3J7Y 1;  1NXG A;  2D9I A;  1HNZ H;  2UUB H;  5DM7 1;  2UUC H;  2ERS A;  2O5J D;  1HNW H;  5RXN A;  4YWL A;  5DT9 A;  3A44 A;  3KYV A;  3PZA A;  1H7V A;  5EIO C;  2V0F A;  1IBK H;  2UXB H;  2XJV A;  4DUZ H;  5MF6 A;  1IU6 A;  3RZT A;  2UUA H;  2O4C A;  3LNL A;  1RDV A;  4X62 H;  1OWB A;  3J80 W;  2VKC A;  5DM6 1;  4B3M H;  3KYU A;  1CAA A;  4TPU A;  4ME3 A;  3J7Z 1;  2AYJ A;  1DX8 A;  1R0H A;  2LF0 A;  1N36 H;  1RB9 A;  3MPS A;  2C6A A;  4B3T H;  5LMN H;  1S03 G;  1YV1 A;  1T9Q A;  1CAD A;  4TVM A;  4AI2 A;  2M6P A;  4GKK H;  1IU5 A;  3OSS D;  4DR7 H;  2Y3M A;  4AHW A;  5GAE c;  1NXE A;  1XNR H;  2ZM6 H;  2A69 D;  1VZG A;  4DR1 H;  4DV4 H;  1RYQ A;  4JI0 H;  4PDB A;  7RXN A;  4JAF A;  2C6B A;  5EIN C;  4JI8 H;  2LCQ A;  4GS7 D;  4LFA H;  2XJS A;  2XJR A;  3J7A K;  5K2M E;  2M6O A;  4X64 H;  4G08 A;  1BQ8 A;  4DV6 H;  5GAH c;  1F0X A;  2PVX A;  4AR4 A;  4POG A;  2XJP A;  1E8J A;  4LF7 H;  5AI2 A;  1N33 H;  4B3R H;  4X66 H;  3OTO H;  4V19 6;  2CKA A;  4LF9 H;  1SMU A;  2A68 D;  2PSM C;  2H12 A;  4DR6 H;  2CKC A;  1C09 A;  3NCV A;  2MS3 A;  2Z3Q B;  1IW7 D;  3RZ6 A;  5IT9 W;  4LHL A;  1R0J A;  2J9U B;  1AN7 A;  3K35 A;  5MGN A;  4OD6 A;  1VCX A;  1HNX H;  1JYB A;  2L0Z A;  1OWC A;  3RF2 A;  2PVE A;  4DR2 H;  4KHP H;  4JI6 H;  2PYA A;  4G6B A;  5GAG c;  3MSU A;  4DV0 H;  4K9F A;  3PKI A;  2V0E A;  3VPB E;  4NXM H;  4E6Y A;  1DVB A;  1FKA H;  5IY0 A;  1B2O A;  1IBM H;  4LF6 H;  4GKJ H;  2JI2 A;  4JI5 H;  1FJG H;  1S2Z A;  2PPT A;  4LFB H;  4JV5 H;  3KYW A;  4RXN A;  3PWF A;  2B5I D;  3RYG A;  4DUY H;  3LPE B;  1QCV A;  3KDG A;  4JI7 H;  4UY8 1;  1HR0 H;  1NNQ A;  4JYA H;  4DV5 H;  4DR5 H;  2ZQE A;  1J5E H;  3GAB A;  1YK4 A;  4AI3 A;  4ZN1 B;  4AHY A;  4YWM A;  3WWN B;  5MLC 3;  4DV7 H;  5AN9 H;  3GR5 A;  4OCH A;  1I6U A;  1QYB A;  2XJU A;  4DV3 H;  3NFP I;  5A2Q W;  1BFY A;  2JI3 A;  1BRF A;  2F4V H;  3OET A;  2E5L H;  8RXN A;  1BQ9 A;  4YY3 H;  3B0A B;  3P8B A;  4LFC H;  1R0G A;  1LKM A;  4YHH H;  2JI1 A;  2FPH X;  1R0F A;  5AI3 A;  2A6H D;  2UU9 H;  1B13 A;  4DR4 H;  4NXN H;  3QVD A;  4POF A;  2V3B B;  4AQY H;  1XNQ H;  1IRN A;  1LTL A;  4AHX A;  3QD7 X;  4DV2 H;  2QL0 A;  1LKO A;  5FLX W;  4NZR M;  3PIO 1;  1FHM A;  2UXD H;  1B2J A;  4LF5 H;  3PIP 1;  2CR8 A;  1SEI A;  1RYT A;  4NZT M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...