1ODHA

Structure of the gcm domain bound to dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
157
structure length
157
Chain Sequence
LSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCSRDCSTEEGRKIYLRPAICDKARQKQQRKSCPNCNGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPRPETKLEAEARRAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription factor/dna
molecule keywords MGCM1
publication title Crystal Structure of the Gcm Domain-DNA Complex: A DNA-Binding Domain with a Novel Fold and Mode of Target Site Recognition
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2003-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03615 GCM GCM motif protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.80 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1odhA02
3.30.1370.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 1odhA01
1ODHA
chains in the Genus database with same CATH superfamily
2KKDA 4JI3H 3MSUA 2J9UB 5RXNA 2M4YA 5K2ME 3RZTA 1N33H 1VCXA 2JEBI 1R0FA 4A3ML 1SMUA 3L7ZC 3U1KA 1PFUA 3LWVB 1VZIA 2UUCH 1RB9A 3S14L 1WHRA 2K2DA 3I4NL 3S1NL 2ZQEA 3H99A 2RDVA 3VPBE 3CQZL 1FHMA 4QMFB 4NBQA 1N32H 1R9TL 2JA7L 3I0PA 5LMUH 4LFBH 4G08A 1S03G 2E2HL 3SS2A 1PZXA 4AR3A 3S15L 2B5ID 3M4OL 4OCHA 3S1RL 4FJSA 2NVQL 2JZXA 4X62H 1XMQH 3FDJA 3HOYL 3PL5A 4YY3H 3J80W 5M5XL 1LKPA 3RF2A 4C2M1 4AHZA 1RDVA 5DM61 2CPQA 2V3BB 2A6ED 2D9IA 3J7Z1 1YK5A 1ZZIA 3B08B 4KHPH 3PKJA 3NCVA 3VKEA 2K1HA 2XJPA 3S16L 4AR6A 4A3JL 5JVH1 1IU5A 2HH3A 4V196 3PO3L 2PVEA 1TWFL 4JVHA 4AR4A 2PPTA 4QIWP 5FLXW 3JAMW 5H1Sc 1MSZA 1PFYA 3S2DL 2CWFA 4JI8H 2OPVA 2A1SA 2HH2A 4AI2A 2RFKB 4DUYH 2KN9A 2DSXA 4JI2H 3P8BA 3QQCE 2G8YA 4WALA 3WWNB 3FKIL 1NXEA 2CTMA 1TWHL 1XNRH 1ZRPA 5EIOC 2VQEH 4DV7H 1K1GA 1TWAL 2M8WA 1R0JA 4BY1L 2M6QA 2PT7G 3LWQB 2JI1A 1WCML 1BE7A 2PYAA 4B3TH 1VIGA 2EY4E 2XJRA 2X06A 3AEVB 1YUZA 3HOZL 3ZG6A 2BL5A 2CTEA 4XXBB 5C4JL 2V0EA 5AI2A 4DV5H 1PFWA 4C3HL 4X6AL 1RYTA 4AHXA 1B2OA 4UY81 1LKOA 1S24A 2JI2A 1FHHA 5IYBL 2E2JL 4AI1A 4E6YA 2CKCA 4AI3A 2HVYC 3S2HL 3LNLA 2ANRA 1ZZKA 3M3YL 1K83L 1X4NA 4POGA 1NXUA 3RZDL 4A3KL 4LF6H 2Z0SA 5EINC 4GKKH 2JE6I 4BY7L 2LF0A 4AHWA 5MFZA 1DVBA 4LF4H 1DT4A 2V0FA 2JA9A 3HOUL 4JI0H 4JVYA 4LIJA 5M3FL 2QL0A 2C6BA 4B8CD 4A93L 4BA2I 2JI3A 3MQKB 3RZ6A 4BXXL 2C6AA 4DV2H 4LHNA 2APOB 2XJUA 3PIP1 1XNQH 4JAEA 3GTLL 4JYAH 4Y7NL 4LF5H 2CR8A 4JV5H 1C09A 1BQ8A 1PFVA 2MS3A 2BA0A 2L0ZA 4ZN3B 5IYCL 5IT9W 4A3BL 2AQCA 2QNDA 3UOEA 1Z2IA 2AYJA 2ERJA 5MFPA 2E3UA 5MGNA 1XRHA 1S2ZA 2HR5A 4RXNA 4OD6A 2PY9A 1WTJA 2NVTL 2ZIXA 1YUXA 1QCVA 5GADc 1PQXA 3H97A 4TVMA 4AHYA 4AQYH 1JYBA 1IU6A 1F4LA 4JAFA 3GTKL 1X4MA 3PO2L 4DR1H 2F4VH 3EZJA 1RYQA 5C4XL 1NXGA 4B8TA 1CAAA 2JA8L 2GMGA 1QYBA 1SEIA 2E5LH 2Y0SP 4AYBP 1R0HA 4A3EL 3H9CA 3GTJL 4AIMA 1YK4A 3GTGL 1J4WA 1VZGA 5GAGc 4X64H 2P2RA 3IU3I 4WFN1 1NNQA 2NYDA 1I6UA 4LF9H 1HNXH 2R7ZL 4EC5A 4DR4H 3HJYB 2CTKA 3J7Y1 1N36H 4X66H 4LF8H 2VL6A 2LCQA 4AI0A 5AN9H 2CWHA 3GABA 3NFPI 1T9QA 1WE8A 4JI1H 1WJVA 2AUSB 4OO1G 3GR5A 3HJWB 6RXNA 4DV3H 2AXYA 4B3SH 2NN6G 2R93L 3FAUA 2HHHH 3RZOL 1OWBA 4X65H 1XMOH 2PQUA 3KDKA 1V9NA 3OETA 7RXNA 4DV0H 4YHHH 4JI4H 2OPUA 2LTLA 4DR6H 4C3JL 1S30A 3HOWL 2YQRA 2Z3QB 3OSSD 1KHMA 3LWPB 4A3DL 4A3FL 4NZTM 5M5WL 2FPHX 1Y1VL 4JI7H 5M3ML 3J81W 3A44A 3H0GL 4OX9H 4ME3A 2R92L 5LMNH 1TUAA 4B3RH 4ZN1B 2LTMA 1ZZJA 1QQTA 4BA1I 2Y3MA 4A3GL 4BBSL 1TWCL 3PZAA 2XJQA 1IRNA 2JA5L 5BR8H 1J5KA 5GAHc 3WWLA 1S20A 4DV1H 3KYYA 4A3LL 2CPMA 3J7AK 1AN7A 5M5YL 2E2IL 1VZHA 1IW7D 2CTFA 4YWLA 4AR5A 1H7VA 1I94H 2UXBH 2A69D 1DTJA 2A68D 3PKIA 1I6HL 3OTOH 1FKAH 2M6PA 5C0XG 5MLC3 4B3MH 5AI3A 1VBIA 3B0AB 2VUML 2NVYL 1T9PA 4WANA 2B63L 4GKJH 1LKMA 3HOXL 5IP9L 1SFOL 3SB1A 2MJHA 3KYWA 3QVDA 1Z92B 1IBLH 2PVXA 8RXNA 2DGRA 2UU9H 4GS7D 4BBRL 4H8AA 1Y1WL 2CKAA 3K35A 2BE5D 1EC6A 2H12A 1X0AA 3HOVL 3LWOB 2UUBH 4JI6H 4LFCH 1DX8A 5DM71 4DR5H 4K0KH 2O4CA 2UXCH 4JAGA 2YU9L 3PIO1 5MF6A 1UG8A 3V69A 4E9JA 4POFA 2CTJA 3KDGA 4AM3A 3S17L 2FFMA 4NXMH 4YWMA 1HR0H 2JA6L 3KYUA 3GTPL 2CTLA 5K36G 1IROA 1CADA 4LF7H 4DUZH 2UUAH 1ZTGA 1HNWH 4DV4H 1B71A 2LRRA 3GTML 1RWDA 1VIHA 1I50L 2VQFH 3JR7A 3MPSA 3PWFA 2JVZA 5C44L 2XJVA 2M4VA 4LHLA 1OWCA 4LFAH 1SMMA 5A2QW 1WVNA 2FMRA 5FJ8L 4A3CL 3LPEB 3GTQL 1YV1A 1B2JA 5JEAG 4TPUA 4NXNH 4XGHA 2Z3RB 3GTOL 1TWGL 1P7PA 3LWRB 3KYVA 5IP7L 1HNZH 2M6OA 4NZRM 1FJGH 3I4ML 5LL6b 4DV6H 2ERSA 1IBKH 1ODHA 4C3IL 4DR7H 3T1YH 2O5JD 2A6HD 5IY0A 3H3VM 4JADA 4JI5H 2PSMC 3H9BA 1F0XA 2XJSA 2NVXL 3QD7X 4K9FA 2WB1P 3S1QL 1V8CA 1R0GA 5GAEc 1LTLA 3HAXC 3P2AA 5DT9A 1I3QL 2ANNA 1BRFA 3RYGA 5FLML 3K7AL 3S1ML 5IYDL 1J5EH 2XJTA 4FJUA 3T1HH 1X9ZA 1B13A 1R0IA 1N34H 4DR2H 4A3IL 1BQ9A 1IBMH 2WAQP 2UXDH 4G6BA 2ZM6H 1SMWA 4DR3H 4IFDG 1RDGA 3HKZP 4U671 4Y52L 1BFYA 3GKUA 5JVG1 1E8JA 1T9OA 2PMZP 2VKCA 2JEAI 5IWAH 4PDBA 5C3EL 3KYXA
chains in the Genus database with same CATH topology
2KKDA 4JI3H 3MSUA 2J9UB 5RXNA 2M4YA 5K2ME 3RZTA 1N33H 1VCXA 1R0FA 1SMUA 1VZIA 2UUCH 1RB9A 2K2DA 2ZQEA 2RDVA 3VPBE 1FHMA 1N32H 5LMUH 4LFBH 4G08A 1S03G 3SS2A 4AR3A 2B5ID 4OCHA 4X62H 1XMQH 4YY3H 3J80W 1LKPA 3RF2A 4AHZA 1RDVA 5DM61 2V3BB 2A6ED 2D9IA 3J7Z1 1YK5A 3B08B 4KHPH 3PKJA 3NCVA 2XJPA 4AR6A 5JVH1 1IU5A 4V196 2PVEA 4AR4A 2PPTA 5FLXW 3JAMW 5H1Sc 4JI8H 4AI2A 4DUYH 2KN9A 2DSXA 4JI2H 3P8BA 3QQCE 3WWNB 1NXEA 1XNRH 1ZRPA 5EIOC 2VQEH 4DV7H 1R0JA 2PT7G 2JI1A 1BE7A 2PYAA 4B3TH 2XJRA 1YUZA 3ZG6A 4XXBB 2V0EA 5AI2A 4DV5H 1RYTA 4AHXA 1B2OA 4UY81 1LKOA 1S24A 2JI2A 1FHHA 4AI1A 4E6YA 2CKCA 4AI3A 3LNLA 4POGA 4LF6H 5EINC 4GKKH 2LF0A 4AHWA 5MFZA 1DVBA 4LF4H 2V0FA 4JI0H 2QL0A 2C6BA 4B8CD 2JI3A 3RZ6A 2C6AA 4DV2H 4LHNA 2XJUA 3PIP1 1XNQH 4JAEA 4JYAH 4LF5H 2CR8A 4JV5H 1C09A 1BQ8A 2MS3A 2L0ZA 4ZN3B 5IT9W 2AYJA 2ERJA 5MFPA 5MGNA 1S2ZA 2HR5A 4RXNA 4OD6A 2ZIXA 1YUXA 1QCVA 5GADc 4TVMA 4AHYA 4AQYH 1JYBA 1IU6A 4JAFA 4DR1H 2F4VH 3EZJA 1RYQA 1NXGA 1CAAA 2GMGA 1QYBA 1SEIA 2E5LH 1R0HA 1YK4A 1VZGA 5GAGc 4X64H 3IU3I 4WFN1 1NNQA 2NYDA 1I6UA 4LF9H 1HNXH 4EC5A 4DR4H 3J7Y1 1N36H 4X66H 4LF8H 2VL6A 2LCQA 4AI0A 5AN9H 3GABA 3NFPI 1T9QA 4JI1H 1WJVA 3GR5A 6RXNA 4DV3H 4B3SH 2HHHH 3FAUA 1OWBA 4X65H 1XMOH 3KDKA 3OETA 7RXNA 4DV0H 4YHHH 4JI4H 4DR6H 1S30A 2Z3QB 3OSSD 4NZTM 4JI7H 2FPHX 3J81W 3A44A 4OX9H 4ME3A 5LMNH 4B3RH 4ZN1B 2Y3MA 3PZAA 2XJQA 1IRNA 5BR8H 5GAHc 3WWLA 4DV1H 3KYYA 3J7AK 1AN7A 1VZHA 1IW7D 4YWLA 4AR5A 1H7VA 1I94H 2UXBH 2A69D 2A68D 3PKIA 3OTOH 1FKAH 2M6PA 5MLC3 4B3MH 5AI3A 3B0AB 1T9PA 4GKJH 1LKMA 3SB1A 3KYWA 3QVDA 1Z92B 1IBLH 2PVXA 8RXNA 2UU9H 4GS7D 2CKAA 3K35A 2BE5D 2H12A 2UUBH 4JI6H 4LFCH 1DX8A 5DM71 4DR5H 4K0KH 2O4CA 2UXCH 4JAGA 3PIO1 5MF6A 4E9JA 4POFA 3KDGA 4NXMH 4YWMA 1HR0H 3KYUA 1IROA 1CADA 4LF7H 4DUZH 2UUAH 1HNWH 4DV4H 1B71A 1RWDA 2VQFH 3MPSA 3PWFA 2XJVA 2M4VA 4LHLA 1OWCA 4LFAH 1SMMA 5A2QW 3LPEB 1YV1A 1B2JA 4TPUA 4NXNH 4XGHA 2Z3RB 3KYVA 1HNZH 2M6OA 4NZRM 1FJGH 5LL6b 4DV6H 2ERSA 1IBKH 1ODHA 4DR7H 3T1YH 2O5JD 2A6HD 5IY0A 4JADA 4JI5H 2PSMC 1F0XA 2XJSA 3QD7X 4K9FA 1R0GA 5GAEc 1LTLA 5DT9A 3P2AA 1BRFA 3RYGA 1J5EH 2XJTA 3T1HH 1X9ZA 1B13A 1R0IA 1N34H 4DR2H 1BQ9A 1IBMH 2UXDH 4G6BA 2ZM6H 1SMWA 4DR3H 1RDGA 4U671 1BFYA 5JVG1 1E8JA 1T9OA 2VKCA 5IWAH 4PDBA 3KYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ODH A; 
#chains in the Genus database with same CATH topology
 2KKD A;  4JI3 H;  3MSU A;  2J9U B;  5RXN A;  2M4Y A;  5K2M E;  3RZT A;  1N33 H;  1VCX A;  2JEB I;  1R0F A;  4A3M L;  1SMU A;  3L7Z C;  3U1K A;  1PFU A;  3LWV B;  1VZI A;  2UUC H;  1RB9 A;  3S14 L;  1WHR A;  2K2D A;  3I4N L;  3S1N L;  2ZQE A;  3H99 A;  2RDV A;  3VPB E;  3CQZ L;  1FHM A;  4QMF B;  4NBQ A;  1N32 H;  1R9T L;  2JA7 L;  3I0P A;  5LMU H;  4LFB H;  4G08 A;  1S03 G;  2E2H L;  3SS2 A;  1PZX A;  4AR3 A;  3S15 L;  2B5I D;  3M4O L;  4OCH A;  3S1R L;  4FJS A;  2NVQ L;  2JZX A;  4X62 H;  1XMQ H;  3FDJ A;  3HOY L;  3PL5 A;  4YY3 H;  3J80 W;  5M5X L;  1LKP A;  3RF2 A;  4C2M 1;  4AHZ A;  1RDV A;  5DM6 1;  2CPQ A;  2V3B B;  2A6E D;  2D9I A;  3J7Z 1;  1YK5 A;  1ZZI A;  3B08 B;  4KHP H;  3PKJ A;  3NCV A;  3VKE A;  2K1H A;  2XJP A;  3S16 L;  4AR6 A;  4A3J L;  5JVH 1;  1IU5 A;  2HH3 A;  4V19 6;  3PO3 L;  2PVE A;  1TWF L;  4JVH A;  4AR4 A;  2PPT A;  4QIW P;  5FLX W;  3JAM W;  5H1S c;  1MSZ A;  1PFY A;  3S2D L;  2CWF A;  4JI8 H;  2OPV A;  2A1S A;  2HH2 A;  4AI2 A;  2RFK B;  4DUY H;  2KN9 A;  2DSX A;  4JI2 H;  3P8B A;  3QQC E;  2G8Y A;  4WAL A;  3WWN B;  3FKI L;  1NXE A;  2CTM A;  1TWH L;  1XNR H;  1ZRP A;  5EIO C;  2VQE H;  4DV7 H;  1K1G A;  1TWA L;  2M8W A;  1R0J A;  4BY1 L;  2M6Q A;  2PT7 G;  3LWQ B;  2JI1 A;  1WCM L;  1BE7 A;  2PYA A;  4B3T H;  1VIG A;  2EY4 E;  2XJR A;  2X06 A;  3AEV B;  1YUZ A;  3HOZ L;  3ZG6 A;  2BL5 A;  2CTE A;  4XXB B;  5C4J L;  2V0E A;  5AI2 A;  4DV5 H;  1PFW A;  4C3H L;  4X6A L;  1RYT A;  4AHX A;  1B2O A;  4UY8 1;  1LKO A;  1S24 A;  2JI2 A;  1FHH A;  5IYB L;  2E2J L;  4AI1 A;  4E6Y A;  2CKC A;  4AI3 A;  2HVY C;  3S2H L;  3LNL A;  2ANR A;  1ZZK A;  3M3Y L;  1K83 L;  1X4N A;  4POG A;  1NXU A;  3RZD L;  4A3K L;  4LF6 H;  2Z0S A;  5EIN C;  4GKK H;  2JE6 I;  4BY7 L;  2LF0 A;  4AHW A;  5MFZ A;  1DVB A;  4LF4 H;  1DT4 A;  2V0F A;  2JA9 A;  3HOU L;  4JI0 H;  4JVY A;  4LIJ A;  5M3F L;  2QL0 A;  2C6B A;  4B8C D;  4A93 L;  4BA2 I;  2JI3 A;  3MQK B;  3RZ6 A;  4BXX L;  2C6A A;  4DV2 H;  4LHN A;  2APO B;  2XJU A;  3PIP 1;  1XNQ H;  4JAE A;  3GTL L;  4JYA H;  4Y7N L;  4LF5 H;  2CR8 A;  4JV5 H;  1C09 A;  1BQ8 A;  1PFV A;  2MS3 A;  2BA0 A;  2L0Z A;  4ZN3 B;  5IYC L;  5IT9 W;  4A3B L;  2AQC A;  2QND A;  3UOE A;  1Z2I A;  2AYJ A;  2ERJ A;  5MFP A;  2E3U A;  5MGN A;  1XRH A;  1S2Z A;  2HR5 A;  4RXN A;  4OD6 A;  2PY9 A;  1WTJ A;  2NVT L;  2ZIX A;  1YUX A;  1QCV A;  5GAD c;  1PQX A;  3H97 A;  4TVM A;  4AHY A;  4AQY H;  1JYB A;  1IU6 A;  1F4L A;  4JAF A;  3GTK L;  1X4M A;  3PO2 L;  4DR1 H;  2F4V H;  3EZJ A;  1RYQ A;  5C4X L;  1NXG A;  4B8T A;  1CAA A;  2JA8 L;  2GMG A;  1QYB A;  1SEI A;  2E5L H;  2Y0S P;  4AYB P;  1R0H A;  4A3E L;  3H9C A;  3GTJ L;  4AIM A;  1YK4 A;  3GTG L;  1J4W A;  1VZG A;  5GAG c;  4X64 H;  2P2R A;  3IU3 I;  4WFN 1;  1NNQ A;  2NYD A;  1I6U A;  4LF9 H;  1HNX H;  2R7Z L;  4EC5 A;  4DR4 H;  3HJY B;  2CTK A;  3J7Y 1;  1N36 H;  4X66 H;  4LF8 H;  2VL6 A;  2LCQ A;  4AI0 A;  5AN9 H;  2CWH A;  3GAB A;  3NFP I;  1T9Q A;  1WE8 A;  4JI1 H;  1WJV A;  2AUS B;  4OO1 G;  3GR5 A;  3HJW B;  6RXN A;  4DV3 H;  2AXY A;  4B3S H;  2NN6 G;  2R93 L;  3FAU A;  2HHH H;  3RZO L;  1OWB A;  4X65 H;  1XMO H;  2PQU A;  3KDK A;  1V9N A;  3OET A;  7RXN A;  4DV0 H;  4YHH H;  4JI4 H;  2OPU A;  2LTL A;  4DR6 H;  4C3J L;  1S30 A;  3HOW L;  2YQR A;  2Z3Q B;  3OSS D;  1KHM A;  3LWP B;  4A3D L;  4A3F L;  4NZT M;  5M5W L;  2FPH X;  1Y1V L;  4JI7 H;  5M3M L;  3J81 W;  3A44 A;  3H0G L;  4OX9 H;  4ME3 A;  2R92 L;  5LMN H;  1TUA A;  4B3R H;  4ZN1 B;  2LTM A;  1ZZJ A;  1QQT A;  4BA1 I;  2Y3M A;  4A3G L;  4BBS L;  1TWC L;  3PZA A;  2XJQ A;  1IRN A;  2JA5 L;  5BR8 H;  1J5K A;  5GAH c;  3WWL A;  1S20 A;  4DV1 H;  3KYY A;  4A3L L;  2CPM A;  3J7A K;  1AN7 A;  5M5Y L;  2E2I L;  1VZH A;  1IW7 D;  2CTF A;  4YWL A;  4AR5 A;  1H7V A;  1I94 H;  2UXB H;  2A69 D;  1DTJ A;  2A68 D;  3PKI A;  1I6H L;  3OTO H;  1FKA H;  2M6P A;  5C0X G;  5MLC 3;  4B3M H;  5AI3 A;  1VBI A;  3B0A B;  2VUM L;  2NVY L;  1T9P A;  4WAN A;  2B63 L;  4GKJ H;  1LKM A;  3HOX L;  5IP9 L;  1SFO L;  3SB1 A;  2MJH A;  3KYW A;  3QVD A;  1Z92 B;  1IBL H;  2PVX A;  8RXN A;  2DGR A;  2UU9 H;  4GS7 D;  4BBR L;  4H8A A;  1Y1W L;  2CKA A;  3K35 A;  2BE5 D;  1EC6 A;  2H12 A;  1X0A A;  3HOV L;  3LWO B;  2UUB H;  4JI6 H;  4LFC H;  1DX8 A;  5DM7 1;  4DR5 H;  4K0K H;  2O4C A;  2UXC H;  4JAG A;  2YU9 L;  3PIO 1;  5MF6 A;  1UG8 A;  3V69 A;  4E9J A;  4POF A;  2CTJ A;  3KDG A;  4AM3 A;  3S17 L;  2FFM A;  4NXM H;  4YWM A;  1HR0 H;  2JA6 L;  3KYU A;  3GTP L;  2CTL A;  5K36 G;  1IRO A;  1CAD A;  4LF7 H;  4DUZ H;  2UUA H;  1ZTG A;  1HNW H;  4DV4 H;  1B71 A;  2LRR A;  3GTM L;  1RWD A;  1VIH A;  1I50 L;  2VQF H;  3JR7 A;  3MPS A;  3PWF A;  2JVZ A;  5C44 L;  2XJV A;  2M4V A;  4LHL A;  1OWC A;  4LFA H;  1SMM A;  5A2Q W;  1WVN A;  2FMR A;  5FJ8 L;  4A3C L;  3LPE B;  3GTQ L;  1YV1 A;  1B2J A;  5JEA G;  4TPU A;  4NXN H;  4XGH A;  2Z3R B;  3GTO L;  1TWG L;  1P7P A;  3LWR B;  3KYV A;  5IP7 L;  1HNZ H;  2M6O A;  4NZR M;  1FJG H;  3I4M L;  5LL6 b;  4DV6 H;  2ERS A;  1IBK H;  1ODH A;  4C3I L;  4DR7 H;  3T1Y H;  2O5J D;  2A6H D;  5IY0 A;  3H3V M;  4JAD A;  4JI5 H;  2PSM C;  3H9B A;  1F0X A;  2XJS A;  2NVX L;  3QD7 X;  4K9F A;  2WB1 P;  3S1Q L;  1V8C A;  1R0G A;  5GAE c;  1LTL A;  3HAX C;  3P2A A;  5DT9 A;  1I3Q L;  2ANN A;  1BRF A;  3RYG A;  5FLM L;  3K7A L;  3S1M L;  5IYD L;  1J5E H;  2XJT A;  4FJU A;  3T1H H;  1X9Z A;  1B13 A;  1R0I A;  1N34 H;  4DR2 H;  4A3I L;  1BQ9 A;  1IBM H;  2WAQ P;  2UXD H;  4G6B A;  2ZM6 H;  1SMW A;  4DR3 H;  4IFD G;  1RDG A;  3HKZ P;  4U67 1;  4Y52 L;  1BFY A;  3GKU A;  5JVG 1;  1E8J A;  1T9O A;  2PMZ P;  2VKC A;  2JEA I;  5IWA H;  4PDB A;  5C3E L;  3KYX A; 
#chains in the Genus database with same CATH homology
 2KKD A;  4JI3 H;  3MSU A;  2J9U B;  5RXN A;  2M4Y A;  5K2M E;  3RZT A;  1N33 H;  1VCX A;  1R0F A;  1SMU A;  1VZI A;  2UUC H;  1RB9 A;  2K2D A;  2ZQE A;  2RDV A;  3VPB E;  1FHM A;  1N32 H;  5LMU H;  4LFB H;  4G08 A;  1S03 G;  3SS2 A;  4AR3 A;  2B5I D;  4OCH A;  4X62 H;  1XMQ H;  4YY3 H;  3J80 W;  1LKP A;  3RF2 A;  4AHZ A;  1RDV A;  5DM6 1;  2V3B B;  2A6E D;  2D9I A;  3J7Z 1;  1YK5 A;  3B08 B;  4KHP H;  3PKJ A;  3NCV A;  2XJP A;  4AR6 A;  5JVH 1;  1IU5 A;  4V19 6;  2PVE A;  4AR4 A;  2PPT A;  5FLX W;  3JAM W;  5H1S c;  4JI8 H;  4AI2 A;  4DUY H;  2KN9 A;  2DSX A;  4JI2 H;  3P8B A;  3QQC E;  3WWN B;  1NXE A;  1XNR H;  1ZRP A;  5EIO C;  2VQE H;  4DV7 H;  1R0J A;  2PT7 G;  2JI1 A;  1BE7 A;  2PYA A;  4B3T H;  2XJR A;  1YUZ A;  3ZG6 A;  4XXB B;  2V0E A;  5AI2 A;  4DV5 H;  1RYT A;  4AHX A;  1B2O A;  4UY8 1;  1LKO A;  1S24 A;  2JI2 A;  1FHH A;  4AI1 A;  4E6Y A;  2CKC A;  4AI3 A;  3LNL A;  4POG A;  4LF6 H;  5EIN C;  4GKK H;  2LF0 A;  4AHW A;  5MFZ A;  1DVB A;  4LF4 H;  2V0F A;  4JI0 H;  2QL0 A;  2C6B A;  4B8C D;  2JI3 A;  3RZ6 A;  2C6A A;  4DV2 H;  4LHN A;  2XJU A;  3PIP 1;  1XNQ H;  4JAE A;  4JYA H;  4LF5 H;  2CR8 A;  4JV5 H;  1C09 A;  1BQ8 A;  2MS3 A;  2L0Z A;  4ZN3 B;  5IT9 W;  2AYJ A;  2ERJ A;  5MFP A;  5MGN A;  1S2Z A;  2HR5 A;  4RXN A;  4OD6 A;  2ZIX A;  1YUX A;  1QCV A;  5GAD c;  4TVM A;  4AHY A;  4AQY H;  1JYB A;  1IU6 A;  4JAF A;  4DR1 H;  2F4V H;  3EZJ A;  1RYQ A;  1NXG A;  1CAA A;  2GMG A;  1QYB A;  1SEI A;  2E5L H;  1R0H A;  1YK4 A;  1VZG A;  5GAG c;  4X64 H;  3IU3 I;  4WFN 1;  1NNQ A;  2NYD A;  1I6U A;  4LF9 H;  1HNX H;  4EC5 A;  4DR4 H;  3J7Y 1;  1N36 H;  4X66 H;  4LF8 H;  2VL6 A;  2LCQ A;  4AI0 A;  5AN9 H;  3GAB A;  3NFP I;  1T9Q A;  4JI1 H;  1WJV A;  3GR5 A;  6RXN A;  4DV3 H;  4B3S H;  2HHH H;  3FAU A;  1OWB A;  4X65 H;  1XMO H;  3KDK A;  3OET A;  7RXN A;  4DV0 H;  4YHH H;  4JI4 H;  4DR6 H;  1S30 A;  2Z3Q B;  3OSS D;  4NZT M;  4JI7 H;  2FPH X;  3J81 W;  3A44 A;  4OX9 H;  4ME3 A;  5LMN H;  4B3R H;  4ZN1 B;  2Y3M A;  3PZA A;  2XJQ A;  1IRN A;  5BR8 H;  5GAH c;  3WWL A;  4DV1 H;  3KYY A;  3J7A K;  1AN7 A;  1VZH A;  1IW7 D;  4YWL A;  4AR5 A;  1H7V A;  1I94 H;  2UXB H;  2A69 D;  2A68 D;  3PKI A;  3OTO H;  1FKA H;  2M6P A;  5MLC 3;  4B3M H;  5AI3 A;  3B0A B;  1T9P A;  4GKJ H;  1LKM A;  3SB1 A;  3KYW A;  3QVD A;  1Z92 B;  1IBL H;  2PVX A;  8RXN A;  2UU9 H;  4GS7 D;  2CKA A;  3K35 A;  2BE5 D;  2H12 A;  2UUB H;  4JI6 H;  4LFC H;  1DX8 A;  5DM7 1;  4DR5 H;  4K0K H;  2O4C A;  2UXC H;  4JAG A;  3PIO 1;  5MF6 A;  4E9J A;  4POF A;  3KDG A;  4NXM H;  4YWM A;  1HR0 H;  3KYU A;  1IRO A;  1CAD A;  4LF7 H;  4DUZ H;  2UUA H;  1HNW H;  4DV4 H;  1B71 A;  1RWD A;  2VQF H;  3MPS A;  3PWF A;  2XJV A;  2M4V A;  4LHL A;  1OWC A;  4LFA H;  1SMM A;  5A2Q W;  3LPE B;  1YV1 A;  1B2J A;  4TPU A;  4NXN H;  4XGH A;  2Z3R B;  3KYV A;  1HNZ H;  2M6O A;  4NZR M;  1FJG H;  5LL6 b;  4DV6 H;  2ERS A;  1IBK H;  1ODH A;  4DR7 H;  3T1Y H;  2O5J D;  2A6H D;  5IY0 A;  4JAD A;  4JI5 H;  2PSM C;  1F0X A;  2XJS A;  3QD7 X;  4K9F A;  1R0G A;  5GAE c;  1LTL A;  5DT9 A;  3P2A A;  1BRF A;  3RYG A;  1J5E H;  2XJT A;  3T1H H;  1X9Z A;  1B13 A;  1R0I A;  1N34 H;  4DR2 H;  1BQ9 A;  1IBM H;  2UXD H;  4G6B A;  2ZM6 H;  1SMW A;  4DR3 H;  1RDG A;  4U67 1;  1BFY A;  5JVG 1;  1E8J A;  1T9O A;  2VKC A;  5IWA H;  4PDB A;  3KYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...