1ODHA

Structure of the gcm domain bound to dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
157
structure length
157
Chain Sequence
LSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCSRDCSTEEGRKIYLRPAICDKARQKQQRKSCPNCNGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPRPETKLEAEARRAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MGCM1
publication title Crystal Structure of the Gcm Domain-DNA Complex: A DNA-Binding Domain with a Novel Fold and Mode of Target Site Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription factor/dna
total genus 27
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2003-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03615 GCM GCM motif protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.80 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1odhA02
3.30.1370.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 1odhA01
1ODHA
chains in the Genus database with same CATH superfamily
4E6YA 1IW7D 2ZM6H 1DX8A 1IBKH 2P2RA 1V8CA 1NXUA 1QYBA 4NZTM 1IBLH 1IROA 2APOB 4NZRM 3LNLA 2A6ED 6RXNA 2CPMA 1B13A 2PQUA 3PWFA 2Z0SA 1YUZA 2PVEA 5C0XG 3M4OL 2KN9A 1ZRPA 2M4VA 4XXBB 5MFZA 3HAXC 3QQCE 4X66H 3IU3I 2EY4E 5AN9H 2R92L 3PO3L 3HJYB 2A68D 5FJ8L 2CKAA 4LF8H 3P8BA 2RDVA 4POFA 2CWHA 1BFYA 1SMUA 4JI3H 2AQCA 1BQ8A 2VQEH 2CR8A 3PIP1 4EC5A 5RXNA 1VZGA 2NVXL 3KYVA 4AI2A 2VKCA 4FJUA 2M6OA 4A3GL 7RXNA 3FKIL 4DV4H 2JI3A 2BE5D 1DT4A 3B0AB 4LFAH 1LTLA 5IYDL 4DR1H 1XNQH 4BXXL 2V0FA 5FLML 3B08B 4DR2H 3LWRB 3KDGA 3L7ZC 3KYUA 2CPQA 3LWOB 3PKJA 1WVNA 2F4VH 2UUBH 1QCVA 3J80W 1IRNA 3HOWL 1R0FA 4ME3A 8RXNA 3GR5A 1RDGA 3GTGL 2QNDA 1EC6A 2OPUA 4A3JL 1SFOL 3PO2L 1YK5A 2UXDH 3J81W 3K35A 4AR5A 3PZAA 2C6BA 1VBIA 3I0PA 2JEAI 3RZOL 5IYBL 1AN7A 4YHHH 1WHRA 4X6AL 4WALA 2ZQEA 4DR3H 1XRHA 2FFMA 2LF0A 1P7PA 3S16L 4BBRL 2X06A 3J7Z1 4JI7H 5JVG1 3S1QL 1JYBA 3JR7A 2A1SA 3LWPB 4A3ML 5IWAH 4DUYH 1S24A 4B3MH 2Z3QB 4LHNA 2DSXA 4AHYA 2NN6G 2JA5L 3HOZL 1TWCL 2XJPA 1DVBA 3GTLL 4WFN1 1ODHA 3HOVL 3I4ML 2CKCA 5EIOC 4AI3A 2YQRA 2AYJA 1R0JA 4GKJH 5DM71 1IU6A 2NYDA 4JI0H 4JAGA 4H8AA 2BL5A 1B71A 1S30A 3VPBE 1B2JA 3S1ML 1WJVA 4JADA 3HJWB 1HNZH 2JEBI 4DUZH 3GTOL 1N32H 3S1NL 2NVYL 3VKEA 1FKAH 2JA6L 5K36G 4RXNA 2HH3A 3UOEA 1I6HL 1QQTA 5M3ML 5IP9L 3SB1A 2HH2A 3QD7X 1K1GA 3GTKL 1I94H 5GAGc 3HOUL 5LL6b 1T9OA 4B3RH 5MFPA 5LMUH 4A3LL 2NVTL 3WWLA 4AR4A 1ZTGA 2PSMC 1BE7A 4G6BA 4KHPH 3S15L 5K2ME 4DR4H 1SMMA 4WANA 1J5KA 4AYBP 4JV5H 4C2M1 1V9NA 1HNXH 4LHLA 1RYTA 1XMOH 4K0KH 2GMGA 1X4MA 3FDJA 3HKZP 2VL6A 1UG8A 4E9JA 1HNWH 1J4WA 1TWGL 1RDVA 4DR7H 3GTML 2D9IA 1T9QA 3OTOH 1RYQA 2PPTA 3HOYL 4LF9H 4TVMA 1X9ZA 2CTKA 1X4NA 1N34H 2AUSB 1WE8A 2LRRA 3H99A 5DM61 4BA1I 3NCVA 3RF2A 1BQ9A 5C44L 4AI1A 4POGA 1WCML 1C09A 1F4LA 3I4NL 2OPVA 4OCHA 4YWLA 5IY0A 4X65H 2R93L 3H9CA 1S20A 4AR6A 4GS7D 5DT9A 4JI5H 4LFCH 2M8WA 1S03G 4DV1H 3SS2A 1R0HA 2XJQA 2UXCH 2RFKB 1N33H 3MSUA 5IP7L 4DR6H 5GADc 3GTQL 3MPSA 2Y3MA 5C3EL 3PIO1 2K1HA 3GABA 2JZXA 3H97A 2Z3RB 2L0ZA 1NXGA 1TUAA 4X64H 1BRFA 1LKPA 3T1HH 1PZXA 4JI1H 3RYGA 1NXEA 4LF5H 1N36H 4XGHA 5MGNA 1CAAA 3A44A 3RZDL 4AR3A 2E2IL 1H7VA 5MLC3 1NNQA 1PFYA 2VUML 3KYXA 4A3FL 4DR5H 4LF4H 2ZIXA 1YK4A 2J9UB 3GTJL 1SMWA 1FHMA 2E3UA 4YWMA 4GKKH 2WAQP 1KHMA 1XNRH 2NVQL 4A3EL 3GKUA 4C3IL 2XJSA 3PKIA 1J5EH 2V0EA 3CQZL 4Y52L 2B63L 4BBSL 2HR5A 4QIWP 1LKMA 3H3VM 4DV6H 3K7AL 1Y1WL 4BY7L 5GAHc 4JI4H 4DV3H 5AI3A 4AHWA 3GTPL 2CWFA 2PMZP 2XJUA 4IFDG 3OSSD 1PFUA 5JEAG 3H0GL 4NXMH 4LIJA 4C3JL 2VQFH 1OWCA 2CTFA 1F0XA 3RZTA 2JA9A 2XJTA 1Y1VL 4JYAH 1SEIA 1VZIA 2H12A 3AEVB 1I3QL 2Y0SP 2QL0A 4NBQA 2ERJA 2JI1A 1I6UA 3M3YL 2C6AA 2MS3A 3ZG6A 2M6PA 1R0IA 2M4YA 2LTLA 2WB1P 3J7Y1 4OX9H 5FLXW 1XMQH 1X0AA 2E2HL 3S1RL 4AHXA 1Z92B 3S2DL 1HR0H 3LPEB 2PYAA 4JAFA 5M5XL 2UUAH 2ANRA 3PL5A 3S14L 2G8YA 2O5JD 3OETA 1FJGH 4TPUA 2JI2A 1RB9A 2K2DA 3P2AA 2E2JL 4A93L 4A3IL 3KYYA 4DV7H 3V69A 1Z2IA 1RWDA 4AIMA 3S2HL 2YU9L 2JA8L 5IYCL 2E5LH 4B8TA 4DV2H 1ZZJA 4A3CL 5C4JL 2PVXA 2ANNA 5M3FL 1S2ZA 2HHHH 4NXNH 1YV1A 4BY1L 1T9PA 4A3BL 4C3HL 2UUCH 4K9FA 2LTMA 2ERSA 2AXYA 3LWVB 4JI8H 1R9TL 3MQKB 4JI2H 4QMFB 1IBMH 4YY3H 1ZZKA 4AHZA 5A2QW 1CADA 4JVHA 5M5WL 2A6HD 5IT9W 5C4XL 3FAUA 2JVZA 1YUXA 3U1KA 4AQYH 3T1YH 5GAEc 1OWBA 5LMNH 4X62H 1TWHL 1FHHA 1B2OA 4LFBH 2XJVA 2CTMA 1I50L 4DV0H 4ZN1B 2FPHX 1PQXA 4BA2I 1R0GA 1K83L 3NFPI 1VIHA 4AI0A 4G08A 1MSZA 4DV5H 2A69D 3KYWA 4JI6H 2LCQA 2CTJA 5H1Sc 1TWFL 1VZHA 4UY81 2V3BB 2PT7G 1ZZIA 1IU5A 5EINC 4B3SH 4Y7NL 4OD6A 1LKOA 2KKDA 4JAEA 1DTJA 3KDKA 3EZJA 2MJHA 5AI2A 1TWAL 2JE6I 1PFVA 2UXBH 5M5YL 3J7AK 4V196 4AM3A 2XJRA 3LWQB 3QVDA 1VIGA 2O4CA 4B3TH 4ZN3B 2JA7L 4PDBA 3RZ6A 2B5ID 4FJSA 2M6QA 4A3KL 4LF6H 2HVYC 1E8JA 1VCXA 3HOXL 2UU9H 4JVYA 1WTJA 5MF6A 4A3DL 4B8CD 2BA0A 2DGRA 1PFWA 5JVH1 2CTEA 3WWNB 4U671 2FMRA 2R7ZL 4OO1G 3H9BA 3S17L 4LF7H 2CTLA 3JAMW 2PY9A 5BR8H
chains in the Genus database with same CATH topology
4E6YA 1IW7D 2ZM6H 1DX8A 1IBKH 1QYBA 4NZTM 1IBLH 1IROA 4NZRM 3LNLA 2A6ED 6RXNA 1B13A 3PWFA 1YUZA 2PVEA 2KN9A 1ZRPA 2M4VA 4XXBB 5MFZA 3QQCE 4X66H 3IU3I 5AN9H 2A68D 4LF8H 2CKAA 3P8BA 2RDVA 4POFA 1BFYA 1SMUA 4JI3H 1BQ8A 2VQEH 2CR8A 3PIP1 4EC5A 5RXNA 1VZGA 3KYVA 4AI2A 2VKCA 2M6OA 7RXNA 4DV4H 2JI3A 2BE5D 3B0AB 4LFAH 1LTLA 4DR1H 1XNQH 2V0FA 3B08B 4DR2H 3KDGA 3KYUA 3PKJA 2F4VH 2UUBH 1QCVA 3J80W 1IRNA 1R0FA 4ME3A 8RXNA 3GR5A 1RDGA 1YK5A 2UXDH 3J81W 3K35A 4AR5A 3PZAA 2C6BA 1AN7A 4YHHH 2ZQEA 4DR3H 2LF0A 3J7Z1 4JI7H 5JVG1 1JYBA 5IWAH 4DUYH 1S24A 4B3MH 2Z3QB 4LHNA 2DSXA 4AHYA 2XJPA 1DVBA 4WFN1 1ODHA 2CKCA 5EIOC 4AI3A 2AYJA 1R0JA 4GKJH 5DM71 1IU6A 2NYDA 4JI0H 4JAGA 1B71A 1S30A 3VPBE 1B2JA 1WJVA 4JADA 1HNZH 4DUZH 1N32H 1FKAH 4RXNA 3SB1A 3QD7X 1I94H 5LL6b 5GAGc 1T9OA 4B3RH 5MFPA 5LMUH 3WWLA 4AR4A 2PSMC 1BE7A 4G6BA 4KHPH 5K2ME 4DR4H 1SMMA 4JV5H 1HNXH 4LHLA 1RYTA 1XMOH 4K0KH 2GMGA 2VL6A 4E9JA 1HNWH 1RDVA 4DR7H 2D9IA 1T9QA 3OTOH 1RYQA 2PPTA 4LF9H 4TVMA 1X9ZA 1N34H 5DM61 3NCVA 3RF2A 1BQ9A 4AI1A 4POGA 1C09A 4OCHA 4YWLA 5IY0A 4X65H 4AR6A 4GS7D 5DT9A 4JI5H 4LFCH 1S03G 4DV1H 3SS2A 1R0HA 2XJQA 2UXCH 1N33H 3MSUA 4DR6H 5GADc 2Y3MA 3MPSA 3PIO1 3GABA 2Z3RB 2L0ZA 1NXGA 4X64H 1BRFA 1LKPA 3T1HH 4JI1H 3RYGA 1NXEA 4LF5H 1N36H 4XGHA 5MGNA 1CAAA 3A44A 4AR3A 1H7VA 5MLC3 1NNQA 3KYXA 4DR5H 4LF4H 2ZIXA 1YK4A 2J9UB 1SMWA 1FHMA 4YWMA 4GKKH 1XNRH 2XJSA 3PKIA 1J5EH 2V0EA 2HR5A 1LKMA 4DV6H 5GAHc 4JI4H 4DV3H 5AI3A 4AHWA 2XJUA 3OSSD 4NXMH 2VQFH 1OWCA 1F0XA 3RZTA 2XJTA 4JYAH 1SEIA 1VZIA 2H12A 2QL0A 2ERJA 2JI1A 1I6UA 2C6AA 2MS3A 3ZG6A 2M6PA 1R0IA 2M4YA 3J7Y1 4OX9H 5FLXW 1XMQH 4AHXA 1Z92B 1HR0H 3LPEB 2PYAA 4JAFA 2UUAH 2O5JD 3OETA 1FJGH 4TPUA 2JI2A 1RB9A 2K2DA 3P2AA 3KYYA 4DV7H 1RWDA 2E5LH 4DV2H 2PVXA 2HHHH 1S2ZA 4NXNH 1YV1A 1T9PA 2UUCH 4K9FA 2ERSA 4JI8H 4JI2H 1IBMH 4YY3H 4AHZA 5A2QW 1CADA 5IT9W 2A6HD 3FAUA 1YUXA 4AQYH 3T1YH 5GAEc 1OWBA 5LMNH 4X62H 1FHHA 1B2OA 4LFBH 2XJVA 4DV0H 4ZN1B 2FPHX 1R0GA 3NFPI 4AI0A 4G08A 4DV5H 2A69D 3KYWA 4JI6H 2LCQA 5H1Sc 1VZHA 4UY81 2V3BB 2PT7G 1IU5A 5EINC 4B3SH 4OD6A 1LKOA 2KKDA 4JAEA 3KDKA 3EZJA 5AI2A 2UXBH 3J7AK 4V196 2XJRA 3QVDA 2O4CA 4B3TH 4ZN3B 4PDBA 3RZ6A 2B5ID 4LF6H 1E8JA 1VCXA 2UU9H 5MF6A 4B8CD 5JVH1 3WWNB 4U671 4LF7H 3JAMW 5BR8H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ODH A; 
#chains in the Genus database with same CATH topology
 4E6Y A;  1IW7 D;  2ZM6 H;  1DX8 A;  1IBK H;  2P2R A;  1V8C A;  1NXU A;  1QYB A;  4NZT M;  1IBL H;  1IRO A;  2APO B;  4NZR M;  3LNL A;  2A6E D;  6RXN A;  2CPM A;  1B13 A;  2PQU A;  3PWF A;  2Z0S A;  1YUZ A;  2PVE A;  5C0X G;  3M4O L;  2KN9 A;  1ZRP A;  2M4V A;  4XXB B;  5MFZ A;  3HAX C;  3QQC E;  4X66 H;  3IU3 I;  2EY4 E;  5AN9 H;  2R92 L;  3PO3 L;  3HJY B;  2A68 D;  5FJ8 L;  2CKA A;  4LF8 H;  3P8B A;  2RDV A;  4POF A;  2CWH A;  1BFY A;  1SMU A;  4JI3 H;  2AQC A;  1BQ8 A;  2VQE H;  2CR8 A;  3PIP 1;  4EC5 A;  5RXN A;  1VZG A;  2NVX L;  3KYV A;  4AI2 A;  2VKC A;  4FJU A;  2M6O A;  4A3G L;  7RXN A;  3FKI L;  4DV4 H;  2JI3 A;  2BE5 D;  1DT4 A;  3B0A B;  4LFA H;  1LTL A;  5IYD L;  4DR1 H;  1XNQ H;  4BXX L;  2V0F A;  5FLM L;  3B08 B;  4DR2 H;  3LWR B;  3KDG A;  3L7Z C;  3KYU A;  2CPQ A;  3LWO B;  3PKJ A;  1WVN A;  2F4V H;  2UUB H;  1QCV A;  3J80 W;  1IRN A;  3HOW L;  1R0F A;  4ME3 A;  8RXN A;  3GR5 A;  1RDG A;  3GTG L;  2QND A;  1EC6 A;  2OPU A;  4A3J L;  1SFO L;  3PO2 L;  1YK5 A;  2UXD H;  3J81 W;  3K35 A;  4AR5 A;  3PZA A;  2C6B A;  1VBI A;  3I0P A;  2JEA I;  3RZO L;  5IYB L;  1AN7 A;  4YHH H;  1WHR A;  4X6A L;  4WAL A;  2ZQE A;  4DR3 H;  1XRH A;  2FFM A;  2LF0 A;  1P7P A;  3S16 L;  4BBR L;  2X06 A;  3J7Z 1;  4JI7 H;  5JVG 1;  3S1Q L;  1JYB A;  3JR7 A;  2A1S A;  3LWP B;  4A3M L;  5IWA H;  4DUY H;  1S24 A;  4B3M H;  2Z3Q B;  4LHN A;  2DSX A;  4AHY A;  2NN6 G;  2JA5 L;  3HOZ L;  1TWC L;  2XJP A;  1DVB A;  3GTL L;  4WFN 1;  1ODH A;  3HOV L;  3I4M L;  2CKC A;  5EIO C;  4AI3 A;  2YQR A;  2AYJ A;  1R0J A;  4GKJ H;  5DM7 1;  1IU6 A;  2NYD A;  4JI0 H;  4JAG A;  4H8A A;  2BL5 A;  1B71 A;  1S30 A;  3VPB E;  1B2J A;  3S1M L;  1WJV A;  4JAD A;  3HJW B;  1HNZ H;  2JEB I;  4DUZ H;  3GTO L;  1N32 H;  3S1N L;  2NVY L;  3VKE A;  1FKA H;  2JA6 L;  5K36 G;  4RXN A;  2HH3 A;  3UOE A;  1I6H L;  1QQT A;  5M3M L;  5IP9 L;  3SB1 A;  2HH2 A;  3QD7 X;  1K1G A;  3GTK L;  1I94 H;  5GAG c;  3HOU L;  5LL6 b;  1T9O A;  4B3R H;  5MFP A;  5LMU H;  4A3L L;  2NVT L;  3WWL A;  4AR4 A;  1ZTG A;  2PSM C;  1BE7 A;  4G6B A;  4KHP H;  3S15 L;  5K2M E;  4DR4 H;  1SMM A;  4WAN A;  1J5K A;  4AYB P;  4JV5 H;  4C2M 1;  1V9N A;  1HNX H;  4LHL A;  1RYT A;  1XMO H;  4K0K H;  2GMG A;  1X4M A;  3FDJ A;  3HKZ P;  2VL6 A;  1UG8 A;  4E9J A;  1HNW H;  1J4W A;  1TWG L;  1RDV A;  4DR7 H;  3GTM L;  2D9I A;  1T9Q A;  3OTO H;  1RYQ A;  2PPT A;  3HOY L;  4LF9 H;  4TVM A;  1X9Z A;  2CTK A;  1X4N A;  1N34 H;  2AUS B;  1WE8 A;  2LRR A;  3H99 A;  5DM6 1;  4BA1 I;  3NCV A;  3RF2 A;  1BQ9 A;  5C44 L;  4AI1 A;  4POG A;  1WCM L;  1C09 A;  1F4L A;  3I4N L;  2OPV A;  4OCH A;  4YWL A;  5IY0 A;  4X65 H;  2R93 L;  3H9C A;  1S20 A;  4AR6 A;  4GS7 D;  5DT9 A;  4JI5 H;  4LFC H;  2M8W A;  1S03 G;  4DV1 H;  3SS2 A;  1R0H A;  2XJQ A;  2UXC H;  2RFK B;  1N33 H;  3MSU A;  5IP7 L;  4DR6 H;  5GAD c;  3GTQ L;  3MPS A;  2Y3M A;  5C3E L;  3PIO 1;  2K1H A;  3GAB A;  2JZX A;  3H97 A;  2Z3R B;  2L0Z A;  1NXG A;  1TUA A;  4X64 H;  1BRF A;  1LKP A;  3T1H H;  1PZX A;  4JI1 H;  3RYG A;  1NXE A;  4LF5 H;  1N36 H;  4XGH A;  5MGN A;  1CAA A;  3A44 A;  3RZD L;  4AR3 A;  2E2I L;  1H7V A;  5MLC 3;  1NNQ A;  1PFY A;  2VUM L;  3KYX A;  4A3F L;  4DR5 H;  4LF4 H;  2ZIX A;  1YK4 A;  2J9U B;  3GTJ L;  1SMW A;  1FHM A;  2E3U A;  4YWM A;  4GKK H;  2WAQ P;  1KHM A;  1XNR H;  2NVQ L;  4A3E L;  3GKU A;  4C3I L;  2XJS A;  3PKI A;  1J5E H;  2V0E A;  3CQZ L;  4Y52 L;  2B63 L;  4BBS L;  2HR5 A;  4QIW P;  1LKM A;  3H3V M;  4DV6 H;  3K7A L;  1Y1W L;  4BY7 L;  5GAH c;  4JI4 H;  4DV3 H;  5AI3 A;  4AHW A;  3GTP L;  2CWF A;  2PMZ P;  2XJU A;  4IFD G;  3OSS D;  1PFU A;  5JEA G;  3H0G L;  4NXM H;  4LIJ A;  4C3J L;  2VQF H;  1OWC A;  2CTF A;  1F0X A;  3RZT A;  2JA9 A;  2XJT A;  1Y1V L;  4JYA H;  1SEI A;  1VZI A;  2H12 A;  3AEV B;  1I3Q L;  2Y0S P;  2QL0 A;  4NBQ A;  2ERJ A;  2JI1 A;  1I6U A;  3M3Y L;  2C6A A;  2MS3 A;  3ZG6 A;  2M6P A;  1R0I A;  2M4Y A;  2LTL A;  2WB1 P;  3J7Y 1;  4OX9 H;  5FLX W;  1XMQ H;  1X0A A;  2E2H L;  3S1R L;  4AHX A;  1Z92 B;  3S2D L;  1HR0 H;  3LPE B;  2PYA A;  4JAF A;  5M5X L;  2UUA H;  2ANR A;  3PL5 A;  3S14 L;  2G8Y A;  2O5J D;  3OET A;  1FJG H;  4TPU A;  2JI2 A;  1RB9 A;  2K2D A;  3P2A A;  2E2J L;  4A93 L;  4A3I L;  3KYY A;  4DV7 H;  3V69 A;  1Z2I A;  1RWD A;  4AIM A;  3S2H L;  2YU9 L;  2JA8 L;  5IYC L;  2E5L H;  4B8T A;  4DV2 H;  1ZZJ A;  4A3C L;  5C4J L;  2PVX A;  2ANN A;  5M3F L;  1S2Z A;  2HHH H;  4NXN H;  1YV1 A;  4BY1 L;  1T9P A;  4A3B L;  4C3H L;  2UUC H;  4K9F A;  2LTM A;  2ERS A;  2AXY A;  3LWV B;  4JI8 H;  1R9T L;  3MQK B;  4JI2 H;  4QMF B;  1IBM H;  4YY3 H;  1ZZK A;  4AHZ A;  5A2Q W;  1CAD A;  4JVH A;  5M5W L;  2A6H D;  5IT9 W;  5C4X L;  3FAU A;  2JVZ A;  1YUX A;  3U1K A;  4AQY H;  3T1Y H;  5GAE c;  1OWB A;  5LMN H;  4X62 H;  1TWH L;  1FHH A;  1B2O A;  4LFB H;  2XJV A;  2CTM A;  1I50 L;  4DV0 H;  4ZN1 B;  2FPH X;  1PQX A;  4BA2 I;  1R0G A;  1K83 L;  3NFP I;  1VIH A;  4AI0 A;  4G08 A;  1MSZ A;  4DV5 H;  2A69 D;  3KYW A;  4JI6 H;  2LCQ A;  2CTJ A;  5H1S c;  1TWF L;  1VZH A;  4UY8 1;  2V3B B;  2PT7 G;  1ZZI A;  1IU5 A;  5EIN C;  4B3S H;  4Y7N L;  4OD6 A;  1LKO A;  2KKD A;  4JAE A;  1DTJ A;  3KDK A;  3EZJ A;  2MJH A;  5AI2 A;  1TWA L;  2JE6 I;  1PFV A;  2UXB H;  5M5Y L;  3J7A K;  4V19 6;  4AM3 A;  2XJR A;  3LWQ B;  3QVD A;  1VIG A;  2O4C A;  4B3T H;  4ZN3 B;  2JA7 L;  4PDB A;  3RZ6 A;  2B5I D;  4FJS A;  2M6Q A;  4A3K L;  4LF6 H;  2HVY C;  1E8J A;  1VCX A;  3HOX L;  2UU9 H;  4JVY A;  1WTJ A;  5MF6 A;  4A3D L;  4B8C D;  2BA0 A;  2DGR A;  1PFW A;  5JVH 1;  2CTE A;  3WWN B;  4U67 1;  2FMR A;  2R7Z L;  4OO1 G;  3H9B A;  3S17 L;  4LF7 H;  2CTL A;  3JAM W;  2PY9 A;  5BR8 H; 
#chains in the Genus database with same CATH homology
 4E6Y A;  1IW7 D;  2ZM6 H;  1DX8 A;  1IBK H;  1QYB A;  4NZT M;  1IBL H;  1IRO A;  4NZR M;  3LNL A;  2A6E D;  6RXN A;  1B13 A;  3PWF A;  1YUZ A;  2PVE A;  2KN9 A;  1ZRP A;  2M4V A;  4XXB B;  5MFZ A;  3QQC E;  4X66 H;  3IU3 I;  5AN9 H;  2A68 D;  4LF8 H;  2CKA A;  3P8B A;  2RDV A;  4POF A;  1BFY A;  1SMU A;  4JI3 H;  1BQ8 A;  2VQE H;  2CR8 A;  3PIP 1;  4EC5 A;  5RXN A;  1VZG A;  3KYV A;  4AI2 A;  2VKC A;  2M6O A;  7RXN A;  4DV4 H;  2JI3 A;  2BE5 D;  3B0A B;  4LFA H;  1LTL A;  4DR1 H;  1XNQ H;  2V0F A;  3B08 B;  4DR2 H;  3KDG A;  3KYU A;  3PKJ A;  2F4V H;  2UUB H;  1QCV A;  3J80 W;  1IRN A;  1R0F A;  4ME3 A;  8RXN A;  3GR5 A;  1RDG A;  1YK5 A;  2UXD H;  3J81 W;  3K35 A;  4AR5 A;  3PZA A;  2C6B A;  1AN7 A;  4YHH H;  2ZQE A;  4DR3 H;  2LF0 A;  3J7Z 1;  4JI7 H;  5JVG 1;  1JYB A;  5IWA H;  4DUY H;  1S24 A;  4B3M H;  2Z3Q B;  4LHN A;  2DSX A;  4AHY A;  2XJP A;  1DVB A;  4WFN 1;  1ODH A;  2CKC A;  5EIO C;  4AI3 A;  2AYJ A;  1R0J A;  4GKJ H;  5DM7 1;  1IU6 A;  2NYD A;  4JI0 H;  4JAG A;  1B71 A;  1S30 A;  3VPB E;  1B2J A;  1WJV A;  4JAD A;  1HNZ H;  4DUZ H;  1N32 H;  1FKA H;  4RXN A;  3SB1 A;  3QD7 X;  1I94 H;  5LL6 b;  5GAG c;  1T9O A;  4B3R H;  5MFP A;  5LMU H;  3WWL A;  4AR4 A;  2PSM C;  1BE7 A;  4G6B A;  4KHP H;  5K2M E;  4DR4 H;  1SMM A;  4JV5 H;  1HNX H;  4LHL A;  1RYT A;  1XMO H;  4K0K H;  2GMG A;  2VL6 A;  4E9J A;  1HNW H;  1RDV A;  4DR7 H;  2D9I A;  1T9Q A;  3OTO H;  1RYQ A;  2PPT A;  4LF9 H;  4TVM A;  1X9Z A;  1N34 H;  5DM6 1;  3NCV A;  3RF2 A;  1BQ9 A;  4AI1 A;  4POG A;  1C09 A;  4OCH A;  4YWL A;  5IY0 A;  4X65 H;  4AR6 A;  4GS7 D;  5DT9 A;  4JI5 H;  4LFC H;  1S03 G;  4DV1 H;  3SS2 A;  1R0H A;  2XJQ A;  2UXC H;  1N33 H;  3MSU A;  4DR6 H;  5GAD c;  2Y3M A;  3MPS A;  3PIO 1;  3GAB A;  2Z3R B;  2L0Z A;  1NXG A;  4X64 H;  1BRF A;  1LKP A;  3T1H H;  4JI1 H;  3RYG A;  1NXE A;  4LF5 H;  1N36 H;  4XGH A;  5MGN A;  1CAA A;  3A44 A;  4AR3 A;  1H7V A;  5MLC 3;  1NNQ A;  3KYX A;  4DR5 H;  4LF4 H;  2ZIX A;  1YK4 A;  2J9U B;  1SMW A;  1FHM A;  4YWM A;  4GKK H;  1XNR H;  2XJS A;  3PKI A;  1J5E H;  2V0E A;  2HR5 A;  1LKM A;  4DV6 H;  5GAH c;  4JI4 H;  4DV3 H;  5AI3 A;  4AHW A;  2XJU A;  3OSS D;  4NXM H;  2VQF H;  1OWC A;  1F0X A;  3RZT A;  2XJT A;  4JYA H;  1SEI A;  1VZI A;  2H12 A;  2QL0 A;  2ERJ A;  2JI1 A;  1I6U A;  2C6A A;  2MS3 A;  3ZG6 A;  2M6P A;  1R0I A;  2M4Y A;  3J7Y 1;  4OX9 H;  5FLX W;  1XMQ H;  4AHX A;  1Z92 B;  1HR0 H;  3LPE B;  2PYA A;  4JAF A;  2UUA H;  2O5J D;  3OET A;  1FJG H;  4TPU A;  2JI2 A;  1RB9 A;  2K2D A;  3P2A A;  3KYY A;  4DV7 H;  1RWD A;  2E5L H;  4DV2 H;  2PVX A;  2HHH H;  1S2Z A;  4NXN H;  1YV1 A;  1T9P A;  2UUC H;  4K9F A;  2ERS A;  4JI8 H;  4JI2 H;  1IBM H;  4YY3 H;  4AHZ A;  5A2Q W;  1CAD A;  5IT9 W;  2A6H D;  3FAU A;  1YUX A;  4AQY H;  3T1Y H;  5GAE c;  1OWB A;  5LMN H;  4X62 H;  1FHH A;  1B2O A;  4LFB H;  2XJV A;  4DV0 H;  4ZN1 B;  2FPH X;  1R0G A;  3NFP I;  4AI0 A;  4G08 A;  4DV5 H;  2A69 D;  3KYW A;  4JI6 H;  2LCQ A;  5H1S c;  1VZH A;  4UY8 1;  2V3B B;  2PT7 G;  1IU5 A;  5EIN C;  4B3S H;  4OD6 A;  1LKO A;  2KKD A;  4JAE A;  3KDK A;  3EZJ A;  5AI2 A;  2UXB H;  3J7A K;  4V19 6;  2XJR A;  3QVD A;  2O4C A;  4B3T H;  4ZN3 B;  4PDB A;  3RZ6 A;  2B5I D;  4LF6 H;  1E8J A;  1VCX A;  2UU9 H;  5MF6 A;  4B8C D;  5JVH 1;  3WWN B;  4U67 1;  4LF7 H;  3JAM W;  5BR8 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...