1ODHA

Structure of the gcm domain bound to dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
157
structure length
157
Chain Sequence
LSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCSRDCSTEEGRKIYLRPAICDKARQKQQRKSCPNCNGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPRPETKLEAEARRAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MGCM1
publication title Crystal Structure of the Gcm Domain-DNA Complex: A DNA-Binding Domain with a Novel Fold and Mode of Target Site Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription factor/dna
total genus 27
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2003-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03615 GCM GCM motif protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.80 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1odhA02
3.30.1370.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 1odhA01
1ODHA
chains in the Genus database with same CATH superfamily
1KHMA 4K9FA 3I4ML 2HVYC 3FKIL 4LFAH 5IYBL 3CQZL 1RYQA 1ODHA 5AI3A 5M5WL 3H99A 4BBRL 1R0GA 3RZ6A 2JE6I 2EY4E 1OWBA 5K2ME 1LKPA 2KN9A 4DR6H 2M6PA 4AHWA 2WB1P 1F4LA 1Y1VL 4C3IL 2JA8L 1NXUA 4B3MH 2XJSA 5FLXW 1PFUA 2Y3MA 2C6AA 3GTGL 2XJVA 4JI2H 4AR5A 3LWQB 2ZIXA 2FMRA 2AUSB 4YWLA 2CR8A 4NXNH 4GKJH 3H9BA 4A3LL 2NYDA 4DUYH 5AI2A 3HOWL 4POFA 3ZG6A 1ZZKA 2AQCA 1J5KA 4A93L 1PQXA 3NCVA 3GKUA 3H3VM 4JV5H 5DM71 1YK5A 3LWVB 2V0EA 1YK4A 4Y7NL 1RB9A 2M8WA 2ERJA 2CPMA 2BL5A 3RZDL 1H7VA 4DV7H 1WVNA 4GKKH 1VIGA 4X66H 3T1HH 3I0PA 2E2HL 4DR4H 4DV0H 1SMUA 3J7Y1 3I4NL 1YV1A 1TWFL 4QMFB 2JI3A 4AHXA 5IP7L 1XNQH 5C0XG 1RWDA 2UXBH 4A3GL 3PO3L 3LWOB 2A1SA 2PMZP 4OCHA 2PVEA 4JI8H 2M6QA 4ME3A 1VZIA 5M5XL 2PSMC 3S1ML 3H97A 1VZHA 1Z92B 4LFBH 3M4OL 1EC6A 4H8AA 2UUCH 2FFMA 1VZGA 2Z3RB 3L7ZC 2UXDH 4DV2H 1B2JA 4WANA 3HOVL 3B0AB 1OWCA 2LTMA 3LWRB 3HOUL 5IP9L 5DM61 1FJGH 4FJUA 1R0HA 3HOZL 2OPUA 1B2OA 3HOXL 5DT9A 1P7PA 4A3JL 3WWNB 2R7ZL 4B3SH 2JEAI 5RXNA 2E2JL 3OETA 2NN6G 3EZJA 1LTLA 1V8CA 1ZZJA 2BE5D 2LRRA 2B63L 5FLML 1NNQA 4LF5H 1Y1WL 7RXNA 5M3FL 2V3BB 2E2IL 2QNDA 4C3JL 4NZTM 1IBMH 3MSUA 5A2QW 1R0IA 1S20A 3VKEA 4YY3H 3KYWA 4AR4A 5LL6b 4A3CL 1ZRPA 4JI7H 3IU3I 1MSZA 3J81W 3U1KA 1RYTA 1VCXA 4A3ML 1FKAH 4JI1H 3LNLA 2HH2A 3S1NL 3A44A 1ZZIA 1T9QA 5C44L 1WHRA 5BR8H 2YQRA 4LHNA 1IBKH 3K7AL 3RZTA 1BRFA 4FJSA 4WFN1 2A6ED 2X06A 1I6UA 1X0AA 4G08A 2HH3A 1K83L 2VQEH 4LF8H 3S2DL 3JAMW 1HNXH 2Z3QB 1PZXA 2XJPA 5EIOC 1V9NA 4B3TH 4DR2H 2HR5A 1IBLH 4A3FL 2JA9A 5MLC3 1I6HL 1JYBA 2ANNA 3T1YH 2MJHA 1C09A 2J9UB 1YUXA 5M5YL 1PFYA 4OO1G 2CTKA 5MF6A 2NVXL 1FHMA 1XRHA 1R9TL 2K1HA 2UUAH 2VUML 3GTJL 1QCVA 4DV3H 1N32H 2CWHA 2CKCA 2CTEA 1N36H 2OPVA 2L0ZA 4AI2A 1S03G 2VL6A 4BY7L 1TUAA 3JR7A 4E6YA 1E8JA 2UXCH 4AI1A 4POGA 3RZOL 1YUZA 4DR5H 4DV4H 1BE7A 1S30A 3GTLL 2P2RA 4B3RH 5GADc 4JADA 5H1Sc 4NZRM 2JA7L 2AYJA 1T9OA 3GTOL 4G6BA 4LIJA 1I50L 4K0KH 2R92L 1SMWA 2V0FA 4C2M1 3S15L 1T9PA 3OSSD 4QIWP 4JI4H 1K1GA 1I94H 2GMGA 3PL5A 2BA0A 4UY81 2VKCA 3QVDA 5LMUH 1HR0H 2CTLA 3GTQL 2PQUA 5MFZA 2UUBH 1QYBA 4DV1H 4X6AL 1S2ZA 3GTPL 3GTKL 1WJVA 2F4VH 2YU9L 4TPUA 4DUZH 1WE8A 3SB1A 5GAEc 2PVXA 2A6HD 3KYYA 1DT4A 4B8CD 3GR5A 3V69A 1TWAL 1IU5A 1N33H 2HHHH 4E9JA 1IRNA 4TVMA 2K2DA 2CTJA 4ZN1B 1Z2IA 4AHYA 5IYCL 3HOYL 4AHZA 2ERSA 2E3UA 2XJTA 1RDVA 2DSXA 3QD7X 4JVHA 2O4CA 4OX9H 1DX8A 5FJ8L 1RDGA 2R93L 2XJQA 4NBQA 3RYGA 4AYBP 5AN9H 3VPBE 2PPTA 3FDJA 1XMQH 5MFPA 4X62H 4A3IL 4JAFA 1CADA 4JI6H 1SMMA 2XJRA 4LF7H 1SEIA 4AM3A 4A3KL 3MQKB 4DR1H 1VIHA 1J5EH 1CAAA 3KDGA 1FHHA 2JA6L 2ZM6H 4EC5A 4B8TA 2LF0A 4LF6H 4BBSL 2PT7G 4JI5H 1B71A 1N34H 3KDKA 5JVH1 2G8YA 2DGRA 1AN7A 5MGNA 3P2AA 3FAUA 2JZXA 3P8BA 4BY1L 4A3EL 2Y0SP 5GAHc 2FPHX 1BQ9A 2A68D 2D9IA 5IT9W 4ZN3B 3H0GL 2LTLA 3GABA 2NVYL 1F0XA 3J7AK 3PIO1 4BA1I 1TWCL 2RDVA 4KHPH 2JVZA 1IU6A 1NXEA 4LHLA 3WWLA 3S14L 4BXXL 4DR3H 2LCQA 4C3HL 1HNWH 1HNZH 3H9CA 1J4WA 4AI3A 4RXNA 4GS7D 3RF2A 4JVYA 3SS2A 2AXYA 2PYAA 3PKJA 1B13A 4IFDG 1TWGL 2H12A 4PDBA 2CTMA 4JAEA 3AEVB 1X4NA 2CPQA 5C4XL 2Z0SA 4Y52L 1DTJA 4U671 1R0JA 3PKIA 1DVBA 4LFCH 4DR7H 1LKOA 5IY0A 1SFOL 2CTFA 4A3BL 2CKAA 3PO2L 1X9ZA 3PIP1 4AIMA 2E5LH 1PFVA 1I3QL 1X4MA 1R0FA 2JI1A 4JI0H 4AI0A 4YHHH 4AQYH 2M4VA 3HJYB 3HJWB 5JVG1 2M4YA 5IWAH 1LKMA 4V196 3NFPI 1XMOH 2O5JD 2QL0A 3PZAA 2RFKB 5C3EL 4DV6H 1BFYA 3S16L 5LMNH 2ZQEA 3QQCE 3OTOH 2APOB 3B08B 2JI2A 6RXNA 3S1QL 4LF4H 4NXMH 1WCML 3J7Z1 2NVTL 5IYDL 5M3ML 3S1RL 4XXBB 1UG8A 3K35A 5JEAG 3GTML 2JEBI 1IROA 2C6BA 3LPEB 3S2HL 4AR6A 1WTJA 3KYXA 3KYVA 1IW7D 3UOEA 2A69D 5C4JL 5GAGc 2JA5L 4X65H 1S24A 3HAXC 3S17L 3M3YL 2WAQP 3KYUA 4WALA 1ZTGA 4JYAH 1XNRH 4YWMA 8RXNA 3HKZP 2NVQL 2VQFH 4DV5H 3LWPB 4JI3H 2KKDA 1TWHL 1PFWA 3PWFA 2PY9A 3MPSA 4BA2I 4LF9H 5K36G 4JAGA 2ANRA 2M6OA 4X64H 1VBIA 4XGHA 2XJUA 4AR3A 3J80W 4OD6A 5EINC 1QQTA 1BQ8A 2UU9H 2CWFA 1NXGA 2B5ID 4A3DL 2MS3A
chains in the Genus database with same CATH topology
4K9FA 4LFAH 1RYQA 1ODHA 5AI3A 1R0GA 3RZ6A 1OWBA 5K2ME 1LKPA 2KN9A 4DR6H 2M6PA 4AHWA 4B3MH 2XJSA 5FLXW 2Y3MA 2C6AA 2XJVA 4JI2H 4AR5A 2ZIXA 4YWLA 2CR8A 4NXNH 4GKJH 2NYDA 4DUYH 5AI2A 4POFA 3ZG6A 3NCVA 4JV5H 5DM71 1YK5A 2V0EA 1YK4A 1RB9A 2ERJA 4DV7H 1H7VA 4GKKH 4X66H 3T1HH 4DR4H 4DV0H 1SMUA 3J7Y1 1YV1A 2JI3A 4AHXA 1XNQH 1RWDA 2UXBH 4OCHA 2PVEA 4JI8H 4ME3A 1VZIA 2PSMC 1VZHA 1Z92B 4LFBH 2UUCH 1VZGA 2Z3RB 2UXDH 4DV2H 1B2JA 3B0AB 1OWCA 1FJGH 5DM61 1R0HA 1B2OA 5DT9A 3WWNB 4B3SH 5RXNA 3OETA 3EZJA 1LTLA 2BE5D 1NNQA 4LF5H 7RXNA 2V3BB 4NZTM 1IBMH 3MSUA 5A2QW 1R0IA 4YY3H 3KYWA 4AR4A 5LL6b 1ZRPA 4JI7H 3IU3I 3J81W 1RYTA 1VCXA 1FKAH 4JI1H 3LNLA 3A44A 1T9QA 5BR8H 4LHNA 1IBKH 3RZTA 1BRFA 4WFN1 2A6ED 1I6UA 4G08A 2VQEH 4LF8H 3JAMW 1HNXH 2Z3QB 2XJPA 5EIOC 4B3TH 4DR2H 2HR5A 1IBLH 5MLC3 1JYBA 3T1YH 1C09A 2J9UB 1YUXA 5MF6A 1FHMA 2UUAH 4DV3H 1QCVA 1N32H 2CKCA 1N36H 2L0ZA 4AI2A 1S03G 2VL6A 1E8JA 4E6YA 2UXCH 4AI1A 4POGA 1YUZA 4DR5H 4DV4H 1BE7A 1S30A 4B3RH 5GADc 4JADA 5H1Sc 4NZRM 2AYJA 1T9OA 4G6BA 4K0KH 1SMWA 2V0FA 1T9PA 3OSSD 4JI4H 1I94H 2GMGA 4UY81 2VKCA 3QVDA 5LMUH 1HR0H 5MFZA 2UUBH 1QYBA 4DV1H 1S2ZA 2F4VH 1WJVA 4TPUA 4DUZH 3SB1A 5GAEc 2PVXA 2A6HD 3KYYA 4B8CD 3GR5A 1IU5A 1N33H 2HHHH 4E9JA 1IRNA 4TVMA 2K2DA 4ZN1B 4AHYA 4AHZA 2ERSA 2XJTA 1RDVA 2DSXA 3QD7X 2O4CA 4OX9H 1DX8A 1RDGA 2XJQA 3RYGA 5AN9H 3VPBE 2PPTA 1XMQH 5MFPA 4X62H 4JAFA 1CADA 4JI6H 1SMMA 2XJRA 4LF7H 1SEIA 4DR1H 1J5EH 1CAAA 3KDGA 1FHHA 2ZM6H 4EC5A 2LF0A 4LF6H 2PT7G 4JI5H 1B71A 1N34H 3KDKA 5JVH1 1AN7A 5MGNA 3P2AA 3FAUA 3P8BA 5GAHc 2FPHX 1BQ9A 2A68D 2D9IA 5IT9W 4ZN3B 3GABA 1F0XA 3J7AK 3PIO1 4KHPH 2RDVA 1IU6A 1NXEA 4LHLA 3WWLA 4DR3H 2LCQA 1HNWH 1HNZH 4AI3A 3RF2A 4RXNA 4GS7D 3SS2A 2PYAA 3PKJA 1B13A 2H12A 4PDBA 4JAEA 4U671 1R0JA 3PKIA 1DVBA 4LFCH 4DR7H 1LKOA 5IY0A 2CKAA 1X9ZA 3PIP1 2E5LH 1R0FA 2JI1A 4JI0H 4AI0A 4YHHH 4AQYH 2M4VA 5JVG1 2M4YA 5IWAH 1LKMA 4V196 3NFPI 1XMOH 2O5JD 2QL0A 3PZAA 4DV6H 1BFYA 5LMNH 2ZQEA 3QQCE 3OTOH 3B08B 2JI2A 6RXNA 4LF4H 4NXMH 3J7Z1 4XXBB 3K35A 1IROA 2C6BA 3LPEB 4AR6A 3KYXA 3KYVA 1IW7D 2A69D 5GAGc 4X65H 1S24A 3KYUA 4JYAH 1XNRH 4YWMA 8RXNA 2VQFH 4DV5H 4JI3H 2KKDA 3PWFA 3MPSA 4LF9H 4JAGA 2M6OA 4X64H 4XGHA 2XJUA 4AR3A 3J80W 4OD6A 5EINC 1BQ8A 2UU9H 1NXGA 2B5ID 2MS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ODH A; 
#chains in the Genus database with same CATH topology
 1KHM A;  4K9F A;  3I4M L;  2HVY C;  3FKI L;  4LFA H;  5IYB L;  3CQZ L;  1RYQ A;  1ODH A;  5AI3 A;  5M5W L;  3H99 A;  4BBR L;  1R0G A;  3RZ6 A;  2JE6 I;  2EY4 E;  1OWB A;  5K2M E;  1LKP A;  2KN9 A;  4DR6 H;  2M6P A;  4AHW A;  2WB1 P;  1F4L A;  1Y1V L;  4C3I L;  2JA8 L;  1NXU A;  4B3M H;  2XJS A;  5FLX W;  1PFU A;  2Y3M A;  2C6A A;  3GTG L;  2XJV A;  4JI2 H;  4AR5 A;  3LWQ B;  2ZIX A;  2FMR A;  2AUS B;  4YWL A;  2CR8 A;  4NXN H;  4GKJ H;  3H9B A;  4A3L L;  2NYD A;  4DUY H;  5AI2 A;  3HOW L;  4POF A;  3ZG6 A;  1ZZK A;  2AQC A;  1J5K A;  4A93 L;  1PQX A;  3NCV A;  3GKU A;  3H3V M;  4JV5 H;  5DM7 1;  1YK5 A;  3LWV B;  2V0E A;  1YK4 A;  4Y7N L;  1RB9 A;  2M8W A;  2ERJ A;  2CPM A;  2BL5 A;  3RZD L;  1H7V A;  4DV7 H;  1WVN A;  4GKK H;  1VIG A;  4X66 H;  3T1H H;  3I0P A;  2E2H L;  4DR4 H;  4DV0 H;  1SMU A;  3J7Y 1;  3I4N L;  1YV1 A;  1TWF L;  4QMF B;  2JI3 A;  4AHX A;  5IP7 L;  1XNQ H;  5C0X G;  1RWD A;  2UXB H;  4A3G L;  3PO3 L;  3LWO B;  2A1S A;  2PMZ P;  4OCH A;  2PVE A;  4JI8 H;  2M6Q A;  4ME3 A;  1VZI A;  5M5X L;  2PSM C;  3S1M L;  3H97 A;  1VZH A;  1Z92 B;  4LFB H;  3M4O L;  1EC6 A;  4H8A A;  2UUC H;  2FFM A;  1VZG A;  2Z3R B;  3L7Z C;  2UXD H;  4DV2 H;  1B2J A;  4WAN A;  3HOV L;  3B0A B;  1OWC A;  2LTM A;  3LWR B;  3HOU L;  5IP9 L;  5DM6 1;  1FJG H;  4FJU A;  1R0H A;  3HOZ L;  2OPU A;  1B2O A;  3HOX L;  5DT9 A;  1P7P A;  4A3J L;  3WWN B;  2R7Z L;  4B3S H;  2JEA I;  5RXN A;  2E2J L;  3OET A;  2NN6 G;  3EZJ A;  1LTL A;  1V8C A;  1ZZJ A;  2BE5 D;  2LRR A;  2B63 L;  5FLM L;  1NNQ A;  4LF5 H;  1Y1W L;  7RXN A;  5M3F L;  2V3B B;  2E2I L;  2QND A;  4C3J L;  4NZT M;  1IBM H;  3MSU A;  5A2Q W;  1R0I A;  1S20 A;  3VKE A;  4YY3 H;  3KYW A;  4AR4 A;  5LL6 b;  4A3C L;  1ZRP A;  4JI7 H;  3IU3 I;  1MSZ A;  3J81 W;  3U1K A;  1RYT A;  1VCX A;  4A3M L;  1FKA H;  4JI1 H;  3LNL A;  2HH2 A;  3S1N L;  3A44 A;  1ZZI A;  1T9Q A;  5C44 L;  1WHR A;  5BR8 H;  2YQR A;  4LHN A;  1IBK H;  3K7A L;  3RZT A;  1BRF A;  4FJS A;  4WFN 1;  2A6E D;  2X06 A;  1I6U A;  1X0A A;  4G08 A;  2HH3 A;  1K83 L;  2VQE H;  4LF8 H;  3S2D L;  3JAM W;  1HNX H;  2Z3Q B;  1PZX A;  2XJP A;  5EIO C;  1V9N A;  4B3T H;  4DR2 H;  2HR5 A;  1IBL H;  4A3F L;  2JA9 A;  5MLC 3;  1I6H L;  1JYB A;  2ANN A;  3T1Y H;  2MJH A;  1C09 A;  2J9U B;  1YUX A;  5M5Y L;  1PFY A;  4OO1 G;  2CTK A;  5MF6 A;  2NVX L;  1FHM A;  1XRH A;  1R9T L;  2K1H A;  2UUA H;  2VUM L;  3GTJ L;  1QCV A;  4DV3 H;  1N32 H;  2CWH A;  2CKC A;  2CTE A;  1N36 H;  2OPV A;  2L0Z A;  4AI2 A;  1S03 G;  2VL6 A;  4BY7 L;  1TUA A;  3JR7 A;  4E6Y A;  1E8J A;  2UXC H;  4AI1 A;  4POG A;  3RZO L;  1YUZ A;  4DR5 H;  4DV4 H;  1BE7 A;  1S30 A;  3GTL L;  2P2R A;  4B3R H;  5GAD c;  4JAD A;  5H1S c;  4NZR M;  2JA7 L;  2AYJ A;  1T9O A;  3GTO L;  4G6B A;  4LIJ A;  1I50 L;  4K0K H;  2R92 L;  1SMW A;  2V0F A;  4C2M 1;  3S15 L;  1T9P A;  3OSS D;  4QIW P;  4JI4 H;  1K1G A;  1I94 H;  2GMG A;  3PL5 A;  2BA0 A;  4UY8 1;  2VKC A;  3QVD A;  5LMU H;  1HR0 H;  2CTL A;  3GTQ L;  2PQU A;  5MFZ A;  2UUB H;  1QYB A;  4DV1 H;  4X6A L;  1S2Z A;  3GTP L;  3GTK L;  1WJV A;  2F4V H;  2YU9 L;  4TPU A;  4DUZ H;  1WE8 A;  3SB1 A;  5GAE c;  2PVX A;  2A6H D;  3KYY A;  1DT4 A;  4B8C D;  3GR5 A;  3V69 A;  1TWA L;  1IU5 A;  1N33 H;  2HHH H;  4E9J A;  1IRN A;  4TVM A;  2K2D A;  2CTJ A;  4ZN1 B;  1Z2I A;  4AHY A;  5IYC L;  3HOY L;  4AHZ A;  2ERS A;  2E3U A;  2XJT A;  1RDV A;  2DSX A;  3QD7 X;  4JVH A;  2O4C A;  4OX9 H;  1DX8 A;  5FJ8 L;  1RDG A;  2R93 L;  2XJQ A;  4NBQ A;  3RYG A;  4AYB P;  5AN9 H;  3VPB E;  2PPT A;  3FDJ A;  1XMQ H;  5MFP A;  4X62 H;  4A3I L;  4JAF A;  1CAD A;  4JI6 H;  1SMM A;  2XJR A;  4LF7 H;  1SEI A;  4AM3 A;  4A3K L;  3MQK B;  4DR1 H;  1VIH A;  1J5E H;  1CAA A;  3KDG A;  1FHH A;  2JA6 L;  2ZM6 H;  4EC5 A;  4B8T A;  2LF0 A;  4LF6 H;  4BBS L;  2PT7 G;  4JI5 H;  1B71 A;  1N34 H;  3KDK A;  5JVH 1;  2G8Y A;  2DGR A;  1AN7 A;  5MGN A;  3P2A A;  3FAU A;  2JZX A;  3P8B A;  4BY1 L;  4A3E L;  2Y0S P;  5GAH c;  2FPH X;  1BQ9 A;  2A68 D;  2D9I A;  5IT9 W;  4ZN3 B;  3H0G L;  2LTL A;  3GAB A;  2NVY L;  1F0X A;  3J7A K;  3PIO 1;  4BA1 I;  1TWC L;  2RDV A;  4KHP H;  2JVZ A;  1IU6 A;  1NXE A;  4LHL A;  3WWL A;  3S14 L;  4BXX L;  4DR3 H;  2LCQ A;  4C3H L;  1HNW H;  1HNZ H;  3H9C A;  1J4W A;  4AI3 A;  4RXN A;  4GS7 D;  3RF2 A;  4JVY A;  3SS2 A;  2AXY A;  2PYA A;  3PKJ A;  1B13 A;  4IFD G;  1TWG L;  2H12 A;  4PDB A;  2CTM A;  4JAE A;  3AEV B;  1X4N A;  2CPQ A;  5C4X L;  2Z0S A;  4Y52 L;  1DTJ A;  4U67 1;  1R0J A;  3PKI A;  1DVB A;  4LFC H;  4DR7 H;  1LKO A;  5IY0 A;  1SFO L;  2CTF A;  4A3B L;  2CKA A;  3PO2 L;  1X9Z A;  3PIP 1;  4AIM A;  2E5L H;  1PFV A;  1I3Q L;  1X4M A;  1R0F A;  2JI1 A;  4JI0 H;  4AI0 A;  4YHH H;  4AQY H;  2M4V A;  3HJY B;  3HJW B;  5JVG 1;  2M4Y A;  5IWA H;  1LKM A;  4V19 6;  3NFP I;  1XMO H;  2O5J D;  2QL0 A;  3PZA A;  2RFK B;  5C3E L;  4DV6 H;  1BFY A;  3S16 L;  5LMN H;  2ZQE A;  3QQC E;  3OTO H;  2APO B;  3B08 B;  2JI2 A;  6RXN A;  3S1Q L;  4LF4 H;  4NXM H;  1WCM L;  3J7Z 1;  2NVT L;  5IYD L;  5M3M L;  3S1R L;  4XXB B;  1UG8 A;  3K35 A;  5JEA G;  3GTM L;  2JEB I;  1IRO A;  2C6B A;  3LPE B;  3S2H L;  4AR6 A;  1WTJ A;  3KYX A;  3KYV A;  1IW7 D;  3UOE A;  2A69 D;  5C4J L;  5GAG c;  2JA5 L;  4X65 H;  1S24 A;  3HAX C;  3S17 L;  3M3Y L;  2WAQ P;  3KYU A;  4WAL A;  1ZTG A;  4JYA H;  1XNR H;  4YWM A;  8RXN A;  3HKZ P;  2NVQ L;  2VQF H;  4DV5 H;  3LWP B;  4JI3 H;  2KKD A;  1TWH L;  1PFW A;  3PWF A;  2PY9 A;  3MPS A;  4BA2 I;  4LF9 H;  5K36 G;  4JAG A;  2ANR A;  2M6O A;  4X64 H;  1VBI A;  4XGH A;  2XJU A;  4AR3 A;  3J80 W;  4OD6 A;  5EIN C;  1QQT A;  1BQ8 A;  2UU9 H;  2CWF A;  1NXG A;  2B5I D;  4A3D L;  2MS3 A; 
#chains in the Genus database with same CATH homology
 4K9F A;  4LFA H;  1RYQ A;  1ODH A;  5AI3 A;  1R0G A;  3RZ6 A;  1OWB A;  5K2M E;  1LKP A;  2KN9 A;  4DR6 H;  2M6P A;  4AHW A;  4B3M H;  2XJS A;  5FLX W;  2Y3M A;  2C6A A;  2XJV A;  4JI2 H;  4AR5 A;  2ZIX A;  4YWL A;  2CR8 A;  4NXN H;  4GKJ H;  2NYD A;  4DUY H;  5AI2 A;  4POF A;  3ZG6 A;  3NCV A;  4JV5 H;  5DM7 1;  1YK5 A;  2V0E A;  1YK4 A;  1RB9 A;  2ERJ A;  4DV7 H;  1H7V A;  4GKK H;  4X66 H;  3T1H H;  4DR4 H;  4DV0 H;  1SMU A;  3J7Y 1;  1YV1 A;  2JI3 A;  4AHX A;  1XNQ H;  1RWD A;  2UXB H;  4OCH A;  2PVE A;  4JI8 H;  4ME3 A;  1VZI A;  2PSM C;  1VZH A;  1Z92 B;  4LFB H;  2UUC H;  1VZG A;  2Z3R B;  2UXD H;  4DV2 H;  1B2J A;  3B0A B;  1OWC A;  1FJG H;  5DM6 1;  1R0H A;  1B2O A;  5DT9 A;  3WWN B;  4B3S H;  5RXN A;  3OET A;  3EZJ A;  1LTL A;  2BE5 D;  1NNQ A;  4LF5 H;  7RXN A;  2V3B B;  4NZT M;  1IBM H;  3MSU A;  5A2Q W;  1R0I A;  4YY3 H;  3KYW A;  4AR4 A;  5LL6 b;  1ZRP A;  4JI7 H;  3IU3 I;  3J81 W;  1RYT A;  1VCX A;  1FKA H;  4JI1 H;  3LNL A;  3A44 A;  1T9Q A;  5BR8 H;  4LHN A;  1IBK H;  3RZT A;  1BRF A;  4WFN 1;  2A6E D;  1I6U A;  4G08 A;  2VQE H;  4LF8 H;  3JAM W;  1HNX H;  2Z3Q B;  2XJP A;  5EIO C;  4B3T H;  4DR2 H;  2HR5 A;  1IBL H;  5MLC 3;  1JYB A;  3T1Y H;  1C09 A;  2J9U B;  1YUX A;  5MF6 A;  1FHM A;  2UUA H;  4DV3 H;  1QCV A;  1N32 H;  2CKC A;  1N36 H;  2L0Z A;  4AI2 A;  1S03 G;  2VL6 A;  1E8J A;  4E6Y A;  2UXC H;  4AI1 A;  4POG A;  1YUZ A;  4DR5 H;  4DV4 H;  1BE7 A;  1S30 A;  4B3R H;  5GAD c;  4JAD A;  5H1S c;  4NZR M;  2AYJ A;  1T9O A;  4G6B A;  4K0K H;  1SMW A;  2V0F A;  1T9P A;  3OSS D;  4JI4 H;  1I94 H;  2GMG A;  4UY8 1;  2VKC A;  3QVD A;  5LMU H;  1HR0 H;  5MFZ A;  2UUB H;  1QYB A;  4DV1 H;  1S2Z A;  2F4V H;  1WJV A;  4TPU A;  4DUZ H;  3SB1 A;  5GAE c;  2PVX A;  2A6H D;  3KYY A;  4B8C D;  3GR5 A;  1IU5 A;  1N33 H;  2HHH H;  4E9J A;  1IRN A;  4TVM A;  2K2D A;  4ZN1 B;  4AHY A;  4AHZ A;  2ERS A;  2XJT A;  1RDV A;  2DSX A;  3QD7 X;  2O4C A;  4OX9 H;  1DX8 A;  1RDG A;  2XJQ A;  3RYG A;  5AN9 H;  3VPB E;  2PPT A;  1XMQ H;  5MFP A;  4X62 H;  4JAF A;  1CAD A;  4JI6 H;  1SMM A;  2XJR A;  4LF7 H;  1SEI A;  4DR1 H;  1J5E H;  1CAA A;  3KDG A;  1FHH A;  2ZM6 H;  4EC5 A;  2LF0 A;  4LF6 H;  2PT7 G;  4JI5 H;  1B71 A;  1N34 H;  3KDK A;  5JVH 1;  1AN7 A;  5MGN A;  3P2A A;  3FAU A;  3P8B A;  5GAH c;  2FPH X;  1BQ9 A;  2A68 D;  2D9I A;  5IT9 W;  4ZN3 B;  3GAB A;  1F0X A;  3J7A K;  3PIO 1;  4KHP H;  2RDV A;  1IU6 A;  1NXE A;  4LHL A;  3WWL A;  4DR3 H;  2LCQ A;  1HNW H;  1HNZ H;  4AI3 A;  3RF2 A;  4RXN A;  4GS7 D;  3SS2 A;  2PYA A;  3PKJ A;  1B13 A;  2H12 A;  4PDB A;  4JAE A;  4U67 1;  1R0J A;  3PKI A;  1DVB A;  4LFC H;  4DR7 H;  1LKO A;  5IY0 A;  2CKA A;  1X9Z A;  3PIP 1;  2E5L H;  1R0F A;  2JI1 A;  4JI0 H;  4AI0 A;  4YHH H;  4AQY H;  2M4V A;  5JVG 1;  2M4Y A;  5IWA H;  1LKM A;  4V19 6;  3NFP I;  1XMO H;  2O5J D;  2QL0 A;  3PZA A;  4DV6 H;  1BFY A;  5LMN H;  2ZQE A;  3QQC E;  3OTO H;  3B08 B;  2JI2 A;  6RXN A;  4LF4 H;  4NXM H;  3J7Z 1;  4XXB B;  3K35 A;  1IRO A;  2C6B A;  3LPE B;  4AR6 A;  3KYX A;  3KYV A;  1IW7 D;  2A69 D;  5GAG c;  4X65 H;  1S24 A;  3KYU A;  4JYA H;  1XNR H;  4YWM A;  8RXN A;  2VQF H;  4DV5 H;  4JI3 H;  2KKD A;  3PWF A;  3MPS A;  4LF9 H;  4JAG A;  2M6O A;  4X64 H;  4XGH A;  2XJU A;  4AR3 A;  3J80 W;  4OD6 A;  5EIN C;  1BQ8 A;  2UU9 H;  1NXG A;  2B5I D;  2MS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...