3RF2A

Crystal structure of 30s ribosomal protein s8 from aquifex aeolicus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
165
Chain Sequence
b'VDPIADMFSAIKNAIMRRDDFLYVPSSKLKERILDVLKKEGFIQDWEALKGEKYEEEYKKMKELAEKSPNPKMKRYLKQLEEYNKGTQYPIKIYLKYLDPKKRKSAITNIVKVSKGGRRVYAGVRTMPYVKRGLGIAIVSTDAGVMTDHEARRMRKGGEVIAFVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S8
molecule tags Ribosomal protein
source organism Aquifex aeolicus
publication title The Structure of Aquifex aeolicus Ribosomal Protein S8 Reveals a Unique Subdomain that Contributes to an Extremely Tight Association with 16S rRNA.
pubmed doi rcsb
total genus 46
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3rf2A01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3rf2A02
4B3SH 4DR7H 1HNZH 4LF9H 4DR2H 4JI0H 1S03G 4LFAH 4JI8H 4GKJH 4NXMH 4JI1H 1IBLH 4DV2H 3OTOH 1XNRH 4B3MH 5IT9W 4JI6H 3RF2A 5A2QW 1IBKH 3T1HH 1N34H 5LL6b 4JV5H 4DR5H 4LF6H 4LFBH 5FLXW 2UUCH 2VQEH 1FKAH 4YHHH 1I94H 2VQFH 4X62H 5LMNH 4DR4H 4B3RH 4DR3H 1IBMH 3J81W 2F4VH 4DUYH 1N33H 4JI7H 5IWAH 1XMQH 4JI2H 4LFCH 5BR8H 2HHHH 1I6UA 4AQYH 3JAMW 1J5EH 4KHPH 4DV4H 4LF8H 1HNXH 1HNWH 4DV6H 4DV0H 5LMUH 2UXDH 2UUBH 4DV5H 2E5LH 4JI5H 4X66H 4DUZH 1XNQH 4B3TH 1N36H 1XMOH 4YY3H 3J80W 1AN7A 2UU9H 4NXNH 4DR1H 2UXBH 3J7AK 4GKKH 4LF4H 4X64H 4X65H 1FJGH 2UXCH 4K0KH 4DR6H 4JYAH 4DV1H 4DV7H 4PDBA 4JI3H 1N32H 4DV3H 2ZM6H 1SEIA 4OX9H 2UUAH 4LF7H 4JI4H 1HR0H 3T1YH 4LF5H
chains in the Genus database with same CATH superfamily
2BQRA 5KT4A 4DR7H 2IMWP 2UVVA 3PW0A 1CQIB 2W70A 2YL2A 3SB1A 3K3VA 4JI8H 4GKJH 3G6XA 2CWHA 2VQDA 2AU0A 1ZHSA 4EYHB 4FJUA 2YCHA 3GTLA 3PN1A 3PO2G 3KTMA 3LP8A 1WCMA 4BBSG 4E9JA 2FB9A 5IYZF 1XNRH 2LRRA 5IT9W 3PR4A 4HNTA 2XIGA 4EEYA 2AGPA 4AIMA 4XZ3B 3IG0A 1K1SA 2W9BA 2G8YA 1EUDB 3T1HH 2ZQEA 1JKJB 4BA2I 2CW7A 3H0GA 2R7NA 2J9GA 5D1OB 1UG8A 5LXTF 5I47A 1ODHA 3HOXG 2LTLA 1I7LA 2V9WA 1OWTA 1JLLB 2JZXA 3DF7A 1M6VA 2FLLA 2W7OA 3M9OB 3RAXA 3NCVA 5T14A 1GLVA 4J9PA 5FPRA 2Y3MA 5L1LA 2JEJA 4C5AA 4ECTA 5KFHA 4RAZA 2ASDA 4YHHH 3OETA 2PT7G 2HGSA 2YS7A 1M0WA 2CZGA 4ME6A 1T36A 5D1OA 4A3IG 4YP3A 3GTQA 2IP4A 5KFCA 4YR3A 2FFMA 2E2HA 5FLMG 1VBHA 3RV3A 3RIZA 5DG8A 2BQUA 4DR3H 1R9TA 3TQTA 4ETSA 1B6RA 5BPHA 4HYKA 1MZBA 3J81W 1B6SA 1I7NA 3R23A 2PBZA 5IP9G 5KFUA 1JX4A 3HOZG 2C35B 1WVNA 2YZMA 5KFWA 5DG7A 2V4RA 2RGVA 2FPIB 5KFTA 5KFSA 1S9FA 1GO3E 4I50F 1CQJB 2C28A 3U1KA 2FK1A 5EWGA 5F9LA 3BABA 2WTFA 4GC6A 3N43B 2ANNA 1BNCA 1W93A 3T5JA 1DV1A 3RB0A 1J5EH 3PVXA 1EYZA 1PK8A 5DGBA 3NGDA 2R8GA 2J6SA 3VKEA 5KT6A 3GTGA 3JRXA 2E2IA 3PR5B 5LMUH 2NN6G 2C2RA 2J6UA 3QZ7A 2UXDH 2CTMA 2UUBH 4ECUA 4AM3A 1Y1WA 2CTKA 4JVYA 1FVIA 3PZPA 4X66H 1Y1VG 3K3PA 1MSZA 2UVRA 3GV5B 4QJFA 4TV8F 2BR0A 3HKZE 4TQRA 2R82A 2FLNA 5KFJA 3JSLA 2NU8B 2UU9H 2O4CA 5IP7G 5EDWA 4FJSA 4DR1H 2UXBH 3KHRA 3V6HA 2DIKA 3BJYA 2JEFA 4FBTA 3MWMA 3GV7B 4XYMB 1FJGH 4E4TA 3R5XA 2W6NA 3BA8A 2W6OA 4FM9A 3N41B 5IYDG 3RAQA 2HH2A 4DR6H 3H0GG 1VS0A 2R7ZA 1EZ1A 4DV1H 2DLNA 3BQ2A 1E4EA 2YZNA 5FPOA 4EFEA 5CA1F 5KFKA 5KFGA 2YYAA 3TIGA 3I0PA 1PX2A 2GPSA 4U6PA 4DV3H 2FE3A 2R84A 1ZZJA 5EWFA 4RB1A 1T3NA 4OX9H 5CAEB 3L7ZC 1RYSA 4UFZA 2YZGA 1TA8A 1KJJA 1TWCA 4R7RA 4JI4H 1X4MA 3EPGA 3WO0A 4LF5H 3GIQA 4GLXA 5L1JA 2R92A 3RV4A 4EBEA 3OSSD 1HNZH 2PY9A 2ZDGA 3KAKA 3CQZA 5KFNA 1T94A 3RGXA 3G8CA 2DZDA 3U9SA 2VUMA 4IR9A 1W96A 5LOVF 2JEGA 4JI1H 4ZOLF 3GIPA 2YU9A 2I80A 2R7MA 2VUGA 4MTDA 4O3SA 1BJTA 2BL5A 1RK5A 2GLTA 3OTOH 1X9ZA 4YJ3F 2JA9A 4QIWA 5H80A 4J9MA 3V6JA 1UNNC 3RF2A 4OD6A 2J6TA 4EFBA 5DQHA 1V4YA 2NU6B 3SI8A 3R5FA 1IBKH 3Q1KA 4G3IA 3GIDA 5LL6b 1M7JA 1WSCA 4CC5A 4YB8B 2DPJA 5DLFA 2B63A 3M9NB 1WR2A 1J4WA 2R86A 3OHAA 2C00A 4U7CA 4OO1G 1DT4A 2M8WA 4MA0A 2VOBA 2FMAA 3BG5A 4RB2C 5FLXW 4AYBE 5JVDF 2WAQE 4O2AF 1I3QA 1TWFA 1KJIA 5KT3A 1DGSA 3RB4A 2PQUA 3V6KA 2JA6A 1B33N 3GTKA 5JUMA 4UCVA 2XCPA 1K1GA 1I94H 2JEAI 4UCRA 4AYBA 4YQWA 1KBLA 2VQFH 3KXYT 3MR2A 2XD4A 4J9QA 2C22A 2AXYA 2M6QA 4X62H 5LMNH 3FDSA 5LP6F 4B3RH 3I4NG 1EUCB 4IRCA 2ZJTA 2CKZB 4JVHA 3RB3A 2F4VH 1KJ8A 5KFXA 4ECXA 2VR1A 1VIHA 1E4EB 4WALA 3GABA 1E4GT 1SYXB 4HNUA 4RUCA 4YJ2F 2NUAB 4DUYH 5FD5A 4RB3C 3IN5A 2QYZA 2FPGB 4IAJA 5KG0A 4Q45A 2BQ3A 5JEAG 5L1IA 2VA3A 4I7HA 5DQGA 3L4JA 2OH2A 1V9NA 4DL6A 4J9SA 3I4MG 4J9LA 2Z0SA 5BR8H 1S10A 1EC6A 2Q2TA 2FKLA 1C3OA 3Q2OA 2CTFA 3JAMW 5KFYA 4A3DG 1KJQA 5FD6A 2R7LA 1VIGA 3H20A 1HNWH 4DV6H 4A3JG 2FLPA 2XCLA 4BA1I 2PMZA 2JEIA 1EHIA 5LYJF 4QWCA 3N6XA 2NU7B 1A9XA 1X9NA 4Q8EA 3VPCA 2CTJA 4F4YA 2XGPA 5C0XG 2XCAA 4J9RA 5KG3A 3HOUG 5CB4F 1C30A 4DUZH 1ZTGA 4MV1A 5KFAA 2V59A 4B3TH 3RGZA 4QWEA 4EBCA 2VUMG 4MTEA 4RNMA 2W57A 4YR0A 4QWDA 2OWOA 4EBDA 2Y0SA 3G6YA 3T5LA 5KX5F 2W8KA 2OLSA 3J7AK 5KFRA 4ZHQF 3VPDA 1UC8A 1N48A 2I8CA 1WTJA 3KHHA 3UQ8A 4X65H 3T5HA 3F8NA 1IOWA 4K0KH 3MFHA 4UCOA 4J9OA 1XDNA 3PO3G 4JYAH 5D1PA 4O3NA 4ED2A 3WNZA 4F50A 2R93A 2R87A 1CS0A 1ZZKA 3RJ0A 5JH7F 2B63G 5DT9A 2D9IA 5J2TF 3N8DA 2WE6A 4MA5A 2ZM6H 5KG1A 2JA8G 2FMRA 5EOYA 1SEIA 4EGQA 2MJHA 4RAYA 3PW5A 4ECSA 4A2AA 2R85A 4M9UA 2E3UA 4IHJF 3G6VA 1TWGA 4ZQIA 2W6PA 4F4WA 5KFPA 5IYBG 1HR0H 2LTMA 3AEVB 4RZQA 3T1YH 3UFXB 4DL5A 5KG5A 1S0MA 3MR6A 3E5NA 2W6MA 1DV2A 4RB0A 5LA6F 4LFAH 1AUVA 4Y8VB 3SE7A 3V4ZA 5FJ8G 5C8YF 2FK3A 4UCUA 2CWFA 3RBEA 4ED0A 4XX0B 4ED3A 1IBLH 4DV2H 4QW8A 2Q2UA 2WAQA 5DGAA 1J5KA 1Z2OX 2Y0SE 2JA5A 3CVZA 1S0OA 3HBLA 1WH2A 4HQ6A 1ZETA 1Z2IA 2I87A 4B8CD 2CTEA 4B3MH 4JI6H 3QZ8A 5KKNB 3RB6A 3HOWG 2WYOA 1X0AA 4IFDG 5A2QW 2R8IA 2IA6A 2P2RA 3GIMA 5HV6A 4EG0A 4RU9A 5C1PA 2HVQA 3GIKA 3MFIA 4JV5H 5BMVF 5KT7A 4DR5H 2UVWA 1GYFA 2C2DA 1BGWA 4UCTA 4LF6H 4QIWE 4ECZA 4O3RA 1JXLA 4Q43A 3TIIA 2HJWA 3HOVG 4ECVA 1NXUA 4A3GG 2FP4B 1RJRA 2NVXA 5K2MA 3GIJA 1A0IA 3N40P 3KHGA 2DPIA 5C4XG 1GSHA 4LSXA 2VQEH 3GTPA 2RF4A 2AQ4A 4WD3A 1FKAH 2V5AA 2JE6I 3H3VH 1L2ZA 4MV3A 2VKCA 1V9PA 1WHRA 5BPFA 4ECYA 2RDJA 4YAJB 1DTJA 1Z2NX 3RTXA 4GC7A 5KFLA 2WDTA 4O2BF 4EEQA 4I4TF 1IBMH 4BY7G 2AGOA 2O03A 3EPIA 3R5HA 1I50A 2JVZA 4NZRM 3WO1A 4IRKA 4YR2A 1DIKA 3TINA 2ZDQA 1N33H 4IRDA 4A3CG 1V8CA 1GGOA 5KFIA 4JI7H 4Q8FA 5KG6A 2CPQA 5IWAH 2W71A 3VPBA 3PW4A 3GR5A 2HHHH 3JZIA 3JRWA 4ECRA 2CW8A 4AQYH 4BY1G 3I12A 4LSAA 4KHPH 1F0XA 3GLKA 4DL3A 4ZI7F 1HNXH 3V69A 2M05A 4ED6A 4O4LF 2NU9B 4DV0H 4C5CA 4ECQA 5KFDA 2YRXA 2BA0A 4MAMA 5KFZA 4A3BG 1KEEA 3FKIA 3HKZA 4DV5H 2E5LH 1V51A 2VA2A 3TQ1A 2W6QA 2FJZA 4WBNF 1XNQH 1N36H 1VAJA 1JDEA 4FBUA 4FS1A 2CTLA 3ETJA 1AN7A 3U9TA 3ORQA 4RNOA 4QW9A 4FS2A 4ED1A 2ASLA 4A3FG 4LIJA 3BA9A 4NZTM 4DL4A 1KC7A 5J2UF 3ETHA 4EC5A 4B8TA 1O75A 4X64H 4LH6A 2FPHX 4TV9F 4O3QA 5KG4A 4RZRA 3KHLA 3N44B 4O3OA 2QNDA 3N42B 4A3EG 2JA7G 2R92G 3FMAA 3UOEA 5L9XA 3OHBA 3QD7X 4FU0A 4JV1A 4NLGA 2W9CA 4CC6A 3V4SA 2OPVA 4H8AA 4DV7H 4RUAA 1Y1VA 4LMYA 4J0MA 5KFFA 2ATLA 5JVLA 4A3KG 2C2EA 2HVSA 3KAJA 5GONF 4C2MA 1RJPA 5EWEA 1JIHA 2UUAH 1WCMG 3FKIG 4NBQA 1VKZA 5C44G 2HH3A 3GIIA 4LF7H 2W9CB 4Q44A 4QMFB 3OUZA 2PVPA 4LH7A 5F9NA 3MWEA 4Q0YA 4M7EA 2JA6G 2X06A 2PMZE 1S20A 2R8HA 2K1HA 4B3SH 3GTOA 2LF0A 1ULZA 4PWQA 2VPSA 4LF9H 4DR2H 4JI0H 2YRWA 5L1KA 1S03G 1K83A 1E4FT 4XYLB 5EZYF 4O3PA 5KFQA 5KT5A 2CPMA 4NXMH 1KHMA 5DLGA 2XGQA 4TQSA 1TAEA 4BWSC 5C1OA 4MV9A 2X0SA 5KFVA 4JV0A 4DLKA 2W6ZA 5KG2A 3MR3A 3GTMA 2R7KA 4A3LG 1XRHA 3QFFA 1Z2PX 1K1QA 1SCUB 4QWAA 1VBGA 1N34H 3H40A 1S97A 1S0NA 2PN1A 3OSPA 2FK2A 4ECWA 3K5IA 3BAAA 1ZQ7A 4JUZA 4LFBH 3PW2A 2JEBI 5KT2A 1VBIA 2R6FA 2WB1E 1GSAA 5K36G 5KFOA 4IZOA 1UC9A 3RBDA 2UUCH 2P0AA 4I55F 5C5JA 3Q8QB 3PW7A 3LMLA 1PQXA 4UCSA 5DQIA 4O4HF 3Q8SB 5HBRB 4HNVA 2WB1A 2AGQA 2YS6A 3GV8B 4DR4H 4OCHA 2QK4A 4MV8A 3M9MB 2ASJA 4ED8A 2R8KA 1WE8A 3RFCA 1Y1WG 2ZDHA 3ORRA 2FPPB 4RNNA 2A1SA 3H4DA 2UVUA 3AYHB 2YW2A 2ALZA 1P8LA 2RGRA 3BQ1A 3L2PA 5KFBA 2RDIA 3RUPA 3VMMA 4C5BA 5DG9A 1KJ9A 3MWDA 3KDKA 1XMQH 1IOVA 1TWAA 3L4KA 1SFOA 1X4NA 4JI2H 4LFCH 3HOYG 4IWYA 1I6UA 2VPQA 4DV4H 3EYYA 4MV4A 4LF8H 2V58A 1BXRA 4MV6A 4BXXG 2GPWA 5IYCG 2W9AA 4ED7A 2NVYA 3BQ0A 1S68A 4HR7A 2W7PA 2DWCA 1TUAA 3H4BA 3OSNA 4JI5H 4F4ZA 2R7ZG 4JV2A 2R93G 4QWBA 3KDGA 3LWBA 3FAUA 4DL2A 2V4QA 3EZJA 2CQYA 2DGRA 2MCTA 2JA7A 1XMOH 5JQWA 4YY3H 2IBKA 3J80W 4MV7A 1ZZIA 4EGJA 4J9NA 1GSOA 4NXNH 2W9BB 4G08A 4F4XA 5CA0F 4R8UB 3Q8PB 3GILA 3KALA 4O4IF 3MR5A 3GTJA 4GKKH 4LF4H 3K5HA 4R8UA 1RYRA 3GQCA 3HB9A 4TUYF 4BBRG 3M4IA 2XC9A 3GKUA 2UXCH 1M0TA 1Y14B 2KSWA 5C3EG 1RJQA 4A93G 4DL7A 2OPUA 1ZHQA 1N56A 4YAKB 1RK6A 4PDBA 4WANA 4YBZB 1AUXA 1B04A 5KFEA 4EYIB 2HVRA 2SCUB 4JI3H 4L1KA 1N32H 2YQRA 3JSNA 5KG7A 2W8LA 3Q8RB 2R8JA 4IWXA 5KFMA 4J9KA 2JA5G 5D8DA 3OUUA 4IR1A 4A3MG 1JDBB 3MJFA 1CE8A 3C0FB 3HXLA 3T5KA 4APMA 2ANRA 4A2BA 1TWHA
chains in the Genus database with same CATH topology
4B3SH 3OSSD 2LF0A 4DR7H 1HNZH 3KAKA 2VPSA 4LF9H 4DR2H 4JI0H 3SB1A 1S03G 4LFAH 1E4FT 3K3VA 4RB0A 4JI8H 3RGXA 4GKJH 4UCUA 4NXMH 4JI1H 1ZHSA 2YCHA 3PN1A 1IBLH 4DV2H 2VUGA 4MTDA 2Q2UA 1TAEA 1BJTA 4BWSC 4MV9A 1Z2OX 3CVZA 4E9JA 3OTOH 1WH2A 1X9ZA 1XNRH 4B8CD 4B3MH 5IT9W 4FM9A 4JI6H 2XIGA 3RF2A 2WYOA 4OD6A 5A2QW 1Z2PX 3IG0A 4EFBA 1IBKH 3T1HH 2ZQEA 1N34H 2CW7A 5LL6b 2HVQA 4CC5A 5D1OB 4JV5H 4DR5H 1GYFA 1ODHA 1BGWA 3BAAA 4LF6H 4UCTA 4LFBH 2VOBA 4RB2C 5FLXW 3DF7A 1A0IA 3N40P 3NCVA 4LSXA 2UUCH 2VQEH 5FPRA 3LMLA 1DGSA 1FKAH 2Y3MA 1L2ZA 4RAZA 4UCSA 4YHHH 2VKCA 1V9PA 4UCVA 1I94H 3OETA 2PT7G 2HGSA 4UCRA 1M0WA 5D1OA 2VQFH 3KXYT 4X62H 5LMNH 4OCHA 4DR4H 4B3RH 1Z2NX 3RTXA 3RIZA 2WDTA 4DR3H 2ZJTA 4EEQA 1IBMH 4ETSA 2O03A 1MZBA 3J81W 2F4VH 4NZRM 3GABA 1E4GT 1SYXB 2RGVA 4DUYH 1N33H 1P8LA 5FD5A 4RB3C 4IAJA 2RGRA 3L2PA 4I7HA 4JI7H 3L4JA 3L4KA 5IWAH 3KDKA 1XMQH 4JI2H 4LFCH 3GR5A 5BR8H 2HHHH 3BABA 3N43B 2CW8A 1I6UA 2Q2TA 4AQYH 3JAMW 1J5EH 4LSAA 4KHPH 1F0XA 4DV4H 3EYYA 5FD6A 4LF8H 1HNXH 1HNWH 4DV6H 3H20A 4DV0H 5LMUH 2UXDH 3N6XA 1S68A 1X9NA 2UUBH 4DV5H 2E5LH 4JI5H 1FVIA 3KDGA 4X66H 3FAUA 4DUZH 3RGZA 1XNQH 4B3TH 3EZJA 1N36H 2MCTA 4MTEA 1XMOH 4YY3H 3J80W 2W57A 4MV7A 2OWOA 3JSLA 1AN7A 2O4CA 2UU9H 4NXNH 4DR1H 4G08A 2UXBH 3J7AK 3BA9A 4NZTM 3KALA 4GKKH 4EC5A 4LF4H 1O75A 4X64H 3MWMA 2FPHX 4LH6A 3UQ8A 4X65H 1FJGH 3M4IA 3N44B 3F8NA 3N42B 2UXCH 1M0TA 2KSWA 4K0KH 3BA8A 3FMAA 3N41B 1XDNA 3QD7X 4DR6H 4JYAH 1ZHQA 4UCOA 1VS0A 5D1PA 4CC6A 4DV1H 4DV7H 3RJ0A 4PDBA 4EFEA 2HVRA 1B04A 5DT9A 5FPOA 2D9IA 4LMYA 4J0MA 4JI3H 2HVSA 1N32H 3JSNA 2WE6A 4DV3H 2ZM6H 2FE3A 3KAJA 5EOYA 4RB1A 1SEIA 4OX9H 4RAYA 2UUAH 4A2AA 4UFZA 4LF7H 1TA8A 4R7RA 4JI4H 4LH7A 3C0FB 1HR0H 3HXLA 4Q0YA 4M7EA 4RZQA 3T1YH 4LF5H 4APMA 4A2BA 4GLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S H;  4DR7 H;  1HNZ H;  4LF9 H;  4DR2 H;  4JI0 H;  1S03 G;  4LFA H;  4JI8 H;  4GKJ H;  4NXM H;  4JI1 H;  1IBL H;  4DV2 H;  3OTO H;  1XNR H;  4B3M H;  5IT9 W;  4JI6 H;  3RF2 A;  5A2Q W;  1IBK H;  3T1H H;  1N34 H;  5LL6 b;  4JV5 H;  4DR5 H;  4LF6 H;  4LFB H;  5FLX W;  2UUC H;  2VQE H;  1FKA H;  4YHH H;  1I94 H;  2VQF H;  4X62 H;  5LMN H;  4DR4 H;  4B3R H;  4DR3 H;  1IBM H;  3J81 W;  2F4V H;  4DUY H;  1N33 H;  4JI7 H;  5IWA H;  1XMQ H;  4JI2 H;  4LFC H;  5BR8 H;  2HHH H;  1I6U A;  4AQY H;  3JAM W;  1J5E H;  4KHP H;  4DV4 H;  4LF8 H;  1HNX H;  1HNW H;  4DV6 H;  4DV0 H;  5LMU H;  2UXD H;  2UUB H;  4DV5 H;  2E5L H;  4JI5 H;  4X66 H;  4DUZ H;  1XNQ H;  4B3T H;  1N36 H;  1XMO H;  4YY3 H;  3J80 W;  1AN7 A;  2UU9 H;  4NXN H;  4DR1 H;  2UXB H;  3J7A K;  4GKK H;  4LF4 H;  4X64 H;  4X65 H;  1FJG H;  2UXC H;  4K0K H;  4DR6 H;  4JYA H;  4DV1 H;  4DV7 H;  4PDB A;  4JI3 H;  1N32 H;  4DV3 H;  2ZM6 H;  1SEI A;  4OX9 H;  2UUA H;  4LF7 H;  4JI4 H;  1HR0 H;  3T1Y H;  4LF5 H; 
#chains in the Genus database with same CATH topology
 2BQR A;  5KT4 A;  4DR7 H;  2IMW P;  2UVV A;  3PW0 A;  1CQI B;  2W70 A;  2YL2 A;  3SB1 A;  3K3V A;  4JI8 H;  4GKJ H;  3G6X A;  2CWH A;  2VQD A;  2AU0 A;  1ZHS A;  4EYH B;  4FJU A;  2YCH A;  3GTL A;  3PN1 A;  3PO2 G;  3KTM A;  3LP8 A;  1WCM A;  4BBS G;  4E9J A;  2FB9 A;  5IYZ F;  1XNR H;  2LRR A;  5IT9 W;  3PR4 A;  4HNT A;  2XIG A;  4EEY A;  2AGP A;  4AIM A;  4XZ3 B;  3IG0 A;  1K1S A;  2W9B A;  2G8Y A;  1EUD B;  3T1H H;  2ZQE A;  1JKJ B;  4BA2 I;  2CW7 A;  3H0G A;  2R7N A;  2J9G A;  5D1O B;  1UG8 A;  5LXT F;  5I47 A;  1ODH A;  3HOX G;  2LTL A;  1I7L A;  2V9W A;  1OWT A;  1JLL B;  2JZX A;  3DF7 A;  1M6V A;  2FLL A;  2W7O A;  3M9O B;  3RAX A;  3NCV A;  5T14 A;  1GLV A;  4J9P A;  5FPR A;  2Y3M A;  5L1L A;  2JEJ A;  4C5A A;  4ECT A;  5KFH A;  4RAZ A;  2ASD A;  4YHH H;  3OET A;  2PT7 G;  2HGS A;  2YS7 A;  1M0W A;  2CZG A;  4ME6 A;  1T36 A;  5D1O A;  4A3I G;  4YP3 A;  3GTQ A;  2IP4 A;  5KFC A;  4YR3 A;  2FFM A;  2E2H A;  5FLM G;  1VBH A;  3RV3 A;  3RIZ A;  5DG8 A;  2BQU A;  4DR3 H;  1R9T A;  3TQT A;  4ETS A;  1B6R A;  5BPH A;  4HYK A;  1MZB A;  3J81 W;  1B6S A;  1I7N A;  3R23 A;  2PBZ A;  5IP9 G;  5KFU A;  1JX4 A;  3HOZ G;  2C35 B;  1WVN A;  2YZM A;  5KFW A;  5DG7 A;  2V4R A;  2RGV A;  2FPI B;  5KFT A;  5KFS A;  1S9F A;  1GO3 E;  4I50 F;  1CQJ B;  2C28 A;  3U1K A;  2FK1 A;  5EWG A;  5F9L A;  3BAB A;  2WTF A;  4GC6 A;  3N43 B;  2ANN A;  1BNC A;  1W93 A;  3T5J A;  1DV1 A;  3RB0 A;  1J5E H;  3PVX A;  1EYZ A;  1PK8 A;  5DGB A;  3NGD A;  2R8G A;  2J6S A;  3VKE A;  5KT6 A;  3GTG A;  3JRX A;  2E2I A;  3PR5 B;  5LMU H;  2NN6 G;  2C2R A;  2J6U A;  3QZ7 A;  2UXD H;  2CTM A;  2UUB H;  4ECU A;  4AM3 A;  1Y1W A;  2CTK A;  4JVY A;  1FVI A;  3PZP A;  4X66 H;  1Y1V G;  3K3P A;  1MSZ A;  2UVR A;  3GV5 B;  4QJF A;  4TV8 F;  2BR0 A;  3HKZ E;  4TQR A;  2R82 A;  2FLN A;  5KFJ A;  3JSL A;  2NU8 B;  2UU9 H;  2O4C A;  5IP7 G;  5EDW A;  4FJS A;  4DR1 H;  2UXB H;  3KHR A;  3V6H A;  2DIK A;  3BJY A;  2JEF A;  4FBT A;  3MWM A;  3GV7 B;  4XYM B;  1FJG H;  4E4T A;  3R5X A;  2W6N A;  3BA8 A;  2W6O A;  4FM9 A;  3N41 B;  5IYD G;  3RAQ A;  2HH2 A;  4DR6 H;  3H0G G;  1VS0 A;  2R7Z A;  1EZ1 A;  4DV1 H;  2DLN A;  3BQ2 A;  1E4E A;  2YZN A;  5FPO A;  4EFE A;  5CA1 F;  5KFK A;  5KFG A;  2YYA A;  3TIG A;  3I0P A;  1PX2 A;  2GPS A;  4U6P A;  4DV3 H;  2FE3 A;  2R84 A;  1ZZJ A;  5EWF A;  4RB1 A;  1T3N A;  4OX9 H;  5CAE B;  3L7Z C;  1RYS A;  4UFZ A;  2YZG A;  1TA8 A;  1KJJ A;  1TWC A;  4R7R A;  4JI4 H;  1X4M A;  3EPG A;  3WO0 A;  4LF5 H;  3GIQ A;  4GLX A;  5L1J A;  2R92 A;  3RV4 A;  4EBE A;  3OSS D;  1HNZ H;  2PY9 A;  2ZDG A;  3KAK A;  3CQZ A;  5KFN A;  1T94 A;  3RGX A;  3G8C A;  2DZD A;  3U9S A;  2VUM A;  4IR9 A;  1W96 A;  5LOV F;  2JEG A;  4JI1 H;  4ZOL F;  3GIP A;  2YU9 A;  2I80 A;  2R7M A;  2VUG A;  4MTD A;  4O3S A;  1BJT A;  2BL5 A;  1RK5 A;  2GLT A;  3OTO H;  1X9Z A;  4YJ3 F;  2JA9 A;  4QIW A;  5H80 A;  4J9M A;  3V6J A;  1UNN C;  3RF2 A;  4OD6 A;  2J6T A;  4EFB A;  5DQH A;  1V4Y A;  2NU6 B;  3SI8 A;  3R5F A;  1IBK H;  3Q1K A;  4G3I A;  3GID A;  5LL6 b;  1M7J A;  1WSC A;  4CC5 A;  4YB8 B;  2DPJ A;  5DLF A;  2B63 A;  3M9N B;  1WR2 A;  1J4W A;  2R86 A;  3OHA A;  2C00 A;  4U7C A;  4OO1 G;  1DT4 A;  2M8W A;  4MA0 A;  2VOB A;  2FMA A;  3BG5 A;  4RB2 C;  5FLX W;  4AYB E;  5JVD F;  2WAQ E;  4O2A F;  1I3Q A;  1TWF A;  1KJI A;  5KT3 A;  1DGS A;  3RB4 A;  2PQU A;  3V6K A;  2JA6 A;  1B33 N;  3GTK A;  5JUM A;  4UCV A;  2XCP A;  1K1G A;  1I94 H;  2JEA I;  4UCR A;  4AYB A;  4YQW A;  1KBL A;  2VQF H;  3KXY T;  3MR2 A;  2XD4 A;  4J9Q A;  2C22 A;  2AXY A;  2M6Q A;  4X62 H;  5LMN H;  3FDS A;  5LP6 F;  4B3R H;  3I4N G;  1EUC B;  4IRC A;  2ZJT A;  2CKZ B;  4JVH A;  3RB3 A;  2F4V H;  1KJ8 A;  5KFX A;  4ECX A;  2VR1 A;  1VIH A;  1E4E B;  4WAL A;  3GAB A;  1E4G T;  1SYX B;  4HNU A;  4RUC A;  4YJ2 F;  2NUA B;  4DUY H;  5FD5 A;  4RB3 C;  3IN5 A;  2QYZ A;  2FPG B;  4IAJ A;  5KG0 A;  4Q45 A;  2BQ3 A;  5JEA G;  5L1I A;  2VA3 A;  4I7H A;  5DQG A;  3L4J A;  2OH2 A;  1V9N A;  4DL6 A;  4J9S A;  3I4M G;  4J9L A;  2Z0S A;  5BR8 H;  1S10 A;  1EC6 A;  2Q2T A;  2FKL A;  1C3O A;  3Q2O A;  2CTF A;  3JAM W;  5KFY A;  4A3D G;  1KJQ A;  5FD6 A;  2R7L A;  1VIG A;  3H20 A;  1HNW H;  4DV6 H;  4A3J G;  2FLP A;  2XCL A;  4BA1 I;  2PMZ A;  2JEI A;  1EHI A;  5LYJ F;  4QWC A;  3N6X A;  2NU7 B;  1A9X A;  1X9N A;  4Q8E A;  3VPC A;  2CTJ A;  4F4Y A;  2XGP A;  5C0X G;  2XCA A;  4J9R A;  5KG3 A;  3HOU G;  5CB4 F;  1C30 A;  4DUZ H;  1ZTG A;  4MV1 A;  5KFA A;  2V59 A;  4B3T H;  3RGZ A;  4QWE A;  4EBC A;  2VUM G;  4MTE A;  4RNM A;  2W57 A;  4YR0 A;  4QWD A;  2OWO A;  4EBD A;  2Y0S A;  3G6Y A;  3T5L A;  5KX5 F;  2W8K A;  2OLS A;  3J7A K;  5KFR A;  4ZHQ F;  3VPD A;  1UC8 A;  1N48 A;  2I8C A;  1WTJ A;  3KHH A;  3UQ8 A;  4X65 H;  3T5H A;  3F8N A;  1IOW A;  4K0K H;  3MFH A;  4UCO A;  4J9O A;  1XDN A;  3PO3 G;  4JYA H;  5D1P A;  4O3N A;  4ED2 A;  3WNZ A;  4F50 A;  2R93 A;  2R87 A;  1CS0 A;  1ZZK A;  3RJ0 A;  5JH7 F;  2B63 G;  5DT9 A;  2D9I A;  5J2T F;  3N8D A;  2WE6 A;  4MA5 A;  2ZM6 H;  5KG1 A;  2JA8 G;  2FMR A;  5EOY A;  1SEI A;  4EGQ A;  2MJH A;  4RAY A;  3PW5 A;  4ECS A;  4A2A A;  2R85 A;  4M9U A;  2E3U A;  4IHJ F;  3G6V A;  1TWG A;  4ZQI A;  2W6P A;  4F4W A;  5KFP A;  5IYB G;  1HR0 H;  2LTM A;  3AEV B;  4RZQ A;  3T1Y H;  3UFX B;  4DL5 A;  5KG5 A;  1S0M A;  3MR6 A;  3E5N A;  2W6M A;  1DV2 A;  4RB0 A;  5LA6 F;  4LFA H;  1AUV A;  4Y8V B;  3SE7 A;  3V4Z A;  5FJ8 G;  5C8Y F;  2FK3 A;  4UCU A;  2CWF A;  3RBE A;  4ED0 A;  4XX0 B;  4ED3 A;  1IBL H;  4DV2 H;  4QW8 A;  2Q2U A;  2WAQ A;  5DGA A;  1J5K A;  1Z2O X;  2Y0S E;  2JA5 A;  3CVZ A;  1S0O A;  3HBL A;  1WH2 A;  4HQ6 A;  1ZET A;  1Z2I A;  2I87 A;  4B8C D;  2CTE A;  4B3M H;  4JI6 H;  3QZ8 A;  5KKN B;  3RB6 A;  3HOW G;  2WYO A;  1X0A A;  4IFD G;  5A2Q W;  2R8I A;  2IA6 A;  2P2R A;  3GIM A;  5HV6 A;  4EG0 A;  4RU9 A;  5C1P A;  2HVQ A;  3GIK A;  3MFI A;  4JV5 H;  5BMV F;  5KT7 A;  4DR5 H;  2UVW A;  1GYF A;  2C2D A;  1BGW A;  4UCT A;  4LF6 H;  4QIW E;  4ECZ A;  4O3R A;  1JXL A;  4Q43 A;  3TII A;  2HJW A;  3HOV G;  4ECV A;  1NXU A;  4A3G G;  2FP4 B;  1RJR A;  2NVX A;  5K2M A;  3GIJ A;  1A0I A;  3N40 P;  3KHG A;  2DPI A;  5C4X G;  1GSH A;  4LSX A;  2VQE H;  3GTP A;  2RF4 A;  2AQ4 A;  4WD3 A;  1FKA H;  2V5A A;  2JE6 I;  3H3V H;  1L2Z A;  4MV3 A;  2VKC A;  1V9P A;  1WHR A;  5BPF A;  4ECY A;  2RDJ A;  4YAJ B;  1DTJ A;  1Z2N X;  3RTX A;  4GC7 A;  5KFL A;  2WDT A;  4O2B F;  4EEQ A;  4I4T F;  1IBM H;  4BY7 G;  2AGO A;  2O03 A;  3EPI A;  3R5H A;  1I50 A;  2JVZ A;  4NZR M;  3WO1 A;  4IRK A;  4YR2 A;  1DIK A;  3TIN A;  2ZDQ A;  1N33 H;  4IRD A;  4A3C G;  1V8C A;  1GGO A;  5KFI A;  4JI7 H;  4Q8F A;  5KG6 A;  2CPQ A;  5IWA H;  2W71 A;  3VPB A;  3PW4 A;  3GR5 A;  2HHH H;  3JZI A;  3JRW A;  4ECR A;  2CW8 A;  4AQY H;  4BY1 G;  3I12 A;  4LSA A;  4KHP H;  1F0X A;  3GLK A;  4DL3 A;  4ZI7 F;  1HNX H;  3V69 A;  2M05 A;  4ED6 A;  4O4L F;  2NU9 B;  4DV0 H;  4C5C A;  4ECQ A;  5KFD A;  2YRX A;  2BA0 A;  4MAM A;  5KFZ A;  4A3B G;  1KEE A;  3FKI A;  3HKZ A;  4DV5 H;  2E5L H;  1V51 A;  2VA2 A;  3TQ1 A;  2W6Q A;  2FJZ A;  4WBN F;  1XNQ H;  1N36 H;  1VAJ A;  1JDE A;  4FBU A;  4FS1 A;  2CTL A;  3ETJ A;  1AN7 A;  3U9T A;  3ORQ A;  4RNO A;  4QW9 A;  4FS2 A;  4ED1 A;  2ASL A;  4A3F G;  4LIJ A;  3BA9 A;  4NZT M;  4DL4 A;  1KC7 A;  5J2U F;  3ETH A;  4EC5 A;  4B8T A;  1O75 A;  4X64 H;  4LH6 A;  2FPH X;  4TV9 F;  4O3Q A;  5KG4 A;  4RZR A;  3KHL A;  3N44 B;  4O3O A;  2QND A;  3N42 B;  4A3E G;  2JA7 G;  2R92 G;  3FMA A;  3UOE A;  5L9X A;  3OHB A;  3QD7 X;  4FU0 A;  4JV1 A;  4NLG A;  2W9C A;  4CC6 A;  3V4S A;  2OPV A;  4H8A A;  4DV7 H;  4RUA A;  1Y1V A;  4LMY A;  4J0M A;  5KFF A;  2ATL A;  5JVL A;  4A3K G;  2C2E A;  2HVS A;  3KAJ A;  5GON F;  4C2M A;  1RJP A;  5EWE A;  1JIH A;  2UUA H;  1WCM G;  3FKI G;  4NBQ A;  1VKZ A;  5C44 G;  2HH3 A;  3GII A;  4LF7 H;  2W9C B;  4Q44 A;  4QMF B;  3OUZ A;  2PVP A;  4LH7 A;  5F9N A;  3MWE A;  4Q0Y A;  4M7E A;  2JA6 G;  2X06 A;  2PMZ E;  1S20 A;  2R8H A;  2K1H A;  4B3S H;  3GTO A;  2LF0 A;  1ULZ A;  4PWQ A;  2VPS A;  4LF9 H;  4DR2 H;  4JI0 H;  2YRW A;  5L1K A;  1S03 G;  1K83 A;  1E4F T;  4XYL B;  5EZY F;  4O3P A;  5KFQ A;  5KT5 A;  2CPM A;  4NXM H;  1KHM A;  5DLG A;  2XGQ A;  4TQS A;  1TAE A;  4BWS C;  5C1O A;  4MV9 A;  2X0S A;  5KFV A;  4JV0 A;  4DLK A;  2W6Z A;  5KG2 A;  3MR3 A;  3GTM A;  2R7K A;  4A3L G;  1XRH A;  3QFF A;  1Z2P X;  1K1Q A;  1SCU B;  4QWA A;  1VBG A;  1N34 H;  3H40 A;  1S97 A;  1S0N A;  2PN1 A;  3OSP A;  2FK2 A;  4ECW A;  3K5I A;  3BAA A;  1ZQ7 A;  4JUZ A;  4LFB H;  3PW2 A;  2JEB I;  5KT2 A;  1VBI A;  2R6F A;  2WB1 E;  1GSA A;  5K36 G;  5KFO A;  4IZO A;  1UC9 A;  3RBD A;  2UUC H;  2P0A A;  4I55 F;  5C5J A;  3Q8Q B;  3PW7 A;  3LML A;  1PQX A;  4UCS A;  5DQI A;  4O4H F;  3Q8S B;  5HBR B;  4HNV A;  2WB1 A;  2AGQ A;  2YS6 A;  3GV8 B;  4DR4 H;  4OCH A;  2QK4 A;  4MV8 A;  3M9M B;  2ASJ A;  4ED8 A;  2R8K A;  1WE8 A;  3RFC A;  1Y1W G;  2ZDH A;  3ORR A;  2FPP B;  4RNN A;  2A1S A;  3H4D A;  2UVU A;  3AYH B;  2YW2 A;  2ALZ A;  1P8L A;  2RGR A;  3BQ1 A;  3L2P A;  5KFB A;  2RDI A;  3RUP A;  3VMM A;  4C5B A;  5DG9 A;  1KJ9 A;  3MWD A;  3KDK A;  1XMQ H;  1IOV A;  1TWA A;  3L4K A;  1SFO A;  1X4N A;  4JI2 H;  4LFC H;  3HOY G;  4IWY A;  1I6U A;  2VPQ A;  4DV4 H;  3EYY A;  4MV4 A;  4LF8 H;  2V58 A;  1BXR A;  4MV6 A;  4BXX G;  2GPW A;  5IYC G;  2W9A A;  4ED7 A;  2NVY A;  3BQ0 A;  1S68 A;  4HR7 A;  2W7P A;  2DWC A;  1TUA A;  3H4B A;  3OSN A;  4JI5 H;  4F4Z A;  2R7Z G;  4JV2 A;  2R93 G;  4QWB A;  3KDG A;  3LWB A;  3FAU A;  4DL2 A;  2V4Q A;  3EZJ A;  2CQY A;  2DGR A;  2MCT A;  2JA7 A;  1XMO H;  5JQW A;  4YY3 H;  2IBK A;  3J80 W;  4MV7 A;  1ZZI A;  4EGJ A;  4J9N A;  1GSO A;  4NXN H;  2W9B B;  4G08 A;  4F4X A;  5CA0 F;  4R8U B;  3Q8P B;  3GIL A;  3KAL A;  4O4I F;  3MR5 A;  3GTJ A;  4GKK H;  4LF4 H;  3K5H A;  4R8U A;  1RYR A;  3GQC A;  3HB9 A;  4TUY F;  4BBR G;  3M4I A;  2XC9 A;  3GKU A;  2UXC H;  1M0T A;  1Y14 B;  2KSW A;  5C3E G;  1RJQ A;  4A93 G;  4DL7 A;  2OPU A;  1ZHQ A;  1N56 A;  4YAK B;  1RK6 A;  4PDB A;  4WAN A;  4YBZ B;  1AUX A;  1B04 A;  5KFE A;  4EYI B;  2HVR A;  2SCU B;  4JI3 H;  4L1K A;  1N32 H;  2YQR A;  3JSN A;  5KG7 A;  2W8L A;  3Q8R B;  2R8J A;  4IWX A;  5KFM A;  4J9K A;  2JA5 G;  5D8D A;  3OUU A;  4IR1 A;  4A3M G;  1JDB B;  3MJF A;  1CE8 A;  3C0F B;  3HXL A;  3T5K A;  4APM A;  2ANR A;  4A2B A;  1TWH A; 
#chains in the Genus database with same CATH homology
 4B3S H;  3OSS D;  2LF0 A;  4DR7 H;  1HNZ H;  3KAK A;  2VPS A;  4LF9 H;  4DR2 H;  4JI0 H;  3SB1 A;  1S03 G;  4LFA H;  1E4F T;  3K3V A;  4RB0 A;  4JI8 H;  3RGX A;  4GKJ H;  4UCU A;  4NXM H;  4JI1 H;  1ZHS A;  2YCH A;  3PN1 A;  1IBL H;  4DV2 H;  2VUG A;  4MTD A;  2Q2U A;  1TAE A;  1BJT A;  4BWS C;  4MV9 A;  1Z2O X;  3CVZ A;  4E9J A;  3OTO H;  1WH2 A;  1X9Z A;  1XNR H;  4B8C D;  4B3M H;  5IT9 W;  4FM9 A;  4JI6 H;  2XIG A;  3RF2 A;  2WYO A;  4OD6 A;  5A2Q W;  1Z2P X;  3IG0 A;  4EFB A;  1IBK H;  3T1H H;  2ZQE A;  1N34 H;  2CW7 A;  5LL6 b;  2HVQ A;  4CC5 A;  5D1O B;  4JV5 H;  4DR5 H;  1GYF A;  1ODH A;  1BGW A;  3BAA A;  4LF6 H;  4UCT A;  4LFB H;  2VOB A;  4RB2 C;  5FLX W;  3DF7 A;  1A0I A;  3N40 P;  3NCV A;  4LSX A;  2UUC H;  2VQE H;  5FPR A;  3LML A;  1DGS A;  1FKA H;  2Y3M A;  1L2Z A;  4RAZ A;  4UCS A;  4YHH H;  2VKC A;  1V9P A;  4UCV A;  1I94 H;  3OET A;  2PT7 G;  2HGS A;  4UCR A;  1M0W A;  5D1O A;  2VQF H;  3KXY T;  4X62 H;  5LMN H;  4OCH A;  4DR4 H;  4B3R H;  1Z2N X;  3RTX A;  3RIZ A;  2WDT A;  4DR3 H;  2ZJT A;  4EEQ A;  1IBM H;  4ETS A;  2O03 A;  1MZB A;  3J81 W;  2F4V H;  4NZR M;  3GAB A;  1E4G T;  1SYX B;  2RGV A;  4DUY H;  1N33 H;  1P8L A;  5FD5 A;  4RB3 C;  4IAJ A;  2RGR A;  3L2P A;  4I7H A;  4JI7 H;  3L4J A;  3L4K A;  5IWA H;  3KDK A;  1XMQ H;  4JI2 H;  4LFC H;  3GR5 A;  5BR8 H;  2HHH H;  3BAB A;  3N43 B;  2CW8 A;  1I6U A;  2Q2T A;  4AQY H;  3JAM W;  1J5E H;  4LSA A;  4KHP H;  1F0X A;  4DV4 H;  3EYY A;  5FD6 A;  4LF8 H;  1HNX H;  1HNW H;  4DV6 H;  3H20 A;  4DV0 H;  5LMU H;  2UXD H;  3N6X A;  1S68 A;  1X9N A;  2UUB H;  4DV5 H;  2E5L H;  4JI5 H;  1FVI A;  3KDG A;  4X66 H;  3FAU A;  4DUZ H;  3RGZ A;  1XNQ H;  4B3T H;  3EZJ A;  1N36 H;  2MCT A;  4MTE A;  1XMO H;  4YY3 H;  3J80 W;  2W57 A;  4MV7 A;  2OWO A;  3JSL A;  1AN7 A;  2O4C A;  2UU9 H;  4NXN H;  4DR1 H;  4G08 A;  2UXB H;  3J7A K;  3BA9 A;  4NZT M;  3KAL A;  4GKK H;  4EC5 A;  4LF4 H;  1O75 A;  4X64 H;  3MWM A;  2FPH X;  4LH6 A;  3UQ8 A;  4X65 H;  1FJG H;  3M4I A;  3N44 B;  3F8N A;  3N42 B;  2UXC H;  1M0T A;  2KSW A;  4K0K H;  3BA8 A;  3FMA A;  3N41 B;  1XDN A;  3QD7 X;  4DR6 H;  4JYA H;  1ZHQ A;  4UCO A;  1VS0 A;  5D1P A;  4CC6 A;  4DV1 H;  4DV7 H;  3RJ0 A;  4PDB A;  4EFE A;  2HVR A;  1B04 A;  5DT9 A;  5FPO A;  2D9I A;  4LMY A;  4J0M A;  4JI3 H;  2HVS A;  1N32 H;  3JSN A;  2WE6 A;  4DV3 H;  2ZM6 H;  2FE3 A;  3KAJ A;  5EOY A;  4RB1 A;  1SEI A;  4OX9 H;  4RAY A;  2UUA H;  4A2A A;  4UFZ A;  4LF7 H;  1TA8 A;  4R7R A;  4JI4 H;  4LH7 A;  3C0F B;  1HR0 H;  3HXL A;  4Q0Y A;  4M7E A;  4RZQ A;  3T1Y H;  4LF5 H;  4APM A;  4A2B A;  4GLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...