3RF2A

Crystal structure of 30s ribosomal protein s8 from aquifex aeolicus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
165
Chain Sequence
VDPIADMFSAIKNAIMRRDDFLYVPSSKLKERILDVLKKEGFIQDWEALKGEKYEEEYKKMKELAEKSPNPKMKRYLKQLEEYNKGTQYPIKIYLKYLDPKKRKSAITNIVKVSKGGRRVYAGVRTMPYVKRGLGIAIVSTDAGVMTDHEARRMRKGGEVIAFVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S8
publication title The Structure of Aquifex aeolicus Ribosomal Protein S8 Reveals a Unique Subdomain that Contributes to an Extremely Tight Association with 16S rRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ribosomal protein
total genus 46
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3rf2A01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3rf2A02
4B3MH 1HR0H 4AQYH 2UU9H 1S03G 2F4VH 4LFAH 4DR3H 4DV2H 2UUBH 4JI2H 1FJGH 4DV6H 4DV1H 4DR7H 5A2QW 1N34H 2HHHH 4JI6H 4X65H 4LF9H 5LL6b 4YHHH 3OTOH 3J81W 1XMQH 2E5LH 2UUAH 4DV5H 3RF2A 4LF6H 3JAMW 4LF7H 4GKJH 4LF4H 4DV4H 1FKAH 2VQEH 4DUYH 1AN7A 4JI8H 1XNQH 4DR6H 1IBLH 4NXNH 4JI1H 4B3TH 4DR4H 1HNXH 5FLXW 1HNWH 5LMUH 2UXCH 3T1HH 4X64H 5BR8H 4DR5H 4LFCH 4B3RH 1XMOH 5IT9W 2UUCH 2ZM6H 2VQFH 1J5EH 4DR1H 4LF5H 4DV7H 4K0KH 1IBKH 4X66H 5LMNH 4LF8H 5IWAH 3J80W 4GKKH 1IBMH 1HNZH 4NXMH 4OX9H 1N33H 4KHPH 1I6UA 1N32H 1SEIA 2UXDH 4DUZH 4YY3H 4JI7H 4DV0H 4JI0H 4JI4H 4X62H 2UXBH 4JI3H 1N36H 1I94H 4JYAH 4DR2H 4JV5H 4JI5H 3T1YH 4LFBH 4DV3H 4PDBA 3J7AK 1XNRH 4B3SH
chains in the Genus database with same CATH superfamily
4ED2A 4YJ2F 2Q2UA 4AQYH 5KFKA 4EBEA 1AUVA 2ZDHA 2XC9A 4QMFB 4J9QA 2Y0SE 4DR3H 1SCUB 3LWBA 5IYBG 2GPSA 3MWEA 3N43B 2MJHA 1J5KA 3K3VA 4A3CG 5EWGA 4OO1G 3M4IA 1RJQA 4HQ6A 5C1PA 1I50A 2CTFA 4HNUA 5JH7F 2BL5A 3I4NG 4DV1H 2AGPA 4RUCA 2HHHH 1N34H 2CPMA 4MAMA 5L9XA 4RB1A 3T5HA 2IP4A 5LL6b 4IR9A 1BNCA 4G3IA 3F8NA 1R9TA 2DGRA 3HOXG 2YL2A 4ECSA 2W8KA 2PMZA 4ECVA 3RB0A 3I12A 4RUAA 2HH3A 2CW7A 1DV1A 5F9NA 4G08A 2WB1E 5KFFA 3M9MB 1KC7A 3EYYA 3KHHA 3G8CA 4BY7G 3GKUA 2FLLA 3HOUG 1XMQH 2R7LA 4HNTA 4NBQA 4DV5H 5KFZA 3KHGA 2RF4A 3L4KA 4DL5A 1IOVA 2I87A 1Z2OX 3V4SA 3L7ZC 4ED6A 3V6KA 3AYHB 4LH7A 2HH2A 2M05A 3V6JA 1S9FA 2J6SA 2UVRA 3HOWG 1P8LA 2PT7G 4DUYH 4O3OA 4IWXA 2P0AA 1Z2NX 3LP8A 5KFTA 1RYRA 3GV5B 5BPFA 1GGOA 4DR6H 2DZDA 2VKCA 2C28A 4Q8EA 2K1HA 5KFGA 1DIKA 1BGWA 3GIJA 4ECRA 4JVHA 4JI1H 4C5CA 5KG0A 5JVDF 3T5LA 4MV6A 4R7RA 3QZ8A 3R5HA 5LYJF 4FS2A 4L1KA 2R8IA 2R86A 1HNWH 3RTXA 1ZZKA 2ATLA 1T36A 2QNDA 1X4MA 2YS6A 1T94A 1Y1VG 3GTLA 2ASDA 2C35B 2WDTA 2QYZA 4B3RH 4JV2A 1PX2A 2JEBI 5L1LA 4NZRM 4E9JA 3R23A 3N41B 5KFXA 5KT5A 2E2IA 5IYDG 5EOYA 2FJZA 5C1OA 1S10A 4HYKA 2PVPA 4J9NA 1B04A 3G6VA 3PZPA 4JV1A 1WVNA 2VQFH 2J9GA 2V5AA 2ANRA 4QWDA 1DT4A 5KG4A 5KT3A 1RJRA 3RGXA 2VPSA 4RZRA 1ZQ7A 3GV7B 4A3IG 5KFQA 2B63G 4ZQIA 3MR3A 1V9NA 1UG8A 2ASJA 2W9BA 1S68A 2XCAA 5LA6F 3QD7X 4TQRA 3MR2A 5KFRA 3KHRA 4GC6A 1KJJA 5IP9G 3GTOA 2UVWA 5JEAG 2VQDA 3TQ1A 2W6MA 2V4RA 3VPBA 1S0MA 2FKLA 3RJ0A 3TQTA 1SEIA 2JA8G 2R8KA 2Z0SA 2V58A 4EYHB 3PW2A 1KHMA 4YR2A 1VBIA 4IR1A 3GIDA 4JI0H 4JI4H 3PO2G 2M8WA 4FU0A 2UXBH 2FK3A 3MR6A 3BQ2A 4B8CD 3GTQA 4B8TA 3M9NB 3GIKA 4RB0A 2J6TA 5KT2A 2XCLA 3N6XA 4RNOA 3MJFA 2W7PA 2XD4A 2JA5G 1Y14B 4YJ3F 2R8GA 4BBRG 1M7JA 2LF0A 1ZZIA 1ODHA 2WYOA 5EWEA 1ZHSA 2DIKA 3NGDA 2CZGA 1J4WA 1EC6A 3J7AK 4IZOA 1XNRH 4RNMA 2R7MA 4O3QA 2PQUA 5D1PA 1V8CA 2DPJA 2HGSA 3T5KA 4IRKA 5IP7G 4MV3A 4LFAH 1S0OA 1ZTGA 4MV9A 1VBHA 4UCRA 2OLSA 3Q8PB 1C30A 1ULZA 3ORRA 4DV2H 3HOZG 2CTEA 1CE8A 3GIQA 5FPRA 3H40A 2R7ZG 2OWOA 2JEIA 1SYXB 4O3NA 4DLKA 5DLFA 1NXUA 4JI6H 4X65H 4I50F 3V4ZA 4ZI7F 4A3MG 2ALZA 1JDBB 4WALA 2I80A 3GTPA 5K2MA 5KT7A 1RYSA 2ASLA 1N48A 3K3PA 1BJTA 2BQ3A 4ED7A 4ME6A 2YZMA 2NVXA 5LOVF 2OPUA 5JUMA 4QW9A 3OTOH 2BA0A 4WD3A 4ECWA 2FP4B 3GV8B 3PW0A 2QK4A 2E5LH 4AYBA 2UUAH 4ECTA 3RF2A 4UCUA 2GLTA 3JAMW 4EEQA 4EEYA 4LF7H 4EGQA 2W9BB 1WTJA 3IN5A 3AEVB 1X0AA 2IA6A 5KG7A 5KG5A 1KJ8A 2JA7G 3RUPA 3R5XA 4O4HF 5IYCG 3HOVG 1IOWA 1UC8A 4BBSG 2JA5A 1CQJB 4E4TA 1VIHA 1TWGA 2Y0SA 2YQRA 4NXNH 2ZDQA 5C8YF 3Q8SB 4MA5A 5CA1F 2V4QA 3FKIA 2LTLA 1AUXA 5KFJA 3BQ1A 4C2MA 3ORQA 2YU9A 2R7ZA 4B3TH 4QW8A 1MZBA 1HNXH 2PN1A 3PR5B 5FLXW 2AGQA 1EYZA 5KFIA 4R8UA 4FBUA 3TIGA 5LMUH 2J6UA 3JZIA 5I47A 5DQIA 1TUAA 3Q8QB 4DR5H 2KSWA 2DWCA 3DF7A 4UCTA 1GSHA 3GTKA 2RGRA 3N40P 4IAJA 2PMZE 4I4TF 2FPPB 5LP6F 2WTFA 4DL3A 4O4LF 5CAEB 5KG1A 1MSZA 2VPQA 2IBKA 4LF5H 1PK8A 1DTJA 4DV7H 4K0KH 3KAJA 4X66H 1I7NA 3BAAA 5BMVF 2CTMA 3J80W 4GKKH 3PO3G 3G6XA 3UOEA 4LSAA 4MA0A 4OX9H 2M6QA 2LTMA 3GR5A 4KHPH 3GLKA 5C3EG 1I6UA 2W9CA 2JEGA 3BG5A 5DLGA 1Z2IA 4A3GG 3JRXA 5EZYF 5KX5F 1A9XA 4FJSA 3WO1A 5C5JA 4J9SA 1RK6A 1GYFA 2AU0A 1SFOA 4YY3H 4M7EA 3GIMA 2W70A 4J9RA 2JA7A 4LSXA 2JEAI 2X0SA 5HBRB 4GC7A 2C2EA 3KDGA 1B33N 4X62H 5IYZF 2UVVA 2G8YA 4QJFA 2VR1A 2MCTA 1GSAA 4I55F 1N36H 5D8DA 2CWFA 5KKNB 1EZ1A 4UCSA 3RB6A 1GLVA 3EPGA 1K1QA 4JV5H 5KFSA 3OSSD 1W96A 4A2AA 2WAQA 2JVZA 2IMWP 2DPIA 1X4NA 4BY1G 3RBEA 3BA8A 3KXYT 2NUAB 4B3SH 3RIZA 3HB9A 3GIPA 3QFFA 4B3MH 5KFOA 1HR0H 3FMAA 2CKZB 2XGQA 5C4XG 5KFCA 2YYAA 2HVQA 4Y8VB 5C44G 3SI8A 3WO0A 3RAXA 2ZJTA 1WHRA 1TA8A 3WNZA 3H4BA 4JI2H 1RK5A 3OHAA 2V59A 3V69A 2C2DA 4R8UB 3Q2OA 5A2QW 1TWHA 3PW4A 2O4CA 1Y1WG 5FD5A 4NLGA 4ECZA 3VKEA 2FFMA 4YHHH 2Q2TA 1V9PA 2CWHA 2FMRA 2CQYA 4ECQA 4QWAA 1EUDB 2RDJA 3MR5A 2V9WA 1UC9A 3GTGA 5KFWA 2LRRA 2AQ4A 3FKIG 4YAKB 4J9OA 3TINA 2CTKA 2I8CA 3GABA 3BJYA 4FJUA 2P2RA 3MFIA 1L2ZA 4QIWA 3J81W 3PR4A 2OPVA 4APMA 4RB2C 1JXLA 4BA1I 1JDEA 1X9NA 4BWSC 5DG8A 2R87A 2CTJA 1FVIA 4XX0B 1E4EB 4FS1A 4LF4H 4DV4H 2PY9A 2VQEH 4EGJA 2FB9A 2ZQEA 1ZZJA 2YS7A 2W9CB 5KFEA 3R5FA 1O75A 4MV4A 2AXYA 5KFYA 4ED3A 4ED0A 1XNQH 4EC5A 4TQSA 1IBLH 2FPGB 5FD6A 1RJPA 1WSCA 3FDSA 1F0XA 1WH2A 4HNVA 3JSLA 2CW8A 4AM3A 2WE6A 1WCMA 5KFVA 3HKZE 5KG3A 4MV1A 4DR4H 5DG7A 2FLPA 4IRCA 1TWAA 3JRWA 4QWBA 3N8DA 4UCVA 4Q43A 2R7NA 4LIJA 5KG6A 4OCHA 3OUUA 2XCPA 1S0NA 2UXCH 3K5IA 3T1HH 5BR8H 1KBLA 3RB3A 4LFCH 1VS0A 3VPCA 2UUCH 2PBZA 4JUZA 4J9MA 2VUGA 5CB4F 5LXTF 4EYIB 4YR3A 4A3DG 4ED8A 5DT9A 2VUMA 2ZM6H 2W57A 4ZOLF 3U9SA 3I4MG 5J2UF 1Y1WA 2NVYA 3QZ7A 2XIGA 4DR1H 2DLNA 5KT6A 4C5BA 5T14A 4Q44A 3L4JA 1WR2A 5KFHA 2AGOA 3E5NA 4U6PA 1IBKH 3IG0A 2FK2A 1EUCB 2SCUB 4BXXG 1I7LA 4IHJF 2JEJA 4LMYA 5H80A 1I3QA 3GTMA 3U1KA 2W9AA 4J9PA 1N33H 4FBTA 2R93A 2NU6B 4A3BG 2FMAA 2VOBA 3M9OB 3KAKA 1XRHA 1VIGA 1EHIA 1E4FT 3G6YA 3OETA 1VBGA 1N32H 4UCOA 2UXDH 2BQUA 3HXLA 2FLNA 1W93A 4JI7H 4A2BA 4JVYA 1KJIA 4DV0H 1JKJB 2WB1A 2NU7B 4J9LA 3PW5A 4YAJB 2FPHX 1UNNC 3H0GG 2R6FA 3BA9A 5L1IA 4DL6A 4A3FG 1ZETA 1I94H 2HVRA 4JYAH 4JV0A 2R8JA 3HOYG 4RAZA 2UVUA 1TWFA 1WE8A 4YB8B 3U9TA 4JI5H 1KJ9A 1M6VA 2W6QA 2JE6I 3ETJA 3T1YH 4LFBH 2X06A 4DV3H 2FK1A 1GSOA 1E4EA 3GILA 2CTLA 3K5HA 5KFDA 4MTEA 2R7KA 3HBLA 2W8LA 1CQIB 4RAYA 3FAUA 2UU9H 1S03G 3KALA 5D1OA 4QWCA 4XYLB 2F4VH 3EPIA 3ETHA 3GTJA 4H8AA 1CS0A 5DGBA 3SB1A 2JA9A 5KFNA 5EDWA 2UUBH 4O4IF 2HJWA 1BXRA 4A3KG 1FJGH 4EFEA 4EFBA 4LH6A 4Q45A 4DV6H 1B6RA 5GONF 4DR7H 4IWYA 4CC6A 2VA3A 3C0FB 4LF9H 4Q0YA 4IRDA 4F4XA 3H3VH 4ED1A 2BR0A 2O03A 3Q8RB 4RB3C 2JA6G 2R8HA 3N42B 3MWDA 2JEFA 1TAEA 3OSNA 4EG0A 3VPDA 2R84A 1DV2A 1WCMG 4YR0A 1XDNA 5CA0F 4AIMA 2W71A 5KT4A 4O3RA 2Y3MA 3L2PA 2W6OA 2C22A 3RBDA 3CVZA 4LF6H 4WBNF 3GQCA 3KTMA 3SE7A 2C00A 5K36G 4MV7A 3BABA 4GKJH 2WAQE 5J2TF 4YQWA 5KFAA 4QWEA 1FKAH 1M0TA 5KFUA 3OHBA 4A3EG 2JZXA 4F4ZA 4GLXA 4BA2I 2R82A 3RFCA 4RNNA 4PWQA 2VUMG 1AN7A 4JI8H 1K83A 3H0GA 4O2AF 5FPOA 3OUZA 5L1KA 2YCHA 2RDIA 1T3NA 4RZQA 5KFLA 3LMLA 4Q8FA 3Q1KA 4CC5A 2W6NA 4ZHQF 4DL2A 2R92G 2XGPA 3RAQA 3RV4A 2W6ZA 3PVXA 2ZDGA 4YP3A 4IFDG 2OH2A 3EZJA 4XZ3B 1S20A 2YZGA 3UQ8A 1B6SA 1DGSA 2R93G 5HV6A 4X64H 1M0WA 3N44B 5DGAA 1JLLB 2W6PA 1XMOH 3CQZA 4YBZB 5IT9W 2NU8B 1GO3E 3KDKA 1KEEA 1VAJA 4TUYF 3JSNA 4MV8A 4O2BF 2W7OA 5JVLA 2GPWA 5EWFA 2E2HA 3VMMA 3RB4A 2NN6G 4NZTM 1J5EH 4MTDA 5L1JA 1JX4A 4O3PA 4QIWE 1JIHA 5D1OB 4TV9F 5FJ8G 3NCVA 4ECUA 5KFPA 1X9ZA 2FE3A 5KFBA 2JA6A 3V6HA 5LMNH 4LF8H 4EBDA 5IWAH 4TV8F 3OSPA 2R85A 2YW2A 2CPQA 4UFZA 4ECYA 1V51A 4DL4A 2BQRA 1IBMH 1HNZH 4M9UA 3T5JA 2ANNA 3GIIA 3H20A 1V4YA 1Y1VA 4NXMH 4A3JG 5KG2A 2A1SA 4FM9A 2YRWA 1E4GT 3MFHA 5FLMG 3I0PA 4WANA 2D9IA 3RGZA 1TWCA 1K1SA 4F50A 2YZNA 4ECXA 4DUZH 5BPHA 2RGVA 2VA2A 1KJQA 3HKZA 4U7CA 5DQGA 3BQ0A 1K1GA 1C3OA 4HR7A 3RV3A 4J0MA 4I7HA 4J9KA 5KFMA 3PW7A 4O3SA 2B63A 2E3UA 3PN1A 5F9LA 1PQXA 4ETSA 3MWMA 4F4WA 1N56A 1ZHQA 1VKZA 4XYMB 5C0XG 2FPIB 2YRXA 4JI3H 4AYBE 1OWTA 3H4DA 4OD6A 2NU9B 5JQWA 4DR2H 4DL7A 2R92A 1Z2PX 2C2RA 3TIIA 4EBCA 4PDBA 1A0IA 5DQHA 3UFXB 4RU9A 3KHLA 4A93G 2HVSA 4F4YA 4C5AA 5DG9A 4A3LG 1S97A
chains in the Genus database with same CATH topology
4B3MH 2HGSA 2Q2UA 1HR0H 4AQYH 3FAUA 2UU9H 1S03G 3FMAA 3KALA 4RAYA 5D1OA 2F4VH 4LFAH 4MV9A 2HVQA 4UCRA 4DR3H 3SB1A 4DV2H 2ZJTA 1TA8A 2UUBH 4JI2H 3N43B 5FPRA 3K3VA 2OWOA 3M4IA 1FJGH 1SYXB 4EFEA 4LH6A 4EFBA 4DV6H 4CC6A 4DV1H 4DR7H 5A2QW 1N34H 2HHHH 2O4CA 4X65H 4JI6H 4LF9H 3C0FB 4Q0YA 5FD5A 4RB1A 5LL6b 2Q2TA 4YHHH 3F8NA 1V9PA 2O03A 4RB3C 3N42B 1BJTA 1TAEA 2CW7A 4G08A 3GABA 3OTOH 3EYYA 1XDNA 1L2ZA 3J81W 2Y3MA 1XMQH 2E5LH 2UUAH 3L2PA 4DV5H 3RF2A 4LF6H 3CVZA 4UCUA 3JAMW 4EEQA 4RB2C 4LF7H 4APMA 3L4KA 1X9NA 1Z2OX 4MV7A 3BABA 4BWSC 1FVIA 4GKJH 4LH7A 4LF4H 4DV4H 1FKAH 1M0TA 1P8LA 2PT7G 2VQEH 4DUYH 4GLXA 2ZQEA 1Z2NX 1O75A 1AN7A 4JI8H 1XNQH 4EC5A 4DR6H 2VKCA 5FPOA 1IBLH 4NXNH 2YCHA 1BGWA 5FD6A 4RZQA 4JI1H 1F0XA 1WH2A 3LMLA 3JSLA 4CC5A 2CW8A 2WE6A 4R7RA 4B3TH 4DR4H 1HNXH 1MZBA 5FLXW 1HNWH 4UCVA 3RTXA 3EZJA 3UQ8A 5LMUH 4OCHA 1DGSA 2UXCH 3T1HH 4X64H 5BR8H 4DR5H 4LFCH 1M0WA 2KSWA 4B3RH 1XMOH 1VS0A 2WDTA 5IT9W 3DF7A 4UCTA 3KDKA 2UUCH 4NZRM 4E9JA 3N40P 3N41B 4IAJA 2RGRA 2VUGA 5EOYA 3JSNA 1B04A 5DT9A 2ZM6H 2VQFH 2W57A 4NZTM 1J5EH 3RGXA 2VPSA 4MTDA 2XIGA 4DR1H 4LF5H 3L4JA 5D1OB 4DV7H 4K0KH 3NCVA 3KAJA 1X9ZA 1IBKH 4X66H 2FE3A 3IG0A 5LMNH 4LF8H 1S68A 3BAAA 5IWAH 3J80W 4GKKH 4UFZA 3QD7X 1IBMH 1HNZH 4LMYA 3H20A 4LSAA 4NXMH 4OX9H 3GR5A 1N33H 4KHPH 1I6UA 2VOBA 4FM9A 3KAKA 1E4GT 1E4FT 3RJ0A 3OETA 2D9IA 1N32H 3RGZA 1SEIA 2UXDH 4UCOA 3HXLA 4DUZH 1GYFA 2RGVA 4YY3H 4M7EA 4JI7H 4A2BA 4LSXA 4J0MA 4DV0H 4JI0H 4JI4H 4I7HA 2FPHX 3KDGA 4X62H 3PN1A 2UXBH 4B8CD 4ETSA 3MWMA 4RB0A 1ZHQA 2MCTA 3N6XA 2HVRA 3BA9A 4JI3H 1N36H 4OD6A 1I94H 4JYAH 4DR2H 4UCSA 4RAZA 2LF0A 1ODHA 4JV5H 1Z2PX 1ZHSA 3OSSD 2WYOA 4A2AA 4JI5H 3T1YH 4LFBH 4DV3H 4PDBA 1A0IA 3N44B 3J7AK 1XNRH 2HVSA 3BA8A 3KXYT 4MTEA 4B3SH 3RIZA 5D1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M H;  1HR0 H;  4AQY H;  2UU9 H;  1S03 G;  2F4V H;  4LFA H;  4DR3 H;  4DV2 H;  2UUB H;  4JI2 H;  1FJG H;  4DV6 H;  4DV1 H;  4DR7 H;  5A2Q W;  1N34 H;  2HHH H;  4JI6 H;  4X65 H;  4LF9 H;  5LL6 b;  4YHH H;  3OTO H;  3J81 W;  1XMQ H;  2E5L H;  2UUA H;  4DV5 H;  3RF2 A;  4LF6 H;  3JAM W;  4LF7 H;  4GKJ H;  4LF4 H;  4DV4 H;  1FKA H;  2VQE H;  4DUY H;  1AN7 A;  4JI8 H;  1XNQ H;  4DR6 H;  1IBL H;  4NXN H;  4JI1 H;  4B3T H;  4DR4 H;  1HNX H;  5FLX W;  1HNW H;  5LMU H;  2UXC H;  3T1H H;  4X64 H;  5BR8 H;  4DR5 H;  4LFC H;  4B3R H;  1XMO H;  5IT9 W;  2UUC H;  2ZM6 H;  2VQF H;  1J5E H;  4DR1 H;  4LF5 H;  4DV7 H;  4K0K H;  1IBK H;  4X66 H;  5LMN H;  4LF8 H;  5IWA H;  3J80 W;  4GKK H;  1IBM H;  1HNZ H;  4NXM H;  4OX9 H;  1N33 H;  4KHP H;  1I6U A;  1N32 H;  1SEI A;  2UXD H;  4DUZ H;  4YY3 H;  4JI7 H;  4DV0 H;  4JI0 H;  4JI4 H;  4X62 H;  2UXB H;  4JI3 H;  1N36 H;  1I94 H;  4JYA H;  4DR2 H;  4JV5 H;  4JI5 H;  3T1Y H;  4LFB H;  4DV3 H;  4PDB A;  3J7A K;  1XNR H;  4B3S H; 
#chains in the Genus database with same CATH topology
 4ED2 A;  4YJ2 F;  2Q2U A;  4AQY H;  5KFK A;  4EBE A;  1AUV A;  2ZDH A;  2XC9 A;  4QMF B;  4J9Q A;  2Y0S E;  4DR3 H;  1SCU B;  3LWB A;  5IYB G;  2GPS A;  3MWE A;  3N43 B;  2MJH A;  1J5K A;  3K3V A;  4A3C G;  5EWG A;  4OO1 G;  3M4I A;  1RJQ A;  4HQ6 A;  5C1P A;  1I50 A;  2CTF A;  4HNU A;  5JH7 F;  2BL5 A;  3I4N G;  4DV1 H;  2AGP A;  4RUC A;  2HHH H;  1N34 H;  2CPM A;  4MAM A;  5L9X A;  4RB1 A;  3T5H A;  2IP4 A;  5LL6 b;  4IR9 A;  1BNC A;  4G3I A;  3F8N A;  1R9T A;  2DGR A;  3HOX G;  2YL2 A;  4ECS A;  2W8K A;  2PMZ A;  4ECV A;  3RB0 A;  3I12 A;  4RUA A;  2HH3 A;  2CW7 A;  1DV1 A;  5F9N A;  4G08 A;  2WB1 E;  5KFF A;  3M9M B;  1KC7 A;  3EYY A;  3KHH A;  3G8C A;  4BY7 G;  3GKU A;  2FLL A;  3HOU G;  1XMQ H;  2R7L A;  4HNT A;  4NBQ A;  4DV5 H;  5KFZ A;  3KHG A;  2RF4 A;  3L4K A;  4DL5 A;  1IOV A;  2I87 A;  1Z2O X;  3V4S A;  3L7Z C;  4ED6 A;  3V6K A;  3AYH B;  4LH7 A;  2HH2 A;  2M05 A;  3V6J A;  1S9F A;  2J6S A;  2UVR A;  3HOW G;  1P8L A;  2PT7 G;  4DUY H;  4O3O A;  4IWX A;  2P0A A;  1Z2N X;  3LP8 A;  5KFT A;  1RYR A;  3GV5 B;  5BPF A;  1GGO A;  4DR6 H;  2DZD A;  2VKC A;  2C28 A;  4Q8E A;  2K1H A;  5KFG A;  1DIK A;  1BGW A;  3GIJ A;  4ECR A;  4JVH A;  4JI1 H;  4C5C A;  5KG0 A;  5JVD F;  3T5L A;  4MV6 A;  4R7R A;  3QZ8 A;  3R5H A;  5LYJ F;  4FS2 A;  4L1K A;  2R8I A;  2R86 A;  1HNW H;  3RTX A;  1ZZK A;  2ATL A;  1T36 A;  2QND A;  1X4M A;  2YS6 A;  1T94 A;  1Y1V G;  3GTL A;  2ASD A;  2C35 B;  2WDT A;  2QYZ A;  4B3R H;  4JV2 A;  1PX2 A;  2JEB I;  5L1L A;  4NZR M;  4E9J A;  3R23 A;  3N41 B;  5KFX A;  5KT5 A;  2E2I A;  5IYD G;  5EOY A;  2FJZ A;  5C1O A;  1S10 A;  4HYK A;  2PVP A;  4J9N A;  1B04 A;  3G6V A;  3PZP A;  4JV1 A;  1WVN A;  2VQF H;  2J9G A;  2V5A A;  2ANR A;  4QWD A;  1DT4 A;  5KG4 A;  5KT3 A;  1RJR A;  3RGX A;  2VPS A;  4RZR A;  1ZQ7 A;  3GV7 B;  4A3I G;  5KFQ A;  2B63 G;  4ZQI A;  3MR3 A;  1V9N A;  1UG8 A;  2ASJ A;  2W9B A;  1S68 A;  2XCA A;  5LA6 F;  3QD7 X;  4TQR A;  3MR2 A;  5KFR A;  3KHR A;  4GC6 A;  1KJJ A;  5IP9 G;  3GTO A;  2UVW A;  5JEA G;  2VQD A;  3TQ1 A;  2W6M A;  2V4R A;  3VPB A;  1S0M A;  2FKL A;  3RJ0 A;  3TQT A;  1SEI A;  2JA8 G;  2R8K A;  2Z0S A;  2V58 A;  4EYH B;  3PW2 A;  1KHM A;  4YR2 A;  1VBI A;  4IR1 A;  3GID A;  4JI0 H;  4JI4 H;  3PO2 G;  2M8W A;  4FU0 A;  2UXB H;  2FK3 A;  3MR6 A;  3BQ2 A;  4B8C D;  3GTQ A;  4B8T A;  3M9N B;  3GIK A;  4RB0 A;  2J6T A;  5KT2 A;  2XCL A;  3N6X A;  4RNO A;  3MJF A;  2W7P A;  2XD4 A;  2JA5 G;  1Y14 B;  4YJ3 F;  2R8G A;  4BBR G;  1M7J A;  2LF0 A;  1ZZI A;  1ODH A;  2WYO A;  5EWE A;  1ZHS A;  2DIK A;  3NGD A;  2CZG A;  1J4W A;  1EC6 A;  3J7A K;  4IZO A;  1XNR H;  4RNM A;  2R7M A;  4O3Q A;  2PQU A;  5D1P A;  1V8C A;  2DPJ A;  2HGS A;  3T5K A;  4IRK A;  5IP7 G;  4MV3 A;  4LFA H;  1S0O A;  1ZTG A;  4MV9 A;  1VBH A;  4UCR A;  2OLS A;  3Q8P B;  1C30 A;  1ULZ A;  3ORR A;  4DV2 H;  3HOZ G;  2CTE A;  1CE8 A;  3GIQ A;  5FPR A;  3H40 A;  2R7Z G;  2OWO A;  2JEI A;  1SYX B;  4O3N A;  4DLK A;  5DLF A;  1NXU A;  4JI6 H;  4X65 H;  4I50 F;  3V4Z A;  4ZI7 F;  4A3M G;  2ALZ A;  1JDB B;  4WAL A;  2I80 A;  3GTP A;  5K2M A;  5KT7 A;  1RYS A;  2ASL A;  1N48 A;  3K3P A;  1BJT A;  2BQ3 A;  4ED7 A;  4ME6 A;  2YZM A;  2NVX A;  5LOV F;  2OPU A;  5JUM A;  4QW9 A;  3OTO H;  2BA0 A;  4WD3 A;  4ECW A;  2FP4 B;  3GV8 B;  3PW0 A;  2QK4 A;  2E5L H;  4AYB A;  2UUA H;  4ECT A;  3RF2 A;  4UCU A;  2GLT A;  3JAM W;  4EEQ A;  4EEY A;  4LF7 H;  4EGQ A;  2W9B B;  1WTJ A;  3IN5 A;  3AEV B;  1X0A A;  2IA6 A;  5KG7 A;  5KG5 A;  1KJ8 A;  2JA7 G;  3RUP A;  3R5X A;  4O4H F;  5IYC G;  3HOV G;  1IOW A;  1UC8 A;  4BBS G;  2JA5 A;  1CQJ B;  4E4T A;  1VIH A;  1TWG A;  2Y0S A;  2YQR A;  4NXN H;  2ZDQ A;  5C8Y F;  3Q8S B;  4MA5 A;  5CA1 F;  2V4Q A;  3FKI A;  2LTL A;  1AUX A;  5KFJ A;  3BQ1 A;  4C2M A;  3ORQ A;  2YU9 A;  2R7Z A;  4B3T H;  4QW8 A;  1MZB A;  1HNX H;  2PN1 A;  3PR5 B;  5FLX W;  2AGQ A;  1EYZ A;  5KFI A;  4R8U A;  4FBU A;  3TIG A;  5LMU H;  2J6U A;  3JZI A;  5I47 A;  5DQI A;  1TUA A;  3Q8Q B;  4DR5 H;  2KSW A;  2DWC A;  3DF7 A;  4UCT A;  1GSH A;  3GTK A;  2RGR A;  3N40 P;  4IAJ A;  2PMZ E;  4I4T F;  2FPP B;  5LP6 F;  2WTF A;  4DL3 A;  4O4L F;  5CAE B;  5KG1 A;  1MSZ A;  2VPQ A;  2IBK A;  4LF5 H;  1PK8 A;  1DTJ A;  4DV7 H;  4K0K H;  3KAJ A;  4X66 H;  1I7N A;  3BAA A;  5BMV F;  2CTM A;  3J80 W;  4GKK H;  3PO3 G;  3G6X A;  3UOE A;  4LSA A;  4MA0 A;  4OX9 H;  2M6Q A;  2LTM A;  3GR5 A;  4KHP H;  3GLK A;  5C3E G;  1I6U A;  2W9C A;  2JEG A;  3BG5 A;  5DLG A;  1Z2I A;  4A3G G;  3JRX A;  5EZY F;  5KX5 F;  1A9X A;  4FJS A;  3WO1 A;  5C5J A;  4J9S A;  1RK6 A;  1GYF A;  2AU0 A;  1SFO A;  4YY3 H;  4M7E A;  3GIM A;  2W70 A;  4J9R A;  2JA7 A;  4LSX A;  2JEA I;  2X0S A;  5HBR B;  4GC7 A;  2C2E A;  3KDG A;  1B33 N;  4X62 H;  5IYZ F;  2UVV A;  2G8Y A;  4QJF A;  2VR1 A;  2MCT A;  1GSA A;  4I55 F;  1N36 H;  5D8D A;  2CWF A;  5KKN B;  1EZ1 A;  4UCS A;  3RB6 A;  1GLV A;  3EPG A;  1K1Q A;  4JV5 H;  5KFS A;  3OSS D;  1W96 A;  4A2A A;  2WAQ A;  2JVZ A;  2IMW P;  2DPI A;  1X4N A;  4BY1 G;  3RBE A;  3BA8 A;  3KXY T;  2NUA B;  4B3S H;  3RIZ A;  3HB9 A;  3GIP A;  3QFF A;  4B3M H;  5KFO A;  1HR0 H;  3FMA A;  2CKZ B;  2XGQ A;  5C4X G;  5KFC A;  2YYA A;  2HVQ A;  4Y8V B;  5C44 G;  3SI8 A;  3WO0 A;  3RAX A;  2ZJT A;  1WHR A;  1TA8 A;  3WNZ A;  3H4B A;  4JI2 H;  1RK5 A;  3OHA A;  2V59 A;  3V69 A;  2C2D A;  4R8U B;  3Q2O A;  5A2Q W;  1TWH A;  3PW4 A;  2O4C A;  1Y1W G;  5FD5 A;  4NLG A;  4ECZ A;  3VKE A;  2FFM A;  4YHH H;  2Q2T A;  1V9P A;  2CWH A;  2FMR A;  2CQY A;  4ECQ A;  4QWA A;  1EUD B;  2RDJ A;  3MR5 A;  2V9W A;  1UC9 A;  3GTG A;  5KFW A;  2LRR A;  2AQ4 A;  3FKI G;  4YAK B;  4J9O A;  3TIN A;  2CTK A;  2I8C A;  3GAB A;  3BJY A;  4FJU A;  2P2R A;  3MFI A;  1L2Z A;  4QIW A;  3J81 W;  3PR4 A;  2OPV A;  4APM A;  4RB2 C;  1JXL A;  4BA1 I;  1JDE A;  1X9N A;  4BWS C;  5DG8 A;  2R87 A;  2CTJ A;  1FVI A;  4XX0 B;  1E4E B;  4FS1 A;  4LF4 H;  4DV4 H;  2PY9 A;  2VQE H;  4EGJ A;  2FB9 A;  2ZQE A;  1ZZJ A;  2YS7 A;  2W9C B;  5KFE A;  3R5F A;  1O75 A;  4MV4 A;  2AXY A;  5KFY A;  4ED3 A;  4ED0 A;  1XNQ H;  4EC5 A;  4TQS A;  1IBL H;  2FPG B;  5FD6 A;  1RJP A;  1WSC A;  3FDS A;  1F0X A;  1WH2 A;  4HNV A;  3JSL A;  2CW8 A;  4AM3 A;  2WE6 A;  1WCM A;  5KFV A;  3HKZ E;  5KG3 A;  4MV1 A;  4DR4 H;  5DG7 A;  2FLP A;  4IRC A;  1TWA A;  3JRW A;  4QWB A;  3N8D A;  4UCV A;  4Q43 A;  2R7N A;  4LIJ A;  5KG6 A;  4OCH A;  3OUU A;  2XCP A;  1S0N A;  2UXC H;  3K5I A;  3T1H H;  5BR8 H;  1KBL A;  3RB3 A;  4LFC H;  1VS0 A;  3VPC A;  2UUC H;  2PBZ A;  4JUZ A;  4J9M A;  2VUG A;  5CB4 F;  5LXT F;  4EYI B;  4YR3 A;  4A3D G;  4ED8 A;  5DT9 A;  2VUM A;  2ZM6 H;  2W57 A;  4ZOL F;  3U9S A;  3I4M G;  5J2U F;  1Y1W A;  2NVY A;  3QZ7 A;  2XIG A;  4DR1 H;  2DLN A;  5KT6 A;  4C5B A;  5T14 A;  4Q44 A;  3L4J A;  1WR2 A;  5KFH A;  2AGO A;  3E5N A;  4U6P A;  1IBK H;  3IG0 A;  2FK2 A;  1EUC B;  2SCU B;  4BXX G;  1I7L A;  4IHJ F;  2JEJ A;  4LMY A;  5H80 A;  1I3Q A;  3GTM A;  3U1K A;  2W9A A;  4J9P A;  1N33 H;  4FBT A;  2R93 A;  2NU6 B;  4A3B G;  2FMA A;  2VOB A;  3M9O B;  3KAK A;  1XRH A;  1VIG A;  1EHI A;  1E4F T;  3G6Y A;  3OET A;  1VBG A;  1N32 H;  4UCO A;  2UXD H;  2BQU A;  3HXL A;  2FLN A;  1W93 A;  4JI7 H;  4A2B A;  4JVY A;  1KJI A;  4DV0 H;  1JKJ B;  2WB1 A;  2NU7 B;  4J9L A;  3PW5 A;  4YAJ B;  2FPH X;  1UNN C;  3H0G G;  2R6F A;  3BA9 A;  5L1I A;  4DL6 A;  4A3F G;  1ZET A;  1I94 H;  2HVR A;  4JYA H;  4JV0 A;  2R8J A;  3HOY G;  4RAZ A;  2UVU A;  1TWF A;  1WE8 A;  4YB8 B;  3U9T A;  4JI5 H;  1KJ9 A;  1M6V A;  2W6Q A;  2JE6 I;  3ETJ A;  3T1Y H;  4LFB H;  2X06 A;  4DV3 H;  2FK1 A;  1GSO A;  1E4E A;  3GIL A;  2CTL A;  3K5H A;  5KFD A;  4MTE A;  2R7K A;  3HBL A;  2W8L A;  1CQI B;  4RAY A;  3FAU A;  2UU9 H;  1S03 G;  3KAL A;  5D1O A;  4QWC A;  4XYL B;  2F4V H;  3EPI A;  3ETH A;  3GTJ A;  4H8A A;  1CS0 A;  5DGB A;  3SB1 A;  2JA9 A;  5KFN A;  5EDW A;  2UUB H;  4O4I F;  2HJW A;  1BXR A;  4A3K G;  1FJG H;  4EFE A;  4EFB A;  4LH6 A;  4Q45 A;  4DV6 H;  1B6R A;  5GON F;  4DR7 H;  4IWY A;  4CC6 A;  2VA3 A;  3C0F B;  4LF9 H;  4Q0Y A;  4IRD A;  4F4X A;  3H3V H;  4ED1 A;  2BR0 A;  2O03 A;  3Q8R B;  4RB3 C;  2JA6 G;  2R8H A;  3N42 B;  3MWD A;  2JEF A;  1TAE A;  3OSN A;  4EG0 A;  3VPD A;  2R84 A;  1DV2 A;  1WCM G;  4YR0 A;  1XDN A;  5CA0 F;  4AIM A;  2W71 A;  5KT4 A;  4O3R A;  2Y3M A;  3L2P A;  2W6O A;  2C22 A;  3RBD A;  3CVZ A;  4LF6 H;  4WBN F;  3GQC A;  3KTM A;  3SE7 A;  2C00 A;  5K36 G;  4MV7 A;  3BAB A;  4GKJ H;  2WAQ E;  5J2T F;  4YQW A;  5KFA A;  4QWE A;  1FKA H;  1M0T A;  5KFU A;  3OHB A;  4A3E G;  2JZX A;  4F4Z A;  4GLX A;  4BA2 I;  2R82 A;  3RFC A;  4RNN A;  4PWQ A;  2VUM G;  1AN7 A;  4JI8 H;  1K83 A;  3H0G A;  4O2A F;  5FPO A;  3OUZ A;  5L1K A;  2YCH A;  2RDI A;  1T3N A;  4RZQ A;  5KFL A;  3LML A;  4Q8F A;  3Q1K A;  4CC5 A;  2W6N A;  4ZHQ F;  4DL2 A;  2R92 G;  2XGP A;  3RAQ A;  3RV4 A;  2W6Z A;  3PVX A;  2ZDG A;  4YP3 A;  4IFD G;  2OH2 A;  3EZJ A;  4XZ3 B;  1S20 A;  2YZG A;  3UQ8 A;  1B6S A;  1DGS A;  2R93 G;  5HV6 A;  4X64 H;  1M0W A;  3N44 B;  5DGA A;  1JLL B;  2W6P A;  1XMO H;  3CQZ A;  4YBZ B;  5IT9 W;  2NU8 B;  1GO3 E;  3KDK A;  1KEE A;  1VAJ A;  4TUY F;  3JSN A;  4MV8 A;  4O2B F;  2W7O A;  5JVL A;  2GPW A;  5EWF A;  2E2H A;  3VMM A;  3RB4 A;  2NN6 G;  4NZT M;  1J5E H;  4MTD A;  5L1J A;  1JX4 A;  4O3P A;  4QIW E;  1JIH A;  5D1O B;  4TV9 F;  5FJ8 G;  3NCV A;  4ECU A;  5KFP A;  1X9Z A;  2FE3 A;  5KFB A;  2JA6 A;  3V6H A;  5LMN H;  4LF8 H;  4EBD A;  5IWA H;  4TV8 F;  3OSP A;  2R85 A;  2YW2 A;  2CPQ A;  4UFZ A;  4ECY A;  1V51 A;  4DL4 A;  2BQR A;  1IBM H;  1HNZ H;  4M9U A;  3T5J A;  2ANN A;  3GII A;  3H20 A;  1V4Y A;  1Y1V A;  4NXM H;  4A3J G;  5KG2 A;  2A1S A;  4FM9 A;  2YRW A;  1E4G T;  3MFH A;  5FLM G;  3I0P A;  4WAN A;  2D9I A;  3RGZ A;  1TWC A;  1K1S A;  4F50 A;  2YZN A;  4ECX A;  4DUZ H;  5BPH A;  2RGV A;  2VA2 A;  1KJQ A;  3HKZ A;  4U7C A;  5DQG A;  3BQ0 A;  1K1G A;  1C3O A;  4HR7 A;  3RV3 A;  4J0M A;  4I7H A;  4J9K A;  5KFM A;  3PW7 A;  4O3S A;  2B63 A;  2E3U A;  3PN1 A;  5F9L A;  1PQX A;  4ETS A;  3MWM A;  4F4W A;  1N56 A;  1ZHQ A;  1VKZ A;  4XYM B;  5C0X G;  2FPI B;  2YRX A;  4JI3 H;  4AYB E;  1OWT A;  3H4D A;  4OD6 A;  2NU9 B;  5JQW A;  4DR2 H;  4DL7 A;  2R92 A;  1Z2P X;  2C2R A;  3TII A;  4EBC A;  4PDB A;  1A0I A;  5DQH A;  3UFX B;  4RU9 A;  3KHL A;  4A93 G;  2HVS A;  4F4Y A;  4C5A A;  5DG9 A;  4A3L G;  1S97 A; 
#chains in the Genus database with same CATH homology
 4B3M H;  2HGS A;  2Q2U A;  1HR0 H;  4AQY H;  3FAU A;  2UU9 H;  1S03 G;  3FMA A;  3KAL A;  4RAY A;  5D1O A;  2F4V H;  4LFA H;  4MV9 A;  2HVQ A;  4UCR A;  4DR3 H;  3SB1 A;  4DV2 H;  2ZJT A;  1TA8 A;  2UUB H;  4JI2 H;  3N43 B;  5FPR A;  3K3V A;  2OWO A;  3M4I A;  1FJG H;  1SYX B;  4EFE A;  4LH6 A;  4EFB A;  4DV6 H;  4CC6 A;  4DV1 H;  4DR7 H;  5A2Q W;  1N34 H;  2HHH H;  2O4C A;  4X65 H;  4JI6 H;  4LF9 H;  3C0F B;  4Q0Y A;  5FD5 A;  4RB1 A;  5LL6 b;  2Q2T A;  4YHH H;  3F8N A;  1V9P A;  2O03 A;  4RB3 C;  3N42 B;  1BJT A;  1TAE A;  2CW7 A;  4G08 A;  3GAB A;  3OTO H;  3EYY A;  1XDN A;  1L2Z A;  3J81 W;  2Y3M A;  1XMQ H;  2E5L H;  2UUA H;  3L2P A;  4DV5 H;  3RF2 A;  4LF6 H;  3CVZ A;  4UCU A;  3JAM W;  4EEQ A;  4RB2 C;  4LF7 H;  4APM A;  3L4K A;  1X9N A;  1Z2O X;  4MV7 A;  3BAB A;  4BWS C;  1FVI A;  4GKJ H;  4LH7 A;  4LF4 H;  4DV4 H;  1FKA H;  1M0T A;  1P8L A;  2PT7 G;  2VQE H;  4DUY H;  4GLX A;  2ZQE A;  1Z2N X;  1O75 A;  1AN7 A;  4JI8 H;  1XNQ H;  4EC5 A;  4DR6 H;  2VKC A;  5FPO A;  1IBL H;  4NXN H;  2YCH A;  1BGW A;  5FD6 A;  4RZQ A;  4JI1 H;  1F0X A;  1WH2 A;  3LML A;  3JSL A;  4CC5 A;  2CW8 A;  2WE6 A;  4R7R A;  4B3T H;  4DR4 H;  1HNX H;  1MZB A;  5FLX W;  1HNW H;  4UCV A;  3RTX A;  3EZJ A;  3UQ8 A;  5LMU H;  4OCH A;  1DGS A;  2UXC H;  3T1H H;  4X64 H;  5BR8 H;  4DR5 H;  4LFC H;  1M0W A;  2KSW A;  4B3R H;  1XMO H;  1VS0 A;  2WDT A;  5IT9 W;  3DF7 A;  4UCT A;  3KDK A;  2UUC H;  4NZR M;  4E9J A;  3N40 P;  3N41 B;  4IAJ A;  2RGR A;  2VUG A;  5EOY A;  3JSN A;  1B04 A;  5DT9 A;  2ZM6 H;  2VQF H;  2W57 A;  4NZT M;  1J5E H;  3RGX A;  2VPS A;  4MTD A;  2XIG A;  4DR1 H;  4LF5 H;  3L4J A;  5D1O B;  4DV7 H;  4K0K H;  3NCV A;  3KAJ A;  1X9Z A;  1IBK H;  4X66 H;  2FE3 A;  3IG0 A;  5LMN H;  4LF8 H;  1S68 A;  3BAA A;  5IWA H;  3J80 W;  4GKK H;  4UFZ A;  3QD7 X;  1IBM H;  1HNZ H;  4LMY A;  3H20 A;  4LSA A;  4NXM H;  4OX9 H;  3GR5 A;  1N33 H;  4KHP H;  1I6U A;  2VOB A;  4FM9 A;  3KAK A;  1E4G T;  1E4F T;  3RJ0 A;  3OET A;  2D9I A;  1N32 H;  3RGZ A;  1SEI A;  2UXD H;  4UCO A;  3HXL A;  4DUZ H;  1GYF A;  2RGV A;  4YY3 H;  4M7E A;  4JI7 H;  4A2B A;  4LSX A;  4J0M A;  4DV0 H;  4JI0 H;  4JI4 H;  4I7H A;  2FPH X;  3KDG A;  4X62 H;  3PN1 A;  2UXB H;  4B8C D;  4ETS A;  3MWM A;  4RB0 A;  1ZHQ A;  2MCT A;  3N6X A;  2HVR A;  3BA9 A;  4JI3 H;  1N36 H;  4OD6 A;  1I94 H;  4JYA H;  4DR2 H;  4UCS A;  4RAZ A;  2LF0 A;  1ODH A;  4JV5 H;  1Z2P X;  1ZHS A;  3OSS D;  2WYO A;  4A2A A;  4JI5 H;  3T1Y H;  4LFB H;  4DV3 H;  4PDB A;  1A0I A;  3N44 B;  3J7A K;  1XNR H;  2HVS A;  3BA8 A;  3KXY T;  4MTE A;  4B3S H;  3RIZ A;  5D1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...