3RF2A

Crystal structure of 30s ribosomal protein s8 from aquifex aeolicus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
165
Chain Sequence
VDPIADMFSAIKNAIMRRDDFLYVPSSKLKERILDVLKKEGFIQDWEALKGEKYEEEYKKMKELAEKSPNPKMKRYLKQLEEYNKGTQYPIKIYLKYLDPKKRKSAITNIVKVSKGGRRVYAGVRTMPYVKRGLGIAIVSTDAGVMTDHEARRMRKGGEVIAFVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Aquifex aeolicus Ribosomal Protein S8 Reveals a Unique Subdomain that Contributes to an Extremely Tight Association with 16S rRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ribosomal protein
molecule keywords 30S ribosomal protein S8
total genus 46
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3rf2A01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3rf2A02
4LF5H 1FJGH 4B3SH 4X64H 4K0KH 1SEIA 1XMOH 4DR6H 4NXNH 2UXBH 4DV3H 1HNWH 4DV4H 3OTOH 3J81W 5LMUH 1N33H 1HNXH 2UUCH 4LF7H 1I94H 3J7AK 4OX9H 4LF6H 4X66H 4DV0H 4DV7H 4JV5H 4X65H 4AQYH 4YY3H 2VQFH 5A2QW 4DR2H 4GKJH 4YHHH 4GKKH 4DR5H 1XNRH 2UXDH 4B3TH 2F4VH 3JAMW 2UU9H 4LF8H 1AN7A 4DR4H 1N36H 4LFBH 5LMNH 4LF4H 4DR7H 4JI3H 4JI8H 1HR0H 4B3RH 2ZM6H 3RF2A 4DUZH 1S03G 4JI6H 5IWAH 4DUYH 4B3MH 4JI5H 2UUBH 4LFCH 4NXMH 4X62H 2HHHH 4DV5H 3T1HH 1FKAH 2UUAH 4JI2H 4LFAH 1XMQH 4JI0H 2UXCH 4DV2H 2E5LH 4KHPH 4DV6H 3T1YH 1IBKH 2VQEH 4LF9H 1XNQH 4JYAH 5BR8H 5FLXW 4JI1H 4PDBA 5LL6b 1I6UA 3J80W 4DR1H 1HNZH 1IBLH 4JI7H 1IBMH 4DV1H 1J5EH 4JI4H 1N34H 5IT9W 4DR3H 1N32H
chains in the Genus database with same CATH superfamily
5C1PA 4LF5H 2A1SA 4X64H 5KG0A 1B33N 3RJ0A 1S9FA 2PN1A 4MV8A 5BPFA 1T94A 3RBDA 4J0MA 1XMOH 2XD4A 4ME6A 3OSNA 5EDWA 3I0PA 2ZJTA 2ASLA 4NXNH 4XZ3B 3U9TA 1CS0A 5KG5A 2JE6I 2J6SA 4EEQA 3KXYT 1KJ9A 5LYJF 3PW5A 2ASJA 2UVRA 2GPSA 2YRWA 5LMUH 1RJRA 3N40P 5IYCG 3VMMA 4RU9A 3Q8PB 3PVXA 1GLVA 2CPMA 1EC6A 2UUCH 4MV4A 5KG7A 3HOVG 2RDIA 4B8CD 4M9UA 4BBSG 3I4MG 2PQUA 4HNTA 4MA5A 5JH7F 5KT2A 3IN5A 4OX9H 2WYOA 5BPHA 2R7KA 4DV0H 1Z2NX 2RF4A 2R8KA 3GTPA 3PZPA 2W6NA 5EWGA 4YY3H 4ECZA 4LSXA 1CQIB 1M6VA 1Y1VG 4J9RA 3JSNA 4HYKA 2BQ3A 1J4WA 3MWEA 3C0FB 3RAQA 4MA0A 5FD5A 2JA9A 5KT5A 4DL6A 5C3EG 5DG9A 2C00A 4IWYA 3PR5B 3VPDA 2F4VH 1RYRA 2UU9H 4ZQIA 2OWOA 2JEJA 1ZZJA 2FPIB 5KFKA 3BA9A 3MFIA 4YAJB 4A2BA 2R86A 4QWBA 3U9SA 1EZ1A 4ZOLF 5IYBG 3MR5A 2G8YA 4AIMA 2JEFA 4A3GG 4LFBH 2CWFA 1N48A 2JEGA 3JZIA 4J9NA 5LMNH 2WAQE 2MJHA 1DV1A 4JI3H 3RB0A 4PWQA 2LRRA 3TQ1A 4BXXG 3PW4A 2BQUA 3RF2A 1S03G 2RGRA 2M6QA 2FJZA 2YZGA 3V4SA 1GSAA 4EG0A 3NGDA 2SCUB 2WAQA 4J9LA 4BA2I 5IWAH 3K3PA 4C2MA 4A3IG 3PW0A 2C2RA 3I4NG 5KFIA 2JA5A 1UNNC 1B6RA 1B6SA 1JDEA 2I80A 1C3OA 3FDSA 3RV3A 4JI5H 2DPIA 2Q2TA 2VA2A 2MCTA 2M8WA 4LFCH 1JIHA 4YB8B 2W57A 2DZDA 3RB3A 1X4NA 3N6XA 3MJFA 2E2HA 4DV5H 1RYSA 4ECVA 4JI2H 3TIIA 2NU9B 2YS6A 2X06A 3KTMA 4JI0H 5L9XA 5DQGA 4DV2H 3H0GA 3GTGA 4UCOA 3E5NA 4F50A 3GTLA 3H4BA 2R93G 2W6QA 5L1IA 3H4DA 1SYXB 4CC5A 4JYAH 1WH2A 3CQZA 5KFJA 2P2RA 3RV4A 5KG1A 3GQCA 2AGPA 5JVDF 1GYFA 1ZHQA 3ORRA 5JVLA 3V6HA 1X9ZA 1DV2A 3GIPA 1VBIA 3HXLA 3U1KA 4R7RA 5C5JA 5KFWA 3MR3A 3M9NB 1GGOA 4LSAA 5L1JA 3T5KA 1W93A 2FLLA 3R23A 4O2AF 5T14A 4JV1A 1Z2OX 4H8AA 3QZ8A 1BXRA 3GTMA 4RB1A 3QD7X 3BG5A 3ORQA 5KFDA 3KHGA 1BNCA 1KJQA 1ZZIA 5KT6A 5IP7G 3GIQA 3KAJA 3VKEA 3RIZA 3G6XA 1CQJB 2I8CA 5FD6A 4C5CA 4Q8EA 5DLFA 2CW7A 1Y1WA 4EBDA 2BL5A 5HBRB 4F4XA 3Q8QB 1EUCB 5KFQA 4HNUA 2CTFA 3GIIA 2PY9A 3RB4A 1N32H 5CAEB 4IR1A 3PO3G 3KHLA 2R8GA 1MSZA 3BA8A 2IMWP 4IRCA 3OUUA 2Y3MA 3LWBA 4LH7A 4MAMA 1A9XA 1SEIA 4DR6H 3I12A 4LMYA 2FPHX 2UXBH 2CWHA 4DV3H 1K1QA 2R87A 1PQXA 2HH3A 3GIJA 5CB4F 5FJ8G 3HOXG 4DV4H 3OTOH 5KT4A 2CW8A 4TUYF 3EYYA 4WALA 5LP6F 4RB3C 2QYZA 3QZ7A 3N8DA 4LF7H 1PX2A 2DPJA 5K36G 4NZTM 4FS1A 4UCUA 1E4EB 2HVQA 2ATLA 2OPUA 4MTDA 4EBCA 4YR2A 2C2EA 2ZQEA 4A2AA 2YQRA 2DWCA 1AUVA 4J9PA 1V9NA 2W70A 2UVUA 4LF6H 3OSSD 2O4CA 2K1HA 2WB1A 4EFBA 1BJTA 2XIGA 3MR2A 2ANNA 2VPSA 2AGOA 4J9KA 4R8UB 5LA6F 4RNNA 5L1KA 2IA6A 3PW7A 3GABA 4GKKH 4I55F 1XNRH 1AUXA 4QIWA 4B3TH 2O03A 2V58A 3GILA 2C35B 3GV8B 2FLPA 1O75A 3RGXA 2W6MA 2YS7A 4UCVA 4IR9A 4A3CG 4FJSA 2FB9A 2V59A 1ZETA 2JEAI 4WD3A 1C30A 2XGQA 2B63G 1N36H 3SE7A 1Z2IA 4DR7H 5KFLA 3L2PA 1I7LA 5DG7A 2ZM6H 1S0MA 4HQ6A 4UCSA 1CE8A 4U7CA 3OETA 2GPWA 4JI6H 4I7HA 4ECUA 2J6TA 4DL3A 2R92G 3KDKA 4MV1A 2CPQA 1V9PA 4IRKA 3HOZG 2DLNA 2WB1E 4ED0A 1KJJA 5DGBA 1E4GT 2VUMA 3K3VA 3KAKA 4A3LG 2Z0SA 4O3SA 2UUAH 1E4EA 1TWGA 3MWMA 2FKLA 2R7MA 3GIDA 4F4WA 2HVRA 5KFVA 1J5KA 3HKZE 2UXCH 3M9OB 2R7ZG 5EZYF 2ZDHA 3UQ8A 1S10A 2PMZA 4DV6H 4RZQA 3RBEA 2VQEH 5JQWA 3VPBA 5D1OB 1V51A 2FFMA 2W9AA 3V6JA 2E2IA 1XNQH 5KFSA 3GV7B 5F9LA 4QW9A 3GKUA 3OSPA 3N42B 5FLXW 4MTEA 1RK5A 4ECWA 1A0IA 2FPPB 2R7NA 4QJFA 4MV7A 3NCVA 3J80W 3GLKA 1V4YA 4YAKB 3OHAA 1Y1WG 2OPVA 4B8TA 4XYLB 4O3RA 4EGQA 2XC9A 5KFXA 3MR6A 4ECTA 4LIJA 1E4FT 1JKJB 2YYAA 1N34H 5IT9W 2AQ4A 3G6VA 4O3QA 4QWEA 4IWXA 2KSWA 5KFOA 4QWAA 1KC7A 3QFFA 3GIKA 1JDBB 5KX5F 2JA6G 2W9BB 4EYIB 5KFMA 4ETSA 2CQYA 3R5HA 2HVSA 1FJGH 1M0TA 4L1KA 4O3OA 4ED8A 4K0KH 5DGAA 3PW2A 2B63A 5D8DA 5CA1F 2W9CB 1XDNA 3EPGA 1DTJA 5IYZF 5IP9G 4A3DG 4IZOA 4ECRA 4E4TA 1R9TA 2Y0SA 5JUMA 2VOBA 5C1OA 4RZRA 5KKNB 2VA3A 2FK3A 1N56A 4YBZB 2CTJA 4XYMB 5KFFA 5KG2A 4ED7A 4RNOA 4JVYA 3HB9A 1I94H 4ZI7F 1PK8A 4BY7G 3J7AK 4DL7A 2PBZA 2VQDA 2JVZA 3ETJA 1KBLA 5FPRA 4X66H 4MV3A 4DV7H 4TV8F 5LXTF 4JV5H 4ECQA 2CKZB 4A3BG 3T5LA 2XCLA 4EFEA 2VQFH 4DL4A 1RJPA 4FJUA 2IP4A 4RB0A 3T5JA 4FBUA 2FPGB 1EHIA 2JA8G 2V4RA 1X4MA 1S68A 4YHHH 4AYBA 2R8HA 5LOVF 4DR5H 1V8CA 3BQ2A 4R8UA 3TINA 2UXDH 5KFGA 4JV2A 2VUMG 1BGWA 3JAMW 4IAJA 4LF8H 4RUCA 3BABA 2R7LA 5KFUA 2PT7G 4O4LF 2XCPA 2YL2A 1Y1VA 1AN7A 2LTMA 3OHBA 2W9CA 2HGSA 1S0NA 2V9WA 5EWEA 1W96A 3AYHB 4GLXA 2C28A 2JA7G 1MZBA 4LF4H 2VR1A 2ZDQA 3GIMA 2W71A 4JI8H 1HR0H 1GO3E 3F8NA 4DL5A 4WBNF 4DUZH 3FKIG 4I50F 3WO1A 4RNMA 5L1LA 2BR0A 2W7OA 3CVZA 4AM3A 4ED1A 2WE6A 4MV6A 2NN6G 3PR4A 4E9JA 1P8LA 4BWSC 2Q2UA 4Q8FA 3GTOA 4X62H 1S0OA 5KFNA 2AU0A 3LMLA 3T1HH 3Q1KA 4NLGA 2YW2A 2BA0A 4EEYA 3HOYG 1L2ZA 1I7NA 1IOWA 4U6PA 3GV5B 2E5LH 5EOYA 4KHPH 2R85A 2WTFA 4ECSA 5C0XG 3GR5A 4M7EA 1IBKH 5KG3A 4LF9H 4TV9F 3RB6A 2VKCA 2C22A 2R8JA 1WCMG 2NU6B 2PVPA 2W6PA 3ETHA 5KG6A 1UC8A 2XCAA 3RAXA 3V4ZA 1DGSA 4ED2A 3DF7A 4EYHB 4DL2A 1ZQ7A 4NZRM 2QK4A 5D1OA 4Q45A 4J9QA 3KHRA 3FAUA 3IG0A 2JA5G 1RJQA 2CTEA 4A3FG 3H0GG 1T3NA 4DR1H 4RAYA 3R5FA 5KFZA 4ZHQF 1IBLH 4OO1G 4EGJA 1ZZKA 1K1SA 3K5IA 4RAZA 4YP3A 1ZHSA 2M05A 1VKZA 4YQWA 3T5HA 5C8YF 4J9MA 3KHHA 3UFXB 4JI7H 1S97A 4IFDG 4FU0A 1IBMH 3HKZA 2HH2A 4BA1I 4A3EG 2AXYA 5IYDG 1VS0A 2DGRA 4JI4H 4QIWE 4QWCA 5CA0F 5EWFA 3Q2OA 4O2BF 2V4QA 2W6ZA 3VPCA 4F4YA 3GTQA 3MWDA 3FKIA 5DLGA 1RK6A 1TA8A 5F9NA 2AGQA 1Y14B 1TAEA 2YU9A 4B3SH 2R8IA 2Y0SE 2NU8B 2ANRA 2W9BA 4O4HF 2R92A 1NXUA 2W6OA 4O3PA 3V6KA 1K83A 2FLNA 1Z2PX 1T36A 1GSOA 5KFEA 4QW8A 1B04A 4IHJF 5DQHA 4YR3A 3PN1A 1XRHA 4A3JG 2CZGA 1HNWH 2JA6A 3TIGA 1TWHA 4JVHA 3J81W 4TQSA 4A3MG 5KFYA 3HOWG 3N41B 1N33H 3K5HA 4C5AA 3Q8SB 2FMAA 3MFHA 4GC6A 3HBLA 4RUAA 1HNXH 4DLKA 2FMRA 1TWCA 3WO0A 4Q44A 2RDJA 4FM9A 1WSCA 3KDGA 4NBQA 1SCUB 1F0XA 2D9IA 1X9NA 4Q0YA 5J2UF 1WHRA 2DIKA 2VPQA 2JZXA 1VIHA 3PO2G 1KJIA 2PMZE 3FMAA 2GLTA 4JUZA 5DG8A 1M7JA 3N44B 3AEVB 4X65H 5DT9A 3M4IA 2FP4B 4AQYH 5KFHA 2J6UA 3EZJA 5JEAG 3SB1A 4WANA 4UCTA 1I50A 5A2QW 2J9GA 4RB2C 3L4KA 4ED6A 4Q43A 4LH6A 4DR2H 1EUDB 4GKJH 3OUZA 1K1GA 1UC9A 3N43B 4FS2A 4MV9A 2JA7A 1KEEA 3Q8RB 2ALZA 2NUAB 5BMVF 1TWAA 2LTLA 1KJ8A 1VIGA 2YRXA 2R7ZA 5KFPA 2FK1A 2W8KA 4O4IF 4C5BA 3EPIA 5H80A 3L7ZC 5FLMG 1OWTA 4QMFB 1X0AA 2FE3A 4J9SA 3BJYA 3GTJA 2W7PA 4HNVA 4IRDA 1ODHA 4DR4H 4ECXA 2NVXA 4JV0A 4OCHA 5I47A 1FVIA 1UG8A 3JRXA 4B3RH 1WVNA 3SI8A 3H40A 2YCHA 2I87A 2R82A 2CTMA 2ASDA 5C44G 4DUYH 2YZMA 1ULZA 2WDTA 4B3MH 3RUPA 4A3KG 2UVVA 2R93A 2R84A 2R6FA 2X0SA 2UUBH 5KFTA 4OD6A 2YZNA 1JXLA 5FPOA 4NXMH 1ZTGA 3JRWA 2HHHH 4O3NA 4TQRA 5GONF 1FKAH 1JLLB 1TWFA 2OLSA 4LFAH 3JSLA 4GC7A 2OH2A 5KFAA 2CTLA 1XMQH 1DIKA 2UVWA 3H3VH 5KT7A 4UCRA 5KFRA 3T1YH 1S20A 1KHMA 3BQ0A 4A93G 1VBGA 2QNDA 3WNZA 2IBKA 1VAJA 3HOUG 2V5AA 4FBTA 2NU7B 2VUGA 1SFOA 4G3IA 2E3UA 5BR8H 2FK2A 3RTXA 3H20A 4JI1H 2C2DA 5HV6A 4PDBA 4YR0A 3RFCA 5KT3A 3KALA 1WR2A 4UFZA 5LL6b 4BY1G 4CC6A 1EYZA 1I6UA 5KFCA 2W8LA 3BQ1A 5J2TF 2JEBI 5KG4A 4ECYA 4EC5A 2P0AA 1HNZH 3G6YA 2LF0A 2BQRA 4Y8VB 3TQTA 4BBRG 3GTKA 3RGZA 1WCMA 1DT4A 2CTKA 4QWDA 1JX4A 3LP8A 1WE8A 3R5XA 4YJ3F 1M0WA 5C4XG 3G8CA 1VBHA 4F4ZA 4DV1H 1IOVA 5K2MA 2HJWA 5D1PA 3M9MB 4J9OA 1I3QA 1J5EH 3L4JA 4ED3A 3BAAA 1WTJA 4DR3H 4YJ2F 4I4TF 5DQIA 2JEIA 1GSHA 4AYBE 4HR7A 4APMA 4EBEA 2RGVA 2NVYA 2ZDGA 4XX0B 3V69A 3UOEA 2XGPA 4G08A 1TUAA 5KFBA
chains in the Genus database with same CATH topology
3BA8A 1TAEA 4LF5H 1FJGH 4B3SH 1M0TA 4X64H 4K0KH 2Y3MA 3RJ0A 4LH7A 1XDNA 4J0MA 1SEIA 1XMOH 4DR6H 1Z2PX 4LMYA 2ZJTA 4NXNH 2FPHX 2UXBH 1B04A 4DV3H 3PN1A 4MTEA 1HNWH 4DV4H 4EEQA 3OTOH 3KXYT 2VOBA 3J81W 2CW8A 3EYYA 5LMUH 1N33H 3N41B 3N40P 4RB3C 1HNXH 2UUCH 4LF7H 4FM9A 4NZTM 1I94H 3KDGA 4UCUA 1F0XA 2HVQA 4B8CD 2D9IA 1X9NA 4Q0YA 4MTDA 3J7AK 2ZQEA 4A2AA 4OX9H 2WYOA 3FMAA 5FPRA 4LF6H 3OSSD 2O4CA 4DV7H 4X66H 4DV0H 4JV5H 1Z2NX 4X65H 5DT9A 1BJTA 3M4IA 4AQYH 4EFBA 2XIGA 3EZJA 4YY3H 4EFEA 2VQFH 3SB1A 2VPSA 4UCTA 4LSXA 4RB0A 5A2QW 3JSNA 3C0FB 4RB2C 3L4KA 4LH6A 4DR2H 4GKJH 5FD5A 1S68A 3GABA 4YHHH 4GKKH 3N43B 4DR5H 1XNRH 4MV9A 2UXDH 4B3TH 1BGWA 2F4VH 3JAMW 2O03A 2UU9H 4IAJA 4LF8H 2OWOA 3BABA 1O75A 3RGXA 1GYFA 3BA9A 2PT7G 4UCVA 4A2BA 2FE3A 1AN7A 1ODHA 4DR4H 1N36H 2HGSA 4LFBH 4GLXA 4OCHA 5LMNH 4LF4H 1FVIA 4DR7H 1MZBA 4JI3H 3RTXA 4JI8H 1HR0H 4B3RH 2ZM6H 3F8NA 3L2PA 2RGRA 3RF2A 4DUZH 1S03G 2YCHA 3OETA 4UCSA 4I7HA 4JI6H 3N44B 5IWAH 3CVZA 4DUYH 3KDKA 2WDTA 4B3MH 1V9PA 2WE6A 2Q2TA 4E9JA 4JI5H 1P8LA 4BWSC 2UUBH 2MCTA 4LFCH 1E4GT 4OD6A 3K3VA 2Q2UA 2W57A 4NXMH 3KAKA 5FPOA 3N6XA 4X62H 2HHHH 4DV5H 3T1HH 1FKAH 2UUAH 4JI2H 4LFAH 3JSLA 3LMLA 3MWMA 1L2ZA 1XMQH 2HVRA 4JI0H 2UXCH 4DV2H 2E5LH 4KHPH 4UCRA 5EOYA 3UQ8A 4UCOA 3GR5A 4M7EA 4DV6H 3T1YH 1IBKH 4RZQA 2VQEH 4LF9H 5D1OB 2VKCA 1SYXB 4CC5A 1XNQH 4JYAH 1WH2A 2VUGA 1DGSA 5BR8H 1ZHQA 5FLXW 3DF7A 3H20A 1X9ZA 3N42B 3HXLA 4JI1H 4NZRM 4R7RA 1A0IA 4PDBA 5D1OA 3KALA 4CC6A 3FAUA 5LL6b 3IG0A 4MV7A 4UFZA 3NCVA 1I6UA 4LSAA 3J80W 4EC5A 4DR1H 1HNZH 1Z2OX 2LF0A 4RAYA 1IBLH 4RAZA 4RB1A 1ZHSA 3QD7X 3RGZA 4JI7H 1M0WA 1E4FT 1IBMH 3KAJA 4DV1H 3RIZA 5D1PA 1VS0A 1J5EH 4JI4H 3L4JA 1N34H 5IT9W 5FD6A 3BAAA 4DR3H 2CW7A 2KSWA 4APMA 2RGVA 1TA8A 4G08A 1N32H 4ETSA 2HVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 H;  1FJG H;  4B3S H;  4X64 H;  4K0K H;  1SEI A;  1XMO H;  4DR6 H;  4NXN H;  2UXB H;  4DV3 H;  1HNW H;  4DV4 H;  3OTO H;  3J81 W;  5LMU H;  1N33 H;  1HNX H;  2UUC H;  4LF7 H;  1I94 H;  3J7A K;  4OX9 H;  4LF6 H;  4X66 H;  4DV0 H;  4DV7 H;  4JV5 H;  4X65 H;  4AQY H;  4YY3 H;  2VQF H;  5A2Q W;  4DR2 H;  4GKJ H;  4YHH H;  4GKK H;  4DR5 H;  1XNR H;  2UXD H;  4B3T H;  2F4V H;  3JAM W;  2UU9 H;  4LF8 H;  1AN7 A;  4DR4 H;  1N36 H;  4LFB H;  5LMN H;  4LF4 H;  4DR7 H;  4JI3 H;  4JI8 H;  1HR0 H;  4B3R H;  2ZM6 H;  3RF2 A;  4DUZ H;  1S03 G;  4JI6 H;  5IWA H;  4DUY H;  4B3M H;  4JI5 H;  2UUB H;  4LFC H;  4NXM H;  4X62 H;  2HHH H;  4DV5 H;  3T1H H;  1FKA H;  2UUA H;  4JI2 H;  4LFA H;  1XMQ H;  4JI0 H;  2UXC H;  4DV2 H;  2E5L H;  4KHP H;  4DV6 H;  3T1Y H;  1IBK H;  2VQE H;  4LF9 H;  1XNQ H;  4JYA H;  5BR8 H;  5FLX W;  4JI1 H;  4PDB A;  5LL6 b;  1I6U A;  3J80 W;  4DR1 H;  1HNZ H;  1IBL H;  4JI7 H;  1IBM H;  4DV1 H;  1J5E H;  4JI4 H;  1N34 H;  5IT9 W;  4DR3 H;  1N32 H; 
#chains in the Genus database with same CATH topology
 5C1P A;  4LF5 H;  2A1S A;  4X64 H;  5KG0 A;  1B33 N;  3RJ0 A;  1S9F A;  2PN1 A;  4MV8 A;  5BPF A;  1T94 A;  3RBD A;  4J0M A;  1XMO H;  2XD4 A;  4ME6 A;  3OSN A;  5EDW A;  3I0P A;  2ZJT A;  2ASL A;  4NXN H;  4XZ3 B;  3U9T A;  1CS0 A;  5KG5 A;  2JE6 I;  2J6S A;  4EEQ A;  3KXY T;  1KJ9 A;  5LYJ F;  3PW5 A;  2ASJ A;  2UVR A;  2GPS A;  2YRW A;  5LMU H;  1RJR A;  3N40 P;  5IYC G;  3VMM A;  4RU9 A;  3Q8P B;  3PVX A;  1GLV A;  2CPM A;  1EC6 A;  2UUC H;  4MV4 A;  5KG7 A;  3HOV G;  2RDI A;  4B8C D;  4M9U A;  4BBS G;  3I4M G;  2PQU A;  4HNT A;  4MA5 A;  5JH7 F;  5KT2 A;  3IN5 A;  4OX9 H;  2WYO A;  5BPH A;  2R7K A;  4DV0 H;  1Z2N X;  2RF4 A;  2R8K A;  3GTP A;  3PZP A;  2W6N A;  5EWG A;  4YY3 H;  4ECZ A;  4LSX A;  1CQI B;  1M6V A;  1Y1V G;  4J9R A;  3JSN A;  4HYK A;  2BQ3 A;  1J4W A;  3MWE A;  3C0F B;  3RAQ A;  4MA0 A;  5FD5 A;  2JA9 A;  5KT5 A;  4DL6 A;  5C3E G;  5DG9 A;  2C00 A;  4IWY A;  3PR5 B;  3VPD A;  2F4V H;  1RYR A;  2UU9 H;  4ZQI A;  2OWO A;  2JEJ A;  1ZZJ A;  2FPI B;  5KFK A;  3BA9 A;  3MFI A;  4YAJ B;  4A2B A;  2R86 A;  4QWB A;  3U9S A;  1EZ1 A;  4ZOL F;  5IYB G;  3MR5 A;  2G8Y A;  4AIM A;  2JEF A;  4A3G G;  4LFB H;  2CWF A;  1N48 A;  2JEG A;  3JZI A;  4J9N A;  5LMN H;  2WAQ E;  2MJH A;  1DV1 A;  4JI3 H;  3RB0 A;  4PWQ A;  2LRR A;  3TQ1 A;  4BXX G;  3PW4 A;  2BQU A;  3RF2 A;  1S03 G;  2RGR A;  2M6Q A;  2FJZ A;  2YZG A;  3V4S A;  1GSA A;  4EG0 A;  3NGD A;  2SCU B;  2WAQ A;  4J9L A;  4BA2 I;  5IWA H;  3K3P A;  4C2M A;  4A3I G;  3PW0 A;  2C2R A;  3I4N G;  5KFI A;  2JA5 A;  1UNN C;  1B6R A;  1B6S A;  1JDE A;  2I80 A;  1C3O A;  3FDS A;  3RV3 A;  4JI5 H;  2DPI A;  2Q2T A;  2VA2 A;  2MCT A;  2M8W A;  4LFC H;  1JIH A;  4YB8 B;  2W57 A;  2DZD A;  3RB3 A;  1X4N A;  3N6X A;  3MJF A;  2E2H A;  4DV5 H;  1RYS A;  4ECV A;  4JI2 H;  3TII A;  2NU9 B;  2YS6 A;  2X06 A;  3KTM A;  4JI0 H;  5L9X A;  5DQG A;  4DV2 H;  3H0G A;  3GTG A;  4UCO A;  3E5N A;  4F50 A;  3GTL A;  3H4B A;  2R93 G;  2W6Q A;  5L1I A;  3H4D A;  1SYX B;  4CC5 A;  4JYA H;  1WH2 A;  3CQZ A;  5KFJ A;  2P2R A;  3RV4 A;  5KG1 A;  3GQC A;  2AGP A;  5JVD F;  1GYF A;  1ZHQ A;  3ORR A;  5JVL A;  3V6H A;  1X9Z A;  1DV2 A;  3GIP A;  1VBI A;  3HXL A;  3U1K A;  4R7R A;  5C5J A;  5KFW A;  3MR3 A;  3M9N B;  1GGO A;  4LSA A;  5L1J A;  3T5K A;  1W93 A;  2FLL A;  3R23 A;  4O2A F;  5T14 A;  4JV1 A;  1Z2O X;  4H8A A;  3QZ8 A;  1BXR A;  3GTM A;  4RB1 A;  3QD7 X;  3BG5 A;  3ORQ A;  5KFD A;  3KHG A;  1BNC A;  1KJQ A;  1ZZI A;  5KT6 A;  5IP7 G;  3GIQ A;  3KAJ A;  3VKE A;  3RIZ A;  3G6X A;  1CQJ B;  2I8C A;  5FD6 A;  4C5C A;  4Q8E A;  5DLF A;  2CW7 A;  1Y1W A;  4EBD A;  2BL5 A;  5HBR B;  4F4X A;  3Q8Q B;  1EUC B;  5KFQ A;  4HNU A;  2CTF A;  3GII A;  2PY9 A;  3RB4 A;  1N32 H;  5CAE B;  4IR1 A;  3PO3 G;  3KHL A;  2R8G A;  1MSZ A;  3BA8 A;  2IMW P;  4IRC A;  3OUU A;  2Y3M A;  3LWB A;  4LH7 A;  4MAM A;  1A9X A;  1SEI A;  4DR6 H;  3I12 A;  4LMY A;  2FPH X;  2UXB H;  2CWH A;  4DV3 H;  1K1Q A;  2R87 A;  1PQX A;  2HH3 A;  3GIJ A;  5CB4 F;  5FJ8 G;  3HOX G;  4DV4 H;  3OTO H;  5KT4 A;  2CW8 A;  4TUY F;  3EYY A;  4WAL A;  5LP6 F;  4RB3 C;  2QYZ A;  3QZ7 A;  3N8D A;  4LF7 H;  1PX2 A;  2DPJ A;  5K36 G;  4NZT M;  4FS1 A;  4UCU A;  1E4E B;  2HVQ A;  2ATL A;  2OPU A;  4MTD A;  4EBC A;  4YR2 A;  2C2E A;  2ZQE A;  4A2A A;  2YQR A;  2DWC A;  1AUV A;  4J9P A;  1V9N A;  2W70 A;  2UVU A;  4LF6 H;  3OSS D;  2O4C A;  2K1H A;  2WB1 A;  4EFB A;  1BJT A;  2XIG A;  3MR2 A;  2ANN A;  2VPS A;  2AGO A;  4J9K A;  4R8U B;  5LA6 F;  4RNN A;  5L1K A;  2IA6 A;  3PW7 A;  3GAB A;  4GKK H;  4I55 F;  1XNR H;  1AUX A;  4QIW A;  4B3T H;  2O03 A;  2V58 A;  3GIL A;  2C35 B;  3GV8 B;  2FLP A;  1O75 A;  3RGX A;  2W6M A;  2YS7 A;  4UCV A;  4IR9 A;  4A3C G;  4FJS A;  2FB9 A;  2V59 A;  1ZET A;  2JEA I;  4WD3 A;  1C30 A;  2XGQ A;  2B63 G;  1N36 H;  3SE7 A;  1Z2I A;  4DR7 H;  5KFL A;  3L2P A;  1I7L A;  5DG7 A;  2ZM6 H;  1S0M A;  4HQ6 A;  4UCS A;  1CE8 A;  4U7C A;  3OET A;  2GPW A;  4JI6 H;  4I7H A;  4ECU A;  2J6T A;  4DL3 A;  2R92 G;  3KDK A;  4MV1 A;  2CPQ A;  1V9P A;  4IRK A;  3HOZ G;  2DLN A;  2WB1 E;  4ED0 A;  1KJJ A;  5DGB A;  1E4G T;  2VUM A;  3K3V A;  3KAK A;  4A3L G;  2Z0S A;  4O3S A;  2UUA H;  1E4E A;  1TWG A;  3MWM A;  2FKL A;  2R7M A;  3GID A;  4F4W A;  2HVR A;  5KFV A;  1J5K A;  3HKZ E;  2UXC H;  3M9O B;  2R7Z G;  5EZY F;  2ZDH A;  3UQ8 A;  1S10 A;  2PMZ A;  4DV6 H;  4RZQ A;  3RBE A;  2VQE H;  5JQW A;  3VPB A;  5D1O B;  1V51 A;  2FFM A;  2W9A A;  3V6J A;  2E2I A;  1XNQ H;  5KFS A;  3GV7 B;  5F9L A;  4QW9 A;  3GKU A;  3OSP A;  3N42 B;  5FLX W;  4MTE A;  1RK5 A;  4ECW A;  1A0I A;  2FPP B;  2R7N A;  4QJF A;  4MV7 A;  3NCV A;  3J80 W;  3GLK A;  1V4Y A;  4YAK B;  3OHA A;  1Y1W G;  2OPV A;  4B8T A;  4XYL B;  4O3R A;  4EGQ A;  2XC9 A;  5KFX A;  3MR6 A;  4ECT A;  4LIJ A;  1E4F T;  1JKJ B;  2YYA A;  1N34 H;  5IT9 W;  2AQ4 A;  3G6V A;  4O3Q A;  4QWE A;  4IWX A;  2KSW A;  5KFO A;  4QWA A;  1KC7 A;  3QFF A;  3GIK A;  1JDB B;  5KX5 F;  2JA6 G;  2W9B B;  4EYI B;  5KFM A;  4ETS A;  2CQY A;  3R5H A;  2HVS A;  1FJG H;  1M0T A;  4L1K A;  4O3O A;  4ED8 A;  4K0K H;  5DGA A;  3PW2 A;  2B63 A;  5D8D A;  5CA1 F;  2W9C B;  1XDN A;  3EPG A;  1DTJ A;  5IYZ F;  5IP9 G;  4A3D G;  4IZO A;  4ECR A;  4E4T A;  1R9T A;  2Y0S A;  5JUM A;  2VOB A;  5C1O A;  4RZR A;  5KKN B;  2VA3 A;  2FK3 A;  1N56 A;  4YBZ B;  2CTJ A;  4XYM B;  5KFF A;  5KG2 A;  4ED7 A;  4RNO A;  4JVY A;  3HB9 A;  1I94 H;  4ZI7 F;  1PK8 A;  4BY7 G;  3J7A K;  4DL7 A;  2PBZ A;  2VQD A;  2JVZ A;  3ETJ A;  1KBL A;  5FPR A;  4X66 H;  4MV3 A;  4DV7 H;  4TV8 F;  5LXT F;  4JV5 H;  4ECQ A;  2CKZ B;  4A3B G;  3T5L A;  2XCL A;  4EFE A;  2VQF H;  4DL4 A;  1RJP A;  4FJU A;  2IP4 A;  4RB0 A;  3T5J A;  4FBU A;  2FPG B;  1EHI A;  2JA8 G;  2V4R A;  1X4M A;  1S68 A;  4YHH H;  4AYB A;  2R8H A;  5LOV F;  4DR5 H;  1V8C A;  3BQ2 A;  4R8U A;  3TIN A;  2UXD H;  5KFG A;  4JV2 A;  2VUM G;  1BGW A;  3JAM W;  4IAJ A;  4LF8 H;  4RUC A;  3BAB A;  2R7L A;  5KFU A;  2PT7 G;  4O4L F;  2XCP A;  2YL2 A;  1Y1V A;  1AN7 A;  2LTM A;  3OHB A;  2W9C A;  2HGS A;  1S0N A;  2V9W A;  5EWE A;  1W96 A;  3AYH B;  4GLX A;  2C28 A;  2JA7 G;  1MZB A;  4LF4 H;  2VR1 A;  2ZDQ A;  3GIM A;  2W71 A;  4JI8 H;  1HR0 H;  1GO3 E;  3F8N A;  4DL5 A;  4WBN F;  4DUZ H;  3FKI G;  4I50 F;  3WO1 A;  4RNM A;  5L1L A;  2BR0 A;  2W7O A;  3CVZ A;  4AM3 A;  4ED1 A;  2WE6 A;  4MV6 A;  2NN6 G;  3PR4 A;  4E9J A;  1P8L A;  4BWS C;  2Q2U A;  4Q8F A;  3GTO A;  4X62 H;  1S0O A;  5KFN A;  2AU0 A;  3LML A;  3T1H H;  3Q1K A;  4NLG A;  2YW2 A;  2BA0 A;  4EEY A;  3HOY G;  1L2Z A;  1I7N A;  1IOW A;  4U6P A;  3GV5 B;  2E5L H;  5EOY A;  4KHP H;  2R85 A;  2WTF A;  4ECS A;  5C0X G;  3GR5 A;  4M7E A;  1IBK H;  5KG3 A;  4LF9 H;  4TV9 F;  3RB6 A;  2VKC A;  2C22 A;  2R8J A;  1WCM G;  2NU6 B;  2PVP A;  2W6P A;  3ETH A;  5KG6 A;  1UC8 A;  2XCA A;  3RAX A;  3V4Z A;  1DGS A;  4ED2 A;  3DF7 A;  4EYH B;  4DL2 A;  1ZQ7 A;  4NZR M;  2QK4 A;  5D1O A;  4Q45 A;  4J9Q A;  3KHR A;  3FAU A;  3IG0 A;  2JA5 G;  1RJQ A;  2CTE A;  4A3F G;  3H0G G;  1T3N A;  4DR1 H;  4RAY A;  3R5F A;  5KFZ A;  4ZHQ F;  1IBL H;  4OO1 G;  4EGJ A;  1ZZK A;  1K1S A;  3K5I A;  4RAZ A;  4YP3 A;  1ZHS A;  2M05 A;  1VKZ A;  4YQW A;  3T5H A;  5C8Y F;  4J9M A;  3KHH A;  3UFX B;  4JI7 H;  1S97 A;  4IFD G;  4FU0 A;  1IBM H;  3HKZ A;  2HH2 A;  4BA1 I;  4A3E G;  2AXY A;  5IYD G;  1VS0 A;  2DGR A;  4JI4 H;  4QIW E;  4QWC A;  5CA0 F;  5EWF A;  3Q2O A;  4O2B F;  2V4Q A;  2W6Z A;  3VPC A;  4F4Y A;  3GTQ A;  3MWD A;  3FKI A;  5DLG A;  1RK6 A;  1TA8 A;  5F9N A;  2AGQ A;  1Y14 B;  1TAE A;  2YU9 A;  4B3S H;  2R8I A;  2Y0S E;  2NU8 B;  2ANR A;  2W9B A;  4O4H F;  2R92 A;  1NXU A;  2W6O A;  4O3P A;  3V6K A;  1K83 A;  2FLN A;  1Z2P X;  1T36 A;  1GSO A;  5KFE A;  4QW8 A;  1B04 A;  4IHJ F;  5DQH A;  4YR3 A;  3PN1 A;  1XRH A;  4A3J G;  2CZG A;  1HNW H;  2JA6 A;  3TIG A;  1TWH A;  4JVH A;  3J81 W;  4TQS A;  4A3M G;  5KFY A;  3HOW G;  3N41 B;  1N33 H;  3K5H A;  4C5A A;  3Q8S B;  2FMA A;  3MFH A;  4GC6 A;  3HBL A;  4RUA A;  1HNX H;  4DLK A;  2FMR A;  1TWC A;  3WO0 A;  4Q44 A;  2RDJ A;  4FM9 A;  1WSC A;  3KDG A;  4NBQ A;  1SCU B;  1F0X A;  2D9I A;  1X9N A;  4Q0Y A;  5J2U F;  1WHR A;  2DIK A;  2VPQ A;  2JZX A;  1VIH A;  3PO2 G;  1KJI A;  2PMZ E;  3FMA A;  2GLT A;  4JUZ A;  5DG8 A;  1M7J A;  3N44 B;  3AEV B;  4X65 H;  5DT9 A;  3M4I A;  2FP4 B;  4AQY H;  5KFH A;  2J6U A;  3EZJ A;  5JEA G;  3SB1 A;  4WAN A;  4UCT A;  1I50 A;  5A2Q W;  2J9G A;  4RB2 C;  3L4K A;  4ED6 A;  4Q43 A;  4LH6 A;  4DR2 H;  1EUD B;  4GKJ H;  3OUZ A;  1K1G A;  1UC9 A;  3N43 B;  4FS2 A;  4MV9 A;  2JA7 A;  1KEE A;  3Q8R B;  2ALZ A;  2NUA B;  5BMV F;  1TWA A;  2LTL A;  1KJ8 A;  1VIG A;  2YRX A;  2R7Z A;  5KFP A;  2FK1 A;  2W8K A;  4O4I F;  4C5B A;  3EPI A;  5H80 A;  3L7Z C;  5FLM G;  1OWT A;  4QMF B;  1X0A A;  2FE3 A;  4J9S A;  3BJY A;  3GTJ A;  2W7P A;  4HNV A;  4IRD A;  1ODH A;  4DR4 H;  4ECX A;  2NVX A;  4JV0 A;  4OCH A;  5I47 A;  1FVI A;  1UG8 A;  3JRX A;  4B3R H;  1WVN A;  3SI8 A;  3H40 A;  2YCH A;  2I87 A;  2R82 A;  2CTM A;  2ASD A;  5C44 G;  4DUY H;  2YZM A;  1ULZ A;  2WDT A;  4B3M H;  3RUP A;  4A3K G;  2UVV A;  2R93 A;  2R84 A;  2R6F A;  2X0S A;  2UUB H;  5KFT A;  4OD6 A;  2YZN A;  1JXL A;  5FPO A;  4NXM H;  1ZTG A;  3JRW A;  2HHH H;  4O3N A;  4TQR A;  5GON F;  1FKA H;  1JLL B;  1TWF A;  2OLS A;  4LFA H;  3JSL A;  4GC7 A;  2OH2 A;  5KFA A;  2CTL A;  1XMQ H;  1DIK A;  2UVW A;  3H3V H;  5KT7 A;  4UCR A;  5KFR A;  3T1Y H;  1S20 A;  1KHM A;  3BQ0 A;  4A93 G;  1VBG A;  2QND A;  3WNZ A;  2IBK A;  1VAJ A;  3HOU G;  2V5A A;  4FBT A;  2NU7 B;  2VUG A;  1SFO A;  4G3I A;  2E3U A;  5BR8 H;  2FK2 A;  3RTX A;  3H20 A;  4JI1 H;  2C2D A;  5HV6 A;  4PDB A;  4YR0 A;  3RFC A;  5KT3 A;  3KAL A;  1WR2 A;  4UFZ A;  5LL6 b;  4BY1 G;  4CC6 A;  1EYZ A;  1I6U A;  5KFC A;  2W8L A;  3BQ1 A;  5J2T F;  2JEB I;  5KG4 A;  4ECY A;  4EC5 A;  2P0A A;  1HNZ H;  3G6Y A;  2LF0 A;  2BQR A;  4Y8V B;  3TQT A;  4BBR G;  3GTK A;  3RGZ A;  1WCM A;  1DT4 A;  2CTK A;  4QWD A;  1JX4 A;  3LP8 A;  1WE8 A;  3R5X A;  4YJ3 F;  1M0W A;  5C4X G;  3G8C A;  1VBH A;  4F4Z A;  4DV1 H;  1IOV A;  5K2M A;  2HJW A;  5D1P A;  3M9M B;  4J9O A;  1I3Q A;  1J5E H;  3L4J A;  4ED3 A;  3BAA A;  1WTJ A;  4DR3 H;  4YJ2 F;  4I4T F;  5DQI A;  2JEI A;  1GSH A;  4AYB E;  4HR7 A;  4APM A;  4EBE A;  2RGV A;  2NVY A;  2ZDG A;  4XX0 B;  3V69 A;  3UOE A;  2XGP A;  4G08 A;  1TUA A;  5KFB A; 
#chains in the Genus database with same CATH homology
 3BA8 A;  1TAE A;  4LF5 H;  1FJG H;  4B3S H;  1M0T A;  4X64 H;  4K0K H;  2Y3M A;  3RJ0 A;  4LH7 A;  1XDN A;  4J0M A;  1SEI A;  1XMO H;  4DR6 H;  1Z2P X;  4LMY A;  2ZJT A;  4NXN H;  2FPH X;  2UXB H;  1B04 A;  4DV3 H;  3PN1 A;  4MTE A;  1HNW H;  4DV4 H;  4EEQ A;  3OTO H;  3KXY T;  2VOB A;  3J81 W;  2CW8 A;  3EYY A;  5LMU H;  1N33 H;  3N41 B;  3N40 P;  4RB3 C;  1HNX H;  2UUC H;  4LF7 H;  4FM9 A;  4NZT M;  1I94 H;  3KDG A;  4UCU A;  1F0X A;  2HVQ A;  4B8C D;  2D9I A;  1X9N A;  4Q0Y A;  4MTD A;  3J7A K;  2ZQE A;  4A2A A;  4OX9 H;  2WYO A;  3FMA A;  5FPR A;  4LF6 H;  3OSS D;  2O4C A;  4DV7 H;  4X66 H;  4DV0 H;  4JV5 H;  1Z2N X;  4X65 H;  5DT9 A;  1BJT A;  3M4I A;  4AQY H;  4EFB A;  2XIG A;  3EZJ A;  4YY3 H;  4EFE A;  2VQF H;  3SB1 A;  2VPS A;  4UCT A;  4LSX A;  4RB0 A;  5A2Q W;  3JSN A;  3C0F B;  4RB2 C;  3L4K A;  4LH6 A;  4DR2 H;  4GKJ H;  5FD5 A;  1S68 A;  3GAB A;  4YHH H;  4GKK H;  3N43 B;  4DR5 H;  1XNR H;  4MV9 A;  2UXD H;  4B3T H;  1BGW A;  2F4V H;  3JAM W;  2O03 A;  2UU9 H;  4IAJ A;  4LF8 H;  2OWO A;  3BAB A;  1O75 A;  3RGX A;  1GYF A;  3BA9 A;  2PT7 G;  4UCV A;  4A2B A;  2FE3 A;  1AN7 A;  1ODH A;  4DR4 H;  1N36 H;  2HGS A;  4LFB H;  4GLX A;  4OCH A;  5LMN H;  4LF4 H;  1FVI A;  4DR7 H;  1MZB A;  4JI3 H;  3RTX A;  4JI8 H;  1HR0 H;  4B3R H;  2ZM6 H;  3F8N A;  3L2P A;  2RGR A;  3RF2 A;  4DUZ H;  1S03 G;  2YCH A;  3OET A;  4UCS A;  4I7H A;  4JI6 H;  3N44 B;  5IWA H;  3CVZ A;  4DUY H;  3KDK A;  2WDT A;  4B3M H;  1V9P A;  2WE6 A;  2Q2T A;  4E9J A;  4JI5 H;  1P8L A;  4BWS C;  2UUB H;  2MCT A;  4LFC H;  1E4G T;  4OD6 A;  3K3V A;  2Q2U A;  2W57 A;  4NXM H;  3KAK A;  5FPO A;  3N6X A;  4X62 H;  2HHH H;  4DV5 H;  3T1H H;  1FKA H;  2UUA H;  4JI2 H;  4LFA H;  3JSL A;  3LML A;  3MWM A;  1L2Z A;  1XMQ H;  2HVR A;  4JI0 H;  2UXC H;  4DV2 H;  2E5L H;  4KHP H;  4UCR A;  5EOY A;  3UQ8 A;  4UCO A;  3GR5 A;  4M7E A;  4DV6 H;  3T1Y H;  1IBK H;  4RZQ A;  2VQE H;  4LF9 H;  5D1O B;  2VKC A;  1SYX B;  4CC5 A;  1XNQ H;  4JYA H;  1WH2 A;  2VUG A;  1DGS A;  5BR8 H;  1ZHQ A;  5FLX W;  3DF7 A;  3H20 A;  1X9Z A;  3N42 B;  3HXL A;  4JI1 H;  4NZR M;  4R7R A;  1A0I A;  4PDB A;  5D1O A;  3KAL A;  4CC6 A;  3FAU A;  5LL6 b;  3IG0 A;  4MV7 A;  4UFZ A;  3NCV A;  1I6U A;  4LSA A;  3J80 W;  4EC5 A;  4DR1 H;  1HNZ H;  1Z2O X;  2LF0 A;  4RAY A;  1IBL H;  4RAZ A;  4RB1 A;  1ZHS A;  3QD7 X;  3RGZ A;  4JI7 H;  1M0W A;  1E4F T;  1IBM H;  3KAJ A;  4DV1 H;  3RIZ A;  5D1P A;  1VS0 A;  1J5E H;  4JI4 H;  3L4J A;  1N34 H;  5IT9 W;  5FD6 A;  3BAA A;  4DR3 H;  2CW7 A;  2KSW A;  4APM A;  2RGV A;  1TA8 A;  4G08 A;  1N32 H;  4ETS A;  2HVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...