3RF2A

Crystal structure of 30s ribosomal protein s8 from aquifex aeolicus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
165
Chain Sequence
VDPIADMFSAIKNAIMRRDDFLYVPSSKLKERILDVLKKEGFIQDWEALKGEKYEEEYKKMKELAEKSPNPKMKRYLKQLEEYNKGTQYPIKIYLKYLDPKKRKSAITNIVKVSKGGRRVYAGVRTMPYVKRGLGIAIVSTDAGVMTDHEARRMRKGGEVIAFVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Aquifex aeolicus Ribosomal Protein S8 Reveals a Unique Subdomain that Contributes to an Extremely Tight Association with 16S rRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ribosomal protein
molecule keywords 30S ribosomal protein S8
total genus 46
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3rf2A01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3rf2A02
1S03G 4B3RH 1HNZH 2UUAH 4LFCH 2UUBH 4YHHH 2VQEH 4JV5H 4GKKH 1AN7A 5BR8H 2VQFH 4DR3H 1XMQH 4JI8H 4DR5H 2UXBH 3T1HH 4KHPH 4DUZH 4JI3H 4LF8H 4X62H 1XMOH 4JI0H 1FJGH 4LFBH 1I6UA 5IT9W 1HR0H 1XNRH 3J81W 4K0KH 4JI5H 1SEIA 4DV1H 1I94H 1IBLH 1HNWH 1HNXH 1N32H 4X65H 4X66H 4PDBA 5LMUH 4LFAH 1FKAH 4LF9H 5LL6b 2UXCH 4DV4H 1IBMH 4AQYH 1N34H 3RF2A 4DR6H 2F4VH 4YY3H 5IWAH 4LF7H 4JI1H 4DV2H 4JI4H 4OX9H 4DV0H 1XNQH 4GKJH 3OTOH 2E5LH 3JAMW 5LMNH 4NXMH 3J7AK 4JYAH 4JI7H 4JI2H 4DR7H 4DR1H 2ZM6H 1N33H 2HHHH 2UUCH 3T1YH 2UXDH 4DR2H 4LF5H 3J80W 4JI6H 4B3MH 1J5EH 1N36H 4X64H 4DR4H 4B3SH 1IBKH 5FLXW 4B3TH 4LF6H 4DV3H 4DV5H 4DV6H 4NXNH 4DUYH 5A2QW 2UU9H 4DV7H 4LF4H
chains in the Genus database with same CATH superfamily
3ORQA 3KTMA 4QIWA 4IZOA 2CWHA 4ECQA 4JVHA 4AM3A 4G08A 4F4YA 4I7HA 2CPQA 1RJRA 3K5HA 2XD4A 1N48A 1B6SA 5KFJA 2V5AA 4J9MA 5I47A 5DGAA 2Y0SA 4LFCH 5DG8A 4YHHH 2W70A 3GTGA 1WVNA 3Q8SB 4FS1A 4YBZB 4YQWA 1AN7A 4IRCA 5KG7A 4NBQA 4YR3A 4ECXA 4EEQA 3Q8PB 5KT5A 1RYRA 4DR3H 2ASJA 3K5IA 3LP8A 4YJ2F 1ZHSA 1WCMG 2DIKA 4U6PA 1X4NA 2VPSA 3ETJA 4QWEA 4HNUA 3IG0A 2JEFA 4DUZH 2P2RA 4EGJA 4JI3H 1TWHA 4LF8H 5FPRA 3VPBA 3PO3G 3SE7A 4J0MA 1XMOH 3HBLA 3HKZE 4XYMB 4E9JA 4LFBH 5KFBA 3KHLA 4QW8A 1A0IA 1CS0A 5JH7F 2RDJA 4IRKA 1BXRA 1CE8A 1KJJA 1Y1WA 1VBIA 1B04A 1ZTGA 3AEVB 4GC7A 4Q44A 2FLLA 4RUCA 1I94H 2DZDA 2W6MA 3EYYA 1JX4A 1HNWH 4RAZA 1N32H 2CTEA 4X66H 1IOVA 2FPGB 3LMLA 5JQWA 5FLMG 5L1JA 3PZPA 2CW7A 5KFTA 4F4ZA 1FKAH 4DL6A 5JUMA 4B8CD 2UXCH 1N56A 3JSNA 1E4EB 4IAJA 1EUCB 2WE6A 2W6ZA 4HR7A 2XIGA 4FJSA 3BA9A 5KFLA 3V6KA 3RF2A 4GLXA 4DR6H 1ODHA 2M8WA 1TAEA 2VQDA 2W6OA 1M7JA 1MZBA 5DQHA 4YR0A 2XCLA 5IWAH 3KXYT 1Y14B 2AQ4A 4JI1H 2R7MA 4UCTA 3TQTA 4U7CA 1WTJA 5JVDF 4A3LG 3OTOH 2JZXA 2AGPA 3T5JA 1V51A 1GSAA 2ATLA 3JAMW 2SCUB 4O4HF 4M9UA 5C1PA 4HNTA 5KT3A 2NUAB 3OSNA 3V6JA 1UG8A 3NCVA 2R7ZA 5KT4A 2DGRA 2YS6A 5JVLA 4RB1A 4JV2A 3V69A 4ZHQF 1WR2A 2A1SA 4O3QA 3M4IA 4IWYA 3I4NG 2CTLA 2BA0A 2CTMA 2VPQA 5L1KA 1E4GT 2RDIA 2W6PA 4DR2H 4YJ3F 5KFMA 2OLSA 5BPHA 2CW8A 1TWFA 2WB1A 3WO0A 5HBRB 5C44G 2IMWP 3G8CA 3J80W 2PMZA 5LA6F 2C22A 1K1SA 1ZZJA 5KG6A 5IYZF 2QK4A 1Y1WG 3BQ1A 5KFPA 4Y8VB 2R8JA 2UVUA 1GGOA 4DR4H 2RGVA 4MTEA 4C5BA 3L4JA 4UFZA 3MWDA 1CQIB 3C0FB 1M6VA 5BPFA 2XGPA 1S97A 4BA1I 2RF4A 4DL3A 4O4LF 1ZZKA 4MV7A 3GV7B 1ZHQA 2FE3A 5A2QW 4L1KA 3KHGA 2ANNA 1EYZA 3HOZG 2R87A 3VMMA 5IP9G 2CTFA 2JEJA 1PX2A 2ANRA 1Y1VG 3FMAA 4MV6A 2MJHA 5KFNA 2XGQA 3KHRA 4ECUA 1C30A 3NGDA 3RGZA 1DTJA 1I7NA 3BAAA 4BY1G 2QNDA 4B3RH 4BBSG 1DV2A 2YRWA 2FK1A 4J9SA 1Z2OX 1KEEA 2UUAH 1KJQA 2UUBH 2LTMA 2VQEH 3GQCA 4GKKH 3HOWG 2W6NA 1C3OA 4J9QA 3TIGA 5BR8H 4GC6A 1EHIA 3RV4A 4A3KG 4JI8H 2BQUA 4ED1A 4I50F 4H8AA 4JVYA 4TQRA 1TWGA 3T1HH 5KFIA 4A3BG 3PO2G 3HOXG 3U1KA 1MSZA 1CQJB 2GPWA 5GONF 3R5HA 4X62H 1K1QA 5L1IA 3BQ2A 4ED6A 3L2PA 2OPUA 3KAJA 4RB3C 4MV3A 3N6XA 1I6UA 4ZI7F 3MR5A 3V6HA 3RBDA 3GILA 4ECVA 1T3NA 1XNRH 2FMRA 1B33N 4EEYA 5KT2A 3J81W 4K0KH 3L7ZC 4JI5H 2WAQE 2YZMA 1SEIA 3H4DA 3PW4A 3PW0A 2OPVA 3GLKA 5FD5A 1IBLH 4J9KA 1HNXH 2V58A 3N42B 2YYAA 3MWMA 2CPMA 1VKZA 4DLKA 2JA7G 3I4MG 4RU9A 2FPHX 1EC6A 1VBHA 4RB2C 5KG2A 2W7PA 5KFRA 4A2AA 2FLNA 4AQYH 3PN1A 4A3GG 1JDBB 5EZYF 3L4KA 2FK3A 3T5LA 2ZDHA 5KFQA 4WANA 2D9IA 4E4TA 4AYBE 2LRRA 4OCHA 2R86A 1S20A 3N43B 4J9PA 3BJYA 4FBTA 3GIKA 2Q2UA 2R7KA 3Q2OA 5J2UF 2XC9A 3VKEA 2NVYA 5CB4F 4DV2H 2UVVA 4JI4H 1TWAA 2CKZB 3MJFA 3RB4A 2C28A 2HJWA 2AGQA 4RUAA 5KFXA 1R9TA 3UOEA 1TWCA 2R92A 1UNNC 2E5LH 4ECTA 2R8GA 5LMNH 3J7AK 3QFFA 2C2DA 1O75A 4F4XA 1VS0A 2R7ZG 3JRWA 3GTJA 1B6RA 4XYLB 3R5FA 4UCRA 1BNCA 2JE6I 4JYAH 2FKLA 3UQ8A 5JEAG 5KFYA 4IHJF 4IFDG 2ZM6H 3K3PA 1SYXB 1X4MA 3KDKA 3BG5A 5KG0A 3V4ZA 2W9AA 2BR0A 1K83A 2UUCH 2Q2TA 3RJ0A 3QD7X 2CQYA 2YRXA 4QIWE 1RK5A 4LMYA 5EWEA 2W7OA 4YP3A 3F8NA 2BL5A 4Q8EA 4A3EG 3GIPA 2FP4B 4YAKB 1GSOA 1ZETA 2DWCA 3PR5B 3GV5B 2C00A 2NVXA 2Y0SE 2RGRA 3I12A 3RGXA 4F50A 5FD6A 3GIDA 1DT4A 3U9TA 3RIZA 2NN6G 2WDTA 3H20A 3H40A 2WTFA 5C4XG 5LXTF 1IBKH 5FLXW 1DIKA 2W9BB 3GTKA 4EYIB 4DV6H 5KFSA 2CWFA 2R8HA 3Q8RB 4O3SA 1XDNA 2ZQEA 2W9BA 1AUVA 3G6XA 1X9NA 4ED3A 4EFEA 4DV7H 1W96A 2R7LA 2LF0A 4BA2I 2IA6A 2PBZA 3BQ0A 2NU9B 3QZ7A 3OHAA 4EFBA 4LSXA 2J6SA 5T14A 3R5XA 1X0AA 2JA5G 1Y1VA 2VUGA 2YZGA 3OETA 4Q45A 3RB3A 2DPJA 5D1PA 2E2HA 3T5HA 4A2BA 4I55F 4MA5A 3UFXB 2FMAA 4A3FG 1P8LA 3FDSA 5J2TF 4G3IA 2NU8B 2PQUA 4JV5H 2J6TA 3KHHA 2ASDA 2FPIB 3KALA 2E3UA 3DF7A 3PVXA 2V59A 2CTJA 2HVSA 2CTKA 2VQFH 2R7NA 2LTLA 3WO1A 5D1OA 4EYHB 1KBLA 2W9CB 3RB6A 3GTLA 4DR5H 4RNMA 4FBUA 4KHPH 3GR5A 3QZ8A 2VKCA 2YS7A 3V4SA 2BQ3A 4ED8A 2R8IA 2FPPB 2VOBA 2ZDGA 5LOVF 4JI0H 2GLTA 2PVPA 2C2RA 1EUDB 4WD3A 2M6QA 5KFKA 5IT9W 4DL4A 1ZZIA 4IR1A 3N40P 2B63G 2JEIA 2JA6A 2R8KA 5KFWA 5KT6A 2J9GA 3RV3A 5KFFA 2XCPA 2VR1A 3PR4A 4DV1H 2V9WA 1DGSA 4QW9A 2R6FA 4QWCA 1JKJB 3Q1KA 4QWAA 1J5KA 4RNOA 1S0OA 2J6UA 1W93A 4C5AA 4PDBA 5F9LA 5LMUH 4LFAH 1V9NA 2AGOA 4OD6A 4ECSA 4LF9H 4DV4H 1KHMA 3GABA 1GLVA 5KFHA 1RK6A 4JUZA 1IBMH 2I80A 3TINA 3GKUA 5BMVF 3BABA 4EBCA 4A3IG 1N34H 3EZJA 1JIHA 3N41B 2YCHA 5FJ8G 5EWGA 4FM9A 3TQ1A 4C5CA 4ECZA 2FLPA 5DT9A 4O3OA 1KJIA 1I50A 2JEGA 3GTQA 4CC5A 5IYDG 3HKZA 2F4VH 1T36A 1M0WA 2G8YA 4B8TA 2XCAA 1SCUB 2PMZE 2V4QA 4IRDA 1PQXA 1I3QA 5DQGA 5KKNB 4OX9H 3H0GA 2YW2A 4A3JG 2BQRA 4GKJH 2FK2A 2I8CA 3N44B 3RB0A 2R93G 4OO1G 2KSWA 3OUUA 1VIGA 1M0TA 4MTDA 4FU0A 2WYOA 2NU7B 4BBRG 5L1LA 4BY7G 4NXMH 4O3NA 1WSCA 5IYCG 3HOVG 4C2MA 4AIMA 5DGBA 4JI7H 2VUMG 1NXUA 2JA8G 2W8LA 2IP4A 3OUZA 5KG4A 1VAJA 5L9XA 4HYKA 4IR9A 4LSAA 2UXDH 2UVWA 3GTPA 4MV9A 5HV6A 5KFEA 4UCOA 3PW2A 5LYJF 1VBGA 2ASLA 4QMFB 3GV8B 2QYZA 4LF5H 3FKIG 2JA9A 4J9LA 5FPOA 4MAMA 4APMA 2YZNA 4O3PA 1FVIA 4EGQA 5C1OA 2HH2A 5C5JA 1J5EH 3ORRA 3G6YA 4ECYA 4JV1A 1V4YA 1GSHA 3E5NA 4NZRM 4X64H 5EWFA 3JRXA 2HH3A 1JDEA 1VIHA 4MA0A 1S68A 2ZJTA 4UCUA 4ZQIA 2C2EA 4LF6H 3ETHA 4Q0YA 5KFZA 2VA3A 4Q43A 3MR6A 4R8UB 2FJZA 4TV9F 3VPDA 2VA2A 3GTMA 2HVRA 3M9NB 1KJ8A 4ED0A 4XX0B 2UU9H 1I7LA 3JSLA 4LH6A 2W9CA 2IBKA 4R7RA 4CC6A 4J9NA 5KG3A 1L2ZA 5KX5F 1GO3E 1TUAA 1S03G 3Q8QB 1T94A 3M9OB 3PW5A 2JA5A 3FAUA 2OH2A 2O4CA 1HNZH 2JEAI 3OHBA 2WAQA 2GPSA 2DPIA 3TIIA 1K1GA 3OSSD 3GIQA 4FS2A 4ECRA 5EDWA 5KFDA 3M9MB 2V4RA 5DQIA 4YR2A 3EPIA 2X0SA 4ED7A 5DG7A 3HOUG 2R93A 3T5KA 2ALZA 4BXXG 4WALA 4NLGA 1ZQ7A 4UCSA 1GYFA 1XMQH 4YAJB 4F4WA 1WCMA 4MV4A 1WH2A 5C0XG 1EZ1A 3H3VH 1BGWA 4NZTM 2UXBH 5KFVA 5C8YF 2HGSA 3RAQA 2Y3MA 4O4IF 4TUYF 5EOYA 4QWDA 3WNZA 4RNNA 1UC8A 1S0MA 1X9ZA 1FJGH 2HVQA 2JA6G 3MR3A 3I0PA 3GIJA 1KJ9A 3K3VA 2JEBI 1HR0H 1S9FA 1V8CA 2NU6B 3RAXA 4MV8A 2Z0SA 5DLFA 2C35B 3SB1A 4Q8FA 2R92G 4EC5A 5C3EG 1S0NA 5K36G 3JZIA 3SI8A 4X65H 4J9RA 4AYBA 1PK8A 5KFAA 3AYHB 1E4EA 1XRHA 5LL6b 2AU0A 4BWSC 5KFOA 1E4FT 3HXLA 4RAYA 4XZ3B 1RJPA 1Z2PX 3KDGA 4RZRA 4A3CG 4LH7A 5KG5A 2FB9A 5DLGA 5CA1F 3H4BA 2I87A 2K1HA 4A3DG 1J4WA 1DV1A 2PY9A 3KAKA 3EPGA 1UC9A 3OSPA 4YY3H 2PT7G 4LF7H 1BJTA 2R85A 2JVZA 3H0GG 4RZQA 5H80A 4O2AF 5K2MA 3RTXA 4M7EA 3GIMA 3IN5A 2OWOA 4O3RA 4J9OA 3LWBA 4DV0H 4QWBA 5IYBG 1XNQH 2FFMA 3MFHA 4ED2A 2W71A 5KFUA 3HB9A 1KC7A 2R84A 2W6QA 4MV1A 5F9NA 1F0XA 2E2IA 1ULZA 2UVRA 2YL2A 1Z2IA 3N8DA 4HNVA 1TA8A 3BA8A 5D8DA 3U9SA 5KFCA 1IOWA 5KG1A 2YU9A 2W57A 4O2BF 4JV0A 3RFCA 4JI2H 4DR7H 4UCVA 3MR2A 4QJFA 4DR1H 2VUMA 1N33H 1RJQA 1OWTA 2ZDQA 5KT7A 1WE8A 2HHHH 2MCTA 3CVZA 4IWXA 4TV8F 3T1YH 3VPCA 4ETSA 4TQSA 1RYSA 5DG9A 2X06A 2M05A 2B63A 2P0AA 1JXLA 4RB0A 4DL5A 4FJUA 2WB1E 4EG0A 5CA0F 3RBEA 1S10A 4A93G 4LIJA 3FKIA 4DL7A 4DL2A 4JI6H 4B3MH 4ME6A 3CQZA 4I4TF 1N36H 2R82A 1V9PA 2YQRA 4YB8B 4WBNF 4EBEA 1JLLB 1WHRA 3PW7A 4B3SH 4B3TH 2DLNA 2W8KA 5IP7G 1A9XA 3R23A 1AUXA 4DV3H 3RUPA 4PWQA 4DV5H 4ZOLF 3GTOA 4ECWA 4NXNH 2JA7A 2PN1A 4DUYH 4R8UA 2CZGA 5D1OB 2AXYA 1Z2NX 3GIIA 4EBDA 3MWEA 5CAEB 4LF4H 3G6VA 3MFIA 5LP6F 2O03A 1SFOA 4HQ6A 4A3MG 5KFGA 3HOYG
chains in the Genus database with same CATH topology
1L2ZA 2VUGA 3RGZA 3OETA 3BAAA 1S03G 5D1PA 4G08A 3FAUA 4A2BA 4I7HA 2O4CA 1HNZH 4B3RH 1P8LA 1Z2OX 2UUAH 4LFCH 3OSSD 2UUBH 4YHHH 2VQEH 4JV5H 4GKKH 1AN7A 3KALA 5BR8H 3DF7A 4EEQA 4UCSA 2HVSA 1GYFA 2VQFH 4DR3H 1XMQH 4JI8H 1WH2A 5D1OA 1ZHSA 4DR5H 1BGWA 4NZTM 2UXBH 3T1HH 2VPSA 4KHPH 2HGSA 2Y3MA 3GR5A 5EOYA 3IG0A 2VKCA 4DUZH 4JI3H 4LF8H 4X62H 5FPRA 2VOBA 4J0MA 1XMOH 1X9ZA 4JI0H 3L2PA 1FJGH 4E9JA 4LFBH 2HVQA 3KAJA 1I6UA 3N6XA 4RB3C 1A0IA 5IT9W 3K3VA 2Q2TA 1HR0H 3N40P 1XNRH 3SB1A 3J81W 4K0KH 4JI5H 1B04A 1SEIA 4DV1H 5FD5A 1I94H 4EC5A 1DGSA 1IBLH 3EYYA 1HNWH 1HNXH 3N42B 1N32H 4RAZA 4X65H 4X66H 3LMLA 4PDBA 2CW7A 5LMUH 4LFAH 3MWMA 1FKAH 4OD6A 4B8CD 5LL6b 4LF9H 2UXCH 2FPHX 4DV4H 3JSNA 3GABA 4BWSC 1E4FT 3HXLA 4IAJA 4RAYA 4RB2C 1IBMH 3KDGA 4AQYH 1Z2PX 2WE6A 3PN1A 3BABA 4LH7A 4A2AA 1N34H 3EZJA 2XIGA 3BA9A 3N41B 2YCHA 3L4KA 4FM9A 3RF2A 5DT9A 2D9IA 4GLXA 4OCHA 4DR6H 1ODHA 1TAEA 3N43B 4CC5A 3KAKA 1MZBA 2F4VH 2Q2UA 1M0WA 4YY3H 2PT7G 5IWAH 4LF7H 1BJTA 3KXYT 4RZQA 3RTXA 4JI1H 4DV2H 4UCTA 4M7EA 4JI4H 4OX9H 4DV0H 1XNQH 4GKJH 3OTOH 3N44B 2E5LH 1F0XA 2KSWA 4MTDA 1M0TA 2WYOA 3JAMW 5LMNH 4NXMH 3J7AK 1O75A 1TA8A 1VS0A 3BA8A 3NCVA 4UCRA 4JYAH 4RB1A 2W57A 4JI7H 3UQ8A 4JI2H 4DR7H 4UCVA 4DR1H 3M4IA 2ZM6H 1SYXB 3KDKA 1N33H 2HHHH 2MCTA 2UUCH 3CVZA 4ETSA 3RJ0A 3QD7X 3T1YH 2UXDH 1E4GT 4DR2H 4MV9A 4LSAA 4UCOA 4LMYA 2CW8A 3F8NA 4RB0A 4LF5H 3J80W 2RGRA 5FPOA 4APMA 4JI6H 4B3MH 1FVIA 3RGXA 5FD6A 1J5EH 1N36H 1V9PA 3RIZA 4NZRM 4X64H 4DR4H 2RGVA 2WDTA 3H20A 4MTEA 2OWOA 1S68A 4B3SH 2ZJTA 4UCUA 1IBKH 5FLXW 4B3TH 4LF6H 3C0FB 4Q0YA 4UFZA 3L4JA 4DV3H 4DV5H 4DV6H 4MV7A 2HVRA 4NXNH 1XDNA 2ZQEA 1ZHQA 4DUYH 1X9NA 2FE3A 5A2QW 5D1OB 2UU9H 3JSLA 4LH6A 4DV7H 1Z2NX 4R7RA 2LF0A 4EFEA 4LF4H 4CC6A 2O03A 4EFBA 3FMAA 4LSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S03 G;  4B3R H;  1HNZ H;  2UUA H;  4LFC H;  2UUB H;  4YHH H;  2VQE H;  4JV5 H;  4GKK H;  1AN7 A;  5BR8 H;  2VQF H;  4DR3 H;  1XMQ H;  4JI8 H;  4DR5 H;  2UXB H;  3T1H H;  4KHP H;  4DUZ H;  4JI3 H;  4LF8 H;  4X62 H;  1XMO H;  4JI0 H;  1FJG H;  4LFB H;  1I6U A;  5IT9 W;  1HR0 H;  1XNR H;  3J81 W;  4K0K H;  4JI5 H;  1SEI A;  4DV1 H;  1I94 H;  1IBL H;  1HNW H;  1HNX H;  1N32 H;  4X65 H;  4X66 H;  4PDB A;  5LMU H;  4LFA H;  1FKA H;  4LF9 H;  5LL6 b;  2UXC H;  4DV4 H;  1IBM H;  4AQY H;  1N34 H;  3RF2 A;  4DR6 H;  2F4V H;  4YY3 H;  5IWA H;  4LF7 H;  4JI1 H;  4DV2 H;  4JI4 H;  4OX9 H;  4DV0 H;  1XNQ H;  4GKJ H;  3OTO H;  2E5L H;  3JAM W;  5LMN H;  4NXM H;  3J7A K;  4JYA H;  4JI7 H;  4JI2 H;  4DR7 H;  4DR1 H;  2ZM6 H;  1N33 H;  2HHH H;  2UUC H;  3T1Y H;  2UXD H;  4DR2 H;  4LF5 H;  3J80 W;  4JI6 H;  4B3M H;  1J5E H;  1N36 H;  4X64 H;  4DR4 H;  4B3S H;  1IBK H;  5FLX W;  4B3T H;  4LF6 H;  4DV3 H;  4DV5 H;  4DV6 H;  4NXN H;  4DUY H;  5A2Q W;  2UU9 H;  4DV7 H;  4LF4 H; 
#chains in the Genus database with same CATH topology
 3ORQ A;  3KTM A;  4QIW A;  4IZO A;  2CWH A;  4ECQ A;  4JVH A;  4AM3 A;  4G08 A;  4F4Y A;  4I7H A;  2CPQ A;  1RJR A;  3K5H A;  2XD4 A;  1N48 A;  1B6S A;  5KFJ A;  2V5A A;  4J9M A;  5I47 A;  5DGA A;  2Y0S A;  4LFC H;  5DG8 A;  4YHH H;  2W70 A;  3GTG A;  1WVN A;  3Q8S B;  4FS1 A;  4YBZ B;  4YQW A;  1AN7 A;  4IRC A;  5KG7 A;  4NBQ A;  4YR3 A;  4ECX A;  4EEQ A;  3Q8P B;  5KT5 A;  1RYR A;  4DR3 H;  2ASJ A;  3K5I A;  3LP8 A;  4YJ2 F;  1ZHS A;  1WCM G;  2DIK A;  4U6P A;  1X4N A;  2VPS A;  3ETJ A;  4QWE A;  4HNU A;  3IG0 A;  2JEF A;  4DUZ H;  2P2R A;  4EGJ A;  4JI3 H;  1TWH A;  4LF8 H;  5FPR A;  3VPB A;  3PO3 G;  3SE7 A;  4J0M A;  1XMO H;  3HBL A;  3HKZ E;  4XYM B;  4E9J A;  4LFB H;  5KFB A;  3KHL A;  4QW8 A;  1A0I A;  1CS0 A;  5JH7 F;  2RDJ A;  4IRK A;  1BXR A;  1CE8 A;  1KJJ A;  1Y1W A;  1VBI A;  1B04 A;  1ZTG A;  3AEV B;  4GC7 A;  4Q44 A;  2FLL A;  4RUC A;  1I94 H;  2DZD A;  2W6M A;  3EYY A;  1JX4 A;  1HNW H;  4RAZ A;  1N32 H;  2CTE A;  4X66 H;  1IOV A;  2FPG B;  3LML A;  5JQW A;  5FLM G;  5L1J A;  3PZP A;  2CW7 A;  5KFT A;  4F4Z A;  1FKA H;  4DL6 A;  5JUM A;  4B8C D;  2UXC H;  1N56 A;  3JSN A;  1E4E B;  4IAJ A;  1EUC B;  2WE6 A;  2W6Z A;  4HR7 A;  2XIG A;  4FJS A;  3BA9 A;  5KFL A;  3V6K A;  3RF2 A;  4GLX A;  4DR6 H;  1ODH A;  2M8W A;  1TAE A;  2VQD A;  2W6O A;  1M7J A;  1MZB A;  5DQH A;  4YR0 A;  2XCL A;  5IWA H;  3KXY T;  1Y14 B;  2AQ4 A;  4JI1 H;  2R7M A;  4UCT A;  3TQT A;  4U7C A;  1WTJ A;  5JVD F;  4A3L G;  3OTO H;  2JZX A;  2AGP A;  3T5J A;  1V51 A;  1GSA A;  2ATL A;  3JAM W;  2SCU B;  4O4H F;  4M9U A;  5C1P A;  4HNT A;  5KT3 A;  2NUA B;  3OSN A;  3V6J A;  1UG8 A;  3NCV A;  2R7Z A;  5KT4 A;  2DGR A;  2YS6 A;  5JVL A;  4RB1 A;  4JV2 A;  3V69 A;  4ZHQ F;  1WR2 A;  2A1S A;  4O3Q A;  3M4I A;  4IWY A;  3I4N G;  2CTL A;  2BA0 A;  2CTM A;  2VPQ A;  5L1K A;  1E4G T;  2RDI A;  2W6P A;  4DR2 H;  4YJ3 F;  5KFM A;  2OLS A;  5BPH A;  2CW8 A;  1TWF A;  2WB1 A;  3WO0 A;  5HBR B;  5C44 G;  2IMW P;  3G8C A;  3J80 W;  2PMZ A;  5LA6 F;  2C22 A;  1K1S A;  1ZZJ A;  5KG6 A;  5IYZ F;  2QK4 A;  1Y1W G;  3BQ1 A;  5KFP A;  4Y8V B;  2R8J A;  2UVU A;  1GGO A;  4DR4 H;  2RGV A;  4MTE A;  4C5B A;  3L4J A;  4UFZ A;  3MWD A;  1CQI B;  3C0F B;  1M6V A;  5BPF A;  2XGP A;  1S97 A;  4BA1 I;  2RF4 A;  4DL3 A;  4O4L F;  1ZZK A;  4MV7 A;  3GV7 B;  1ZHQ A;  2FE3 A;  5A2Q W;  4L1K A;  3KHG A;  2ANN A;  1EYZ A;  3HOZ G;  2R87 A;  3VMM A;  5IP9 G;  2CTF A;  2JEJ A;  1PX2 A;  2ANR A;  1Y1V G;  3FMA A;  4MV6 A;  2MJH A;  5KFN A;  2XGQ A;  3KHR A;  4ECU A;  1C30 A;  3NGD A;  3RGZ A;  1DTJ A;  1I7N A;  3BAA A;  4BY1 G;  2QND A;  4B3R H;  4BBS G;  1DV2 A;  2YRW A;  2FK1 A;  4J9S A;  1Z2O X;  1KEE A;  2UUA H;  1KJQ A;  2UUB H;  2LTM A;  2VQE H;  3GQC A;  4GKK H;  3HOW G;  2W6N A;  1C3O A;  4J9Q A;  3TIG A;  5BR8 H;  4GC6 A;  1EHI A;  3RV4 A;  4A3K G;  4JI8 H;  2BQU A;  4ED1 A;  4I50 F;  4H8A A;  4JVY A;  4TQR A;  1TWG A;  3T1H H;  5KFI A;  4A3B G;  3PO2 G;  3HOX G;  3U1K A;  1MSZ A;  1CQJ B;  2GPW A;  5GON F;  3R5H A;  4X62 H;  1K1Q A;  5L1I A;  3BQ2 A;  4ED6 A;  3L2P A;  2OPU A;  3KAJ A;  4RB3 C;  4MV3 A;  3N6X A;  1I6U A;  4ZI7 F;  3MR5 A;  3V6H A;  3RBD A;  3GIL A;  4ECV A;  1T3N A;  1XNR H;  2FMR A;  1B33 N;  4EEY A;  5KT2 A;  3J81 W;  4K0K H;  3L7Z C;  4JI5 H;  2WAQ E;  2YZM A;  1SEI A;  3H4D A;  3PW4 A;  3PW0 A;  2OPV A;  3GLK A;  5FD5 A;  1IBL H;  4J9K A;  1HNX H;  2V58 A;  3N42 B;  2YYA A;  3MWM A;  2CPM A;  1VKZ A;  4DLK A;  2JA7 G;  3I4M G;  4RU9 A;  2FPH X;  1EC6 A;  1VBH A;  4RB2 C;  5KG2 A;  2W7P A;  5KFR A;  4A2A A;  2FLN A;  4AQY H;  3PN1 A;  4A3G G;  1JDB B;  5EZY F;  3L4K A;  2FK3 A;  3T5L A;  2ZDH A;  5KFQ A;  4WAN A;  2D9I A;  4E4T A;  4AYB E;  2LRR A;  4OCH A;  2R86 A;  1S20 A;  3N43 B;  4J9P A;  3BJY A;  4FBT A;  3GIK A;  2Q2U A;  2R7K A;  3Q2O A;  5J2U F;  2XC9 A;  3VKE A;  2NVY A;  5CB4 F;  4DV2 H;  2UVV A;  4JI4 H;  1TWA A;  2CKZ B;  3MJF A;  3RB4 A;  2C28 A;  2HJW A;  2AGQ A;  4RUA A;  5KFX A;  1R9T A;  3UOE A;  1TWC A;  2R92 A;  1UNN C;  2E5L H;  4ECT A;  2R8G A;  5LMN H;  3J7A K;  3QFF A;  2C2D A;  1O75 A;  4F4X A;  1VS0 A;  2R7Z G;  3JRW A;  3GTJ A;  1B6R A;  4XYL B;  3R5F A;  4UCR A;  1BNC A;  2JE6 I;  4JYA H;  2FKL A;  3UQ8 A;  5JEA G;  5KFY A;  4IHJ F;  4IFD G;  2ZM6 H;  3K3P A;  1SYX B;  1X4M A;  3KDK A;  3BG5 A;  5KG0 A;  3V4Z A;  2W9A A;  2BR0 A;  1K83 A;  2UUC H;  2Q2T A;  3RJ0 A;  3QD7 X;  2CQY A;  2YRX A;  4QIW E;  1RK5 A;  4LMY A;  5EWE A;  2W7O A;  4YP3 A;  3F8N A;  2BL5 A;  4Q8E A;  4A3E G;  3GIP A;  2FP4 B;  4YAK B;  1GSO A;  1ZET A;  2DWC A;  3PR5 B;  3GV5 B;  2C00 A;  2NVX A;  2Y0S E;  2RGR A;  3I12 A;  3RGX A;  4F50 A;  5FD6 A;  3GID A;  1DT4 A;  3U9T A;  3RIZ A;  2NN6 G;  2WDT A;  3H20 A;  3H40 A;  2WTF A;  5C4X G;  5LXT F;  1IBK H;  5FLX W;  1DIK A;  2W9B B;  3GTK A;  4EYI B;  4DV6 H;  5KFS A;  2CWF A;  2R8H A;  3Q8R B;  4O3S A;  1XDN A;  2ZQE A;  2W9B A;  1AUV A;  3G6X A;  1X9N A;  4ED3 A;  4EFE A;  4DV7 H;  1W96 A;  2R7L A;  2LF0 A;  4BA2 I;  2IA6 A;  2PBZ A;  3BQ0 A;  2NU9 B;  3QZ7 A;  3OHA A;  4EFB A;  4LSX A;  2J6S A;  5T14 A;  3R5X A;  1X0A A;  2JA5 G;  1Y1V A;  2VUG A;  2YZG A;  3OET A;  4Q45 A;  3RB3 A;  2DPJ A;  5D1P A;  2E2H A;  3T5H A;  4A2B A;  4I55 F;  4MA5 A;  3UFX B;  2FMA A;  4A3F G;  1P8L A;  3FDS A;  5J2T F;  4G3I A;  2NU8 B;  2PQU A;  4JV5 H;  2J6T A;  3KHH A;  2ASD A;  2FPI B;  3KAL A;  2E3U A;  3DF7 A;  3PVX A;  2V59 A;  2CTJ A;  2HVS A;  2CTK A;  2VQF H;  2R7N A;  2LTL A;  3WO1 A;  5D1O A;  4EYH B;  1KBL A;  2W9C B;  3RB6 A;  3GTL A;  4DR5 H;  4RNM A;  4FBU A;  4KHP H;  3GR5 A;  3QZ8 A;  2VKC A;  2YS7 A;  3V4S A;  2BQ3 A;  4ED8 A;  2R8I A;  2FPP B;  2VOB A;  2ZDG A;  5LOV F;  4JI0 H;  2GLT A;  2PVP A;  2C2R A;  1EUD B;  4WD3 A;  2M6Q A;  5KFK A;  5IT9 W;  4DL4 A;  1ZZI A;  4IR1 A;  3N40 P;  2B63 G;  2JEI A;  2JA6 A;  2R8K A;  5KFW A;  5KT6 A;  2J9G A;  3RV3 A;  5KFF A;  2XCP A;  2VR1 A;  3PR4 A;  4DV1 H;  2V9W A;  1DGS A;  4QW9 A;  2R6F A;  4QWC A;  1JKJ B;  3Q1K A;  4QWA A;  1J5K A;  4RNO A;  1S0O A;  2J6U A;  1W93 A;  4C5A A;  4PDB A;  5F9L A;  5LMU H;  4LFA H;  1V9N A;  2AGO A;  4OD6 A;  4ECS A;  4LF9 H;  4DV4 H;  1KHM A;  3GAB A;  1GLV A;  5KFH A;  1RK6 A;  4JUZ A;  1IBM H;  2I80 A;  3TIN A;  3GKU A;  5BMV F;  3BAB A;  4EBC A;  4A3I G;  1N34 H;  3EZJ A;  1JIH A;  3N41 B;  2YCH A;  5FJ8 G;  5EWG A;  4FM9 A;  3TQ1 A;  4C5C A;  4ECZ A;  2FLP A;  5DT9 A;  4O3O A;  1KJI A;  1I50 A;  2JEG A;  3GTQ A;  4CC5 A;  5IYD G;  3HKZ A;  2F4V H;  1T36 A;  1M0W A;  2G8Y A;  4B8T A;  2XCA A;  1SCU B;  2PMZ E;  2V4Q A;  4IRD A;  1PQX A;  1I3Q A;  5DQG A;  5KKN B;  4OX9 H;  3H0G A;  2YW2 A;  4A3J G;  2BQR A;  4GKJ H;  2FK2 A;  2I8C A;  3N44 B;  3RB0 A;  2R93 G;  4OO1 G;  2KSW A;  3OUU A;  1VIG A;  1M0T A;  4MTD A;  4FU0 A;  2WYO A;  2NU7 B;  4BBR G;  5L1L A;  4BY7 G;  4NXM H;  4O3N A;  1WSC A;  5IYC G;  3HOV G;  4C2M A;  4AIM A;  5DGB A;  4JI7 H;  2VUM G;  1NXU A;  2JA8 G;  2W8L A;  2IP4 A;  3OUZ A;  5KG4 A;  1VAJ A;  5L9X A;  4HYK A;  4IR9 A;  4LSA A;  2UXD H;  2UVW A;  3GTP A;  4MV9 A;  5HV6 A;  5KFE A;  4UCO A;  3PW2 A;  5LYJ F;  1VBG A;  2ASL A;  4QMF B;  3GV8 B;  2QYZ A;  4LF5 H;  3FKI G;  2JA9 A;  4J9L A;  5FPO A;  4MAM A;  4APM A;  2YZN A;  4O3P A;  1FVI A;  4EGQ A;  5C1O A;  2HH2 A;  5C5J A;  1J5E H;  3ORR A;  3G6Y A;  4ECY A;  4JV1 A;  1V4Y A;  1GSH A;  3E5N A;  4NZR M;  4X64 H;  5EWF A;  3JRX A;  2HH3 A;  1JDE A;  1VIH A;  4MA0 A;  1S68 A;  2ZJT A;  4UCU A;  4ZQI A;  2C2E A;  4LF6 H;  3ETH A;  4Q0Y A;  5KFZ A;  2VA3 A;  4Q43 A;  3MR6 A;  4R8U B;  2FJZ A;  4TV9 F;  3VPD A;  2VA2 A;  3GTM A;  2HVR A;  3M9N B;  1KJ8 A;  4ED0 A;  4XX0 B;  2UU9 H;  1I7L A;  3JSL A;  4LH6 A;  2W9C A;  2IBK A;  4R7R A;  4CC6 A;  4J9N A;  5KG3 A;  1L2Z A;  5KX5 F;  1GO3 E;  1TUA A;  1S03 G;  3Q8Q B;  1T94 A;  3M9O B;  3PW5 A;  2JA5 A;  3FAU A;  2OH2 A;  2O4C A;  1HNZ H;  2JEA I;  3OHB A;  2WAQ A;  2GPS A;  2DPI A;  3TII A;  1K1G A;  3OSS D;  3GIQ A;  4FS2 A;  4ECR A;  5EDW A;  5KFD A;  3M9M B;  2V4R A;  5DQI A;  4YR2 A;  3EPI A;  2X0S A;  4ED7 A;  5DG7 A;  3HOU G;  2R93 A;  3T5K A;  2ALZ A;  4BXX G;  4WAL A;  4NLG A;  1ZQ7 A;  4UCS A;  1GYF A;  1XMQ H;  4YAJ B;  4F4W A;  1WCM A;  4MV4 A;  1WH2 A;  5C0X G;  1EZ1 A;  3H3V H;  1BGW A;  4NZT M;  2UXB H;  5KFV A;  5C8Y F;  2HGS A;  3RAQ A;  2Y3M A;  4O4I F;  4TUY F;  5EOY A;  4QWD A;  3WNZ A;  4RNN A;  1UC8 A;  1S0M A;  1X9Z A;  1FJG H;  2HVQ A;  2JA6 G;  3MR3 A;  3I0P A;  3GIJ A;  1KJ9 A;  3K3V A;  2JEB I;  1HR0 H;  1S9F A;  1V8C A;  2NU6 B;  3RAX A;  4MV8 A;  2Z0S A;  5DLF A;  2C35 B;  3SB1 A;  4Q8F A;  2R92 G;  4EC5 A;  5C3E G;  1S0N A;  5K36 G;  3JZI A;  3SI8 A;  4X65 H;  4J9R A;  4AYB A;  1PK8 A;  5KFA A;  3AYH B;  1E4E A;  1XRH A;  5LL6 b;  2AU0 A;  4BWS C;  5KFO A;  1E4F T;  3HXL A;  4RAY A;  4XZ3 B;  1RJP A;  1Z2P X;  3KDG A;  4RZR A;  4A3C G;  4LH7 A;  5KG5 A;  2FB9 A;  5DLG A;  5CA1 F;  3H4B A;  2I87 A;  2K1H A;  4A3D G;  1J4W A;  1DV1 A;  2PY9 A;  3KAK A;  3EPG A;  1UC9 A;  3OSP A;  4YY3 H;  2PT7 G;  4LF7 H;  1BJT A;  2R85 A;  2JVZ A;  3H0G G;  4RZQ A;  5H80 A;  4O2A F;  5K2M A;  3RTX A;  4M7E A;  3GIM A;  3IN5 A;  2OWO A;  4O3R A;  4J9O A;  3LWB A;  4DV0 H;  4QWB A;  5IYB G;  1XNQ H;  2FFM A;  3MFH A;  4ED2 A;  2W71 A;  5KFU A;  3HB9 A;  1KC7 A;  2R84 A;  2W6Q A;  4MV1 A;  5F9N A;  1F0X A;  2E2I A;  1ULZ A;  2UVR A;  2YL2 A;  1Z2I A;  3N8D A;  4HNV A;  1TA8 A;  3BA8 A;  5D8D A;  3U9S A;  5KFC A;  1IOW A;  5KG1 A;  2YU9 A;  2W57 A;  4O2B F;  4JV0 A;  3RFC A;  4JI2 H;  4DR7 H;  4UCV A;  3MR2 A;  4QJF A;  4DR1 H;  2VUM A;  1N33 H;  1RJQ A;  1OWT A;  2ZDQ A;  5KT7 A;  1WE8 A;  2HHH H;  2MCT A;  3CVZ A;  4IWX A;  4TV8 F;  3T1Y H;  3VPC A;  4ETS A;  4TQS A;  1RYS A;  5DG9 A;  2X06 A;  2M05 A;  2B63 A;  2P0A A;  1JXL A;  4RB0 A;  4DL5 A;  4FJU A;  2WB1 E;  4EG0 A;  5CA0 F;  3RBE A;  1S10 A;  4A93 G;  4LIJ A;  3FKI A;  4DL7 A;  4DL2 A;  4JI6 H;  4B3M H;  4ME6 A;  3CQZ A;  4I4T F;  1N36 H;  2R82 A;  1V9P A;  2YQR A;  4YB8 B;  4WBN F;  4EBE A;  1JLL B;  1WHR A;  3PW7 A;  4B3S H;  4B3T H;  2DLN A;  2W8K A;  5IP7 G;  1A9X A;  3R23 A;  1AUX A;  4DV3 H;  3RUP A;  4PWQ A;  4DV5 H;  4ZOL F;  3GTO A;  4ECW A;  4NXN H;  2JA7 A;  2PN1 A;  4DUY H;  4R8U A;  2CZG A;  5D1O B;  2AXY A;  1Z2N X;  3GII A;  4EBD A;  3MWE A;  5CAE B;  4LF4 H;  3G6V A;  3MFI A;  5LP6 F;  2O03 A;  1SFO A;  4HQ6 A;  4A3M G;  5KFG A;  3HOY G; 
#chains in the Genus database with same CATH homology
 1L2Z A;  2VUG A;  3RGZ A;  3OET A;  3BAA A;  1S03 G;  5D1P A;  4G08 A;  3FAU A;  4A2B A;  4I7H A;  2O4C A;  1HNZ H;  4B3R H;  1P8L A;  1Z2O X;  2UUA H;  4LFC H;  3OSS D;  2UUB H;  4YHH H;  2VQE H;  4JV5 H;  4GKK H;  1AN7 A;  3KAL A;  5BR8 H;  3DF7 A;  4EEQ A;  4UCS A;  2HVS A;  1GYF A;  2VQF H;  4DR3 H;  1XMQ H;  4JI8 H;  1WH2 A;  5D1O A;  1ZHS A;  4DR5 H;  1BGW A;  4NZT M;  2UXB H;  3T1H H;  2VPS A;  4KHP H;  2HGS A;  2Y3M A;  3GR5 A;  5EOY A;  3IG0 A;  2VKC A;  4DUZ H;  4JI3 H;  4LF8 H;  4X62 H;  5FPR A;  2VOB A;  4J0M A;  1XMO H;  1X9Z A;  4JI0 H;  3L2P A;  1FJG H;  4E9J A;  4LFB H;  2HVQ A;  3KAJ A;  1I6U A;  3N6X A;  4RB3 C;  1A0I A;  5IT9 W;  3K3V A;  2Q2T A;  1HR0 H;  3N40 P;  1XNR H;  3SB1 A;  3J81 W;  4K0K H;  4JI5 H;  1B04 A;  1SEI A;  4DV1 H;  5FD5 A;  1I94 H;  4EC5 A;  1DGS A;  1IBL H;  3EYY A;  1HNW H;  1HNX H;  3N42 B;  1N32 H;  4RAZ A;  4X65 H;  4X66 H;  3LML A;  4PDB A;  2CW7 A;  5LMU H;  4LFA H;  3MWM A;  1FKA H;  4OD6 A;  4B8C D;  5LL6 b;  4LF9 H;  2UXC H;  2FPH X;  4DV4 H;  3JSN A;  3GAB A;  4BWS C;  1E4F T;  3HXL A;  4IAJ A;  4RAY A;  4RB2 C;  1IBM H;  3KDG A;  4AQY H;  1Z2P X;  2WE6 A;  3PN1 A;  3BAB A;  4LH7 A;  4A2A A;  1N34 H;  3EZJ A;  2XIG A;  3BA9 A;  3N41 B;  2YCH A;  3L4K A;  4FM9 A;  3RF2 A;  5DT9 A;  2D9I A;  4GLX A;  4OCH A;  4DR6 H;  1ODH A;  1TAE A;  3N43 B;  4CC5 A;  3KAK A;  1MZB A;  2F4V H;  2Q2U A;  1M0W A;  4YY3 H;  2PT7 G;  5IWA H;  4LF7 H;  1BJT A;  3KXY T;  4RZQ A;  3RTX A;  4JI1 H;  4DV2 H;  4UCT A;  4M7E A;  4JI4 H;  4OX9 H;  4DV0 H;  1XNQ H;  4GKJ H;  3OTO H;  3N44 B;  2E5L H;  1F0X A;  2KSW A;  4MTD A;  1M0T A;  2WYO A;  3JAM W;  5LMN H;  4NXM H;  3J7A K;  1O75 A;  1TA8 A;  1VS0 A;  3BA8 A;  3NCV A;  4UCR A;  4JYA H;  4RB1 A;  2W57 A;  4JI7 H;  3UQ8 A;  4JI2 H;  4DR7 H;  4UCV A;  4DR1 H;  3M4I A;  2ZM6 H;  1SYX B;  3KDK A;  1N33 H;  2HHH H;  2MCT A;  2UUC H;  3CVZ A;  4ETS A;  3RJ0 A;  3QD7 X;  3T1Y H;  2UXD H;  1E4G T;  4DR2 H;  4MV9 A;  4LSA A;  4UCO A;  4LMY A;  2CW8 A;  3F8N A;  4RB0 A;  4LF5 H;  3J80 W;  2RGR A;  5FPO A;  4APM A;  4JI6 H;  4B3M H;  1FVI A;  3RGX A;  5FD6 A;  1J5E H;  1N36 H;  1V9P A;  3RIZ A;  4NZR M;  4X64 H;  4DR4 H;  2RGV A;  2WDT A;  3H20 A;  4MTE A;  2OWO A;  1S68 A;  4B3S H;  2ZJT A;  4UCU A;  1IBK H;  5FLX W;  4B3T H;  4LF6 H;  3C0F B;  4Q0Y A;  4UFZ A;  3L4J A;  4DV3 H;  4DV5 H;  4DV6 H;  4MV7 A;  2HVR A;  4NXN H;  1XDN A;  2ZQE A;  1ZHQ A;  4DUY H;  1X9N A;  2FE3 A;  5A2Q W;  5D1O B;  2UU9 H;  3JSL A;  4LH6 A;  4DV7 H;  1Z2N X;  4R7R A;  2LF0 A;  4EFE A;  4LF4 H;  4CC6 A;  2O03 A;  4EFB A;  3FMA A;  4LSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...