3RF2A

Crystal structure of 30s ribosomal protein s8 from aquifex aeolicus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
165
Chain Sequence
VDPIADMFSAIKNAIMRRDDFLYVPSSKLKERILDVLKKEGFIQDWEALKGEKYEEEYKKMKELAEKSPNPKMKRYLKQLEEYNKGTQYPIKIYLKYLDPKKRKSAITNIVKVSKGGRRVYAGVRTMPYVKRGLGIAIVSTDAGVMTDHEARRMRKGGEVIAFVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 30S ribosomal protein S8
publication title The Structure of Aquifex aeolicus Ribosomal Protein S8 Reveals a Unique Subdomain that Contributes to an Extremely Tight Association with 16S rRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 46
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3rf2A01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3rf2A02
4DUZH 5IT9W 4DV4H 1XMOH 4DR2H 1N32H 4JI5H 4X64H 1SEIA 1J5EH 4X62H 4JI4H 4DV2H 2UU9H 4DR7H 3RF2A 4OX9H 1N33H 2ZM6H 4AQYH 4LF8H 4YHHH 2UUCH 4DR4H 4DV5H 1N36H 4DV6H 2E5LH 1I6UA 4X65H 4DR1H 4PDBA 5A2QW 4NXNH 4B3MH 2VQFH 1HR0H 4JI3H 3JAMW 2UUBH 4LF5H 1XNRH 4KHPH 4JI0H 3T1YH 2UUAH 1IBLH 4DV7H 3J80W 2UXCH 3J7AK 1FKAH 1FJGH 4DV0H 4X66H 4JI6H 5BR8H 4YY3H 4DR3H 5FLXW 4GKJH 2UXDH 4B3TH 4JYAH 1HNXH 4JV5H 4DR5H 4LF4H 4LF6H 4NXMH 4JI8H 4GKKH 2UXBH 1XNQH 4DR6H 2VQEH 4LF9H 4DUYH 4LFCH 4DV3H 4B3RH 4JI1H 4LFAH 1HNWH 1N34H 4DV1H 4LF7H 5LMNH 1S03G 3J81W 1XMQH 4JI2H 5LMUH 3OTOH 1IBKH 4K0KH 4LFBH 1HNZH 2HHHH 5IWAH 5LL6b 1AN7A 2F4VH 4JI7H 4B3SH 3T1HH 1I94H 1IBMH
chains in the Genus database with same CATH superfamily
5KT5A 2SCUB 4DUZH 5EZYF 4O2AF 2LF0A 5KG3A 4BBRG 4EEYA 4ECWA 1N32H 1TWFA 2OWOA 1J5KA 4LH7A 4A3JG 4EFBA 1M6VA 1B04A 4MV3A 4JI4H 5FD5A 4UCVA 2R7LA 3N43B 2JEGA 2W6QA 4FS2A 4DV2H 4I7HA 2DLNA 3PZPA 2CWFA 4FS1A 2DPJA 2A1SA 3GKUA 4PWQA 4ECTA 4AQYH 1VAJA 1ZETA 1VS0A 2CW8A 4ZI7F 2VOBA 4YJ3F 4Q45A 1DIKA 4DR4H 2R86A 5EWFA 4ED0A 2E2IA 2W57A 5KFSA 1Z2PX 3TQTA 4FM9A 3HOXG 2JVZA 4A2BA 2X06A 1PK8A 2I87A 1E4EB 4YAJB 2WTFA 3GV8B 2W8LA 2JEIA 1O75A 2O03A 4X65H 3GIIA 4PDBA 4J9NA 4MV7A 3I0PA 4B3MH 3RJ0A 2PMZE 2IA6A 3PW4A 1AUXA 3N8DA 1Z2IA 2VQFH 1HR0H 4MV1A 2CW7A 2FMRA 3SI8A 4MAMA 2UUBH 5CAEB 1C30A 2R85A 2LTLA 5D8DA 4DL2A 2BQ3A 4C2MA 3MWMA 2OPUA 4QWAA 3OHBA 2RDJA 3BG5A 3BABA 2VR1A 2XCLA 4EYIB 3G6XA 4YB8B 1K1SA 4ZOLF 3BAAA 5C1PA 3EZJA 2V5AA 5JQWA 4A3BG 3T1YH 2UUAH 2YCHA 3IN5A 4EBDA 3V4SA 4MV4A 1DGSA 5KG0A 3MR6A 3HBLA 4J9OA 1JKJB 2YW2A 2CTJA 2RDIA 1Y14B 3T5LA 1TWHA 3RUPA 5KG4A 1JDEA 2YZNA 5KFOA 2YQRA 2FLPA 4GLXA 2PVPA 3LWBA 2IMWP 2RGVA 2G8YA 3FKIA 4IZOA 5KFYA 2GLTA 2OPVA 4R8UA 2AGOA 4JYAH 1EUCB 3GABA 1ZHQA 5BPHA 4DR5H 4LF6H 3U9TA 3GV7B 3V6KA 1GSHA 1V51A 1GO3E 1IOVA 2WDTA 4Q8EA 5KFLA 5C8YF 3MFIA 3OSSD 3NCVA 2J6SA 2CQYA 4I4TF 3PR4A 2JA8G 2VPSA 5C4XG 1XRHA 4XZ3B 4LF9H 4ZQIA 1KJ9A 2JA5G 4A3LG 2JA6A 1KHMA 1RJPA 3KHHA 4LMYA 3OSPA 4UFZA 2ASJA 4RZQA 4RNMA 2C00A 5C5JA 2IP4A 3GTPA 5K2MA 3PO2G 2WAQE 1SYXB 1N56A 1S97A 3J81W 4JI2H 4UCOA 3HOVG 3RBDA 3K3VA 1X4MA 4K0KH 2BQRA 3DF7A 2UVWA 2NU8B 1VIHA 4EFEA 1DTJA 1MSZA 4LFBH 5KFJA 4QW9A 1T3NA 1TWAA 3R23A 2HHHH 4IHJF 4Q0YA 2YS6A 5IP7G 4RNOA 3GIMA 3OUZA 5IWAH 4Q44A 5CA1F 3L4KA 2I8CA 1JDBB 3H0GG 4M9UA 3VKEA 1V9PA 1S68A 2Z0SA 1BXRA 4MA5A 2R84A 1UG8A 5IYZF 2CTMA 2CPMA 2XC9A 3PN1A 3Q8PB 3T5JA 3JSLA 2BL5A 5KFGA 5FLMG 2R7MA 3SE7A 2NN6G 2R7KA 2VUGA 3KAKA 4UCTA 4A3FG 4DL3A 4DR2H 1N48A 3H20A 3HKZE 4EYHB 2AQ4A 2JA5A 2PMZA 2PY9A 3EPGA 1KJIA 2R8GA 1J5EH 3U1KA 4QWBA 3HXLA 2FPIB 2AGQA 1KBLA 5F9NA 4YQWA 1WH2A 2B63G 2UU9H 4DL7A 1I3QA 4DR7H 3G8CA 5L1KA 1A9XA 5DQHA 4U7CA 2W9CA 4ED1A 2FE3A 4DLKA 2W7OA 2FP4B 2PBZA 2ZM6H 4J9KA 2ASDA 3AYHB 3JZIA 3RV3A 5KFHA 3RBEA 4HNVA 2MJHA 4Y8VB 1BJTA 2XCAA 4A3KG 1V8CA 1T94A 2M8WA 4M7EA 1J4WA 1N36H 2JEJA 1V4YA 4ECSA 4TUYF 3H0GA 3GIDA 5D1OA 4C5BA 3UQ8A 4RZRA 3AEVB 2V4RA 1RK6A 4DL4A 2FKLA 2FPPB 1EYZA 3MR3A 3RV4A 3M9OB 3PVXA 4JI3H 2FK1A 2LRRA 2ZDQA 2R8HA 5FJ8G 3Q1KA 2M6QA 4IR9A 4HNUA 3OETA 3RGZA 5KFEA 5CB4F 3GTLA 2J9GA 1XNRH 3RB4A 4NZRM 1BGWA 4O3OA 3R5FA 4KHPH 4JI0H 3GQCA 4EGJA 4BXXG 1GYFA 1I50A 2B63A 3M9NB 3BQ1A 5KFCA 4O2BF 2JA7G 3J7AK 1FKAH 1M7JA 1FJGH 2AU0A 2WYOA 3QFFA 4C5AA 3EPIA 2KSWA 2W6ZA 5KFDA 3GV5B 2XCPA 4JI6H 5DG7A 4A93G 4ECVA 4J9MA 5BR8H 2PT7G 4BBSG 2Y3MA 4YY3H 5KFZA 3EYYA 2WAQA 3ETJA 4RUCA 4B8CD 5FLXW 4RU9A 4GKJH 3TINA 2UXDH 4B3TH 2ZDGA 1VBGA 2C22A 3TQ1A 1HNXH 3GTKA 5DT9A 1X4NA 2IBKA 5KG5A 2P2RA 3FAUA 1S0NA 4MV8A 4NXMH 2WB1E 5J2UF 5IYBG 3KHLA 2CZGA 4MV9A 1RYSA 4O4HF 1XNQH 5DQIA 4E4TA 4RB1A 2VPQA 3K3PA 3KXYT 4DR6H 2VQEH 1XDNA 3N41B 3QZ7A 3MR5A 2ZQEA 3K5HA 1ZTGA 4LFAH 2HVSA 4ED3A 4A3IG 1BNCA 3HB9A 3GIQA 1DV1A 2FLLA 1CQIB 4BY1G 4IRCA 4XYMB 3OSNA 4DL5A 2DGRA 5FPRA 1XMQH 4GC6A 1SCUB 3HKZA 1VBIA 1TWCA 3OTOH 3KTMA 3HOZG 5KT7A 5KFWA 3HOUG 3TIGA 3L4JA 3G6VA 2W9BB 3K5IA 3PW0A 2XD4A 1I7NA 5L1LA 4GC7A 1Y1WG 1NXUA 3OHAA 4ED6A 4YJ2F 1R9TA 2NUAB 4ECXA 3PO3G 2HVQA 4ECYA 4EEQA 2FPHX 4AM3A 4JI7H 5H80A 5C0XG 4B3SH 3GTMA 4A3MG 3MJFA 3KALA 2NU6B 1E4EA 3VPBA 3GIKA 4A3DG 3ORRA 2Q2TA 2PN1A 4O4LF 2ANRA 3FDSA 5IT9W 3L7ZC 4DV4H 4CC6A 5JVDF 2C28A 1SFOA 3E5NA 1WCMG 1VIGA 5DQGA 4WBNF 5KG7A 3GIJA 2YZMA 5KFAA 4FBTA 1UC8A 5JH7F 1DT4A 2JEFA 2NVXA 1SEIA 3N6XA 4JVYA 1ZZIA 2DZDA 5FPOA 2R82A 4J9PA 3GTOA 1I7LA 3RTXA 1UNNC 2R6FA 4QMFB 4ED7A 4NLGA 3RB3A 3VPCA 2BR0A 2YU9A 3UOEA 2ZDHA 2V59A 3F8NA 4ETSA 3RF2A 5KFXA 2AGPA 1K1GA 5BMVF 4OX9H 3H40A 3M4IA 3GLKA 1N33H 2Y0SE 4RB3C 2YYAA 5LA6F 4YP3A 2CPQA 4LF8H 2LTMA 1T36A 4IWXA 1KJJA 1B6SA 3VMMA 2UUCH 5DG9A 1X0AA 5F9LA 5DLGA 1Y1WA 4DV5H 1RJQA 4OCHA 1VBHA 2HJWA 4QWCA 2W70A 5DGAA 2E5LH 1E4GT 4QIWE 5KT6A 2R7NA 2AXYA 3BA9A 4DR1H 4FU0A 2YRXA 4TV9F 5D1PA 3MWDA 2CTKA 5CA0F 2RF4A 3R5XA 2V9WA 1JIHA 2M05A 5I47A 2VA3A 3LMLA 4ED8A 3JAMW 5DLFA 4F50A 5KFBA 2R7ZG 1PQXA 1X9ZA 3BQ0A 1WTJA 1TAEA 5KFNA 2V58A 4MA0A 3ETHA 1S20A 2JE6I 4G3IA 5LOVF 1TA8A 2YZGA 2WB1A 1S10A 5C3EG 3Q2OA 2V4QA 1S0MA 3V6HA 2W7PA 4IWYA 3GILA 4Q43A 3VPDA 3BJYA 1IBLH 5KFKA 2UXCH 2C2EA 4L1KA 3H3VH 3UFXB 2NU9B 5HBRB 2DIKA 2R8IA 2C35B 5KG2A 4HR7A 5KFUA 4U6PA 5EWEA 3I4NG 1M0TA 2NVYA 3JSNA 4O3RA 4DR3H 3RFCA 1K1QA 1KJ8A 4EG0A 4DL6A 5IP9G 4O4IF 4OD6A 3HOYG 1WSCA 2JEBI 4QWEA 4IRKA 2FJZA 1S9FA 4LIJA 4LF4H 1WR2A 1KJQA 2FPGB 5K36G 3N44B 4CC5A 4J9SA 4XYLB 4GKKH 2P0AA 3GTQA 2UXBH 1K83A 2D9IA 2QNDA 4MV6A 2C2RA 2R7ZA 5KG6A 5KX5F 3H4BA 1A0IA 1JXLA 5KFVA 2VUMG 5T14A 4LSXA 4YR0A 4J9QA 4RNNA 4ECZA 4B3RH 1KEEA 2YL2A 4WD3A 3QD7X 4APMA 3H4DA 4RAZA 4FJUA 4UCRA 4RUAA 4YBZB 3T5KA 5LYJF 2J6TA 4BA1I 4DV1H 4LF7H 1C3OA 4A2AA 3TIIA 5LMNH 2R92G 2QYZA 1S03G 4ECRA 2ALZA 4QW8A 1CQJB 3KHGA 5C44G 2W6NA 4HNTA 2UVUA 4BY7G 4YR2A 5LMUH 1EHIA 3BQ2A 3T5HA 3PW2A 4FBUA 1B33N 1V9NA 1M0WA 1HNZH 3V69A 4R8UB 2VKCA 4ED2A 2R8KA 2CTFA 3GTJA 3RIZA 2HVRA 5EWGA 4J9LA 4MTDA 2FK2A 2W9AA 4I55F 2Y0SA 4H8AA 3T1HH 2FK3A 1I94H 1IBMH 4IAJA 5KFRA 3FKIG 3SB1A 5L1JA 4F4WA 4EBCA 2OLSA 2VA2A 2JA9A 2MCTA 1RK5A 3GR5A 5LXTF 3KDGA 3U9SA 1WHRA 3KDKA 4RB2C 3QZ8A 2DPIA 2W6OA 4A3EG 2UVVA 3C0FB 5L9XA 3V6JA 1RYRA 3PR5B 4QIWA 2RGRA 1XMOH 1W96A 2XGPA 5C1OA 5GONF 3V4ZA 3CVZA 5KFPA 2VUMA 5KT2A 3ORQA 4X64H 4JI5H 2ANNA 2JEAI 3OUUA 5DGBA 1ZZJA 2E3UA 4E9JA 4EGQA 4X62H 2R93G 2JA7A 2JA6G 1ZHSA 5FD6A 4I50F 4A3GG 4UCUA 4IFDG 1FVIA 5JEAG 1DV2A 2XGQA 2R87A 3N40P 2R92A 3L2PA 5JUMA 2K1HA 1TWGA 2FMAA 5BPFA 3HOWG 1Y1VG 5DG8A 4JV1A 4NBQA 1JLLB 2W71A 5J2TF 4YHHH 3RGXA 4JVHA 4O3NA 5IYCG 3JRXA 4QJFA 4R7RA 4YAKB 1ZZKA 4QWDA 3M9MB 5KT4A 5KT3A 4DV6H 1X9NA 1I6UA 4AIMA 5KG1A 4BWSC 5KFTA 2HH3A 5A2QW 2GPSA 3CQZA 4NXNH 4MTEA 2X0SA 2GPWA 4C5CA 4RB0A 4EC5A 4ZHQF 2C2DA 3MFHA 1GSOA 1E4FT 4JV0A 5EDWA 4BA2I 3I4MG 3RB0A 5KFQA 1GLVA 1Z2OX 2O4CA 1L2ZA 4B8TA 2HGSA 3BA8A 1EZ1A 2FLNA 1GSAA 4LF5H 4AYBA 4J0MA 1PX2A 2FB9A 3PW5A 1WVNA 4NZTM 2DWCA 4O3QA 1JX4A 4TQRA 4WALA 1VKZA 2W9CB 4JV2A 2YRWA 2R93A 2PQUA 2CWHA 1Z2NX 3GIPA 5KKNB 5KFMA 4YR3A 4DV7H 1W93A 3RAXA 3J80W 2WE6A 4DV0H 4TV8F 5L1IA 1Y1VA 2FFMA 4HYKA 5KFIA 2BA0A 4G08A 4X66H 2VQDA 2ZJTA 5D1OB 5LP6F 4LH6A 4F4ZA 2JZXA 1AUVA 2W9BA 4J9RA 1RJRA 2CKZB 1IOWA 4TQSA 3WO1A 3PW7A 3GTGA 4JV5H 1F0XA 3JRWA 1ODHA 4JI8H 1WCMA 2ASLA 2HH2A 1CE8A 4ME6A 4A3CG 2OH2A 3IG0A 2E2HA 5JVLA 1UC9A 4O3PA 3FMAA 4LSAA 3WNZA 2CTLA 1GGOA 4FJSA 4DUYH 2CTEA 1ULZA 2Q2UA 1EUDB 4LFCH 4XX0B 1TUAA 4F4YA 4DV3H 3RB6A 4JI1H 1MZBA 1KC7A 1HNWH 1EC6A 4HQ6A 1OWTA 4IR1A 1B6RA 1WE8A 2NU7B 3WO0A 1N34H 1ZQ7A 3MWEA 4JUZA 3I12A 4WANA 1P8LA 3Q8SB 4EBEA 2W8KA 1S0OA 3Q8RB 2XIGA 3Q8QB 1IBKH 5EOYA 3LP8A 4O3SA 2J6UA 2YS7A 2W6MA 2ATLA 3MR2A 5IYDG 3KHRA 2BQUA 3KAJA 1CS0A 2I80A 4AYBE 3G6YA 4IRDA 4Q8FA 4F4XA 3RAQA 4RAYA 3NGDA 3R5HA 2QK4A 5LL6b 4OO1G 1AN7A 2W6PA 4ECQA 2F4VH 3N42B 4ECUA 2UVRA 2R8JA 4UCSA 5HV6A 5KFFA
chains in the Genus database with same CATH topology
2MCTA 3PN1A 3GR5A 3KDGA 4DUZH 3KDKA 3JSLA 4RB2C 2Q2TA 3C0FB 2LF0A 5IT9W 2VUGA 4DV4H 3KAKA 4UCTA 4CC6A 2RGRA 1XMOH 4DR2H 3H20A 1N32H 3CVZA 2OWOA 4X64H 4JI5H 4LH7A 4EFBA 1SEIA 1J5EH 3N6XA 1B04A 4E9JA 5FPOA 4X62H 4JI4H 3HXLA 5FD5A 4UCVA 1ZHSA 3N43B 3RTXA 5FD6A 1WH2A 4UCUA 1FVIA 4DV2H 2UU9H 3F8NA 4DR7H 3N40P 4I7HA 3RF2A 4ETSA 3L2PA 4OX9H 2FE3A 3M4IA 1N33H 2ZM6H 4AQYH 4RB3C 1VS0A 2CW8A 2VOBA 4LF8H 4YHHH 1BJTA 3RGXA 2UUCH 4DR4H 2W57A 1Z2PX 4DV5H 4R7RA 1N36H 4OCHA 3KALA 4A2BA 4M7EA 4DV6H 4FM9A 1X9NA 2E5LH 1I6UA 1O75A 2O03A 1E4GT 4BWSC 3BA9A 4X65H 4DR1H 5D1OA 5D1PA 4PDBA 3UQ8A 5A2QW 4MV7A 4NXNH 4B3MH 4MTEA 3RJ0A 4RB0A 4EC5A 2VQFH 1HR0H 3LMLA 1E4FT 4JI3H 2CW7A 3JAMW 2UUBH 1Z2OX 2O4CA 1L2ZA 2HGSA 1X9ZA 3BA8A 3MWMA 3OETA 4LF5H 1TAEA 4J0MA 3RGZA 4NZTM 3BABA 1XNRH 4NZRM 1BGWA 1TA8A 3BAAA 3EZJA 4KHPH 4JI0H 3T1YH 2UUAH 2YCHA 1GYFA 1Z2NX 1DGSA 1IBLH 4DV7H 3J80W 2UXCH 3J7AK 1FKAH 2WE6A 1FJGH 4DV0H 2WYOA 2KSWA 4G08A 4X66H 4JI6H 2ZJTA 5D1OB 4GLXA 4LH6A 5BR8H 2PT7G 1M0TA 2Y3MA 4YY3H 2RGVA 3EYYA 3JSNA 4DR3H 4B8CD 5FLXW 4GKJH 2UXDH 4B3TH 4OD6A 4JYAH 1HNXH 3GABA 5DT9A 1ZHQA 4JV5H 4DR5H 1F0XA 4LF4H 4LF6H 3FAUA 1ODHA 4NXMH 4JI8H 3N44B 4CC5A 2WDTA 4MV9A 3OSSD 3NCVA 4GKKH 2UXBH 3IG0A 2D9IA 3FMAA 4LSAA 1XNQH 4RB1A 2VPSA 3KXYT 3N41B 4DR6H 2VQEH 1XDNA 4LF9H 4DUYH 2ZQEA 1A0IA 2Q2UA 4LFCH 4LSXA 4DV3H 4B3RH 4JI1H 1MZBA 4LFAH 1HNWH 3QD7X 4LMYA 4UFZA 4APMA 4RAZA 2HVSA 4UCRA 1N34H 4RZQA 4DV1H 4LF7H 4A2AA 1P8LA 5LMNH 1S03G 2XIGA 5FPRA 1SYXB 3J81W 1XMQH 4JI2H 4UCOA 5LMUH 3OTOH 1IBKH 3K3VA 5EOYA 4K0KH 3DF7A 3L4JA 4EFEA 3KAJA 4LFBH 1M0WA 1HNZH 2VKCA 2HHHH 4Q0YA 4RAYA 5IWAH 2HVQA 3RIZA 3L4KA 2HVRA 5LL6b 4EEQA 4MTDA 1AN7A 2FPHX 2F4VH 1V9PA 3N42B 1S68A 4JI7H 4B3SH 4UCSA 3T1HH 4IAJA 1I94H 1IBMH 3SB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ H;  5IT9 W;  4DV4 H;  1XMO H;  4DR2 H;  1N32 H;  4JI5 H;  4X64 H;  1SEI A;  1J5E H;  4X62 H;  4JI4 H;  4DV2 H;  2UU9 H;  4DR7 H;  3RF2 A;  4OX9 H;  1N33 H;  2ZM6 H;  4AQY H;  4LF8 H;  4YHH H;  2UUC H;  4DR4 H;  4DV5 H;  1N36 H;  4DV6 H;  2E5L H;  1I6U A;  4X65 H;  4DR1 H;  4PDB A;  5A2Q W;  4NXN H;  4B3M H;  2VQF H;  1HR0 H;  4JI3 H;  3JAM W;  2UUB H;  4LF5 H;  1XNR H;  4KHP H;  4JI0 H;  3T1Y H;  2UUA H;  1IBL H;  4DV7 H;  3J80 W;  2UXC H;  3J7A K;  1FKA H;  1FJG H;  4DV0 H;  4X66 H;  4JI6 H;  5BR8 H;  4YY3 H;  4DR3 H;  5FLX W;  4GKJ H;  2UXD H;  4B3T H;  4JYA H;  1HNX H;  4JV5 H;  4DR5 H;  4LF4 H;  4LF6 H;  4NXM H;  4JI8 H;  4GKK H;  2UXB H;  1XNQ H;  4DR6 H;  2VQE H;  4LF9 H;  4DUY H;  4LFC H;  4DV3 H;  4B3R H;  4JI1 H;  4LFA H;  1HNW H;  1N34 H;  4DV1 H;  4LF7 H;  5LMN H;  1S03 G;  3J81 W;  1XMQ H;  4JI2 H;  5LMU H;  3OTO H;  1IBK H;  4K0K H;  4LFB H;  1HNZ H;  2HHH H;  5IWA H;  5LL6 b;  1AN7 A;  2F4V H;  4JI7 H;  4B3S H;  3T1H H;  1I94 H;  1IBM H; 
#chains in the Genus database with same CATH topology
 5KT5 A;  2SCU B;  4DUZ H;  5EZY F;  4O2A F;  2LF0 A;  5KG3 A;  4BBR G;  4EEY A;  4ECW A;  1N32 H;  1TWF A;  2OWO A;  1J5K A;  4LH7 A;  4A3J G;  4EFB A;  1M6V A;  1B04 A;  4MV3 A;  4JI4 H;  5FD5 A;  4UCV A;  2R7L A;  3N43 B;  2JEG A;  2W6Q A;  4FS2 A;  4DV2 H;  4I7H A;  2DLN A;  3PZP A;  2CWF A;  4FS1 A;  2DPJ A;  2A1S A;  3GKU A;  4PWQ A;  4ECT A;  4AQY H;  1VAJ A;  1ZET A;  1VS0 A;  2CW8 A;  4ZI7 F;  2VOB A;  4YJ3 F;  4Q45 A;  1DIK A;  4DR4 H;  2R86 A;  5EWF A;  4ED0 A;  2E2I A;  2W57 A;  5KFS A;  1Z2P X;  3TQT A;  4FM9 A;  3HOX G;  2JVZ A;  4A2B A;  2X06 A;  1PK8 A;  2I87 A;  1E4E B;  4YAJ B;  2WTF A;  3GV8 B;  2W8L A;  2JEI A;  1O75 A;  2O03 A;  4X65 H;  3GII A;  4PDB A;  4J9N A;  4MV7 A;  3I0P A;  4B3M H;  3RJ0 A;  2PMZ E;  2IA6 A;  3PW4 A;  1AUX A;  3N8D A;  1Z2I A;  2VQF H;  1HR0 H;  4MV1 A;  2CW7 A;  2FMR A;  3SI8 A;  4MAM A;  2UUB H;  5CAE B;  1C30 A;  2R85 A;  2LTL A;  5D8D A;  4DL2 A;  2BQ3 A;  4C2M A;  3MWM A;  2OPU A;  4QWA A;  3OHB A;  2RDJ A;  3BG5 A;  3BAB A;  2VR1 A;  2XCL A;  4EYI B;  3G6X A;  4YB8 B;  1K1S A;  4ZOL F;  3BAA A;  5C1P A;  3EZJ A;  2V5A A;  5JQW A;  4A3B G;  3T1Y H;  2UUA H;  2YCH A;  3IN5 A;  4EBD A;  3V4S A;  4MV4 A;  1DGS A;  5KG0 A;  3MR6 A;  3HBL A;  4J9O A;  1JKJ B;  2YW2 A;  2CTJ A;  2RDI A;  1Y14 B;  3T5L A;  1TWH A;  3RUP A;  5KG4 A;  1JDE A;  2YZN A;  5KFO A;  2YQR A;  2FLP A;  4GLX A;  2PVP A;  3LWB A;  2IMW P;  2RGV A;  2G8Y A;  3FKI A;  4IZO A;  5KFY A;  2GLT A;  2OPV A;  4R8U A;  2AGO A;  4JYA H;  1EUC B;  3GAB A;  1ZHQ A;  5BPH A;  4DR5 H;  4LF6 H;  3U9T A;  3GV7 B;  3V6K A;  1GSH A;  1V51 A;  1GO3 E;  1IOV A;  2WDT A;  4Q8E A;  5KFL A;  5C8Y F;  3MFI A;  3OSS D;  3NCV A;  2J6S A;  2CQY A;  4I4T F;  3PR4 A;  2JA8 G;  2VPS A;  5C4X G;  1XRH A;  4XZ3 B;  4LF9 H;  4ZQI A;  1KJ9 A;  2JA5 G;  4A3L G;  2JA6 A;  1KHM A;  1RJP A;  3KHH A;  4LMY A;  3OSP A;  4UFZ A;  2ASJ A;  4RZQ A;  4RNM A;  2C00 A;  5C5J A;  2IP4 A;  3GTP A;  5K2M A;  3PO2 G;  2WAQ E;  1SYX B;  1N56 A;  1S97 A;  3J81 W;  4JI2 H;  4UCO A;  3HOV G;  3RBD A;  3K3V A;  1X4M A;  4K0K H;  2BQR A;  3DF7 A;  2UVW A;  2NU8 B;  1VIH A;  4EFE A;  1DTJ A;  1MSZ A;  4LFB H;  5KFJ A;  4QW9 A;  1T3N A;  1TWA A;  3R23 A;  2HHH H;  4IHJ F;  4Q0Y A;  2YS6 A;  5IP7 G;  4RNO A;  3GIM A;  3OUZ A;  5IWA H;  4Q44 A;  5CA1 F;  3L4K A;  2I8C A;  1JDB B;  3H0G G;  4M9U A;  3VKE A;  1V9P A;  1S68 A;  2Z0S A;  1BXR A;  4MA5 A;  2R84 A;  1UG8 A;  5IYZ F;  2CTM A;  2CPM A;  2XC9 A;  3PN1 A;  3Q8P B;  3T5J A;  3JSL A;  2BL5 A;  5KFG A;  5FLM G;  2R7M A;  3SE7 A;  2NN6 G;  2R7K A;  2VUG A;  3KAK A;  4UCT A;  4A3F G;  4DL3 A;  4DR2 H;  1N48 A;  3H20 A;  3HKZ E;  4EYH B;  2AQ4 A;  2JA5 A;  2PMZ A;  2PY9 A;  3EPG A;  1KJI A;  2R8G A;  1J5E H;  3U1K A;  4QWB A;  3HXL A;  2FPI B;  2AGQ A;  1KBL A;  5F9N A;  4YQW A;  1WH2 A;  2B63 G;  2UU9 H;  4DL7 A;  1I3Q A;  4DR7 H;  3G8C A;  5L1K A;  1A9X A;  5DQH A;  4U7C A;  2W9C A;  4ED1 A;  2FE3 A;  4DLK A;  2W7O A;  2FP4 B;  2PBZ A;  2ZM6 H;  4J9K A;  2ASD A;  3AYH B;  3JZI A;  3RV3 A;  5KFH A;  3RBE A;  4HNV A;  2MJH A;  4Y8V B;  1BJT A;  2XCA A;  4A3K G;  1V8C A;  1T94 A;  2M8W A;  4M7E A;  1J4W A;  1N36 H;  2JEJ A;  1V4Y A;  4ECS A;  4TUY F;  3H0G A;  3GID A;  5D1O A;  4C5B A;  3UQ8 A;  4RZR A;  3AEV B;  2V4R A;  1RK6 A;  4DL4 A;  2FKL A;  2FPP B;  1EYZ A;  3MR3 A;  3RV4 A;  3M9O B;  3PVX A;  4JI3 H;  2FK1 A;  2LRR A;  2ZDQ A;  2R8H A;  5FJ8 G;  3Q1K A;  2M6Q A;  4IR9 A;  4HNU A;  3OET A;  3RGZ A;  5KFE A;  5CB4 F;  3GTL A;  2J9G A;  1XNR H;  3RB4 A;  4NZR M;  1BGW A;  4O3O A;  3R5F A;  4KHP H;  4JI0 H;  3GQC A;  4EGJ A;  4BXX G;  1GYF A;  1I50 A;  2B63 A;  3M9N B;  3BQ1 A;  5KFC A;  4O2B F;  2JA7 G;  3J7A K;  1FKA H;  1M7J A;  1FJG H;  2AU0 A;  2WYO A;  3QFF A;  4C5A A;  3EPI A;  2KSW A;  2W6Z A;  5KFD A;  3GV5 B;  2XCP A;  4JI6 H;  5DG7 A;  4A93 G;  4ECV A;  4J9M A;  5BR8 H;  2PT7 G;  4BBS G;  2Y3M A;  4YY3 H;  5KFZ A;  3EYY A;  2WAQ A;  3ETJ A;  4RUC A;  4B8C D;  5FLX W;  4RU9 A;  4GKJ H;  3TIN A;  2UXD H;  4B3T H;  2ZDG A;  1VBG A;  2C22 A;  3TQ1 A;  1HNX H;  3GTK A;  5DT9 A;  1X4N A;  2IBK A;  5KG5 A;  2P2R A;  3FAU A;  1S0N A;  4MV8 A;  4NXM H;  2WB1 E;  5J2U F;  5IYB G;  3KHL A;  2CZG A;  4MV9 A;  1RYS A;  4O4H F;  1XNQ H;  5DQI A;  4E4T A;  4RB1 A;  2VPQ A;  3K3P A;  3KXY T;  4DR6 H;  2VQE H;  1XDN A;  3N41 B;  3QZ7 A;  3MR5 A;  2ZQE A;  3K5H A;  1ZTG A;  4LFA H;  2HVS A;  4ED3 A;  4A3I G;  1BNC A;  3HB9 A;  3GIQ A;  1DV1 A;  2FLL A;  1CQI B;  4BY1 G;  4IRC A;  4XYM B;  3OSN A;  4DL5 A;  2DGR A;  5FPR A;  1XMQ H;  4GC6 A;  1SCU B;  3HKZ A;  1VBI A;  1TWC A;  3OTO H;  3KTM A;  3HOZ G;  5KT7 A;  5KFW A;  3HOU G;  3TIG A;  3L4J A;  3G6V A;  2W9B B;  3K5I A;  3PW0 A;  2XD4 A;  1I7N A;  5L1L A;  4GC7 A;  1Y1W G;  1NXU A;  3OHA A;  4ED6 A;  4YJ2 F;  1R9T A;  2NUA B;  4ECX A;  3PO3 G;  2HVQ A;  4ECY A;  4EEQ A;  2FPH X;  4AM3 A;  4JI7 H;  5H80 A;  5C0X G;  4B3S H;  3GTM A;  4A3M G;  3MJF A;  3KAL A;  2NU6 B;  1E4E A;  3VPB A;  3GIK A;  4A3D G;  3ORR A;  2Q2T A;  2PN1 A;  4O4L F;  2ANR A;  3FDS A;  5IT9 W;  3L7Z C;  4DV4 H;  4CC6 A;  5JVD F;  2C28 A;  1SFO A;  3E5N A;  1WCM G;  1VIG A;  5DQG A;  4WBN F;  5KG7 A;  3GIJ A;  2YZM A;  5KFA A;  4FBT A;  1UC8 A;  5JH7 F;  1DT4 A;  2JEF A;  2NVX A;  1SEI A;  3N6X A;  4JVY A;  1ZZI A;  2DZD A;  5FPO A;  2R82 A;  4J9P A;  3GTO A;  1I7L A;  3RTX A;  1UNN C;  2R6F A;  4QMF B;  4ED7 A;  4NLG A;  3RB3 A;  3VPC A;  2BR0 A;  2YU9 A;  3UOE A;  2ZDH A;  2V59 A;  3F8N A;  4ETS A;  3RF2 A;  5KFX A;  2AGP A;  1K1G A;  5BMV F;  4OX9 H;  3H40 A;  3M4I A;  3GLK A;  1N33 H;  2Y0S E;  4RB3 C;  2YYA A;  5LA6 F;  4YP3 A;  2CPQ A;  4LF8 H;  2LTM A;  1T36 A;  4IWX A;  1KJJ A;  1B6S A;  3VMM A;  2UUC H;  5DG9 A;  1X0A A;  5F9L A;  5DLG A;  1Y1W A;  4DV5 H;  1RJQ A;  4OCH A;  1VBH A;  2HJW A;  4QWC A;  2W70 A;  5DGA A;  2E5L H;  1E4G T;  4QIW E;  5KT6 A;  2R7N A;  2AXY A;  3BA9 A;  4DR1 H;  4FU0 A;  2YRX A;  4TV9 F;  5D1P A;  3MWD A;  2CTK A;  5CA0 F;  2RF4 A;  3R5X A;  2V9W A;  1JIH A;  2M05 A;  5I47 A;  2VA3 A;  3LML A;  4ED8 A;  3JAM W;  5DLF A;  4F50 A;  5KFB A;  2R7Z G;  1PQX A;  1X9Z A;  3BQ0 A;  1WTJ A;  1TAE A;  5KFN A;  2V58 A;  4MA0 A;  3ETH A;  1S20 A;  2JE6 I;  4G3I A;  5LOV F;  1TA8 A;  2YZG A;  2WB1 A;  1S10 A;  5C3E G;  3Q2O A;  2V4Q A;  1S0M A;  3V6H A;  2W7P A;  4IWY A;  3GIL A;  4Q43 A;  3VPD A;  3BJY A;  1IBL H;  5KFK A;  2UXC H;  2C2E A;  4L1K A;  3H3V H;  3UFX B;  2NU9 B;  5HBR B;  2DIK A;  2R8I A;  2C35 B;  5KG2 A;  4HR7 A;  5KFU A;  4U6P A;  5EWE A;  3I4N G;  1M0T A;  2NVY A;  3JSN A;  4O3R A;  4DR3 H;  3RFC A;  1K1Q A;  1KJ8 A;  4EG0 A;  4DL6 A;  5IP9 G;  4O4I F;  4OD6 A;  3HOY G;  1WSC A;  2JEB I;  4QWE A;  4IRK A;  2FJZ A;  1S9F A;  4LIJ A;  4LF4 H;  1WR2 A;  1KJQ A;  2FPG B;  5K36 G;  3N44 B;  4CC5 A;  4J9S A;  4XYL B;  4GKK H;  2P0A A;  3GTQ A;  2UXB H;  1K83 A;  2D9I A;  2QND A;  4MV6 A;  2C2R A;  2R7Z A;  5KG6 A;  5KX5 F;  3H4B A;  1A0I A;  1JXL A;  5KFV A;  2VUM G;  5T14 A;  4LSX A;  4YR0 A;  4J9Q A;  4RNN A;  4ECZ A;  4B3R H;  1KEE A;  2YL2 A;  4WD3 A;  3QD7 X;  4APM A;  3H4D A;  4RAZ A;  4FJU A;  4UCR A;  4RUA A;  4YBZ B;  3T5K A;  5LYJ F;  2J6T A;  4BA1 I;  4DV1 H;  4LF7 H;  1C3O A;  4A2A A;  3TII A;  5LMN H;  2R92 G;  2QYZ A;  1S03 G;  4ECR A;  2ALZ A;  4QW8 A;  1CQJ B;  3KHG A;  5C44 G;  2W6N A;  4HNT A;  2UVU A;  4BY7 G;  4YR2 A;  5LMU H;  1EHI A;  3BQ2 A;  3T5H A;  3PW2 A;  4FBU A;  1B33 N;  1V9N A;  1M0W A;  1HNZ H;  3V69 A;  4R8U B;  2VKC A;  4ED2 A;  2R8K A;  2CTF A;  3GTJ A;  3RIZ A;  2HVR A;  5EWG A;  4J9L A;  4MTD A;  2FK2 A;  2W9A A;  4I55 F;  2Y0S A;  4H8A A;  3T1H H;  2FK3 A;  1I94 H;  1IBM H;  4IAJ A;  5KFR A;  3FKI G;  3SB1 A;  5L1J A;  4F4W A;  4EBC A;  2OLS A;  2VA2 A;  2JA9 A;  2MCT A;  1RK5 A;  3GR5 A;  5LXT F;  3KDG A;  3U9S A;  1WHR A;  3KDK A;  4RB2 C;  3QZ8 A;  2DPI A;  2W6O A;  4A3E G;  2UVV A;  3C0F B;  5L9X A;  3V6J A;  1RYR A;  3PR5 B;  4QIW A;  2RGR A;  1XMO H;  1W96 A;  2XGP A;  5C1O A;  5GON F;  3V4Z A;  3CVZ A;  5KFP A;  2VUM A;  5KT2 A;  3ORQ A;  4X64 H;  4JI5 H;  2ANN A;  2JEA I;  3OUU A;  5DGB A;  1ZZJ A;  2E3U A;  4E9J A;  4EGQ A;  4X62 H;  2R93 G;  2JA7 A;  2JA6 G;  1ZHS A;  5FD6 A;  4I50 F;  4A3G G;  4UCU A;  4IFD G;  1FVI A;  5JEA G;  1DV2 A;  2XGQ A;  2R87 A;  3N40 P;  2R92 A;  3L2P A;  5JUM A;  2K1H A;  1TWG A;  2FMA A;  5BPF A;  3HOW G;  1Y1V G;  5DG8 A;  4JV1 A;  4NBQ A;  1JLL B;  2W71 A;  5J2T F;  4YHH H;  3RGX A;  4JVH A;  4O3N A;  5IYC G;  3JRX A;  4QJF A;  4R7R A;  4YAK B;  1ZZK A;  4QWD A;  3M9M B;  5KT4 A;  5KT3 A;  4DV6 H;  1X9N A;  1I6U A;  4AIM A;  5KG1 A;  4BWS C;  5KFT A;  2HH3 A;  5A2Q W;  2GPS A;  3CQZ A;  4NXN H;  4MTE A;  2X0S A;  2GPW A;  4C5C A;  4RB0 A;  4EC5 A;  4ZHQ F;  2C2D A;  3MFH A;  1GSO A;  1E4F T;  4JV0 A;  5EDW A;  4BA2 I;  3I4M G;  3RB0 A;  5KFQ A;  1GLV A;  1Z2O X;  2O4C A;  1L2Z A;  4B8T A;  2HGS A;  3BA8 A;  1EZ1 A;  2FLN A;  1GSA A;  4LF5 H;  4AYB A;  4J0M A;  1PX2 A;  2FB9 A;  3PW5 A;  1WVN A;  4NZT M;  2DWC A;  4O3Q A;  1JX4 A;  4TQR A;  4WAL A;  1VKZ A;  2W9C B;  4JV2 A;  2YRW A;  2R93 A;  2PQU A;  2CWH A;  1Z2N X;  3GIP A;  5KKN B;  5KFM A;  4YR3 A;  4DV7 H;  1W93 A;  3RAX A;  3J80 W;  2WE6 A;  4DV0 H;  4TV8 F;  5L1I A;  1Y1V A;  2FFM A;  4HYK A;  5KFI A;  2BA0 A;  4G08 A;  4X66 H;  2VQD A;  2ZJT A;  5D1O B;  5LP6 F;  4LH6 A;  4F4Z A;  2JZX A;  1AUV A;  2W9B A;  4J9R A;  1RJR A;  2CKZ B;  1IOW A;  4TQS A;  3WO1 A;  3PW7 A;  3GTG A;  4JV5 H;  1F0X A;  3JRW A;  1ODH A;  4JI8 H;  1WCM A;  2ASL A;  2HH2 A;  1CE8 A;  4ME6 A;  4A3C G;  2OH2 A;  3IG0 A;  2E2H A;  5JVL A;  1UC9 A;  4O3P A;  3FMA A;  4LSA A;  3WNZ A;  2CTL A;  1GGO A;  4FJS A;  4DUY H;  2CTE A;  1ULZ A;  2Q2U A;  1EUD B;  4LFC H;  4XX0 B;  1TUA A;  4F4Y A;  4DV3 H;  3RB6 A;  4JI1 H;  1MZB A;  1KC7 A;  1HNW H;  1EC6 A;  4HQ6 A;  1OWT A;  4IR1 A;  1B6R A;  1WE8 A;  2NU7 B;  3WO0 A;  1N34 H;  1ZQ7 A;  3MWE A;  4JUZ A;  3I12 A;  4WAN A;  1P8L A;  3Q8S B;  4EBE A;  2W8K A;  1S0O A;  3Q8R B;  2XIG A;  3Q8Q B;  1IBK H;  5EOY A;  3LP8 A;  4O3S A;  2J6U A;  2YS7 A;  2W6M A;  2ATL A;  3MR2 A;  5IYD G;  3KHR A;  2BQU A;  3KAJ A;  1CS0 A;  2I80 A;  4AYB E;  3G6Y A;  4IRD A;  4Q8F A;  4F4X A;  3RAQ A;  4RAY A;  3NGD A;  3R5H A;  2QK4 A;  5LL6 b;  4OO1 G;  1AN7 A;  2W6P A;  4ECQ A;  2F4V H;  3N42 B;  4ECU A;  2UVR A;  2R8J A;  4UCS A;  5HV6 A;  5KFF A; 
#chains in the Genus database with same CATH homology
 2MCT A;  3PN1 A;  3GR5 A;  3KDG A;  4DUZ H;  3KDK A;  3JSL A;  4RB2 C;  2Q2T A;  3C0F B;  2LF0 A;  5IT9 W;  2VUG A;  4DV4 H;  3KAK A;  4UCT A;  4CC6 A;  2RGR A;  1XMO H;  4DR2 H;  3H20 A;  1N32 H;  3CVZ A;  2OWO A;  4X64 H;  4JI5 H;  4LH7 A;  4EFB A;  1SEI A;  1J5E H;  3N6X A;  1B04 A;  4E9J A;  5FPO A;  4X62 H;  4JI4 H;  3HXL A;  5FD5 A;  4UCV A;  1ZHS A;  3N43 B;  3RTX A;  5FD6 A;  1WH2 A;  4UCU A;  1FVI A;  4DV2 H;  2UU9 H;  3F8N A;  4DR7 H;  3N40 P;  4I7H A;  3RF2 A;  4ETS A;  3L2P A;  4OX9 H;  2FE3 A;  3M4I A;  1N33 H;  2ZM6 H;  4AQY H;  4RB3 C;  1VS0 A;  2CW8 A;  2VOB A;  4LF8 H;  4YHH H;  1BJT A;  3RGX A;  2UUC H;  4DR4 H;  2W57 A;  1Z2P X;  4DV5 H;  4R7R A;  1N36 H;  4OCH A;  3KAL A;  4A2B A;  4M7E A;  4DV6 H;  4FM9 A;  1X9N A;  2E5L H;  1I6U A;  1O75 A;  2O03 A;  1E4G T;  4BWS C;  3BA9 A;  4X65 H;  4DR1 H;  5D1O A;  5D1P A;  4PDB A;  3UQ8 A;  5A2Q W;  4MV7 A;  4NXN H;  4B3M H;  4MTE A;  3RJ0 A;  4RB0 A;  4EC5 A;  2VQF H;  1HR0 H;  3LML A;  1E4F T;  4JI3 H;  2CW7 A;  3JAM W;  2UUB H;  1Z2O X;  2O4C A;  1L2Z A;  2HGS A;  1X9Z A;  3BA8 A;  3MWM A;  3OET A;  4LF5 H;  1TAE A;  4J0M A;  3RGZ A;  4NZT M;  3BAB A;  1XNR H;  4NZR M;  1BGW A;  1TA8 A;  3BAA A;  3EZJ A;  4KHP H;  4JI0 H;  3T1Y H;  2UUA H;  2YCH A;  1GYF A;  1Z2N X;  1DGS A;  1IBL H;  4DV7 H;  3J80 W;  2UXC H;  3J7A K;  1FKA H;  2WE6 A;  1FJG H;  4DV0 H;  2WYO A;  2KSW A;  4G08 A;  4X66 H;  4JI6 H;  2ZJT A;  5D1O B;  4GLX A;  4LH6 A;  5BR8 H;  2PT7 G;  1M0T A;  2Y3M A;  4YY3 H;  2RGV A;  3EYY A;  3JSN A;  4DR3 H;  4B8C D;  5FLX W;  4GKJ H;  2UXD H;  4B3T H;  4OD6 A;  4JYA H;  1HNX H;  3GAB A;  5DT9 A;  1ZHQ A;  4JV5 H;  4DR5 H;  1F0X A;  4LF4 H;  4LF6 H;  3FAU A;  1ODH A;  4NXM H;  4JI8 H;  3N44 B;  4CC5 A;  2WDT A;  4MV9 A;  3OSS D;  3NCV A;  4GKK H;  2UXB H;  3IG0 A;  2D9I A;  3FMA A;  4LSA A;  1XNQ H;  4RB1 A;  2VPS A;  3KXY T;  3N41 B;  4DR6 H;  2VQE H;  1XDN A;  4LF9 H;  4DUY H;  2ZQE A;  1A0I A;  2Q2U A;  4LFC H;  4LSX A;  4DV3 H;  4B3R H;  4JI1 H;  1MZB A;  4LFA H;  1HNW H;  3QD7 X;  4LMY A;  4UFZ A;  4APM A;  4RAZ A;  2HVS A;  4UCR A;  1N34 H;  4RZQ A;  4DV1 H;  4LF7 H;  4A2A A;  1P8L A;  5LMN H;  1S03 G;  2XIG A;  5FPR A;  1SYX B;  3J81 W;  1XMQ H;  4JI2 H;  4UCO A;  5LMU H;  3OTO H;  1IBK H;  3K3V A;  5EOY A;  4K0K H;  3DF7 A;  3L4J A;  4EFE A;  3KAJ A;  4LFB H;  1M0W A;  1HNZ H;  2VKC A;  2HHH H;  4Q0Y A;  4RAY A;  5IWA H;  2HVQ A;  3RIZ A;  3L4K A;  2HVR A;  5LL6 b;  4EEQ A;  4MTD A;  1AN7 A;  2FPH X;  2F4V H;  1V9P A;  3N42 B;  1S68 A;  4JI7 H;  4B3S H;  4UCS A;  3T1H H;  4IAJ A;  1I94 H;  1IBM H;  3SB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...