3RF2A

Crystal structure of 30s ribosomal protein s8 from aquifex aeolicus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
165
Chain Sequence
VDPIADMFSAIKNAIMRRDDFLYVPSSKLKERILDVLKKEGFIQDWEALKGEKYEEEYKKMKELAEKSPNPKMKRYLKQLEEYNKGTQYPIKIYLKYLDPKKRKSAITNIVKVSKGGRRVYAGVRTMPYVKRGLGIAIVSTDAGVMTDHEARRMRKGGEVIAFVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S8
publication title The Structure of Aquifex aeolicus Ribosomal Protein S8 Reveals a Unique Subdomain that Contributes to an Extremely Tight Association with 16S rRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ribosomal protein
total genus 46
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3rf2A01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3rf2A02
5IWAH 2UUAH 4DR6H 1XMOH 4DV0H 4YHHH 4LFCH 1N32H 3JAMW 5FLXW 4X66H 4JI4H 4OX9H 1IBLH 3J7AK 4YY3H 1J5EH 4GKJH 4DV2H 1SEIA 4PDBA 4KHPH 4JI5H 1XMQH 1HR0H 5IT9W 1HNXH 4B3SH 5BR8H 4LFAH 1S03G 4NXNH 1I6UA 4DUZH 4LF8H 4JI7H 4LF4H 4DR2H 5LMNH 1N34H 4X62H 4DV3H 4JI6H 4B3RH 2UXCH 4DR4H 1HNWH 5LMUH 4JI3H 4NXMH 4GKKH 1N33H 4X64H 4JI0H 4DR1H 3T1YH 4JI8H 2VQFH 4JI1H 2ZM6H 1HNZH 2UUBH 2UXBH 4K0KH 4B3TH 4LF5H 4DV7H 2UXDH 4DR5H 2F4VH 3RF2A 3T1HH 4X65H 1IBKH 2UUCH 1I94H 1XNRH 2VQEH 1IBMH 4B3MH 4LF9H 3OTOH 4DV6H 4LF6H 4LFBH 2UU9H 4JI2H 5LL6b 4AQYH 4DR3H 4DV5H 4LF7H 2E5LH 5A2QW 1FKAH 1N36H 2HHHH 4DV4H 3J80W 4JV5H 4DR7H 3J81W 1AN7A 1FJGH 4JYAH 4DUYH 1XNQH 4DV1H
chains in the Genus database with same CATH superfamily
2YCHA 3KAKA 4EGJA 5C44G 2JA8G 2IP4A 3Q1KA 2CTFA 1VAJA 4O4IF 2VPQA 4RZQA 4DV0H 2YYAA 4ECQA 2C2DA 1N32H 2W8KA 3RB0A 4J0MA 5KT7A 5C1OA 4MTDA 1VIHA 4ED6A 2OPUA 2QK4A 2RF4A 2UVUA 4HR7A 5JQWA 5BPHA 4QW9A 2JEBI 3BQ2A 1BXRA 4PWQA 3SI8A 3I0PA 3VMMA 4EBEA 4IWYA 3PW5A 1J5KA 2NU8B 1PQXA 2NU9B 5JH7F 4MV7A 4QIWA 5KG2A 2FLNA 4WANA 5DG9A 2D9IA 4O2AF 1TUAA 4F4YA 5KT2A 2Q2TA 5CB4F 3H3VH 2R7NA 2X06A 2ASJA 4FJSA 3HOWG 5IYDG 1WR2A 4APMA 3PW4A 1UC8A 1I6UA 2WTFA 4DUZH 5EWEA 2O4CA 1JDEA 2CW7A 3N41B 5KFLA 4MV1A 3U9SA 1PX2A 4LMYA 1M6VA 5KFNA 5KFWA 4DR2H 4A3IG 3H0GG 3BJYA 2JEFA 1KJJA 4A3LG 1DIKA 4B3RH 2Y3MA 2ZQEA 3BQ1A 5DLGA 3MWMA 2JEAI 3KHRA 1GYFA 4FS1A 4JI3H 5IP9G 2DPJA 2BA0A 3OETA 5FD5A 5KG7A 1N33H 4JI0H 1ZHQA 2I80A 5JUMA 4BY7G 3MWDA 2R7ZA 4UFZA 2CTLA 4EFBA 2CPQA 2JEIA 2UUBH 5F9NA 1TWFA 2R87A 3JRXA 1EHIA 3PW7A 1V8CA 1E4EA 2AGPA 2VUMA 2VOBA 2PBZA 2ANNA 1M7JA 3JSLA 3L7ZC 4R7RA 2V5AA 3LWBA 4DL5A 1B6RA 3RUPA 2FK3A 2K1HA 3MFIA 4MV9A 4AYBE 4DL7A 2CTMA 1S0MA 2E2HA 3GIJA 2X0SA 4Q44A 2J6UA 3GLKA 3HOUG 4O4HF 5GONF 3EPGA 1OWTA 1TAEA 5D8DA 3IN5A 1ZZKA 2R82A 2W9BB 3OSSD 2HH2A 3FAUA 1O75A 2OLSA 1VBHA 4Q8FA 4RUAA 2M6QA 1CQIB 2PMZA 3GV7B 2PY9A 4DL6A 3OTOH 4RAZA 1F0XA 5FJ8G 2R8IA 1B04A 5C5JA 2W71A 1WSCA 4ECWA 2JEJA 4IWXA 4C2MA 2HVRA 4AIMA 4FBTA 3VPBA 5IYCG 2R8HA 3VPCA 2WB1A 3PVXA 3PN1A 1Y1WG 3RV3A 2PVPA 2FMRA 2I87A 4DL3A 2BQ3A 2C2RA 3K5HA 4AQYH 2NVYA 5C3EG 2R92G 4RB0A 3TQ1A 3JZIA 2IMWP 1KJIA 3M9OB 4MAMA 1CE8A 2XCAA 1KHMA 2I8CA 5FD6A 4EC5A 3GR5A 2FMAA 2WE6A 2ZDHA 5L1IA 5C4XG 2CZGA 2YS7A 3M9NB 4DR7H 2DWCA 1TWGA 3MR6A 4A2AA 2R93G 1DT4A 4EYIB 4ECUA 2W8LA 3BQ0A 4R8UB 5KG1A 1N48A 1Y1VA 4ECZA 1KBLA 4DV1H 1W96A 5C8YF 2R86A 5LXTF 3V6KA 3AYHB 2RDJA 4J9QA 4BBSG 2AU0A 4ZOLF 1XMOH 3WNZA 3LMLA 4WD3A 4ZHQF 4YHHH 2A1SA 1VBIA 5FLXW 2FPPB 3K5IA 1ZHSA 3RTXA 4FJUA 4X66H 5LP6F 5KFMA 3KAJA 3PW2A 5KFPA 2J6SA 3HBLA 2JZXA 2FB9A 3LP8A 1IBLH 4UCRA 4O3RA 4XYMB 5KT5A 4EBCA 1S10A 3GKUA 4ECTA 3MR5A 1K1GA 1ZTGA 1GSAA 3GIDA 4BA1I 1CQJB 4RNNA 2XIGA 5KFFA 4G3IA 2YS6A 1SEIA 4OO1G 4KHPH 3HOZG 5IT9W 3GIIA 1HNXH 3GV8B 5DQGA 4ME6A 4H8AA 3KHGA 4FS2A 1SFOA 4B3SH 5LOVF 4JVHA 3H4DA 1C30A 3RAXA 4UCOA 2XGPA 3PW0A 5KFSA 4I7HA 2V4QA 1S9FA 4NLGA 4FBUA 4IRKA 4LF4H 3N40P 4UCTA 1UC9A 1B33N 3ORQA 3RGZA 4X62H 4EG0A 1X9NA 4QWCA 2R7MA 5IYBG 4MA0A 1HNWH 2JVZA 1GSHA 3V69A 5D1OA 2W57A 2W6ZA 2DIKA 4QMFB 3HB9A 4NXMH 3I4NG 4O3OA 4LH7A 2FPHX 1GSOA 2XCLA 3N8DA 4YR3A 1KJ8A 4DR1H 2Y0SE 4JI8H 4IFDG 3K3VA 2R7KA 1SYXB 5J2UF 5L1KA 3FKIG 2CTJA 4F4XA 1RYRA 1E4FT 3TIGA 2ZM6H 2UXBH 3N42B 2FK1A 4UCVA 5EOYA 1PK8A 2QNDA 4ED8A 5DQIA 4ED7A 2M05A 1CS0A 1IOWA 5H80A 5FLMG 1E4GT 4GC6A 3Q8QB 4C5CA 2E2IA 2P0AA 2XCPA 5C0XG 2UVVA 4DR5H 3Q8PB 3GIQA 4ECRA 4A3EG 2ALZA 1BJTA 1N56A 2FLPA 2F4VH 4I55F 2M8WA 2PN1A 3RF2A 3T1HH 4NBQA 3K3PA 4A3FG 1Z2IA 4QJFA 4A3BG 2JEGA 4JVYA 4Q8EA 2UUCH 4NZTM 3TIIA 1TWCA 1I94H 4AYBA 4QWBA 2JA6G 3HOVG 1IOVA 4XZ3B 1WCMG 5DGAA 1KC7A 2ZJTA 5KFHA 2VQEH 3AEVB 2W9AA 4A3DG 4J9PA 4B3MH 1I7NA 4YBZB 2XGQA 2JA7G 4DV6H 3Q2OA 4EFEA 2WYOA 3GIKA 4CC6A 4BY1G 5KFDA 4MA5A 4NZRM 2PQUA 5LA6F 4QW8A 3MR2A 2R8GA 3Q8RB 3T5KA 3GTJA 2MJHA 2JA5G 4EYHB 1RJQA 3RFCA 3TQTA 2HGSA 4ED3A 1SCUB 2YU9A 1ULZA 3FMAA 2J9GA 5KFUA 1EUDB 2HVSA 5FPRA 3RB6A 3H0GA 1DGSA 5A2QW 3L2PA 2B63G 5DG8A 1JIHA 1GO3E 3NGDA 4LIJA 4O3PA 1RYSA 2BQRA 3RGXA 3BABA 2HHHH 1TWAA 4YJ2F 3J80W 4BWSC 1C3OA 2WAQE 3GIPA 3OUUA 1AN7A 2W9CA 4IRCA 4JYAH 2YZMA 1VIGA 1T94A 1X4MA 2AXYA 2WDTA 3FDSA 3HKZE 4DUYH 1M0WA 3R23A 4O3QA 3MFHA 1JX4A 2BL5A 4ECSA 3HXLA 4DLKA 3T5JA 3WO1A 4I50F 2KSWA 3GTMA 2YZGA 3G6VA 1AUVA 3CVZA 3PZPA 2FK2A 5KFAA 2FPIB 4DL2A 3JAMW 1I50A 2CW8A 2G8YA 1ODHA 1MZBA 1XDNA 3N44B 4JI4H 1FVIA 5KFEA 2IBKA 4OX9H 4A2BA 4BBRG 3GTOA 5KX5F 4XX0B 4J9KA 3J7AK 1GGOA 2VUGA 4YR2A 3I4MG 1UG8A 4B8TA 4YP3A 4EBDA 3MJFA 4MV4A 4ETSA 3V6JA 2BQUA 3ETJA 3OSNA 2HH3A 1E4EB 4U6PA 4F4WA 1JLLB 5K36G 4PDBA 3L4KA 4MV6A 3M9MB 3GTGA 4JI5H 1M0TA 4RB2C 1I7LA 4Y8VB 5JVDF 5IP7G 4ED2A 4AM3A 2R8KA 5KFYA 2W7OA 4A3GG 3RV4A 5F9LA 4E4TA 4LFAH 2IA6A 3MWEA 3TINA 1MSZA 3M4IA 4RUCA 2VA3A 4JI7H 2QYZA 3WO0A 3PR4A 2CQYA 2CKZB 4YQWA 5L1LA 2GPSA 5KFOA 1Y1WA 5EWGA 3R5FA 4A3CG 2FP4B 5CA1F 5KFJA 3UFXB 2W6NA 3KTMA 3V6HA 5DGBA 4JI6H 4J9LA 2UXCH 3QFFA 3GABA 2R84A 4GLXA 4DR4H 2FLLA 4FM9A 2R92A 3G6YA 3E5NA 1Z2OX 5LMUH 4TV9F 1JDBB 5HBRB 3GTKA 4A3KG 4UCSA 4F4ZA 5KFGA 3EZJA 2E3UA 4GKKH 3VKEA 4TV8F 4LSXA 2W70A 4RB3C 2C2EA 4X64H 2ANRA 1BNCA 3T1YH 1S0OA 1RK6A 2XD4A 2V4RA 2VQFH 3U1KA 4J9SA 1WHRA 3KALA 5KG3A 1Z2PX 3GILA 2ASLA 4YR0A 1V9NA 4LF5H 2MCTA 1I3QA 2ZDQA 2CTEA 3HOXG 1P8LA 2Y0SA 2W6OA 4I4TF 4OD6A 5BPFA 2YL2A 2W7PA 4A3JG 3G8CA 3GV5B 3PO2G 4ECXA 3RB4A 3JSNA 2UXDH 1L2ZA 2J6TA 4YB8B 5KFXA 5DLFA 1BGWA 4IRDA 4EEQA 3GTLA 4GC7A 2CWFA 3KHHA 5KFZA 4X65H 3OSPA 3KDGA 5JEAG 4DL4A 1XNRH 1K1QA 3OHAA 4QWDA 2C00A 3DF7A 1DTJA 4WBNF 1IBMH 2LTLA 1V51A 3V4ZA 4TQSA 2NN6G 1R9TA 4U7CA 3L4JA 2VR1A 4C5AA 5KFRA 4O2BF 4IR9A 4LF6H 5J2TF 2ATLA 4LFBH 1WH2A 2V9WA 1B6SA 5EWFA 3QZ7A 4TQRA 2NVXA 2UU9H 5EZYF 4JI2H 3R5HA 5KFTA 5LL6b 2CWHA 4ECYA 1ZETA 2UVWA 2V59A 4ZI7F 4DV5H 4LF7H 2XC9A 2E5LH 4MV3A 2C35B 4UCUA 5BMVF 1JXLA 3GQCA 4O3NA 3IG0A 2DLNA 3JRWA 1N36H 5L1JA 4DV4H 2VA2A 4Q43A 3J81W 1FJGH 3RJ0A 4ED0A 2YZNA 1DV2A 4ED1A 1VKZA 5EDWA 3I12A 1WE8A 2UVRA 3QZ8A 3KHLA 2R7ZG 1RJPA 2C28A 2Q2UA 2P2RA 3HOYG 3BA9A 1S68A 1EYZA 4YJ3F 2WAQA 2R7LA 3ORRA 3OUZA 5IWAH 4WALA 2UUAH 4DR6H 5D1OB 5D1PA 1A9XA 4QWEA 2VUMG 3FKIA 4LFCH 3HKZA 3R5XA 4LSAA 4HNVA 3RIZA 2W9BA 2W6MA 4LH6A 2JA9A 3U9TA 4XYLB 4HNUA 2V58A 2CTKA 1TWHA 3EYYA 4QIWE 4RNOA 4J9RA 4ZQIA 1S0NA 2YQRA 2FPGB 1TA8A 5KT4A 4IR1A 4YY3H 1J5EH 2LRRA 5T14A 1NXUA 4JUZA 4EGQA 5IYZF 5KKNB 5KG0A 4GKJH 4M9UA 4DV2H 2DGRA 5KG4A 4OCHA 1J4WA 2RGVA 4CC5A 4J9OA 1XMQH 1HR0H 1VS0A 3SE7A 4HYKA 3T5LA 2JA6A 1UNNC 3F8NA 2O03A 2FKLA 1WCMA 1DV1A 4B8CD 5BR8H 1S03G 4NXNH 3BA8A 5FPOA 4Q45A 2JA7A 4BXXG 2JE6I 2NU6B 2OPVA 1EC6A 2NUAB 5KG5A 4LF8H 5L9XA 1ZQ7A 3SB1A 2YRWA 3PO3G 4E9JA 3RBDA 2DPIA 2CPMA 4Q0YA 2R8JA 3UOEA 5LMNH 1X4NA 4R8UA 4A93G 4JV0A 2JA5A 3PR5B 1N34H 3UQ8A 4DV3H 3RBEA 4RZRA 2YW2A 4RNMA 2C22A 2HVQA 2GPWA 4EEYA 2B63A 4JV2A 4HQ6A 1T36A 3MR3A 3H4BA 2RGRA 1EZ1A 1V9PA 5CA0F 1Y1VG 3RB3A 1X0AA 5I47A 3BG5A 4G08A 3QD7X 4QWAA 5KFCA 1WTJA 5DQHA 5KFQA 4J9NA 4M7EA 1S20A 4F50A 2OWOA 4JI1H 3BAAA 2ASDA 5KFBA 2VPSA 2Z0SA 3Q8SB 2LF0A 1HNZH 4TUYF 2AGQA 2OH2A 4K0KH 5LYJF 4IHJF 1GLVA 4B3TH 2W9CB 3T5HA 1XRHA 1W93A 2FJZA 2R85A 4YAKB 5JVLA 1WVNA 3C0FB 2SCUB 2W6PA 3H40A 4J9MA 2AQ4A 4DV7H 4O4LF 1AUXA 1KJ9A 5K2MA 3GIMA 1T3NA 4JV1A 5KT6A 4MV8A 4MTEA 3VPDA 2PMZE 2W6QA 5KFKA 1V4YA 1Z2NX 5KFVA 5DG7A 3KXYT 4C5BA 2RDIA 2GLTA 2PT7G 3KDKA 1IBKH 2DZDA 4ECVA 3GTPA 4A3MG 1EUCB 5KG6A 1ZZJA 1ZZIA 1RK5A 1RJRA 2WB1E 3H20A 1KJQA 5DT9A 4L1KA 2FE3A 4LF9H 2R93A 3V4SA 5HV6A 4IZOA 3G6XA 2LTMA 2YRXA 4HNTA 3N6XA 2AGOA 2ZDGA 1A0IA 3CQZA 1VBGA 2FFMA 4O3SA 4FU0A 3EPIA 3ETHA 2BR0A 3NCVA 4IAJA 4YAJB 5C1PA 4DR3H 3RAQA 2VKCA 4RB1A 5KT3A 1Y14B 2VQDA 1FKAH 1X9ZA 1K83A 2R6FA 4JV5H 1K1SA 3N43B 4BA2I 1JKJB 5CAEB 2NU7B 4RAYA 5KFIA 3GTQA 1S97A 4RU9A 2HJWA 1KEEA 1XNQH 3OHBA
chains in the Genus database with same CATH topology
2Q2UA 2YCHA 3KAKA 3BA9A 1S68A 2KSWA 5IWAH 2UUAH 4DR6H 1XMOH 4RZQA 3CVZA 5D1OB 4DV0H 3LMLA 5D1PA 4YHHH 4LSAA 4LFCH 1N32H 3RIZA 3JAMW 5FLXW 2CW8A 1ZHSA 3RTXA 4X66H 4J0MA 1ODHA 1MZBA 1XDNA 3KAJA 4JI4H 1FVIA 3N44B 4LH6A 4MTDA 4OX9H 4A2BA 3EYYA 1IBLH 4UCRA 3J7AK 1TA8A 2VUGA 4YY3H 1J5EH 4ETSA 2XIGA 4GKJH 4DV2H 1SEIA 4OCHA 4MV7A 2Q2TA 4PDBA 3L4KA 2D9IA 4KHPH 2RGVA 1XMQH 1HR0H 4JI5H 5IT9W 1M0TA 1HNXH 1VS0A 3F8NA 4RB2C 2O03A 4B8CD 4APMA 4B3SH 5BR8H 4LFAH 1S03G 4NXNH 1I6UA 3BA8A 5FPOA 4UCOA 3M4IA 4DUZH 2O4CA 4LF8H 2CW7A 3HXLA 3N41B 3SB1A 4JI7H 4I7HA 4E9JA 4LF4H 3N40P 4LMYA 4Q0YA 4UCTA 4DR2H 5LMNH 3RGZA 1N34H 3UQ8A 4X62H 4DV3H 1X9NA 4JI6H 2Y3MA 2ZQEA 4B3RH 3GABA 2UXCH 4GLXA 4DR4H 4FM9A 1HNWH 3MWMA 1Z2OX 2HVQA 5LMUH 5D1OA 4CC5A 2W57A 1GYFA 4JI3H 2RGRA 1V9PA 4UCSA 4NXMH 3EZJA 3OETA 4GKKH 4LH7A 5FD5A 2FPHX 4LSXA 1N33H 4RB3C 4X64H 4JI0H 1ZHQA 4DR1H 4G08A 3T1YH 3QD7X 4JI8H 3K3VA 2VQFH 1SYXB 4M7EA 2OWOA 4JI1H 3BAAA 4UFZA 4EFBA 2VPSA 1E4FT 1Z2PX 2LF0A 2ZM6H 1HNZH 2UUBH 2UXBH 4K0KH 3KALA 3N42B 4UCVA 4B3TH 4LF5H 2MCTA 5EOYA 1P8LA 2VOBA 1E4GT 3C0FB 4OD6A 3JSLA 4R7RA 4DV7H 3JSNA 2UXDH 4MV9A 1L2ZA 4DR5H 4MTEA 1BJTA 1BGWA 2F4VH 1Z2NX 4EEQA 3KXYT 3RF2A 3T1HH 1TAEA 4X65H 2PT7G 3KDKA 1IBKH 2UUCH 3OSSD 4NZTM 3KDGA 1I94H 3FAUA 1XNRH 1O75A 3H20A 3DF7A 2ZJTA 5DT9A 2VQEH 1IBMH 2FE3A 4B3MH 4LF9H 3OTOH 4RAZA 1F0XA 1B04A 3L4JA 4DV6H 4LF6H 4EFEA 2WYOA 3N6XA 2HVRA 4LFBH 4CC6A 1WH2A 1A0IA 4NZRM 3PN1A 3NCVA 2UU9H 4JI2H 4IAJA 5LL6b 2HGSA 4AQYH 4DR3H 4DV5H 3FMAA 4RB0A 2HVSA 5FPRA 4LF7H 2VKCA 4RB1A 2E5LH 3L2PA 1DGSA 5A2QW 1FKAH 4UCUA 1X9ZA 3IG0A 5FD6A 3RGXA 4EC5A 3GR5A 1N36H 2HHHH 2WE6A 3BABA 4DV4H 3J80W 4JV5H 4BWSC 3N43B 4DR7H 3J81W 1AN7A 1FJGH 4RAYA 4JYAH 4A2AA 3RJ0A 2WDTA 4DUYH 1M0WA 1XNQH 4DV1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA H;  2UUA H;  4DR6 H;  1XMO H;  4DV0 H;  4YHH H;  4LFC H;  1N32 H;  3JAM W;  5FLX W;  4X66 H;  4JI4 H;  4OX9 H;  1IBL H;  3J7A K;  4YY3 H;  1J5E H;  4GKJ H;  4DV2 H;  1SEI A;  4PDB A;  4KHP H;  4JI5 H;  1XMQ H;  1HR0 H;  5IT9 W;  1HNX H;  4B3S H;  5BR8 H;  4LFA H;  1S03 G;  4NXN H;  1I6U A;  4DUZ H;  4LF8 H;  4JI7 H;  4LF4 H;  4DR2 H;  5LMN H;  1N34 H;  4X62 H;  4DV3 H;  4JI6 H;  4B3R H;  2UXC H;  4DR4 H;  1HNW H;  5LMU H;  4JI3 H;  4NXM H;  4GKK H;  1N33 H;  4X64 H;  4JI0 H;  4DR1 H;  3T1Y H;  4JI8 H;  2VQF H;  4JI1 H;  2ZM6 H;  1HNZ H;  2UUB H;  2UXB H;  4K0K H;  4B3T H;  4LF5 H;  4DV7 H;  2UXD H;  4DR5 H;  2F4V H;  3RF2 A;  3T1H H;  4X65 H;  1IBK H;  2UUC H;  1I94 H;  1XNR H;  2VQE H;  1IBM H;  4B3M H;  4LF9 H;  3OTO H;  4DV6 H;  4LF6 H;  4LFB H;  2UU9 H;  4JI2 H;  5LL6 b;  4AQY H;  4DR3 H;  4DV5 H;  4LF7 H;  2E5L H;  5A2Q W;  1FKA H;  1N36 H;  2HHH H;  4DV4 H;  3J80 W;  4JV5 H;  4DR7 H;  3J81 W;  1AN7 A;  1FJG H;  4JYA H;  4DUY H;  1XNQ H;  4DV1 H; 
#chains in the Genus database with same CATH topology
 2YCH A;  3KAK A;  4EGJ A;  5C44 G;  2JA8 G;  2IP4 A;  3Q1K A;  2CTF A;  1VAJ A;  4O4I F;  2VPQ A;  4RZQ A;  4DV0 H;  2YYA A;  4ECQ A;  2C2D A;  1N32 H;  2W8K A;  3RB0 A;  4J0M A;  5KT7 A;  5C1O A;  4MTD A;  1VIH A;  4ED6 A;  2OPU A;  2QK4 A;  2RF4 A;  2UVU A;  4HR7 A;  5JQW A;  5BPH A;  4QW9 A;  2JEB I;  3BQ2 A;  1BXR A;  4PWQ A;  3SI8 A;  3I0P A;  3VMM A;  4EBE A;  4IWY A;  3PW5 A;  1J5K A;  2NU8 B;  1PQX A;  2NU9 B;  5JH7 F;  4MV7 A;  4QIW A;  5KG2 A;  2FLN A;  4WAN A;  5DG9 A;  2D9I A;  4O2A F;  1TUA A;  4F4Y A;  5KT2 A;  2Q2T A;  5CB4 F;  3H3V H;  2R7N A;  2X06 A;  2ASJ A;  4FJS A;  3HOW G;  5IYD G;  1WR2 A;  4APM A;  3PW4 A;  1UC8 A;  1I6U A;  2WTF A;  4DUZ H;  5EWE A;  2O4C A;  1JDE A;  2CW7 A;  3N41 B;  5KFL A;  4MV1 A;  3U9S A;  1PX2 A;  4LMY A;  1M6V A;  5KFN A;  5KFW A;  4DR2 H;  4A3I G;  3H0G G;  3BJY A;  2JEF A;  1KJJ A;  4A3L G;  1DIK A;  4B3R H;  2Y3M A;  2ZQE A;  3BQ1 A;  5DLG A;  3MWM A;  2JEA I;  3KHR A;  1GYF A;  4FS1 A;  4JI3 H;  5IP9 G;  2DPJ A;  2BA0 A;  3OET A;  5FD5 A;  5KG7 A;  1N33 H;  4JI0 H;  1ZHQ A;  2I80 A;  5JUM A;  4BY7 G;  3MWD A;  2R7Z A;  4UFZ A;  2CTL A;  4EFB A;  2CPQ A;  2JEI A;  2UUB H;  5F9N A;  1TWF A;  2R87 A;  3JRX A;  1EHI A;  3PW7 A;  1V8C A;  1E4E A;  2AGP A;  2VUM A;  2VOB A;  2PBZ A;  2ANN A;  1M7J A;  3JSL A;  3L7Z C;  4R7R A;  2V5A A;  3LWB A;  4DL5 A;  1B6R A;  3RUP A;  2FK3 A;  2K1H A;  3MFI A;  4MV9 A;  4AYB E;  4DL7 A;  2CTM A;  1S0M A;  2E2H A;  3GIJ A;  2X0S A;  4Q44 A;  2J6U A;  3GLK A;  3HOU G;  4O4H F;  5GON F;  3EPG A;  1OWT A;  1TAE A;  5D8D A;  3IN5 A;  1ZZK A;  2R82 A;  2W9B B;  3OSS D;  2HH2 A;  3FAU A;  1O75 A;  2OLS A;  1VBH A;  4Q8F A;  4RUA A;  2M6Q A;  1CQI B;  2PMZ A;  3GV7 B;  2PY9 A;  4DL6 A;  3OTO H;  4RAZ A;  1F0X A;  5FJ8 G;  2R8I A;  1B04 A;  5C5J A;  2W71 A;  1WSC A;  4ECW A;  2JEJ A;  4IWX A;  4C2M A;  2HVR A;  4AIM A;  4FBT A;  3VPB A;  5IYC G;  2R8H A;  3VPC A;  2WB1 A;  3PVX A;  3PN1 A;  1Y1W G;  3RV3 A;  2PVP A;  2FMR A;  2I87 A;  4DL3 A;  2BQ3 A;  2C2R A;  3K5H A;  4AQY H;  2NVY A;  5C3E G;  2R92 G;  4RB0 A;  3TQ1 A;  3JZI A;  2IMW P;  1KJI A;  3M9O B;  4MAM A;  1CE8 A;  2XCA A;  1KHM A;  2I8C A;  5FD6 A;  4EC5 A;  3GR5 A;  2FMA A;  2WE6 A;  2ZDH A;  5L1I A;  5C4X G;  2CZG A;  2YS7 A;  3M9N B;  4DR7 H;  2DWC A;  1TWG A;  3MR6 A;  4A2A A;  2R93 G;  1DT4 A;  4EYI B;  4ECU A;  2W8L A;  3BQ0 A;  4R8U B;  5KG1 A;  1N48 A;  1Y1V A;  4ECZ A;  1KBL A;  4DV1 H;  1W96 A;  5C8Y F;  2R86 A;  5LXT F;  3V6K A;  3AYH B;  2RDJ A;  4J9Q A;  4BBS G;  2AU0 A;  4ZOL F;  1XMO H;  3WNZ A;  3LML A;  4WD3 A;  4ZHQ F;  4YHH H;  2A1S A;  1VBI A;  5FLX W;  2FPP B;  3K5I A;  1ZHS A;  3RTX A;  4FJU A;  4X66 H;  5LP6 F;  5KFM A;  3KAJ A;  3PW2 A;  5KFP A;  2J6S A;  3HBL A;  2JZX A;  2FB9 A;  3LP8 A;  1IBL H;  4UCR A;  4O3R A;  4XYM B;  5KT5 A;  4EBC A;  1S10 A;  3GKU A;  4ECT A;  3MR5 A;  1K1G A;  1ZTG A;  1GSA A;  3GID A;  4BA1 I;  1CQJ B;  4RNN A;  2XIG A;  5KFF A;  4G3I A;  2YS6 A;  1SEI A;  4OO1 G;  4KHP H;  3HOZ G;  5IT9 W;  3GII A;  1HNX H;  3GV8 B;  5DQG A;  4ME6 A;  4H8A A;  3KHG A;  4FS2 A;  1SFO A;  4B3S H;  5LOV F;  4JVH A;  3H4D A;  1C30 A;  3RAX A;  4UCO A;  2XGP A;  3PW0 A;  5KFS A;  4I7H A;  2V4Q A;  1S9F A;  4NLG A;  4FBU A;  4IRK A;  4LF4 H;  3N40 P;  4UCT A;  1UC9 A;  1B33 N;  3ORQ A;  3RGZ A;  4X62 H;  4EG0 A;  1X9N A;  4QWC A;  2R7M A;  5IYB G;  4MA0 A;  1HNW H;  2JVZ A;  1GSH A;  3V69 A;  5D1O A;  2W57 A;  2W6Z A;  2DIK A;  4QMF B;  3HB9 A;  4NXM H;  3I4N G;  4O3O A;  4LH7 A;  2FPH X;  1GSO A;  2XCL A;  3N8D A;  4YR3 A;  1KJ8 A;  4DR1 H;  2Y0S E;  4JI8 H;  4IFD G;  3K3V A;  2R7K A;  1SYX B;  5J2U F;  5L1K A;  3FKI G;  2CTJ A;  4F4X A;  1RYR A;  1E4F T;  3TIG A;  2ZM6 H;  2UXB H;  3N42 B;  2FK1 A;  4UCV A;  5EOY A;  1PK8 A;  2QND A;  4ED8 A;  5DQI A;  4ED7 A;  2M05 A;  1CS0 A;  1IOW A;  5H80 A;  5FLM G;  1E4G T;  4GC6 A;  3Q8Q B;  4C5C A;  2E2I A;  2P0A A;  2XCP A;  5C0X G;  2UVV A;  4DR5 H;  3Q8P B;  3GIQ A;  4ECR A;  4A3E G;  2ALZ A;  1BJT A;  1N56 A;  2FLP A;  2F4V H;  4I55 F;  2M8W A;  2PN1 A;  3RF2 A;  3T1H H;  4NBQ A;  3K3P A;  4A3F G;  1Z2I A;  4QJF A;  4A3B G;  2JEG A;  4JVY A;  4Q8E A;  2UUC H;  4NZT M;  3TII A;  1TWC A;  1I94 H;  4AYB A;  4QWB A;  2JA6 G;  3HOV G;  1IOV A;  4XZ3 B;  1WCM G;  5DGA A;  1KC7 A;  2ZJT A;  5KFH A;  2VQE H;  3AEV B;  2W9A A;  4A3D G;  4J9P A;  4B3M H;  1I7N A;  4YBZ B;  2XGQ A;  2JA7 G;  4DV6 H;  3Q2O A;  4EFE A;  2WYO A;  3GIK A;  4CC6 A;  4BY1 G;  5KFD A;  4MA5 A;  4NZR M;  2PQU A;  5LA6 F;  4QW8 A;  3MR2 A;  2R8G A;  3Q8R B;  3T5K A;  3GTJ A;  2MJH A;  2JA5 G;  4EYH B;  1RJQ A;  3RFC A;  3TQT A;  2HGS A;  4ED3 A;  1SCU B;  2YU9 A;  1ULZ A;  3FMA A;  2J9G A;  5KFU A;  1EUD B;  2HVS A;  5FPR A;  3RB6 A;  3H0G A;  1DGS A;  5A2Q W;  3L2P A;  2B63 G;  5DG8 A;  1JIH A;  1GO3 E;  3NGD A;  4LIJ A;  4O3P A;  1RYS A;  2BQR A;  3RGX A;  3BAB A;  2HHH H;  1TWA A;  4YJ2 F;  3J80 W;  4BWS C;  1C3O A;  2WAQ E;  3GIP A;  3OUU A;  1AN7 A;  2W9C A;  4IRC A;  4JYA H;  2YZM A;  1VIG A;  1T94 A;  1X4M A;  2AXY A;  2WDT A;  3FDS A;  3HKZ E;  4DUY H;  1M0W A;  3R23 A;  4O3Q A;  3MFH A;  1JX4 A;  2BL5 A;  4ECS A;  3HXL A;  4DLK A;  3T5J A;  3WO1 A;  4I50 F;  2KSW A;  3GTM A;  2YZG A;  3G6V A;  1AUV A;  3CVZ A;  3PZP A;  2FK2 A;  5KFA A;  2FPI B;  4DL2 A;  3JAM W;  1I50 A;  2CW8 A;  2G8Y A;  1ODH A;  1MZB A;  1XDN A;  3N44 B;  4JI4 H;  1FVI A;  5KFE A;  2IBK A;  4OX9 H;  4A2B A;  4BBR G;  3GTO A;  5KX5 F;  4XX0 B;  4J9K A;  3J7A K;  1GGO A;  2VUG A;  4YR2 A;  3I4M G;  1UG8 A;  4B8T A;  4YP3 A;  4EBD A;  3MJF A;  4MV4 A;  4ETS A;  3V6J A;  2BQU A;  3ETJ A;  3OSN A;  2HH3 A;  1E4E B;  4U6P A;  4F4W A;  1JLL B;  5K36 G;  4PDB A;  3L4K A;  4MV6 A;  3M9M B;  3GTG A;  4JI5 H;  1M0T A;  4RB2 C;  1I7L A;  4Y8V B;  5JVD F;  5IP7 G;  4ED2 A;  4AM3 A;  2R8K A;  5KFY A;  2W7O A;  4A3G G;  3RV4 A;  5F9L A;  4E4T A;  4LFA H;  2IA6 A;  3MWE A;  3TIN A;  1MSZ A;  3M4I A;  4RUC A;  2VA3 A;  4JI7 H;  2QYZ A;  3WO0 A;  3PR4 A;  2CQY A;  2CKZ B;  4YQW A;  5L1L A;  2GPS A;  5KFO A;  1Y1W A;  5EWG A;  3R5F A;  4A3C G;  2FP4 B;  5CA1 F;  5KFJ A;  3UFX B;  2W6N A;  3KTM A;  3V6H A;  5DGB A;  4JI6 H;  4J9L A;  2UXC H;  3QFF A;  3GAB A;  2R84 A;  4GLX A;  4DR4 H;  2FLL A;  4FM9 A;  2R92 A;  3G6Y A;  3E5N A;  1Z2O X;  5LMU H;  4TV9 F;  1JDB B;  5HBR B;  3GTK A;  4A3K G;  4UCS A;  4F4Z A;  5KFG A;  3EZJ A;  2E3U A;  4GKK H;  3VKE A;  4TV8 F;  4LSX A;  2W70 A;  4RB3 C;  2C2E A;  4X64 H;  2ANR A;  1BNC A;  3T1Y H;  1S0O A;  1RK6 A;  2XD4 A;  2V4R A;  2VQF H;  3U1K A;  4J9S A;  1WHR A;  3KAL A;  5KG3 A;  1Z2P X;  3GIL A;  2ASL A;  4YR0 A;  1V9N A;  4LF5 H;  2MCT A;  1I3Q A;  2ZDQ A;  2CTE A;  3HOX G;  1P8L A;  2Y0S A;  2W6O A;  4I4T F;  4OD6 A;  5BPF A;  2YL2 A;  2W7P A;  4A3J G;  3G8C A;  3GV5 B;  3PO2 G;  4ECX A;  3RB4 A;  3JSN A;  2UXD H;  1L2Z A;  2J6T A;  4YB8 B;  5KFX A;  5DLF A;  1BGW A;  4IRD A;  4EEQ A;  3GTL A;  4GC7 A;  2CWF A;  3KHH A;  5KFZ A;  4X65 H;  3OSP A;  3KDG A;  5JEA G;  4DL4 A;  1XNR H;  1K1Q A;  3OHA A;  4QWD A;  2C00 A;  3DF7 A;  1DTJ A;  4WBN F;  1IBM H;  2LTL A;  1V51 A;  3V4Z A;  4TQS A;  2NN6 G;  1R9T A;  4U7C A;  3L4J A;  2VR1 A;  4C5A A;  5KFR A;  4O2B F;  4IR9 A;  4LF6 H;  5J2T F;  2ATL A;  4LFB H;  1WH2 A;  2V9W A;  1B6S A;  5EWF A;  3QZ7 A;  4TQR A;  2NVX A;  2UU9 H;  5EZY F;  4JI2 H;  3R5H A;  5KFT A;  5LL6 b;  2CWH A;  4ECY A;  1ZET A;  2UVW A;  2V59 A;  4ZI7 F;  4DV5 H;  4LF7 H;  2XC9 A;  2E5L H;  4MV3 A;  2C35 B;  4UCU A;  5BMV F;  1JXL A;  3GQC A;  4O3N A;  3IG0 A;  2DLN A;  3JRW A;  1N36 H;  5L1J A;  4DV4 H;  2VA2 A;  4Q43 A;  3J81 W;  1FJG H;  3RJ0 A;  4ED0 A;  2YZN A;  1DV2 A;  4ED1 A;  1VKZ A;  5EDW A;  3I12 A;  1WE8 A;  2UVR A;  3QZ8 A;  3KHL A;  2R7Z G;  1RJP A;  2C28 A;  2Q2U A;  2P2R A;  3HOY G;  3BA9 A;  1S68 A;  1EYZ A;  4YJ3 F;  2WAQ A;  2R7L A;  3ORR A;  3OUZ A;  5IWA H;  4WAL A;  2UUA H;  4DR6 H;  5D1O B;  5D1P A;  1A9X A;  4QWE A;  2VUM G;  3FKI A;  4LFC H;  3HKZ A;  3R5X A;  4LSA A;  4HNV A;  3RIZ A;  2W9B A;  2W6M A;  4LH6 A;  2JA9 A;  3U9T A;  4XYL B;  4HNU A;  2V58 A;  2CTK A;  1TWH A;  3EYY A;  4QIW E;  4RNO A;  4J9R A;  4ZQI A;  1S0N A;  2YQR A;  2FPG B;  1TA8 A;  5KT4 A;  4IR1 A;  4YY3 H;  1J5E H;  2LRR A;  5T14 A;  1NXU A;  4JUZ A;  4EGQ A;  5IYZ F;  5KKN B;  5KG0 A;  4GKJ H;  4M9U A;  4DV2 H;  2DGR A;  5KG4 A;  4OCH A;  1J4W A;  2RGV A;  4CC5 A;  4J9O A;  1XMQ H;  1HR0 H;  1VS0 A;  3SE7 A;  4HYK A;  3T5L A;  2JA6 A;  1UNN C;  3F8N A;  2O03 A;  2FKL A;  1WCM A;  1DV1 A;  4B8C D;  5BR8 H;  1S03 G;  4NXN H;  3BA8 A;  5FPO A;  4Q45 A;  2JA7 A;  4BXX G;  2JE6 I;  2NU6 B;  2OPV A;  1EC6 A;  2NUA B;  5KG5 A;  4LF8 H;  5L9X A;  1ZQ7 A;  3SB1 A;  2YRW A;  3PO3 G;  4E9J A;  3RBD A;  2DPI A;  2CPM A;  4Q0Y A;  2R8J A;  3UOE A;  5LMN H;  1X4N A;  4R8U A;  4A93 G;  4JV0 A;  2JA5 A;  3PR5 B;  1N34 H;  3UQ8 A;  4DV3 H;  3RBE A;  4RZR A;  2YW2 A;  4RNM A;  2C22 A;  2HVQ A;  2GPW A;  4EEY A;  2B63 A;  4JV2 A;  4HQ6 A;  1T36 A;  3MR3 A;  3H4B A;  2RGR A;  1EZ1 A;  1V9P A;  5CA0 F;  1Y1V G;  3RB3 A;  1X0A A;  5I47 A;  3BG5 A;  4G08 A;  3QD7 X;  4QWA A;  5KFC A;  1WTJ A;  5DQH A;  5KFQ A;  4J9N A;  4M7E A;  1S20 A;  4F50 A;  2OWO A;  4JI1 H;  3BAA A;  2ASD A;  5KFB A;  2VPS A;  2Z0S A;  3Q8S B;  2LF0 A;  1HNZ H;  4TUY F;  2AGQ A;  2OH2 A;  4K0K H;  5LYJ F;  4IHJ F;  1GLV A;  4B3T H;  2W9C B;  3T5H A;  1XRH A;  1W93 A;  2FJZ A;  2R85 A;  4YAK B;  5JVL A;  1WVN A;  3C0F B;  2SCU B;  2W6P A;  3H40 A;  4J9M A;  2AQ4 A;  4DV7 H;  4O4L F;  1AUX A;  1KJ9 A;  5K2M A;  3GIM A;  1T3N A;  4JV1 A;  5KT6 A;  4MV8 A;  4MTE A;  3VPD A;  2PMZ E;  2W6Q A;  5KFK A;  1V4Y A;  1Z2N X;  5KFV A;  5DG7 A;  3KXY T;  4C5B A;  2RDI A;  2GLT A;  2PT7 G;  3KDK A;  1IBK H;  2DZD A;  4ECV A;  3GTP A;  4A3M G;  1EUC B;  5KG6 A;  1ZZJ A;  1ZZI A;  1RK5 A;  1RJR A;  2WB1 E;  3H20 A;  1KJQ A;  5DT9 A;  4L1K A;  2FE3 A;  4LF9 H;  2R93 A;  3V4S A;  5HV6 A;  4IZO A;  3G6X A;  2LTM A;  2YRX A;  4HNT A;  3N6X A;  2AGO A;  2ZDG A;  1A0I A;  3CQZ A;  1VBG A;  2FFM A;  4O3S A;  4FU0 A;  3EPI A;  3ETH A;  2BR0 A;  3NCV A;  4IAJ A;  4YAJ B;  5C1P A;  4DR3 H;  3RAQ A;  2VKC A;  4RB1 A;  5KT3 A;  1Y14 B;  2VQD A;  1FKA H;  1X9Z A;  1K83 A;  2R6F A;  4JV5 H;  1K1S A;  3N43 B;  4BA2 I;  1JKJ B;  5CAE B;  2NU7 B;  4RAY A;  5KFI A;  3GTQ A;  1S97 A;  4RU9 A;  2HJW A;  1KEE A;  1XNQ H;  3OHB A; 
#chains in the Genus database with same CATH homology
 2Q2U A;  2YCH A;  3KAK A;  3BA9 A;  1S68 A;  2KSW A;  5IWA H;  2UUA H;  4DR6 H;  1XMO H;  4RZQ A;  3CVZ A;  5D1O B;  4DV0 H;  3LML A;  5D1P A;  4YHH H;  4LSA A;  4LFC H;  1N32 H;  3RIZ A;  3JAM W;  5FLX W;  2CW8 A;  1ZHS A;  3RTX A;  4X66 H;  4J0M A;  1ODH A;  1MZB A;  1XDN A;  3KAJ A;  4JI4 H;  1FVI A;  3N44 B;  4LH6 A;  4MTD A;  4OX9 H;  4A2B A;  3EYY A;  1IBL H;  4UCR A;  3J7A K;  1TA8 A;  2VUG A;  4YY3 H;  1J5E H;  4ETS A;  2XIG A;  4GKJ H;  4DV2 H;  1SEI A;  4OCH A;  4MV7 A;  2Q2T A;  4PDB A;  3L4K A;  2D9I A;  4KHP H;  2RGV A;  1XMQ H;  1HR0 H;  4JI5 H;  5IT9 W;  1M0T A;  1HNX H;  1VS0 A;  3F8N A;  4RB2 C;  2O03 A;  4B8C D;  4APM A;  4B3S H;  5BR8 H;  4LFA H;  1S03 G;  4NXN H;  1I6U A;  3BA8 A;  5FPO A;  4UCO A;  3M4I A;  4DUZ H;  2O4C A;  4LF8 H;  2CW7 A;  3HXL A;  3N41 B;  3SB1 A;  4JI7 H;  4I7H A;  4E9J A;  4LF4 H;  3N40 P;  4LMY A;  4Q0Y A;  4UCT A;  4DR2 H;  5LMN H;  3RGZ A;  1N34 H;  3UQ8 A;  4X62 H;  4DV3 H;  1X9N A;  4JI6 H;  2Y3M A;  2ZQE A;  4B3R H;  3GAB A;  2UXC H;  4GLX A;  4DR4 H;  4FM9 A;  1HNW H;  3MWM A;  1Z2O X;  2HVQ A;  5LMU H;  5D1O A;  4CC5 A;  2W57 A;  1GYF A;  4JI3 H;  2RGR A;  1V9P A;  4UCS A;  4NXM H;  3EZJ A;  3OET A;  4GKK H;  4LH7 A;  5FD5 A;  2FPH X;  4LSX A;  1N33 H;  4RB3 C;  4X64 H;  4JI0 H;  1ZHQ A;  4DR1 H;  4G08 A;  3T1Y H;  3QD7 X;  4JI8 H;  3K3V A;  2VQF H;  1SYX B;  4M7E A;  2OWO A;  4JI1 H;  3BAA A;  4UFZ A;  4EFB A;  2VPS A;  1E4F T;  1Z2P X;  2LF0 A;  2ZM6 H;  1HNZ H;  2UUB H;  2UXB H;  4K0K H;  3KAL A;  3N42 B;  4UCV A;  4B3T H;  4LF5 H;  2MCT A;  5EOY A;  1P8L A;  2VOB A;  1E4G T;  3C0F B;  4OD6 A;  3JSL A;  4R7R A;  4DV7 H;  3JSN A;  2UXD H;  4MV9 A;  1L2Z A;  4DR5 H;  4MTE A;  1BJT A;  1BGW A;  2F4V H;  1Z2N X;  4EEQ A;  3KXY T;  3RF2 A;  3T1H H;  1TAE A;  4X65 H;  2PT7 G;  3KDK A;  1IBK H;  2UUC H;  3OSS D;  4NZT M;  3KDG A;  1I94 H;  3FAU A;  1XNR H;  1O75 A;  3H20 A;  3DF7 A;  2ZJT A;  5DT9 A;  2VQE H;  1IBM H;  2FE3 A;  4B3M H;  4LF9 H;  3OTO H;  4RAZ A;  1F0X A;  1B04 A;  3L4J A;  4DV6 H;  4LF6 H;  4EFE A;  2WYO A;  3N6X A;  2HVR A;  4LFB H;  4CC6 A;  1WH2 A;  1A0I A;  4NZR M;  3PN1 A;  3NCV A;  2UU9 H;  4JI2 H;  4IAJ A;  5LL6 b;  2HGS A;  4AQY H;  4DR3 H;  4DV5 H;  3FMA A;  4RB0 A;  2HVS A;  5FPR A;  4LF7 H;  2VKC A;  4RB1 A;  2E5L H;  3L2P A;  1DGS A;  5A2Q W;  1FKA H;  4UCU A;  1X9Z A;  3IG0 A;  5FD6 A;  3RGX A;  4EC5 A;  3GR5 A;  1N36 H;  2HHH H;  2WE6 A;  3BAB A;  4DV4 H;  3J80 W;  4JV5 H;  4BWS C;  3N43 B;  4DR7 H;  3J81 W;  1AN7 A;  1FJG H;  4RAY A;  4JYA H;  4A2A A;  3RJ0 A;  2WDT A;  4DUY H;  1M0W A;  1XNQ H;  4DV1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...