2PT7G

Crystal structure of cag virb11 (hp0525) and an inhibitory protein (hp1451)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
145
structure length
145
Chain Sequence
KLHEIKQELKDLFSHLPYKINKVEVSLYEPGVLLIDIDGEDSALLIGEKGYRYKALSYLLFNWIHPTYGYSIRLEISTFLQNQEKVMDTQLQSVIMTVHEVGKGQMKAPDGVLTYIALKKLRKAFPNKYVSIKTNLNDEKYIVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cag-alfa
publication title Identification, structure and mode of action of a new regulator of the Helicobacter pylori HP0525 ATPase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/protein binding
total genus 44
structure length 145
sequence length 145
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF18472 HP1451_C HP1451 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2pt7G01
3.30.1370.180 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2pt7G02
1USPA 1WH9A 1J5EC 4MTNA 4DCVA 1XNQC 4YY3C 2PN2A 3I07A 2HHHC 1LQLA 5IWAC 1N32C 2QL8A 3J81D 2UUBC 2EGTA 1IBKC 4JI6C 1JOSA 4JI2C 4JI7C 3J80D 5LMUC 1L2FA 5FLXD 2E7GA 4B3TC 1NYEA 4DV2C 1HNWC 2JMPA 4B3MC 4X65C 4DCTA 4DUZC 4JI3C 4JI8C 4X66C 3AF5A 4DV5C 4DR6C 1HNXC 5LMNC 1N34C 5A2QD 1N2FA 4JV5C 4DV3C 4B3SC 4DR3C 2OPLB 4DV0C 2E8CA 2ONFA 4JI1C 4LFAC 1ZB8A 1ZB9A 4JI5C 2XR1A 1WF3A 4JYAC 4DR2C 1PA4A 4LFCC 4XX2A 3T1HC 2YCBA 2KZFA 4NXMC 2OPLA 2BJOA 5BR8C 4DV7C 2ATWA 4LF4C 3R9XA 4NOZA 2UUAC 1KKGA 2HJGA 2UU9C 1HNZC 4AQYC 4LFBC 1FJGC 1HR0C 2D7VA 4LF6C 4DV1C 2E8FA 2E5LC 4DV6C 1N36C 1N33C 2ZM6C 3IEUA 4DR4C 3CJEA 4JI0C 4LF9C 4DR5C 4JI4C 3AF6A 2UUCC 2VQFC 1K0RA 1MKYA 1QWIA 1I94C 1UKKA 1EGAA 1ML8A 2CXCA 1VLAA 4DV4C 3JAMD 1XNRC 4KHPC 3R9WA 2CY1A 3IEVA 1IBLC 1XMQC 4LF7C 1IBMC 2F4VC 3LUSA 2VQEC 4X62C 4K0KC 2ASBA 4LF8C 4X64C 1XMOC 4YHHC 4DR7C 3GKUA 3T1YC 1HH2P 2UXCC 3OTOC 4OX9C 2UXDC 4GKKC 4GKJC 4LF5C 5IT9D 2DYJA 4B3RC 4BSZA 1USPB 4MH4A 4DR1C 2PT7G 4DCUA 2UXBC 4DUYC 4DCSA 3EERA 2E8EA 4NXNC
chains in the Genus database with same CATH superfamily
3RV2A 1FJGH 4DR6H 4YY3C 1HNXH 3I07A 1HR0H 2HHHC 1N32C 2QL8A 4R1MA 4DV6H 2MJHA 1IB8A 2UUBC 3A9VA 2EGTA 4NBQA 2AXYA 1O92A 5FLXD 1DT4A 2WD9A 4LF9H 4NZTM 2VKCA 4JI5H 4X65C 3CQ2A 4WALA 4X66C 3AF5A 2P2MA 4ISBA 5BSVA 3N54B 2X06A 1J4WA 2CPMA 4DV5C 4DG9A 4FTFA 2UUAH 5AE3A 1AN7A 4NZRM 5LMNC 2Y3MA 4LF7H 4X62H 5ADZA 4K0KH 4JV5C 4B3SC 3PESA 2M6QA 4TPSB 5CZXA 3L7ZC 4X64H 4JVYA 4PHTA 1N33H 2VZEA 4LFAC 3T1YH 1ZB9A 5K8FA 2JVZA 5LL6b 1P4EA 2OPLA 2BJOA 5LCIA 5A1GA 3NYRA 1Z2IA 4B3RH 3I08A 2HJGA 3DAYA 4FUTA 3VNQA 4AQYC 2UXBH 1FKAH 2D7VA 4PZPA 1KHMA 1XMQH 1V60A 1WE8A 5JEAG 3GR1A 4D57A 1N32H 4JI4C 2UUCC 2UUBH 5BURA 1ZZIA 3A4IA 1I94C 4EC5A 2OO4A 2A1SA 2LTLA 3TUFA 3A9UA 2D1RA 2Y4OA 4X65H 4LF5H 1XNRC 4KHPC 2CY1A 3IEVA 1WHRA 2CTFA 3TR3A 4DV5H 2D1SA 1XMOC 3DHVA 5LMNH 3VNSA 1XRAA 1HH2P 1MXCA 2D1QA 3OTOC 4B3SH 1GPMA 2DHMA 3QD7X 5IWAH 4B8TA 4GKKC 1NY8A 1XHJA 1V8CA 3KDGA 1I6UA 1USPB 3U1KA 5A2QW 4B3MH 4I9FA 5BSRA 3SO4A 4DR1C 4OD6A 5A1IA 1YJ7A 4G1IA 4GXQA 4DCUA 4R1LA 4DCSA 4DUYC 4DUZH 2ANNA 4WANA 3L8CA 2FFMA 3L95X 3FCCA 5FLXW 4NXNC 4AQYH 2DGRA 4RM3A 2P2BA 1S03G 2G8YA 1LQLA 2V7BA 3J81D 2DPLA 3LGXA 2Y27A 2D1TA 4ZLPA 3CQ3A 3K6RA 2E7GA 1P7LA 4DV2C 1M6XA 1VIHA 2PY9A 4L7IA 3T1HH 2MM9A 4L2ZA 4D4IA 1P4EC 4AIMA 5CZVA 1XNRH 4RLFA 4KHPH 1FUGA 1NXUA 1PU1A 1VBIA 2QVZX 2P2FA 2JEBI 1N34C 1J5KA 3UOWA 5A2QD 2BA0A 4DV3C 1XMOH 4DV0C 1X4NA 2NN6G 1N36H 4JI1C 1ZB8A 4JYAC 3CW9A 2ZM6H 4FUQA 4XX2A 4ZJZA 4LFCC 4G37A 5BSUA 4GKKH 4NXMC 2CTJA 4G08A 2ATWA 1V26A 1KKGA 2UU9C 4DR1H 1HNZC 1ODHA 1TH5A 4DUYH 2P2JA 4LFBC 4LF6C 4DV1C 3TDEA 5GTDA 4NXNH 2LRRA 4OCHA 5A19A 2QVXX 3IEUA 4DR4C 1WCJA 2LF0A 2VQFC 1X4MA 4PDBA 3GR0A 4ODJA 1K0RA 3OETA 4PROC 4U5YD 1AMUA 1ML8A 3EQ6A 4DV2H 3PBKA 4JVHA 3IPLA 2HH2A 4WS9A 3NPDA 2F4VC 5BUSA 2ASBA 5AE1A 5T8TA 4LF8C 4YHHC 5JRHA 4B8CD 1N34H 2UXCC 1UG8A 1S20A 3B7WA 4YY3H 4DV3H 4E9JA 4OX9C 2LTMA 2HHHH 4DV0H 4GKJC 2JZXA 5IT9D 4BCAA 3H2TA 5KYTA 1ULTA 4LFCH 2DYJA 4BC7A 1M6XC 1V25A 4NXMH 4R0MA 3NI2A 2YWCA 4LE5A 1X9ZA 3J81W 2JA9A 2ANRA 2MMAB 2Y4NA 4X66H 3V69A 2UU9H 1USPA 1WH9A 3TQIA 4LFBH 4DCVA 1MSZA 2K1HA 4LF6H 3CQ1A 4DV1H 1PQXA 2CTEA 3UZ0A 1IBKC 3VNRA 4JI2C 4JI6C 4K0BA 3J80D 1VEHA 1L2FA 5LMUC 4JI7C 4JV5H 1MXAA 1MDBA 1NYEA 4LFAH 1HNWC 2ZQEA 1O90A 2O4CA 3CW8X 4JI3C 5DV9A 4QMFB 1O9TA 4JI8C 3UX3A 4DR6C 1HNXC 3FCEA 5BSWA 2F4VH 5KYVA 4LF8H 4YHHH 2E8CA 3FAUA 3LAXA 1PG4A 2BH1X 4JI5C 3UOEA 2UXCH 1WF3A 2VSQA 1PG3A 4OX9H 4JI4H 2UUCH 2YCBA 4RMNA 4GKJH 2KZFA 1X0AA 3NYQA 2P02A 4IR7A 1I94H 3R9XA 3SB1A 2UUAC 1T5HX 2PQUA 2CTMA 3RF2A 3LNVA 4OYCA 2E8FA 2E5LC 1N33C 4EATA 2PROA 2JEAI 1BA3A 4FJSA 1RG9A 3CJEA 4JI0C 4H8AA 2CTKA 4DR5C 2MCQA 1IBKH 4D56A 3OTOH 4JI6H 2M5OA 5LMUH 1EGAA 1LCIA 1K1GA 1HNWH 4DV4C 2CPQA 3UEBA 3R9WA 1MD9A 5IFIA 4JI3H 1IBLC 3GABA 3GR5A 4G36A 2YWBA 2HH3A 1XMQC 1IBMC 4BBYA 2VQEC 1O93A 3NCVA 5K85A 5BUQA 5IT9W 3E7XA 3KXWA 4DG8A 4DR7C 3GKUA 1XRBA 3A25A 2UXDC 1ZZJA 4PUGA 3DLPX 2JE6I 4LF5C 2CTLA 1XRHA 1FLOA 1ZTGA 2E3UA 4MH4A 4RVNA 2ZZNA 3C5EA 3O2EA 3EERA 5C0XG 2E0GA 1MXBA 4D4GA 3J80W 2E8EA 5T8SA 4BA2I 2OPUA 3GPCA 1J5EC 4MTNA 1XNQC 4LIJA 2M8WA 2YQRA 2PN2A 2QW0X 5IWAC 2FPHX 2E5LH 4KTVA 3PROC 3VKEA 1XRCA 1F0XA 4IFDG 1JOSA 3IMLA 4IZ6A 4JI0H 4RLQA 4B3TC 4OXIA 4DR5H 4JI1H 2JMPA 4B3MC 2Z51A 2CWHA 4DCTA 4JYAH 2QVYX 4DUZC 2OBVA 4NDNA 5AE2A 4DV4H 1VIGA 2P20A 3UX2A 1QM4A 4PUHA 1IBLH 4I9GA 2CWFA 1HNZH 1IBMH 1T5DX 5E7QA 5K36G 2QNDA 2Z0SA 4FJUA 2VQEH 1WVNA 4JM1A 1N2FA 3S82A 3R44A 3JAMW 4RM2A 4DR3C 2OPLB 4DR7H 2ONFA 5KEIA 2XR1A 4DR2C 4DR4H 1PA4A 2YX1A 3T1HC 2UXDH 2P2RA 2VQFH 1XS3A 2D9IA 5BR8C 2AYAA 4DV7C 4LF4C 2P2QA 4NOZA 1TUAA 3ETCA 1WTJA 4KTTA 3EZJA 4L4QA 1FJGC 2FMRA 1MDFA 1HR0C 4GXRA 3AY0A 4BA1I 4DV6C 1N36C 2M5HA 4BC9A 4OO1G 2CU6A 5DT9A 2WP0C 2ZM6C 1J5EH 1XNQH 4AM3A 4LF9C 5H9UA 3AF6A 1V9NA 3ETOA 3AEVB 1MKYA 2D27A 1DTJA 3I0PA 1QWIA 3LNOA 2OPVA 1UKKA 4B3TH 1SEIA 2CXCA 3E7WA 1VLAA 3JAMD 4GS5A 4LF7C 3N2QA 3LUSA 4X62C 1RY2A 4K0KC 2NCLA 1ZZKA 4PUIA 5BSMA 3KDKA 4X64C 2KZ0A 3T1YC 3J7AK 2JNVA 4DR3H 2D28C 3A26A 5BSTA 4JI2H 4DR2H 4JI7H 2KDNA 4WV3A 1EC6A 4B3RC 3OSSD 2ZZMA 4BSZA 3G7SA 5BR8H 2BL5A 2PT7G 2UXBC 4DV7H 4LF4H 1UWDA 4JI8H 3RG2A 4HPVA 4RVOA
chains in the Genus database with same CATH topology
3RV2A 1FJGH 4DR6H 4YY3C 1HNXH 3I07A 1HR0H 2HHHC 1N32C 2QL8A 4R1MA 4DV6H 2UUBC 3A9VA 2EGTA 1O92A 5FLXD 4LF9H 2WD9A 4NZTM 2VKCA 4JI5H 4X65C 4X66C 3AF5A 2P2MA 4ISBA 5BSVA 3N54B 4DV5C 4DG9A 4FTFA 2UUAH 5AE3A 1AN7A 4NZRM 5LMNC 2Y3MA 4LF7H 4X62H 5ADZA 4K0KH 4JV5C 4B3SC 3PESA 4X64H 4TPSB 5CZXA 4PHTA 1N33H 2VZEA 4LFAC 3T1YH 1ZB9A 5K8FA 5LL6b 2OPLA 2BJOA 5A1GA 3NYRA 4B3RH 3I08A 2HJGA 3DAYA 4FUTA 3VNQA 4AQYC 2UXBH 1FKAH 2D7VA 4PZPA 1XMQH 3GR1A 4D57A 1N32H 4JI4C 2UUCC 2UUBH 5BURA 3A4IA 1I94C 4EC5A 2OO4A 3TUFA 3A9UA 2D1RA 2Y4OA 4X65H 4LF5H 1XNRC 4KHPC 2CY1A 3IEVA 4DV5H 2D1SA 1XMOC 3DHVA 5LMNH 3VNSA 1XRAA 1HH2P 1MXCA 2D1QA 3OTOC 4B3SH 1GPMA 5IWAH 3QD7X 4GKKC 3KDGA 1I6UA 1USPB 5A2QW 4B3MH 4I9FA 5BSRA 4DR1C 3SO4A 4OD6A 5A1IA 1YJ7A 4G1IA 4GXQA 4DCUA 4R1LA 4DCSA 4DUYC 4DUZH 3L8CA 3L95X 3FCCA 5FLXW 4NXNC 4AQYH 4RM3A 2P2BA 1S03G 1LQLA 2V7BA 3J81D 2DPLA 3LGXA 2Y27A 2D1TA 4ZLPA 2E7GA 1P7LA 4DV2C 4L7IA 3T1HH 4L2ZA 4D4IA 5CZVA 1XNRH 4RLFA 4KHPH 1FUGA 2QVZX 2P2FA 1N34C 3UOWA 5A2QD 4DV3C 1XMOH 4DV0C 1N36H 4JI1C 1ZB8A 4JYAC 3CW9A 2ZM6H 4FUQA 4XX2A 4ZJZA 4LFCC 4G37A 5BSUA 4GKKH 4NXMC 4G08A 2ATWA 1V26A 1KKGA 2UU9C 4DR1H 1HNZC 1ODHA 4DUYH 2P2JA 4LFBC 4LF6C 4DV1C 3TDEA 5GTDA 4NXNH 4OCHA 5A19A 2QVXX 3IEUA 4DR4C 2LF0A 2VQFC 4PDBA 3GR0A 4ODJA 1K0RA 3OETA 4PROC 4U5YD 1AMUA 1ML8A 3EQ6A 4DV2H 3PBKA 3IPLA 4WS9A 3NPDA 2F4VC 5BUSA 2ASBA 5AE1A 5T8TA 4LF8C 4YHHC 5JRHA 4B8CD 1N34H 2UXCC 3B7WA 4YY3H 4DV3H 4E9JA 4OX9C 2HHHH 4DV0H 4GKJC 5IT9D 4BCAA 3H2TA 5KYTA 1ULTA 4LFCH 2DYJA 4BC7A 1V25A 4NXMH 4R0MA 3NI2A 2YWCA 4LE5A 1X9ZA 3J81W 2Y4NA 4X66H 2UU9H 1USPA 1WH9A 3TQIA 4LFBH 4DCVA 4LF6H 4DV1H 3UZ0A 1IBKC 3VNRA 4JI2C 4JI6C 4K0BA 3J80D 5LMUC 1L2FA 4JI7C 4JV5H 1MXAA 1MDBA 1NYEA 4LFAH 1HNWC 2ZQEA 1O90A 2O4CA 3CW8X 4JI3C 5DV9A 1O9TA 4JI8C 4DR6C 1HNXC 3FCEA 5BSWA 2F4VH 5KYVA 4LF8H 4YHHH 2E8CA 3FAUA 3LAXA 1PG4A 2BH1X 4JI5C 2UXCH 1WF3A 2VSQA 1PG3A 4OX9H 4JI4H 2UUCH 2YCBA 4RMNA 4GKJH 2KZFA 3NYQA 2P02A 4IR7A 1I94H 3R9XA 3SB1A 2UUAC 1T5HX 3RF2A 3LNVA 4OYCA 2E8FA 2E5LC 1N33C 4EATA 2PROA 1BA3A 1RG9A 3CJEA 4JI0C 4DR5C 1IBKH 4D56A 3OTOH 4JI6H 5LMUH 1EGAA 1LCIA 1HNWH 4DV4C 3R9WA 1MD9A 5IFIA 4JI3H 1IBLC 3GABA 3GR5A 4G36A 2YWBA 1XMQC 1IBMC 4BBYA 2VQEC 1O93A 3NCVA 5K85A 5BUQA 5IT9W 3E7XA 3KXWA 4DG8A 4DR7C 3GKUA 1XRBA 2UXDC 3DLPX 4LF5C 4MH4A 4RVNA 3C5EA 3EERA 2E0GA 1MXBA 4D4GA 3J80W 2E8EA 5T8SA 3GPCA 1J5EC 4MTNA 1XNQC 2PN2A 2QW0X 5IWAC 2FPHX 2E5LH 4KTVA 3PROC 1XRCA 1F0XA 1JOSA 3IMLA 4IZ6A 4JI0H 4RLQA 4B3TC 4OXIA 4DR5H 4JI1H 2JMPA 4B3MC 4JYAH 4DCTA 2QVYX 4DUZC 2OBVA 4NDNA 5AE2A 4DV4H 2P20A 1QM4A 1IBLH 4I9GA 1HNZH 1IBMH 1T5DX 5E7QA 2VQEH 4JM1A 1N2FA 3S82A 3R44A 3JAMW 4RM2A 4DR3C 2OPLB 4DR7H 2ONFA 5KEIA 2XR1A 4DR2C 4DR4H 1PA4A 3T1HC 2UXDH 2VQFH 2D9IA 5BR8C 2AYAA 4DV7C 4LF4C 2P2QA 4NOZA 3ETCA 4KTTA 3EZJA 4L4QA 1FJGC 1MDFA 1HR0C 4GXRA 4DV6C 1N36C 4BC9A 5DT9A 2WP0C 2ZM6C 1J5EH 1XNQH 4LF9C 5H9UA 3AF6A 3ETOA 1MKYA 2D27A 1QWIA 1UKKA 4B3TH 1SEIA 2CXCA 3E7WA 1VLAA 3JAMD 4GS5A 4LF7C 3N2QA 3LUSA 4X62C 1RY2A 4K0KC 5BSMA 3KDKA 4X64C 3T1YC 3J7AK 4DR3H 2D28C 5BSTA 4JI2H 4DR2H 4JI7H 4WV3A 4B3RC 3OSSD 4BSZA 3G7SA 5BR8H 2PT7G 2UXBC 4DV7H 4LF4H 4JI8H 3RG2A 4HPVA 4RVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP A;  1WH9 A;  1J5E C;  4MTN A;  4DCV A;  1XNQ C;  4YY3 C;  2PN2 A;  3I07 A;  2HHH C;  1LQL A;  5IWA C;  1N32 C;  2QL8 A;  3J81 D;  2UUB C;  2EGT A;  1IBK C;  4JI6 C;  1JOS A;  4JI2 C;  4JI7 C;  3J80 D;  5LMU C;  1L2F A;  5FLX D;  2E7G A;  4B3T C;  1NYE A;  4DV2 C;  1HNW C;  2JMP A;  4B3M C;  4X65 C;  4DCT A;  4DUZ C;  4JI3 C;  4JI8 C;  4X66 C;  3AF5 A;  4DV5 C;  4DR6 C;  1HNX C;  5LMN C;  1N34 C;  5A2Q D;  1N2F A;  4JV5 C;  4DV3 C;  4B3S C;  4DR3 C;  2OPL B;  4DV0 C;  2E8C A;  2ONF A;  4JI1 C;  4LFA C;  1ZB8 A;  1ZB9 A;  4JI5 C;  2XR1 A;  1WF3 A;  4JYA C;  4DR2 C;  1PA4 A;  4LFC C;  4XX2 A;  3T1H C;  2YCB A;  2KZF A;  4NXM C;  2OPL A;  2BJO A;  5BR8 C;  4DV7 C;  2ATW A;  4LF4 C;  3R9X A;  4NOZ A;  2UUA C;  1KKG A;  2HJG A;  2UU9 C;  1HNZ C;  4AQY C;  4LFB C;  1FJG C;  1HR0 C;  2D7V A;  4LF6 C;  4DV1 C;  2E8F A;  2E5L C;  4DV6 C;  1N36 C;  1N33 C;  2ZM6 C;  3IEU A;  4DR4 C;  3CJE A;  4JI0 C;  4LF9 C;  4DR5 C;  4JI4 C;  3AF6 A;  2UUC C;  2VQF C;  1K0R A;  1MKY A;  1QWI A;  1I94 C;  1UKK A;  1EGA A;  1ML8 A;  2CXC A;  1VLA A;  4DV4 C;  3JAM D;  1XNR C;  4KHP C;  3R9W A;  2CY1 A;  3IEV A;  1IBL C;  1XMQ C;  4LF7 C;  1IBM C;  2F4V C;  3LUS A;  2VQE C;  4X62 C;  4K0K C;  2ASB A;  4LF8 C;  4X64 C;  1XMO C;  4YHH C;  4DR7 C;  3GKU A;  3T1Y C;  1HH2 P;  2UXC C;  3OTO C;  4OX9 C;  2UXD C;  4GKK C;  4GKJ C;  4LF5 C;  5IT9 D;  2DYJ A;  4B3R C;  4BSZ A;  1USP B;  4MH4 A;  4DR1 C;  2PT7 G;  4DCU A;  2UXB C;  4DUY C;  4DCS A;  3EER A;  2E8E A;  4NXN C; 
#chains in the Genus database with same CATH topology
 3RV2 A;  1FJG H;  4DR6 H;  4YY3 C;  1HNX H;  3I07 A;  1HR0 H;  2HHH C;  1N32 C;  2QL8 A;  4R1M A;  4DV6 H;  2MJH A;  1IB8 A;  2UUB C;  3A9V A;  2EGT A;  4NBQ A;  2AXY A;  1O92 A;  5FLX D;  1DT4 A;  2WD9 A;  4LF9 H;  4NZT M;  2VKC A;  4JI5 H;  4X65 C;  3CQ2 A;  4WAL A;  4X66 C;  3AF5 A;  2P2M A;  4ISB A;  5BSV A;  3N54 B;  2X06 A;  1J4W A;  2CPM A;  4DV5 C;  4DG9 A;  4FTF A;  2UUA H;  5AE3 A;  1AN7 A;  4NZR M;  5LMN C;  2Y3M A;  4LF7 H;  4X62 H;  5ADZ A;  4K0K H;  4JV5 C;  4B3S C;  3PES A;  2M6Q A;  4TPS B;  5CZX A;  3L7Z C;  4X64 H;  4JVY A;  4PHT A;  1N33 H;  2VZE A;  4LFA C;  3T1Y H;  1ZB9 A;  5K8F A;  2JVZ A;  5LL6 b;  1P4E A;  2OPL A;  2BJO A;  5LCI A;  5A1G A;  3NYR A;  1Z2I A;  4B3R H;  3I08 A;  2HJG A;  3DAY A;  4FUT A;  3VNQ A;  4AQY C;  2UXB H;  1FKA H;  2D7V A;  4PZP A;  1KHM A;  1XMQ H;  1V60 A;  1WE8 A;  5JEA G;  3GR1 A;  4D57 A;  1N32 H;  4JI4 C;  2UUC C;  2UUB H;  5BUR A;  1ZZI A;  3A4I A;  1I94 C;  4EC5 A;  2OO4 A;  2A1S A;  2LTL A;  3TUF A;  3A9U A;  2D1R A;  2Y4O A;  4X65 H;  4LF5 H;  1XNR C;  4KHP C;  2CY1 A;  3IEV A;  1WHR A;  2CTF A;  3TR3 A;  4DV5 H;  2D1S A;  1XMO C;  3DHV A;  5LMN H;  3VNS A;  1XRA A;  1HH2 P;  1MXC A;  2D1Q A;  3OTO C;  4B3S H;  1GPM A;  2DHM A;  3QD7 X;  5IWA H;  4B8T A;  4GKK C;  1NY8 A;  1XHJ A;  1V8C A;  3KDG A;  1I6U A;  1USP B;  3U1K A;  5A2Q W;  4B3M H;  4I9F A;  5BSR A;  3SO4 A;  4DR1 C;  4OD6 A;  5A1I A;  1YJ7 A;  4G1I A;  4GXQ A;  4DCU A;  4R1L A;  4DCS A;  4DUY C;  4DUZ H;  2ANN A;  4WAN A;  3L8C A;  2FFM A;  3L95 X;  3FCC A;  5FLX W;  4NXN C;  4AQY H;  2DGR A;  4RM3 A;  2P2B A;  1S03 G;  2G8Y A;  1LQL A;  2V7B A;  3J81 D;  2DPL A;  3LGX A;  2Y27 A;  2D1T A;  4ZLP A;  3CQ3 A;  3K6R A;  2E7G A;  1P7L A;  4DV2 C;  1M6X A;  1VIH A;  2PY9 A;  4L7I A;  3T1H H;  2MM9 A;  4L2Z A;  4D4I A;  1P4E C;  4AIM A;  5CZV A;  1XNR H;  4RLF A;  4KHP H;  1FUG A;  1NXU A;  1PU1 A;  1VBI A;  2QVZ X;  2P2F A;  2JEB I;  1N34 C;  1J5K A;  3UOW A;  5A2Q D;  2BA0 A;  4DV3 C;  1XMO H;  4DV0 C;  1X4N A;  2NN6 G;  1N36 H;  4JI1 C;  1ZB8 A;  4JYA C;  3CW9 A;  2ZM6 H;  4FUQ A;  4XX2 A;  4ZJZ A;  4LFC C;  4G37 A;  5BSU A;  4GKK H;  4NXM C;  2CTJ A;  4G08 A;  2ATW A;  1V26 A;  1KKG A;  2UU9 C;  4DR1 H;  1HNZ C;  1ODH A;  1TH5 A;  4DUY H;  2P2J A;  4LFB C;  4LF6 C;  4DV1 C;  3TDE A;  5GTD A;  4NXN H;  2LRR A;  4OCH A;  5A19 A;  2QVX X;  3IEU A;  4DR4 C;  1WCJ A;  2LF0 A;  2VQF C;  1X4M A;  4PDB A;  3GR0 A;  4ODJ A;  1K0R A;  3OET A;  4PRO C;  4U5Y D;  1AMU A;  1ML8 A;  3EQ6 A;  4DV2 H;  3PBK A;  4JVH A;  3IPL A;  2HH2 A;  4WS9 A;  3NPD A;  2F4V C;  5BUS A;  2ASB A;  5AE1 A;  5T8T A;  4LF8 C;  4YHH C;  5JRH A;  4B8C D;  1N34 H;  2UXC C;  1UG8 A;  1S20 A;  3B7W A;  4YY3 H;  4DV3 H;  4E9J A;  4OX9 C;  2LTM A;  2HHH H;  4DV0 H;  4GKJ C;  2JZX A;  5IT9 D;  4BCA A;  3H2T A;  5KYT A;  1ULT A;  4LFC H;  2DYJ A;  4BC7 A;  1M6X C;  1V25 A;  4NXM H;  4R0M A;  3NI2 A;  2YWC A;  4LE5 A;  1X9Z A;  3J81 W;  2JA9 A;  2ANR A;  2MMA B;  2Y4N A;  4X66 H;  3V69 A;  2UU9 H;  1USP A;  1WH9 A;  3TQI A;  4LFB H;  4DCV A;  1MSZ A;  2K1H A;  4LF6 H;  3CQ1 A;  4DV1 H;  1PQX A;  2CTE A;  3UZ0 A;  1IBK C;  3VNR A;  4JI2 C;  4JI6 C;  4K0B A;  3J80 D;  1VEH A;  1L2F A;  5LMU C;  4JI7 C;  4JV5 H;  1MXA A;  1MDB A;  1NYE A;  4LFA H;  1HNW C;  2ZQE A;  1O90 A;  2O4C A;  3CW8 X;  4JI3 C;  5DV9 A;  4QMF B;  1O9T A;  4JI8 C;  3UX3 A;  4DR6 C;  1HNX C;  3FCE A;  5BSW A;  2F4V H;  5KYV A;  4LF8 H;  4YHH H;  2E8C A;  3FAU A;  3LAX A;  1PG4 A;  2BH1 X;  4JI5 C;  3UOE A;  2UXC H;  1WF3 A;  2VSQ A;  1PG3 A;  4OX9 H;  4JI4 H;  2UUC H;  2YCB A;  4RMN A;  4GKJ H;  2KZF A;  1X0A A;  3NYQ A;  2P02 A;  4IR7 A;  1I94 H;  3R9X A;  3SB1 A;  2UUA C;  1T5H X;  2PQU A;  2CTM A;  3RF2 A;  3LNV A;  4OYC A;  2E8F A;  2E5L C;  1N33 C;  4EAT A;  2PRO A;  2JEA I;  1BA3 A;  4FJS A;  1RG9 A;  3CJE A;  4JI0 C;  4H8A A;  2CTK A;  4DR5 C;  2MCQ A;  1IBK H;  4D56 A;  3OTO H;  4JI6 H;  2M5O A;  5LMU H;  1EGA A;  1LCI A;  1K1G A;  1HNW H;  4DV4 C;  2CPQ A;  3UEB A;  3R9W A;  1MD9 A;  5IFI A;  4JI3 H;  1IBL C;  3GAB A;  3GR5 A;  4G36 A;  2YWB A;  2HH3 A;  1XMQ C;  1IBM C;  4BBY A;  2VQE C;  1O93 A;  3NCV A;  5K85 A;  5BUQ A;  5IT9 W;  3E7X A;  3KXW A;  4DG8 A;  4DR7 C;  3GKU A;  1XRB A;  3A25 A;  2UXD C;  1ZZJ A;  4PUG A;  3DLP X;  2JE6 I;  4LF5 C;  2CTL A;  1XRH A;  1FLO A;  1ZTG A;  2E3U A;  4MH4 A;  4RVN A;  2ZZN A;  3C5E A;  3O2E A;  3EER A;  5C0X G;  2E0G A;  1MXB A;  4D4G A;  3J80 W;  2E8E A;  5T8S A;  4BA2 I;  2OPU A;  3GPC A;  1J5E C;  4MTN A;  1XNQ C;  4LIJ A;  2M8W A;  2YQR A;  2PN2 A;  2QW0 X;  5IWA C;  2FPH X;  2E5L H;  4KTV A;  3PRO C;  3VKE A;  1XRC A;  1F0X A;  4IFD G;  1JOS A;  3IML A;  4IZ6 A;  4JI0 H;  4RLQ A;  4B3T C;  4OXI A;  4DR5 H;  4JI1 H;  2JMP A;  4B3M C;  2Z51 A;  2CWH A;  4DCT A;  4JYA H;  2QVY X;  4DUZ C;  2OBV A;  4NDN A;  5AE2 A;  4DV4 H;  1VIG A;  2P20 A;  3UX2 A;  1QM4 A;  4PUH A;  1IBL H;  4I9G A;  2CWF A;  1HNZ H;  1IBM H;  1T5D X;  5E7Q A;  5K36 G;  2QND A;  2Z0S A;  4FJU A;  2VQE H;  1WVN A;  4JM1 A;  1N2F A;  3S82 A;  3R44 A;  3JAM W;  4RM2 A;  4DR3 C;  2OPL B;  4DR7 H;  2ONF A;  5KEI A;  2XR1 A;  4DR2 C;  4DR4 H;  1PA4 A;  2YX1 A;  3T1H C;  2UXD H;  2P2R A;  2VQF H;  1XS3 A;  2D9I A;  5BR8 C;  2AYA A;  4DV7 C;  4LF4 C;  2P2Q A;  4NOZ A;  1TUA A;  3ETC A;  1WTJ A;  4KTT A;  3EZJ A;  4L4Q A;  1FJG C;  2FMR A;  1MDF A;  1HR0 C;  4GXR A;  3AY0 A;  4BA1 I;  4DV6 C;  1N36 C;  2M5H A;  4BC9 A;  4OO1 G;  2CU6 A;  5DT9 A;  2WP0 C;  2ZM6 C;  1J5E H;  1XNQ H;  4AM3 A;  4LF9 C;  5H9U A;  3AF6 A;  1V9N A;  3ETO A;  3AEV B;  1MKY A;  2D27 A;  1DTJ A;  3I0P A;  1QWI A;  3LNO A;  2OPV A;  1UKK A;  4B3T H;  1SEI A;  2CXC A;  3E7W A;  1VLA A;  3JAM D;  4GS5 A;  4LF7 C;  3N2Q A;  3LUS A;  4X62 C;  1RY2 A;  4K0K C;  2NCL A;  1ZZK A;  4PUI A;  5BSM A;  3KDK A;  4X64 C;  2KZ0 A;  3T1Y C;  3J7A K;  2JNV A;  4DR3 H;  2D28 C;  3A26 A;  5BST A;  4JI2 H;  4DR2 H;  4JI7 H;  2KDN A;  4WV3 A;  1EC6 A;  4B3R C;  3OSS D;  2ZZM A;  4BSZ A;  3G7S A;  5BR8 H;  2BL5 A;  2PT7 G;  2UXB C;  4DV7 H;  4LF4 H;  1UWD A;  4JI8 H;  3RG2 A;  4HPV A;  4RVO A; 
#chains in the Genus database with same CATH homology
 3RV2 A;  1FJG H;  4DR6 H;  4YY3 C;  1HNX H;  3I07 A;  1HR0 H;  2HHH C;  1N32 C;  2QL8 A;  4R1M A;  4DV6 H;  2UUB C;  3A9V A;  2EGT A;  1O92 A;  5FLX D;  4LF9 H;  2WD9 A;  4NZT M;  2VKC A;  4JI5 H;  4X65 C;  4X66 C;  3AF5 A;  2P2M A;  4ISB A;  5BSV A;  3N54 B;  4DV5 C;  4DG9 A;  4FTF A;  2UUA H;  5AE3 A;  1AN7 A;  4NZR M;  5LMN C;  2Y3M A;  4LF7 H;  4X62 H;  5ADZ A;  4K0K H;  4JV5 C;  4B3S C;  3PES A;  4X64 H;  4TPS B;  5CZX A;  4PHT A;  1N33 H;  2VZE A;  4LFA C;  3T1Y H;  1ZB9 A;  5K8F A;  5LL6 b;  2OPL A;  2BJO A;  5A1G A;  3NYR A;  4B3R H;  3I08 A;  2HJG A;  3DAY A;  4FUT A;  3VNQ A;  4AQY C;  2UXB H;  1FKA H;  2D7V A;  4PZP A;  1XMQ H;  3GR1 A;  4D57 A;  1N32 H;  4JI4 C;  2UUC C;  2UUB H;  5BUR A;  3A4I A;  1I94 C;  4EC5 A;  2OO4 A;  3TUF A;  3A9U A;  2D1R A;  2Y4O A;  4X65 H;  4LF5 H;  1XNR C;  4KHP C;  2CY1 A;  3IEV A;  4DV5 H;  2D1S A;  1XMO C;  3DHV A;  5LMN H;  3VNS A;  1XRA A;  1HH2 P;  1MXC A;  2D1Q A;  3OTO C;  4B3S H;  1GPM A;  5IWA H;  3QD7 X;  4GKK C;  3KDG A;  1I6U A;  1USP B;  5A2Q W;  4B3M H;  4I9F A;  5BSR A;  4DR1 C;  3SO4 A;  4OD6 A;  5A1I A;  1YJ7 A;  4G1I A;  4GXQ A;  4DCU A;  4R1L A;  4DCS A;  4DUY C;  4DUZ H;  3L8C A;  3L95 X;  3FCC A;  5FLX W;  4NXN C;  4AQY H;  4RM3 A;  2P2B A;  1S03 G;  1LQL A;  2V7B A;  3J81 D;  2DPL A;  3LGX A;  2Y27 A;  2D1T A;  4ZLP A;  2E7G A;  1P7L A;  4DV2 C;  4L7I A;  3T1H H;  4L2Z A;  4D4I A;  5CZV A;  1XNR H;  4RLF A;  4KHP H;  1FUG A;  2QVZ X;  2P2F A;  1N34 C;  3UOW A;  5A2Q D;  4DV3 C;  1XMO H;  4DV0 C;  1N36 H;  4JI1 C;  1ZB8 A;  4JYA C;  3CW9 A;  2ZM6 H;  4FUQ A;  4XX2 A;  4ZJZ A;  4LFC C;  4G37 A;  5BSU A;  4GKK H;  4NXM C;  4G08 A;  2ATW A;  1V26 A;  1KKG A;  2UU9 C;  4DR1 H;  1HNZ C;  1ODH A;  4DUY H;  2P2J A;  4LFB C;  4LF6 C;  4DV1 C;  3TDE A;  5GTD A;  4NXN H;  4OCH A;  5A19 A;  2QVX X;  3IEU A;  4DR4 C;  2LF0 A;  2VQF C;  4PDB A;  3GR0 A;  4ODJ A;  1K0R A;  3OET A;  4PRO C;  4U5Y D;  1AMU A;  1ML8 A;  3EQ6 A;  4DV2 H;  3PBK A;  3IPL A;  4WS9 A;  3NPD A;  2F4V C;  5BUS A;  2ASB A;  5AE1 A;  5T8T A;  4LF8 C;  4YHH C;  5JRH A;  4B8C D;  1N34 H;  2UXC C;  3B7W A;  4YY3 H;  4DV3 H;  4E9J A;  4OX9 C;  2HHH H;  4DV0 H;  4GKJ C;  5IT9 D;  4BCA A;  3H2T A;  5KYT A;  1ULT A;  4LFC H;  2DYJ A;  4BC7 A;  1V25 A;  4NXM H;  4R0M A;  3NI2 A;  2YWC A;  4LE5 A;  1X9Z A;  3J81 W;  2Y4N A;  4X66 H;  2UU9 H;  1USP A;  1WH9 A;  3TQI A;  4LFB H;  4DCV A;  4LF6 H;  4DV1 H;  3UZ0 A;  1IBK C;  3VNR A;  4JI2 C;  4JI6 C;  4K0B A;  3J80 D;  5LMU C;  1L2F A;  4JI7 C;  4JV5 H;  1MXA A;  1MDB A;  1NYE A;  4LFA H;  1HNW C;  2ZQE A;  1O90 A;  2O4C A;  3CW8 X;  4JI3 C;  5DV9 A;  1O9T A;  4JI8 C;  4DR6 C;  1HNX C;  3FCE A;  5BSW A;  2F4V H;  5KYV A;  4LF8 H;  4YHH H;  2E8C A;  3FAU A;  3LAX A;  1PG4 A;  2BH1 X;  4JI5 C;  2UXC H;  1WF3 A;  2VSQ A;  1PG3 A;  4OX9 H;  4JI4 H;  2UUC H;  2YCB A;  4RMN A;  4GKJ H;  2KZF A;  3NYQ A;  2P02 A;  4IR7 A;  1I94 H;  3R9X A;  3SB1 A;  2UUA C;  1T5H X;  3RF2 A;  3LNV A;  4OYC A;  2E8F A;  2E5L C;  1N33 C;  4EAT A;  2PRO A;  1BA3 A;  1RG9 A;  3CJE A;  4JI0 C;  4DR5 C;  1IBK H;  4D56 A;  3OTO H;  4JI6 H;  5LMU H;  1EGA A;  1LCI A;  1HNW H;  4DV4 C;  3R9W A;  1MD9 A;  5IFI A;  4JI3 H;  1IBL C;  3GAB A;  3GR5 A;  4G36 A;  2YWB A;  1XMQ C;  1IBM C;  4BBY A;  2VQE C;  1O93 A;  3NCV A;  5K85 A;  5BUQ A;  5IT9 W;  3E7X A;  3KXW A;  4DG8 A;  4DR7 C;  3GKU A;  1XRB A;  2UXD C;  3DLP X;  4LF5 C;  4MH4 A;  4RVN A;  3C5E A;  3EER A;  2E0G A;  1MXB A;  4D4G A;  3J80 W;  2E8E A;  5T8S A;  3GPC A;  1J5E C;  4MTN A;  1XNQ C;  2PN2 A;  2QW0 X;  5IWA C;  2FPH X;  2E5L H;  4KTV A;  3PRO C;  1XRC A;  1F0X A;  1JOS A;  3IML A;  4IZ6 A;  4JI0 H;  4RLQ A;  4B3T C;  4OXI A;  4DR5 H;  4JI1 H;  2JMP A;  4B3M C;  4JYA H;  4DCT A;  2QVY X;  4DUZ C;  2OBV A;  4NDN A;  5AE2 A;  4DV4 H;  2P20 A;  1QM4 A;  1IBL H;  4I9G A;  1HNZ H;  1IBM H;  1T5D X;  5E7Q A;  2VQE H;  4JM1 A;  1N2F A;  3S82 A;  3R44 A;  3JAM W;  4RM2 A;  4DR3 C;  2OPL B;  4DR7 H;  2ONF A;  5KEI A;  2XR1 A;  4DR2 C;  4DR4 H;  1PA4 A;  3T1H C;  2UXD H;  2VQF H;  2D9I A;  5BR8 C;  2AYA A;  4DV7 C;  4LF4 C;  2P2Q A;  4NOZ A;  3ETC A;  4KTT A;  3EZJ A;  4L4Q A;  1FJG C;  1MDF A;  1HR0 C;  4GXR A;  4DV6 C;  1N36 C;  4BC9 A;  5DT9 A;  2WP0 C;  2ZM6 C;  1J5E H;  1XNQ H;  4LF9 C;  5H9U A;  3AF6 A;  3ETO A;  1MKY A;  2D27 A;  1QWI A;  1UKK A;  4B3T H;  1SEI A;  2CXC A;  3E7W A;  1VLA A;  3JAM D;  4GS5 A;  4LF7 C;  3N2Q A;  3LUS A;  4X62 C;  1RY2 A;  4K0K C;  5BSM A;  3KDK A;  4X64 C;  3T1Y C;  3J7A K;  4DR3 H;  2D28 C;  5BST A;  4JI2 H;  4DR2 H;  4JI7 H;  4WV3 A;  4B3R C;  3OSS D;  4BSZ A;  3G7S A;  5BR8 H;  2PT7 G;  2UXB C;  4DV7 H;  4LF4 H;  4JI8 H;  3RG2 A;  4HPV A;  4RVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...