2PT7G

Crystal structure of cag virb11 (hp0525) and an inhibitory protein (hp1451)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
145
structure length
145
Chain Sequence
KLHEIKQELKDLFSHLPYKINKVEVSLYEPGVLLIDIDGEDSALLIGEKGYRYKALSYLLFNWIHPTYGYSIRLEISTFLQNQEKVMDTQLQSVIMTVHEVGKGQMKAPDGVLTYIALKKLRKAFPNKYVSIKTNLNDEKYIVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification, structure and mode of action of a new regulator of the Helicobacter pylori HP0525 ATPase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/protein binding
molecule keywords Cag-alfa
total genus 44
structure length 145
sequence length 145
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF18472 HP1451_C HP1451 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2pt7G01
3.30.1370.180 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2pt7G02
2D7VA 4B3MC 5A2QD 2CXCA 1KKGA 3IEUA 4LFCC 2E5LC 4X66C 4B3TC 2DYJA 4DV5C 2XR1A 2OPLB 1IBKC 3JAMD 4DR6C 5LMNC 1EGAA 2UU9C 2E8EA 1UKKA 1VLAA 3R9XA 2KZFA 2UUAC 4DR1C 4DR5C 1FJGC 4DR7C 4JI7C 1XMQC 2UXDC 2ATWA 1JOSA 4DV2C 1IBMC 3OTOC 2BJOA 4JI3C 4LF9C 4NOZA 2UUBC 2CY1A 3T1HC 2E8CA 2QL8A 4GKJC 1N2FA 5FLXD 2PN2A 1WH9A 4JV5C 4JI4C 1J5EC 4DV3C 3AF6A 4YHHC 1USPB 1IBLC 4DV4C 3I07A 4X62C 4NXNC 2F4VC 2UUCC 2YCBA 3CJEA 4JI5C 5IWAC 2UXCC 4JI6C 1QWIA 5BR8C 4YY3C 2VQFC 1XNQC 1WF3A 4AQYC 1HNZC 4LFBC 4DCUA 2OPLA 1ZB8A 4X65C 1L2FA 4MH4A 1HNWC 1N36C 4MTNA 5IT9D 4DR3C 1USPA 4K0KC 3EERA 1K0RA 4JI1C 2HJGA 4NXMC 4LFAC 4LF6C 1PA4A 5LMUC 2PT7G 4GKKC 3J80D 4XX2A 1XMOC 4X64C 4DV0C 1I94C 4B3RC 4LF5C 2E7GA 2ONFA 4DV6C 4DR2C 2HHHC 2UXBC 4JI2C 2ASBA 4B3SC 1N33C 2VQEC 4BSZA 1HR0C 1MKYA 1XNRC 4LF4C 4KHPC 2ZM6C 1HH2P 4JI8C 4JI0C 4LF7C 4JYAC 3IEVA 4OX9C 3R9WA 3AF5A 4DV1C 3J81D 1LQLA 1ZB9A 4DCSA 2E8FA 4DV7C 4DUZC 4DCVA 1HNXC 4DR4C 4LF8C 3LUSA 3T1YC 1NYEA 4DUYC 2JMPA 3GKUA 4DCTA 1N32C 1ML8A 2EGTA 1N34C
chains in the Genus database with same CATH superfamily
4B3MC 5A2QW 1MD9A 1KKGA 5BR8H 2LTLA 2ANRA 2D1RA 4DV5C 3A9VA 2OPLB 4AM3A 2QVZX 1IBKC 4B3MH 1RG9A 4DR6C 5LMNC 1XMQH 1EGAA 1VLAA 4JI0H 4U5YD 2E3UA 4LF5H 4DR5H 2KZFA 2P2MA 2UUAC 4NZTM 1X0AA 4B3SH 1FJGC 4DR7C 5A19A 4JI7C 1DTJA 4D4IA 1XMQC 2Z0SA 1ZZIA 2UXDC 3TQIA 4FTFA 1X4NA 3T1YH 1MDFA 2LTMA 2FPHX 2Y4NA 3T1HC 2E8CA 4QMFB 5IFIA 4EATA 3NYQA 1WH9A 3J7AK 2VZEA 4JV5C 4L2ZA 4DV5H 3VNSA 2CTKA 2K1HA 3NCVA 4DV3C 2UXCH 1USPB 2BH1X 3N54B 1X9ZA 4I9GA 2HH3A 3C5EA 3I07A 2CTLA 3UX3A 4X62C 3FCCA 2UUCC 2YCBA 3CJEA 3CQ3A 5IWAC 4D4GA 1QWIA 4YY3C 2VQFC 2OPVA 1FKAH 1HNZC 4LFBC 4DCUA 2OPLA 3ETOA 1FLOA 4BC7A 5H9UA 5LMUH 5IT9D 2OBVA 2P2BA 2HJGA 4NXMC 1WE8A 4OYCA 3J80D 5BURA 4X64C 1XRAA 4JI2H 3OSSD 4B3RC 4DR1H 1V25A 4WV3A 2M6QA 2CTJA 4DR7H 2ASBA 4B3SC 1N33C 2VQEC 2ZQEA 1MKYA 2BL5A 4LF4C 4KHPC 2DGRA 4JI0C 4LF7C 3IEVA 4OX9C 2M8WA 3KXWA 3IMLA 3J81W 1FJGH 1N34H 4DV3H 2WP0C 3EZJA 2PY9A 4JI6H 4DV7C 3UX2A 4BA1I 2V7BA 1WHRA 1AMUA 4FUQA 4H8AA 2D1TA 2E5LH 1BA3A 2F4VH 2JMPA 1ML8A 4LFAC 1N34C 4RMNA 3E7XA 1MXAA 4LF8H 4DR4H 2D7VA 4OX9H 5A2QD 5DV9A 5T8TA 2Y3MA 1WVNA 4B3TH 4L7IA 1DT4A 1UG8A 3OTOH 4X66C 4LIJA 2XR1A 2E0GA 4NXNH 1V26A 5BSVA 1YJ7A 2E8EA 1UKKA 4OD6A 1O90A 1VEHA 1VIGA 3KDGA 3R9XA 2YWBA 4DR1C 1IBMH 4X66H 3B7WA 4DR5C 4GKKH 3TUFA 1PG4A 4GXQA 4BBYA 4R1MA 4JI3C 4LF9C 2NN6G 2DPLA 4NOZA 2UUBC 1GPMA 2CY1A 2QL8A 3UOWA 1N2FA 5KEIA 4D57A 4PUHA 3TR3A 4RLFA 3VKEA 4JI8H 1QM4A 5K85A 3PESA 3LGXA 4ISBA 4DUZH 1LCIA 1XMOH 3R44A 1J5EC 4KTVA 1PG3A 3AF6A 1IBLC 5BUQA 2HH2A 4DV6H 4DV4C 4DR2H 2HHHH 2UUCH 4TPSB 5T8SA 1O92A 4KHPH 4JI5C 2UXCC 3I0PA 3E7WA 1J5EH 3IPLA 3U1KA 4PHTA 5BSWA 2JE6I 4PUIA 4X65C 4AQYH 3OETA 4JI3H 1N36C 1MSZA 2D28C 4NDNA 1P4EC 3EERA 4DG9A 4JI1C 2D9IA 1I94H 1PA4A 5LMUC 1MXBA 1O93A 4JI7H 1M6XC 3A26A 3K6RA 4GKKC 4I9FA 1ODHA 1K1GA 1T5DX 1XRHA 3UOEA 3J80W 3LNOA 1HR0C 5IWAH 2ZM6C 2CPMA 1HH2P 4JI8C 4JM1A 1V8CA 4JYAC 4JI1H 1O9TA 3R9WA 2NCLA 1SEIA 1LQLA 1XRCA 2FFMA 1Z2IA 4NZRM 4PROC 3AEVB 4DCVA 2JNVA 5JEAG 4G36A 3QD7X 5A1GA 1VBIA 3CW9A 4L4QA 4DUYH 2CPQA 4JI4H 5E7QA 3T1YC 2EGTA 3L95X 4E9JA 5FLXW 4KTTA 4IZ6A 2P2RA 1I6UA 1IBLH 3O2EA 3L7ZC 4LFCC 2ZZMA 2D1SA 2DYJA 4B3TC 1N33H 4IR7A 5K36G 2WD9A 5C0XG 4B8TA 3NYRA 3NPDA 3JAMD 1P7LA 4B8CD 4PDBA 2P02A 2KDNA 4JV5H 2CTMA 3DHVA 3A25A 4G08A 2UXBH 4LF6H 2P2FA 4DG8A 4DR3H 4K0KH 1V60A 4DV2C 1JOSA 2PROA 3VNQA 2Y4OA 1V9NA 2BJOA 4LFCH 4WS9A 1XRBA 2Y27A 4BA2I 4GKJC 5FLXD 5BSRA 3SO4A 3AY0A 4LFBH 1F0XA 1WTJA 5LL6b 4YY3H 5BUSA 4YHHC 1NXUA 5LMNH 1J5KA 1TUAA 1P4EA 1ZZKA 3G7SA 2VKCA 4NXNC 4LFAH 2F4VC 5BSMA 3RG2A 3FCEA 4G1IA 4AQYC 2P2JA 2ZZNA 4NXMH 2CWFA 2ANNA 1EC6A 3DLPX 1ZB8A 1N36H 1L2FA 3TDEA 4MH4A 3S82A 1XNRH 4MTNA 2P2QA 3PROC 1K0RA 1ZTGA 3GPCA 4LF7H 5AE2A 4RM3A 2BA0A 4LE5A 4LF4H 1PQXA 3DAYA 4R1LA 5CZXA 4RVOA 4DV0C 1I94C 2X06A 3FAUA 3GR5A 4LF5C 4FJUA 2JA9A 2ONFA 2KZ0A 3I08A 3L8CA 5GTDA 4DV6C 4DR2C 2HHHC 4OO1G 4OXIA 5KYVA 2P20A 1ULTA 3UEBA 4BSZA 2JZXA 3KDKA 4EC5A 1XNRC 4G37A 2A1SA 2OO4A 4RVNA 3AF5A 5BSUA 3ETCA 5AE3A 3J81D 3GABA 4DCSA 2E8FA 4JI5H 4X65H 3GR0A 3GR1A 1TH5A 5K8FA 1HNXC 3UZ0A 2D27A 2DHMA 3JAMW 1HNWH 3VNRA 5KYTA 2LF0A 2VQFH 2CTEA 1RY2A 3LUSA 1MDBA 2AXYA 2MJHA 5JRHA 1NYEA 4DUYC 4R0MA 2MM9A 2CXCA 3IEUA 2OPUA 2CU6A 1MXCA 5CZVA 2JEAI 2E5LC 3A4IA 2YX1A 2QW0X 4K0BA 3RV2A 4X62H 2YWCA 4PZPA 2UU9C 2CWHA 5DT9A 2QVYX 4RM2A 4DV7H 2G8YA 2FMRA 1XHJA 1HR0H 2AYAA 2UXDH 2MCQA 2LRRA 3N2QA 4JVYA 1FUGA 4RLQA 1J4WA 2D1QA 2ZM6H 2ATWA 4DV0H 1IBMC 3NI2A 3OTOC 2M5OA 2M5HA 1X4MA 5BSTA 2CTFA 3RF2A 2PN2A 2Z51A 2MMAB 1M6XA 4IFDG 2VQEH 4JI4C 2PQUA 2VSQA 4WALA 4FJSA 1NY8A 3LAXA 4OCHA 3CW8X 1PU1A 4YHHH 4JI6C 5BR8C 4AIMA 1XNQC 1WF3A 1T5HX 4BCAA 3LNVA 3H2TA 4JYAH 1N32H 4D56A 4JVHA 1HNZH 1UWDA 2QNDA 3A9UA 2YQRA 1KHMA 1IB8A 5A1IA 1HNWC 4ZJZA 4DR3C 1USPA 4K0KC 5AE1A 4HPVA 4DV4H 3PBKA 2O4CA 4GKJH 4LF6C 4B3RH 4ODJA 4DV1H 2PT7G 4X64H 4GXRA 3CQ2A 4XX2A 1XMOC 3SB1A 4DV2H 3V69A 5LCIA 2E7GA 2UU9H 5IT9W 1WCJA 2UXBC 4GS5A 4JI2C 3T1HH 4LF9H 2QVXX 4PUGA 2JEBI 3CQ1A 4BC9A 4ZLPA 5ADZA 4NBQA 1S03G 1AN7A 2JVZA 1XS3A 4DV1C 1ZB9A 2UUAH 4WANA 4DUZC 1ZZJA 4FUTA 4DR6H 1IBKH 4DR4C 3EQ6A 2UUBH 4LF8C 1XNQH 1HNXH 1VIHA 3GKUA 4DCTA 1N32C 1S20A
chains in the Genus database with same CATH topology
4B3MC 5A2QW 1MD9A 1KKGA 5BR8H 2D1RA 4DV5C 3A9VA 2OPLB 2QVZX 1IBKC 4B3MH 1RG9A 4DR6C 5LMNC 1XMQH 1EGAA 1VLAA 4JI0H 4U5YD 4LF5H 4DR5H 2KZFA 2P2MA 2UUAC 4NZTM 4B3SH 1FJGC 4DR7C 5A19A 4JI7C 4D4IA 1XMQC 2UXDC 3TQIA 4FTFA 3T1YH 1MDFA 2FPHX 2Y4NA 3T1HC 2E8CA 5IFIA 4EATA 3NYQA 1WH9A 3J7AK 2VZEA 4JV5C 4L2ZA 4DV5H 3VNSA 3NCVA 4DV3C 2UXCH 1USPB 2BH1X 3N54B 1X9ZA 4I9GA 3C5EA 3I07A 4X62C 3FCCA 2UUCC 2YCBA 3CJEA 5IWAC 4D4GA 1QWIA 4YY3C 2VQFC 1FKAH 1HNZC 4LFBC 4DCUA 2OPLA 3ETOA 4BC7A 5H9UA 5LMUH 5IT9D 2OBVA 2P2BA 2HJGA 4NXMC 4OYCA 3J80D 5BURA 4X64C 1XRAA 4JI2H 3OSSD 4B3RC 4DR1H 1V25A 4WV3A 4DR7H 2ASBA 4B3SC 1N33C 2VQEC 2ZQEA 1MKYA 4LF4C 4KHPC 4JI0C 4LF7C 3IEVA 4OX9C 3KXWA 3IMLA 3J81W 1FJGH 1N34H 4DV3H 2WP0C 3EZJA 4JI6H 4DV7C 2V7BA 1AMUA 4FUQA 2D1TA 2E5LH 1BA3A 2F4VH 2JMPA 1ML8A 4LFAC 1N34C 4RMNA 3E7XA 1MXAA 4LF8H 4DR4H 2D7VA 4OX9H 5A2QD 5DV9A 5T8TA 2Y3MA 4B3TH 4L7IA 3OTOH 4X66C 2XR1A 2E0GA 4NXNH 1V26A 5BSVA 1YJ7A 2E8EA 1UKKA 4OD6A 1O90A 3KDGA 3R9XA 2YWBA 4DR1C 1IBMH 4X66H 3B7WA 4DR5C 4GKKH 3TUFA 1PG4A 4GXQA 4BBYA 4R1MA 4JI3C 4LF9C 2DPLA 4NOZA 2UUBC 1GPMA 2CY1A 2QL8A 3UOWA 1N2FA 5KEIA 4D57A 4RLFA 4JI8H 1QM4A 5K85A 3PESA 3LGXA 4ISBA 4DUZH 1LCIA 1XMOH 3R44A 1J5EC 4KTVA 1PG3A 3AF6A 1IBLC 5BUQA 4DV6H 4DR2H 4DV4C 2HHHH 2UUCH 4TPSB 5T8SA 1O92A 4KHPH 4JI5C 2UXCC 3E7WA 1J5EH 3IPLA 4PHTA 5BSWA 4X65C 4AQYH 3OETA 4JI3H 1N36C 2D28C 4NDNA 3EERA 4DG9A 4JI1C 2D9IA 1I94H 1PA4A 5LMUC 1MXBA 1O93A 4JI7H 4GKKC 4I9FA 1ODHA 1T5DX 3J80W 1HR0C 5IWAH 2ZM6C 1HH2P 4JI8C 4JM1A 4JI1H 4JYAC 1O9TA 3R9WA 1SEIA 1LQLA 1XRCA 4NZRM 4PROC 4DCVA 4G36A 3QD7X 5A1GA 3CW9A 4L4QA 4DUYH 4JI4H 5E7QA 3T1YC 2EGTA 3L95X 4E9JA 5FLXW 4KTTA 4IZ6A 1I6UA 1IBLH 4LFCC 2D1SA 2DYJA 1N33H 4IR7A 2WD9A 3NYRA 3NPDA 3JAMD 1P7LA 4B8CD 4PDBA 2P02A 4JV5H 3DHVA 4G08A 2UXBH 4LF6H 2P2FA 4DG8A 4DR3H 4K0KH 4DV2C 1JOSA 2PROA 3VNQA 2Y4OA 2BJOA 4LFCH 4WS9A 1XRBA 2Y27A 4GKJC 5FLXD 5BSRA 3SO4A 4LFBH 1F0XA 5LL6b 4YY3H 5BUSA 4YHHC 5LMNH 2VKCA 3G7SA 4NXNC 4LFAH 2F4VC 4DCTA 5BSMA 3RG2A 3FCEA 4G1IA 4AQYC 2P2JA 4NXMH 3DLPX 1ZB8A 1N36H 1L2FA 3TDEA 4MH4A 3S82A 1XNRH 4MTNA 2P2QA 3PROC 1K0RA 4LF7H 3GPCA 5AE2A 4RM3A 4LE5A 4LF4H 3DAYA 4R1LA 5CZXA 4RVOA 4DV0C 1I94C 3FAUA 3GR5A 4LF5C 2ONFA 3I08A 3L8CA 5GTDA 4DV6C 4DR2C 2HHHC 4OXIA 5KYVA 2P20A 1ULTA 4BSZA 3KDKA 4EC5A 1XNRC 4G37A 2OO4A 4RVNA 3AF5A 5BSUA 3ETCA 5AE3A 3J81D 3GABA 4DCSA 2E8FA 4JI5H 4X65H 3GR0A 3GR1A 5K8FA 1HNXC 3UZ0A 2D27A 3JAMW 1HNWH 3VNRA 5KYTA 2LF0A 2VQFH 1RY2A 3LUSA 1MDBA 5JRHA 1NYEA 4DUYC 4R0MA 2CXCA 3IEUA 1MXCA 5CZVA 2E5LC 3A4IA 2QW0X 4K0BA 3RV2A 4X62H 2YWCA 4PZPA 2UU9C 5DT9A 2QVYX 4RM2A 4DV7H 1HR0H 2AYAA 2UXDH 3N2QA 1FUGA 4RLQA 2D1QA 2ZM6H 2ATWA 4DV0H 1IBMC 3NI2A 3OTOC 5BSTA 3RF2A 2PN2A 2VQEH 4JI4C 2VSQA 3LAXA 4OCHA 3CW8X 4YHHH 4JI6C 5BR8C 1XNQC 1WF3A 1T5HX 4BCAA 3LNVA 3H2TA 4JYAH 1N32H 4D56A 1HNZH 3A9UA 5A1IA 1HNWC 4ZJZA 4DR3C 1USPA 4K0KC 5AE1A 4HPVA 4DV4H 3PBKA 2O4CA 4GKJH 4LF6C 4B3RH 4ODJA 4DV1H 2PT7G 4X64H 4GXRA 4XX2A 1XMOC 3SB1A 4DV2H 2E7GA 2UU9H 5IT9W 2UXBC 4GS5A 4JI2C 3T1HH 4LF9H 2QVXX 4BC9A 4ZLPA 5ADZA 1S03G 1AN7A 4DV1C 1ZB9A 2UUAH 4DUZC 4FUTA 4DR6H 1IBKH 4DR4C 3EQ6A 2UUBH 4LF8C 1XNQH 1HNXH 3GKUA 4B3TC 1N32C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7V A;  4B3M C;  5A2Q D;  2CXC A;  1KKG A;  3IEU A;  4LFC C;  2E5L C;  4X66 C;  4B3T C;  2DYJ A;  4DV5 C;  2XR1 A;  2OPL B;  1IBK C;  3JAM D;  4DR6 C;  5LMN C;  1EGA A;  2UU9 C;  2E8E A;  1UKK A;  1VLA A;  3R9X A;  2KZF A;  2UUA C;  4DR1 C;  4DR5 C;  1FJG C;  4DR7 C;  4JI7 C;  1XMQ C;  2UXD C;  2ATW A;  1JOS A;  4DV2 C;  1IBM C;  3OTO C;  2BJO A;  4JI3 C;  4LF9 C;  4NOZ A;  2UUB C;  2CY1 A;  3T1H C;  2E8C A;  2QL8 A;  4GKJ C;  1N2F A;  5FLX D;  2PN2 A;  1WH9 A;  4JV5 C;  4JI4 C;  1J5E C;  4DV3 C;  3AF6 A;  4YHH C;  1USP B;  1IBL C;  4DV4 C;  3I07 A;  4X62 C;  4NXN C;  2F4V C;  2UUC C;  2YCB A;  3CJE A;  4JI5 C;  5IWA C;  2UXC C;  4JI6 C;  1QWI A;  5BR8 C;  4YY3 C;  2VQF C;  1XNQ C;  1WF3 A;  4AQY C;  1HNZ C;  4LFB C;  4DCU A;  2OPL A;  1ZB8 A;  4X65 C;  1L2F A;  4MH4 A;  1HNW C;  1N36 C;  4MTN A;  5IT9 D;  4DR3 C;  1USP A;  4K0K C;  3EER A;  1K0R A;  4JI1 C;  2HJG A;  4NXM C;  4LFA C;  4LF6 C;  1PA4 A;  5LMU C;  2PT7 G;  4GKK C;  3J80 D;  4XX2 A;  1XMO C;  4X64 C;  4DV0 C;  1I94 C;  4B3R C;  4LF5 C;  2E7G A;  2ONF A;  4DV6 C;  4DR2 C;  2HHH C;  2UXB C;  4JI2 C;  2ASB A;  4B3S C;  1N33 C;  2VQE C;  4BSZ A;  1HR0 C;  1MKY A;  1XNR C;  4LF4 C;  4KHP C;  2ZM6 C;  1HH2 P;  4JI8 C;  4JI0 C;  4LF7 C;  4JYA C;  3IEV A;  4OX9 C;  3R9W A;  3AF5 A;  4DV1 C;  3J81 D;  1LQL A;  1ZB9 A;  4DCS A;  2E8F A;  4DV7 C;  4DUZ C;  4DCV A;  1HNX C;  4DR4 C;  4LF8 C;  3LUS A;  3T1Y C;  1NYE A;  4DUY C;  2JMP A;  3GKU A;  4DCT A;  1N32 C;  1ML8 A;  2EGT A;  1N34 C; 
#chains in the Genus database with same CATH topology
 4B3M C;  5A2Q W;  1MD9 A;  1KKG A;  5BR8 H;  2LTL A;  2ANR A;  2D1R A;  4DV5 C;  3A9V A;  2OPL B;  4AM3 A;  2QVZ X;  1IBK C;  4B3M H;  1RG9 A;  4DR6 C;  5LMN C;  1XMQ H;  1EGA A;  1VLA A;  4JI0 H;  4U5Y D;  2E3U A;  4LF5 H;  4DR5 H;  2KZF A;  2P2M A;  2UUA C;  4NZT M;  1X0A A;  4B3S H;  1FJG C;  4DR7 C;  5A19 A;  4JI7 C;  1DTJ A;  4D4I A;  1XMQ C;  2Z0S A;  1ZZI A;  2UXD C;  3TQI A;  4FTF A;  1X4N A;  3T1Y H;  1MDF A;  2LTM A;  2FPH X;  2Y4N A;  3T1H C;  2E8C A;  4QMF B;  5IFI A;  4EAT A;  3NYQ A;  1WH9 A;  3J7A K;  2VZE A;  4JV5 C;  4L2Z A;  4DV5 H;  3VNS A;  2CTK A;  2K1H A;  3NCV A;  4DV3 C;  2UXC H;  1USP B;  2BH1 X;  3N54 B;  1X9Z A;  4I9G A;  2HH3 A;  3C5E A;  3I07 A;  2CTL A;  3UX3 A;  4X62 C;  3FCC A;  2UUC C;  2YCB A;  3CJE A;  3CQ3 A;  5IWA C;  4D4G A;  1QWI A;  4YY3 C;  2VQF C;  2OPV A;  1FKA H;  1HNZ C;  4LFB C;  4DCU A;  2OPL A;  3ETO A;  1FLO A;  4BC7 A;  5H9U A;  5LMU H;  5IT9 D;  2OBV A;  2P2B A;  2HJG A;  4NXM C;  1WE8 A;  4OYC A;  3J80 D;  5BUR A;  4X64 C;  1XRA A;  4JI2 H;  3OSS D;  4B3R C;  4DR1 H;  1V25 A;  4WV3 A;  2M6Q A;  2CTJ A;  4DR7 H;  2ASB A;  4B3S C;  1N33 C;  2VQE C;  2ZQE A;  1MKY A;  2BL5 A;  4LF4 C;  4KHP C;  2DGR A;  4JI0 C;  4LF7 C;  3IEV A;  4OX9 C;  2M8W A;  3KXW A;  3IML A;  3J81 W;  1FJG H;  1N34 H;  4DV3 H;  2WP0 C;  3EZJ A;  2PY9 A;  4JI6 H;  4DV7 C;  3UX2 A;  4BA1 I;  2V7B A;  1WHR A;  1AMU A;  4FUQ A;  4H8A A;  2D1T A;  2E5L H;  1BA3 A;  2F4V H;  2JMP A;  1ML8 A;  4LFA C;  1N34 C;  4RMN A;  3E7X A;  1MXA A;  4LF8 H;  4DR4 H;  2D7V A;  4OX9 H;  5A2Q D;  5DV9 A;  5T8T A;  2Y3M A;  1WVN A;  4B3T H;  4L7I A;  1DT4 A;  1UG8 A;  3OTO H;  4X66 C;  4LIJ A;  2XR1 A;  2E0G A;  4NXN H;  1V26 A;  5BSV A;  1YJ7 A;  2E8E A;  1UKK A;  4OD6 A;  1O90 A;  1VEH A;  1VIG A;  3KDG A;  3R9X A;  2YWB A;  4DR1 C;  1IBM H;  4X66 H;  3B7W A;  4DR5 C;  4GKK H;  3TUF A;  1PG4 A;  4GXQ A;  4BBY A;  4R1M A;  4JI3 C;  4LF9 C;  2NN6 G;  2DPL A;  4NOZ A;  2UUB C;  1GPM A;  2CY1 A;  2QL8 A;  3UOW A;  1N2F A;  5KEI A;  4D57 A;  4PUH A;  3TR3 A;  4RLF A;  3VKE A;  4JI8 H;  1QM4 A;  5K85 A;  3PES A;  3LGX A;  4ISB A;  4DUZ H;  1LCI A;  1XMO H;  3R44 A;  1J5E C;  4KTV A;  1PG3 A;  3AF6 A;  1IBL C;  5BUQ A;  2HH2 A;  4DV6 H;  4DV4 C;  4DR2 H;  2HHH H;  2UUC H;  4TPS B;  5T8S A;  1O92 A;  4KHP H;  4JI5 C;  2UXC C;  3I0P A;  3E7W A;  1J5E H;  3IPL A;  3U1K A;  4PHT A;  5BSW A;  2JE6 I;  4PUI A;  4X65 C;  4AQY H;  3OET A;  4JI3 H;  1N36 C;  1MSZ A;  2D28 C;  4NDN A;  1P4E C;  3EER A;  4DG9 A;  4JI1 C;  2D9I A;  1I94 H;  1PA4 A;  5LMU C;  1MXB A;  1O93 A;  4JI7 H;  1M6X C;  3A26 A;  3K6R A;  4GKK C;  4I9F A;  1ODH A;  1K1G A;  1T5D X;  1XRH A;  3UOE A;  3J80 W;  3LNO A;  1HR0 C;  5IWA H;  2ZM6 C;  2CPM A;  1HH2 P;  4JI8 C;  4JM1 A;  1V8C A;  4JYA C;  4JI1 H;  1O9T A;  3R9W A;  2NCL A;  1SEI A;  1LQL A;  1XRC A;  2FFM A;  1Z2I A;  4NZR M;  4PRO C;  3AEV B;  4DCV A;  2JNV A;  5JEA G;  4G36 A;  3QD7 X;  5A1G A;  1VBI A;  3CW9 A;  4L4Q A;  4DUY H;  2CPQ A;  4JI4 H;  5E7Q A;  3T1Y C;  2EGT A;  3L95 X;  4E9J A;  5FLX W;  4KTT A;  4IZ6 A;  2P2R A;  1I6U A;  1IBL H;  3O2E A;  3L7Z C;  4LFC C;  2ZZM A;  2D1S A;  2DYJ A;  4B3T C;  1N33 H;  4IR7 A;  5K36 G;  2WD9 A;  5C0X G;  4B8T A;  3NYR A;  3NPD A;  3JAM D;  1P7L A;  4B8C D;  4PDB A;  2P02 A;  2KDN A;  4JV5 H;  2CTM A;  3DHV A;  3A25 A;  4G08 A;  2UXB H;  4LF6 H;  2P2F A;  4DG8 A;  4DR3 H;  4K0K H;  1V60 A;  4DV2 C;  1JOS A;  2PRO A;  3VNQ A;  2Y4O A;  1V9N A;  2BJO A;  4LFC H;  4WS9 A;  1XRB A;  2Y27 A;  4BA2 I;  4GKJ C;  5FLX D;  5BSR A;  3SO4 A;  3AY0 A;  4LFB H;  1F0X A;  1WTJ A;  5LL6 b;  4YY3 H;  5BUS A;  4YHH C;  1NXU A;  5LMN H;  1J5K A;  1TUA A;  1P4E A;  1ZZK A;  3G7S A;  2VKC A;  4NXN C;  4LFA H;  2F4V C;  5BSM A;  3RG2 A;  3FCE A;  4G1I A;  4AQY C;  2P2J A;  2ZZN A;  4NXM H;  2CWF A;  2ANN A;  1EC6 A;  3DLP X;  1ZB8 A;  1N36 H;  1L2F A;  3TDE A;  4MH4 A;  3S82 A;  1XNR H;  4MTN A;  2P2Q A;  3PRO C;  1K0R A;  1ZTG A;  3GPC A;  4LF7 H;  5AE2 A;  4RM3 A;  2BA0 A;  4LE5 A;  4LF4 H;  1PQX A;  3DAY A;  4R1L A;  5CZX A;  4RVO A;  4DV0 C;  1I94 C;  2X06 A;  3FAU A;  3GR5 A;  4LF5 C;  4FJU A;  2JA9 A;  2ONF A;  2KZ0 A;  3I08 A;  3L8C A;  5GTD A;  4DV6 C;  4DR2 C;  2HHH C;  4OO1 G;  4OXI A;  5KYV A;  2P20 A;  1ULT A;  3UEB A;  4BSZ A;  2JZX A;  3KDK A;  4EC5 A;  1XNR C;  4G37 A;  2A1S A;  2OO4 A;  4RVN A;  3AF5 A;  5BSU A;  3ETC A;  5AE3 A;  3J81 D;  3GAB A;  4DCS A;  2E8F A;  4JI5 H;  4X65 H;  3GR0 A;  3GR1 A;  1TH5 A;  5K8F A;  1HNX C;  3UZ0 A;  2D27 A;  2DHM A;  3JAM W;  1HNW H;  3VNR A;  5KYT A;  2LF0 A;  2VQF H;  2CTE A;  1RY2 A;  3LUS A;  1MDB A;  2AXY A;  2MJH A;  5JRH A;  1NYE A;  4DUY C;  4R0M A;  2MM9 A;  2CXC A;  3IEU A;  2OPU A;  2CU6 A;  1MXC A;  5CZV A;  2JEA I;  2E5L C;  3A4I A;  2YX1 A;  2QW0 X;  4K0B A;  3RV2 A;  4X62 H;  2YWC A;  4PZP A;  2UU9 C;  2CWH A;  5DT9 A;  2QVY X;  4RM2 A;  4DV7 H;  2G8Y A;  2FMR A;  1XHJ A;  1HR0 H;  2AYA A;  2UXD H;  2MCQ A;  2LRR A;  3N2Q A;  4JVY A;  1FUG A;  4RLQ A;  1J4W A;  2D1Q A;  2ZM6 H;  2ATW A;  4DV0 H;  1IBM C;  3NI2 A;  3OTO C;  2M5O A;  2M5H A;  1X4M A;  5BST A;  2CTF A;  3RF2 A;  2PN2 A;  2Z51 A;  2MMA B;  1M6X A;  4IFD G;  2VQE H;  4JI4 C;  2PQU A;  2VSQ A;  4WAL A;  4FJS A;  1NY8 A;  3LAX A;  4OCH A;  3CW8 X;  1PU1 A;  4YHH H;  4JI6 C;  5BR8 C;  4AIM A;  1XNQ C;  1WF3 A;  1T5H X;  4BCA A;  3LNV A;  3H2T A;  4JYA H;  1N32 H;  4D56 A;  4JVH A;  1HNZ H;  1UWD A;  2QND A;  3A9U A;  2YQR A;  1KHM A;  1IB8 A;  5A1I A;  1HNW C;  4ZJZ A;  4DR3 C;  1USP A;  4K0K C;  5AE1 A;  4HPV A;  4DV4 H;  3PBK A;  2O4C A;  4GKJ H;  4LF6 C;  4B3R H;  4ODJ A;  4DV1 H;  2PT7 G;  4X64 H;  4GXR A;  3CQ2 A;  4XX2 A;  1XMO C;  3SB1 A;  4DV2 H;  3V69 A;  5LCI A;  2E7G A;  2UU9 H;  5IT9 W;  1WCJ A;  2UXB C;  4GS5 A;  4JI2 C;  3T1H H;  4LF9 H;  2QVX X;  4PUG A;  2JEB I;  3CQ1 A;  4BC9 A;  4ZLP A;  5ADZ A;  4NBQ A;  1S03 G;  1AN7 A;  2JVZ A;  1XS3 A;  4DV1 C;  1ZB9 A;  2UUA H;  4WAN A;  4DUZ C;  1ZZJ A;  4FUT A;  4DR6 H;  1IBK H;  4DR4 C;  3EQ6 A;  2UUB H;  4LF8 C;  1XNQ H;  1HNX H;  1VIH A;  3GKU A;  4DCT A;  1N32 C;  1S20 A; 
#chains in the Genus database with same CATH homology
 4B3M C;  5A2Q W;  1MD9 A;  1KKG A;  5BR8 H;  2D1R A;  4DV5 C;  3A9V A;  2OPL B;  2QVZ X;  1IBK C;  4B3M H;  1RG9 A;  4DR6 C;  5LMN C;  1XMQ H;  1EGA A;  1VLA A;  4JI0 H;  4U5Y D;  4LF5 H;  4DR5 H;  2KZF A;  2P2M A;  2UUA C;  4NZT M;  4B3S H;  1FJG C;  4DR7 C;  5A19 A;  4JI7 C;  4D4I A;  1XMQ C;  2UXD C;  3TQI A;  4FTF A;  3T1Y H;  1MDF A;  2FPH X;  2Y4N A;  3T1H C;  2E8C A;  5IFI A;  4EAT A;  3NYQ A;  1WH9 A;  3J7A K;  2VZE A;  4JV5 C;  4L2Z A;  4DV5 H;  3VNS A;  3NCV A;  4DV3 C;  2UXC H;  1USP B;  2BH1 X;  3N54 B;  1X9Z A;  4I9G A;  3C5E A;  3I07 A;  4X62 C;  3FCC A;  2UUC C;  2YCB A;  3CJE A;  5IWA C;  4D4G A;  1QWI A;  4YY3 C;  2VQF C;  1FKA H;  1HNZ C;  4LFB C;  4DCU A;  2OPL A;  3ETO A;  4BC7 A;  5H9U A;  5LMU H;  5IT9 D;  2OBV A;  2P2B A;  2HJG A;  4NXM C;  4OYC A;  3J80 D;  5BUR A;  4X64 C;  1XRA A;  4JI2 H;  3OSS D;  4B3R C;  4DR1 H;  1V25 A;  4WV3 A;  4DR7 H;  2ASB A;  4B3S C;  1N33 C;  2VQE C;  2ZQE A;  1MKY A;  4LF4 C;  4KHP C;  4JI0 C;  4LF7 C;  3IEV A;  4OX9 C;  3KXW A;  3IML A;  3J81 W;  1FJG H;  1N34 H;  4DV3 H;  2WP0 C;  3EZJ A;  4JI6 H;  4DV7 C;  2V7B A;  1AMU A;  4FUQ A;  2D1T A;  2E5L H;  1BA3 A;  2F4V H;  2JMP A;  1ML8 A;  4LFA C;  1N34 C;  4RMN A;  3E7X A;  1MXA A;  4LF8 H;  4DR4 H;  2D7V A;  4OX9 H;  5A2Q D;  5DV9 A;  5T8T A;  2Y3M A;  4B3T H;  4L7I A;  3OTO H;  4X66 C;  2XR1 A;  2E0G A;  4NXN H;  1V26 A;  5BSV A;  1YJ7 A;  2E8E A;  1UKK A;  4OD6 A;  1O90 A;  3KDG A;  3R9X A;  2YWB A;  4DR1 C;  1IBM H;  4X66 H;  3B7W A;  4DR5 C;  4GKK H;  3TUF A;  1PG4 A;  4GXQ A;  4BBY A;  4R1M A;  4JI3 C;  4LF9 C;  2DPL A;  4NOZ A;  2UUB C;  1GPM A;  2CY1 A;  2QL8 A;  3UOW A;  1N2F A;  5KEI A;  4D57 A;  4RLF A;  4JI8 H;  1QM4 A;  5K85 A;  3PES A;  3LGX A;  4ISB A;  4DUZ H;  1LCI A;  1XMO H;  3R44 A;  1J5E C;  4KTV A;  1PG3 A;  3AF6 A;  1IBL C;  5BUQ A;  4DV6 H;  4DR2 H;  4DV4 C;  2HHH H;  2UUC H;  4TPS B;  5T8S A;  1O92 A;  4KHP H;  4JI5 C;  2UXC C;  3E7W A;  1J5E H;  3IPL A;  4PHT A;  5BSW A;  4X65 C;  4AQY H;  3OET A;  4JI3 H;  1N36 C;  2D28 C;  4NDN A;  3EER A;  4DG9 A;  4JI1 C;  2D9I A;  1I94 H;  1PA4 A;  5LMU C;  1MXB A;  1O93 A;  4JI7 H;  4GKK C;  4I9F A;  1ODH A;  1T5D X;  3J80 W;  1HR0 C;  5IWA H;  2ZM6 C;  1HH2 P;  4JI8 C;  4JM1 A;  4JI1 H;  4JYA C;  1O9T A;  3R9W A;  1SEI A;  1LQL A;  1XRC A;  4NZR M;  4PRO C;  4DCV A;  4G36 A;  3QD7 X;  5A1G A;  3CW9 A;  4L4Q A;  4DUY H;  4JI4 H;  5E7Q A;  3T1Y C;  2EGT A;  3L95 X;  4E9J A;  5FLX W;  4KTT A;  4IZ6 A;  1I6U A;  1IBL H;  4LFC C;  2D1S A;  2DYJ A;  1N33 H;  4IR7 A;  2WD9 A;  3NYR A;  3NPD A;  3JAM D;  1P7L A;  4B8C D;  4PDB A;  2P02 A;  4JV5 H;  3DHV A;  4G08 A;  2UXB H;  4LF6 H;  2P2F A;  4DG8 A;  4DR3 H;  4K0K H;  4DV2 C;  1JOS A;  2PRO A;  3VNQ A;  2Y4O A;  2BJO A;  4LFC H;  4WS9 A;  1XRB A;  2Y27 A;  4GKJ C;  5FLX D;  5BSR A;  3SO4 A;  4LFB H;  1F0X A;  5LL6 b;  4YY3 H;  5BUS A;  4YHH C;  5LMN H;  2VKC A;  3G7S A;  4NXN C;  4LFA H;  2F4V C;  4DCT A;  5BSM A;  3RG2 A;  3FCE A;  4G1I A;  4AQY C;  2P2J A;  4NXM H;  3DLP X;  1ZB8 A;  1N36 H;  1L2F A;  3TDE A;  4MH4 A;  3S82 A;  1XNR H;  4MTN A;  2P2Q A;  3PRO C;  1K0R A;  4LF7 H;  3GPC A;  5AE2 A;  4RM3 A;  4LE5 A;  4LF4 H;  3DAY A;  4R1L A;  5CZX A;  4RVO A;  4DV0 C;  1I94 C;  3FAU A;  3GR5 A;  4LF5 C;  2ONF A;  3I08 A;  3L8C A;  5GTD A;  4DV6 C;  4DR2 C;  2HHH C;  4OXI A;  5KYV A;  2P20 A;  1ULT A;  4BSZ A;  3KDK A;  4EC5 A;  1XNR C;  4G37 A;  2OO4 A;  4RVN A;  3AF5 A;  5BSU A;  3ETC A;  5AE3 A;  3J81 D;  3GAB A;  4DCS A;  2E8F A;  4JI5 H;  4X65 H;  3GR0 A;  3GR1 A;  5K8F A;  1HNX C;  3UZ0 A;  2D27 A;  3JAM W;  1HNW H;  3VNR A;  5KYT A;  2LF0 A;  2VQF H;  1RY2 A;  3LUS A;  1MDB A;  5JRH A;  1NYE A;  4DUY C;  4R0M A;  2CXC A;  3IEU A;  1MXC A;  5CZV A;  2E5L C;  3A4I A;  2QW0 X;  4K0B A;  3RV2 A;  4X62 H;  2YWC A;  4PZP A;  2UU9 C;  5DT9 A;  2QVY X;  4RM2 A;  4DV7 H;  1HR0 H;  2AYA A;  2UXD H;  3N2Q A;  1FUG A;  4RLQ A;  2D1Q A;  2ZM6 H;  2ATW A;  4DV0 H;  1IBM C;  3NI2 A;  3OTO C;  5BST A;  3RF2 A;  2PN2 A;  2VQE H;  4JI4 C;  2VSQ A;  3LAX A;  4OCH A;  3CW8 X;  4YHH H;  4JI6 C;  5BR8 C;  1XNQ C;  1WF3 A;  1T5H X;  4BCA A;  3LNV A;  3H2T A;  4JYA H;  1N32 H;  4D56 A;  1HNZ H;  3A9U A;  5A1I A;  1HNW C;  4ZJZ A;  4DR3 C;  1USP A;  4K0K C;  5AE1 A;  4HPV A;  4DV4 H;  3PBK A;  2O4C A;  4GKJ H;  4LF6 C;  4B3R H;  4ODJ A;  4DV1 H;  2PT7 G;  4X64 H;  4GXR A;  4XX2 A;  1XMO C;  3SB1 A;  4DV2 H;  2E7G A;  2UU9 H;  5IT9 W;  2UXB C;  4GS5 A;  4JI2 C;  3T1H H;  4LF9 H;  2QVX X;  4BC9 A;  4ZLP A;  5ADZ A;  1S03 G;  1AN7 A;  4DV1 C;  1ZB9 A;  2UUA H;  4DUZ C;  4FUT A;  4DR6 H;  1IBK H;  4DR4 C;  3EQ6 A;  2UUB H;  4LF8 C;  1XNQ H;  1HNX H;  3GKU A;  4B3T C;  1N32 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...