2PT7G

Crystal structure of cag virb11 (hp0525) and an inhibitory protein (hp1451)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
145
structure length
145
Chain Sequence
KLHEIKQELKDLFSHLPYKINKVEVSLYEPGVLLIDIDGEDSALLIGEKGYRYKALSYLLFNWIHPTYGYSIRLEISTFLQNQEKVMDTQLQSVIMTVHEVGKGQMKAPDGVLTYIALKKLRKAFPNKYVSIKTNLNDEKYIVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords Cag-alfa
publication title Identification, structure and mode of action of a new regulator of the Helicobacter pylori HP0525 ATPase.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 44
structure length 145
sequence length 145
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF18472 HP1451_C HP1451 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2pt7G01
3.30.1370.180 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2pt7G02
4X62C 4LF4C 2UXBC 1KKGA 4JI8C 1L2FA 2E5LC 2UUBC 3R9WA 1ZB9A 4LFAC 4JI4C 4DR4C 1NYEA 3LUSA 2CXCA 1N36C 4DV7C 4JI2C 1HR0C 4MTNA 5LMUC 2VQFC 2QL8A 4DR7C 4JI1C 2YCBA 4NXMC 1HNXC 1IBKC 4YHHC 4X66C 2CY1A 2UUAC 2PN2A 2D7VA 1MKYA 3T1YC 3OTOC 2E8CA 4DR5C 2UU9C 2DYJA 2OPLA 2OPLB 4DV3C 3EERA 1XNQC 1WF3A 1N2FA 4B3RC 1IBMC 4B3TC 1UKKA 4OX9C 4JI6C 2UUCC 2KZFA 4JI5C 4GKKC 4LF8C 1USPA 4DV4C 2E8FA 3GKUA 1USPB 4DR3C 4MH4A 4LFBC 2E7GA 2F4VC 4LF7C 4X65C 1JOSA 4DUYC 4DR6C 4JI3C 4AQYC 4DUZC 4LFCC 4JI7C 4DR2C 3AF6A 1ZB8A 1K0RA 3I07A 3IEUA 1HNZC 2HHHC 3IEVA 3R9XA 4GKJC 2HJGA 5LMNC 2BJOA 4LF5C 4JV5C 1FJGC 4LF6C 5A2QD 1XMOC 1I94C 4DCTA 2ATWA 3J80D 5BR8C 1PA4A 2E8EA 5IT9D 4DCSA 3T1HC 2UXCC 4DV5C 3CJEA 2UXDC 4DCVA 1LQLA 4B3SC 4DR1C 1N33C 1XMQC 4B3MC 2EGTA 4DV2C 3AF5A 1J5EC 1VLAA 1N34C 1WH9A 2VQEC 4DCUA 4XX2A 4DV0C 3J81D 4BSZA 2ASBA 1QWIA 2XR1A 5FLXD 2ONFA 4LF9C 4JYAC 4DV1C 4NXNC 1N32C 4JI0C 3JAMD 4NOZA 4YY3C 1EGAA 1HH2P 4K0KC 2JMPA 2ZM6C 2PT7G 1XNRC 1IBLC 4KHPC 1HNWC 1ML8A 4DV6C 4X64C 5IWAC
chains in the Genus database with same CATH superfamily
4NXNH 1VIHA 2UXBC 1RG9A 1L2FA 3KXWA 4YY3H 4BA1I 3LGXA 5JEAG 2OPVA 1ZZIA 4PZPA 4JI4C 4DR4C 2UXCH 1N36C 1DTJA 3L95X 3LAXA 3E7WA 4B3MH 2BH1X 1NXUA 2CTFA 2D28C 3TQIA 1XRAA 2PN2A 1WVNA 2CTEA 4PUIA 1EC6A 2QW0X 1PQXA 4GS5A 1J5KA 1WHRA 2JVZA 2D1SA 4NDNA 3EQ6A 1AN7A 2A1SA 1VBIA 3A25A 1MDFA 1NY8A 1IB8A 1WF3A 2FMRA 3A4IA 1N2FA 4YHHH 4OX9C 3TUFA 1MSZA 4DR3H 2UUCC 2KZFA 2CWFA 2Z0SA 1USPA 4DV4C 2UXBH 5K85A 3GKUA 4MH4A 1TUAA 2K1HA 2F4VC 4PUGA 3ETCA 5BUSA 2P02A 3LNVA 3UOWA 4RM3A 4LFCC 4DR4H 5A1GA 1ZB8A 1K0RA 3I07A 3PROC 1N36H 1HNZC 4GKKH 4WS9A 2HHHC 2HJGA 2JA9A 4IR7A 1O93A 3VNSA 2OBVA 4WANA 1MXCA 1FUGA 3A9UA 2QVYX 4BBYA 1UWDA 3IPLA 1XRBA 2FPHX 5BR8C 2HH3A 2E8EA 4DG9A 2P2MA 4HPVA 3RG2A 4DCVA 1LQLA 5AE3A 3CQ3A 3AEVB 3UZ0A 1DT4A 4LIJA 5A2QW 4PUHA 5BURA 1XMQC 4OX9H 2MJHA 2UUCH 1VLAA 1MXBA 1WH9A 2D27A 4DV4H 4RMNA 2QVXX 1QWIA 2ONFA 5AE1A 3N2QA 4LF9C 2F4VH 4NXNC 2P2RA 3J7AK 4LFCH 1N33H 2VZEA 4YY3C 5T8SA 2Z51A 1HNZH 1V8CA 1HH2P 2HHHH 4DV0H 2M5OA 1XS3A 4FUTA 4OXIA 4PHTA 4ISBA 4D56A 1WCJA 2AYAA 4X64C 4NBQA 2ANNA 4DV1H 4OO1G 1N32H 1KKGA 4JI8C 2AXYA 2P2JA 4G36A 1S03G 3JAMW 3FCEA 4EATA 2UUBC 5BR8H 2M8WA 5BSMA 1AMUA 3R9WA 4TPSB 4FJSA 4LFAC 3UX2A 4LE5A 1YJ7A 1NYEA 4BCAA 3LUSA 5JRHA 4WV3A 2M6QA 3PBKA 4MTNA 2VQFC 1XMQH 4AIMA 2YCBA 4NXMC 4NZTM 1IBKC 2CTLA 4K0BA 4YHHC 3QD7X 4X66C 3I08A 4FUQA 1MXAA 4LF9H 3OTOC 4DR5C 2Y4OA 1LCIA 3CQ1A 2VSQA 2OPLB 1ZTGA 3EERA 4OCHA 4JI1H 2CTJA 3UOEA 5ADZA 4JI6C 4X64H 4GKKC 1XRHA 3SB1A 2CU6A 3N54B 2YQRA 3GPCA 4JI8H 5CZXA 2M5HA 2UUBH 4X65C 3S82A 1X0AA 4DR6C 4LFAH 4JI7C 2Y3MA 5A19A 2YWCA 2BA0A 1I6UA 2D9IA 4R0MA 5BSWA 2VQFH 1O90A 4JVHA 5A2QD 2CPQA 2KDNA 2MCQA 3NYQA 4NXMH 4DCTA 1IBKH 3RV2A 2WD9A 2X06A 4X66H 4DUZH 2Y4NA 3DAYA 3FCCA 4GXRA 4D57A 3UX3A 3VNRA 3OTOH 4DR5H 4GXQA 1PA4A 4E9JA 4IFDG 4ZJZA 2JNVA 4JV5H 3KDGA 4DV5C 3CJEA 2UXDC 3FAUA 4B8TA 3TR3A 4DR1C 1I94H 5A1IA 2MM9A 3J81W 1N33C 2EGTA 4JI6H 4DV2C 4EC5A 4DV0C 1WE8A 4DG8A 4G37A 1Z2IA 4BSZA 3I0PA 3T1HH 4JYAC 2XR1A 5IT9W 3CQ2A 2DGRA 4DV1C 4B3SH 1N32C 4X65H 3JAMD 4DR6H 2CPMA 4JI7H 1EGAA 2ZM6C 2PT7G 1IBLC 1HNWC 3K6RA 4DV6C 1M6XC 1J4WA 4LF4C 2P20A 1VIGA 4KTTA 2OPUA 4JVYA 2O4CA 4R1MA 1BA3A 1T5HX 4ZLPA 2D1QA 1ZB9A 4B8CD 5BSTA 4R1LA 4DV5H 4I9FA 2UXDH 2LTMA 2CXCA 4DR1H 4DV7C 4JI2C 4WALA 2PQUA 2PY9A 3LNOA 3DHVA 2QL8A 3GR1A 2BL5A 4G1IA 4DR7C 1X4MA 4DV2H 4JI1C 1HNXC 2CY1A 2UUAC 1PG4A 4RLFA 1S20A 1MKYA 4JYAH 2WP0C 1P4EC 2E8CA 2OPLA 1K1GA 3NPDA 3AY0A 4AM3A 4JM1A 3PESA 3TDEA 4B3RC 4I9GA 5DV9A 2ZM6H 4B3TC 3NI2A 1UKKA 5K8FA 1IBLH 4H8AA 1HNWH 4DV6H 3OETA 3C5EA 4LF4H 5BSVA 4BC9A 4PROC 5BSRA 3UEBA 4DUYC 1JOSA 2YWBA 3H2TA 2JZXA 4L4QA 5IFIA 1XNQH 3GR5A 4JI3C 4AQYC 4DUZC 2P2BA 4DR2C 2ANRA 3A9VA 1GPMA 1XHJA 2YX1A 3B7WA 4DV7H 3IEVA 2NCLA 3R9XA 4JI2H 4LF5C 4JV5C 1FJGC 1RY2A 4LF6C 3ETOA 4BA2I 4DR7H 1I94C 4RM2A 2ZZNA 4RVNA 1HNXH 2ATWA 2JE6I 4RVOA 2UUAH 2ZQEA 2E0GA 4OYCA 5E7QA 5IT9D 3T1HC 2CWHA 4B3SC 2P2QA 2KZ0A 4IZ6A 4B3RH 1MDBA 4OD6A 4B3TH 1QM4A 3AF5A 3G7SA 1J5EC 3J80W 1FLOA 5GTDA 2ASBA 1ULTA 3L8CA 4FTFA 2QVZX 1XRCA 4JI0C 4DUYH 1ZZJA 3R44A 3GABA 4NOZA 4AQYH 4JI3H 2D1RA 4DR2H 1WTJA 3EZJA 5KYVA 4K0KC 1N34H 2VQEH 4ODJA 4LF5H 2JMPA 3VKEA 1FJGH 1MD9A 1XNRC 4LF6H 4KTVA 3V69A 5IWAC 4X62C 5FLXW 2QNDA 2E5LC 3NYRA 2HH2A 2P2FA 5KEIA 3CW9A 2CTKA 1KHMA 4KHPH 1F0XA 2MMAB 2DPLA 1PU1A 1HR0C 5CZVA 3CW8X 5LMUC 1M6XA 4NZRM 4D4IA 1V25A 3E7XA 1J5EH 4L7IA 2E3UA 4U5YD 5AE2A 4JI4H 2D7VA 4D4GA 3T1YC 1ZZKA 3NCVA 4JI0H 2UU9C 2DYJA 4L2ZA 4DV3C 1XNQC 4K0KH 1VEHA 5BUQA 1IBMC 2LTLA 1XNRH 4JI5C 3KDKA 4LF8C 3IMLA 5IWAH 1ODHA 5LCIA 2E8FA 5KYTA 1P7LA 4X62H 2FFMA 1USPB 1XMOH 1T5DX 1P4EA 2Y27A 4LFBC 2E7GA 2LRRA 2E5LH 4LF7C 1V60A 5DT9A 1FKAH 2V7BA 3AF6A 3IEUA 2NN6G 4GKJC 4PDBA 1HR0H 5LMNC 2BJOA 5LMUH 5T8TA 1XMOC 3GR0A 4FJUA 2OO4A 1TH5A 4QMFB 5H9UA 3J80D 3U1KA 5C0XG 3T1YH 3DLPX 1X9ZA 2UU9H 1SEIA 4DCSA 2JEBI 2PROA 2VKCA 2UXCC 2CTMA 4DV3H 3VNQA 2D1TA 3OSSD 2JEAI 1IBMH 2DHMA 3SO4A 5K36G 4B3MC 1O92A 1V9NA 1O9TA 3O2EA 3L7ZC 4JI5H 4LF8H 1N34C 2VQEC 4DCUA 4XX2A 1UG8A 1X4NA 3A26A 5LL6b 3J81D 4LFBH 5FLXD 2G8YA 4BC7A 4LF7H 2LF0A 1PG3A 3RF2A 1V26A 5BSUA 4GKJH 4G08A 5LMNH 4KHPC 1ML8A 2ZZMA 4DR3C 4RLQA
chains in the Genus database with same CATH topology
4NXNH 2UXBC 1RG9A 1L2FA 3KXWA 4YY3H 3LGXA 4PZPA 4JI4C 4DR4C 2UXCH 1N36C 3L95X 3LAXA 3E7WA 4B3MH 2BH1X 2D28C 3TQIA 1XRAA 2PN2A 2QW0X 4GS5A 2D1SA 4NDNA 3EQ6A 1AN7A 1MDFA 1WF3A 3A4IA 1N2FA 4YHHH 4OX9C 3TUFA 4DR3H 2UUCC 2KZFA 1USPA 4DV4C 2UXBH 5K85A 3GKUA 4MH4A 2F4VC 3ETCA 5BUSA 2P02A 3LNVA 3UOWA 4RM3A 4LFCC 4DR4H 5A1GA 1ZB8A 1K0RA 3I07A 3PROC 1N36H 1HNZC 4GKKH 4WS9A 2HHHC 2HJGA 4IR7A 1O93A 3VNSA 2OBVA 1MXCA 1FUGA 3A9UA 2QVYX 4BBYA 3IPLA 1XRBA 2FPHX 5BR8C 2E8EA 4DG9A 2P2MA 4HPVA 3RG2A 4DCVA 1LQLA 5AE3A 3UZ0A 5A2QW 5BURA 4OX9H 1XMQC 2UUCH 1VLAA 1MXBA 1WH9A 2D27A 4DV4H 4RMNA 2QVXX 1QWIA 2ONFA 5AE1A 3N2QA 4LF9C 2F4VH 4NXNC 3J7AK 4LFCH 1N33H 2VZEA 4YY3C 5T8SA 1HNZH 1HH2P 2HHHH 4DV0H 4FUTA 4OXIA 4PHTA 4ISBA 4D56A 4X64C 2AYAA 4DV1H 1N32H 1KKGA 4JI8C 2P2JA 4G36A 1S03G 3JAMW 3FCEA 4EATA 2UUBC 5BR8H 5BSMA 1AMUA 3R9WA 4TPSB 4LFAC 4LE5A 1YJ7A 1NYEA 4BCAA 3LUSA 5JRHA 4WV3A 3PBKA 4MTNA 2VQFC 1XMQH 2YCBA 4NXMC 4NZTM 1IBKC 4K0BA 4YHHC 3QD7X 4X66C 3I08A 4FUQA 1MXAA 4LF9H 3OTOC 4DR5C 2Y4OA 1LCIA 2VSQA 2OPLB 3EERA 4OCHA 4JI1H 5ADZA 4JI6C 4X64H 4GKKC 3SB1A 3N54B 3GPCA 4JI8H 5CZXA 2UUBH 4X65C 3S82A 4DR6C 4LFAH 4JI7C 2Y3MA 5A19A 2YWCA 1I6UA 2D9IA 4R0MA 5BSWA 2VQFH 1O90A 5A2QD 3NYQA 4NXMH 4DCTA 1IBKH 3RV2A 2WD9A 4X66H 4DUZH 2Y4NA 3DAYA 3FCCA 4GXRA 4D57A 3VNRA 3OTOH 4DR5H 4GXQA 1PA4A 4E9JA 4ZJZA 4JV5H 3KDGA 4DV5C 3CJEA 2UXDC 3FAUA 1I94H 4DR1C 5A1IA 3J81W 1N33C 2EGTA 4JI6H 4DV2C 4EC5A 4DV0C 4DG8A 4G37A 4BSZA 3T1HH 4JYAC 2XR1A 5IT9W 4DV1C 4B3SH 1N32C 4X65H 3JAMD 4DR6H 4JI7H 1EGAA 2ZM6C 2PT7G 1IBLC 1HNWC 4DV6C 4LF4C 2P20A 4KTTA 2O4CA 4R1MA 1BA3A 1T5HX 4ZLPA 2D1QA 1ZB9A 4B8CD 5BSTA 4R1LA 4DV5H 4I9FA 2UXDH 2CXCA 4DR1H 4DV7C 4JI2C 3DHVA 2QL8A 3GR1A 4DV2H 4G1IA 4DR7C 4JI1C 1HNXC 2CY1A 2UUAC 1PG4A 4RLFA 1MKYA 4JYAH 2WP0C 2E8CA 2OPLA 3NPDA 4JM1A 3PESA 3TDEA 4B3RC 4I9GA 5DV9A 2ZM6H 4B3TC 3NI2A 1UKKA 5K8FA 1IBLH 1HNWH 4DV6H 3OETA 3C5EA 4LF4H 5BSVA 4BC9A 4PROC 5BSRA 4DUYC 1JOSA 2YWBA 3H2TA 1XNQH 4L4QA 5IFIA 3GR5A 4JI3C 4AQYC 4DUZC 2P2BA 4DR2C 3A9VA 1GPMA 3B7WA 4DV7H 3IEVA 3R9XA 4JI2H 4LF5C 4JV5C 1FJGC 1RY2A 4LF6C 3ETOA 4DR7H 1I94C 4RM2A 4RVNA 1HNXH 2ATWA 4RVOA 2UUAH 2ZQEA 2E0GA 4OYCA 5E7QA 5IT9D 3T1HC 4B3SC 2P2QA 4IZ6A 4B3RH 1MDBA 4OD6A 4B3TH 1QM4A 3AF5A 3G7SA 1J5EC 3J80W 5GTDA 2ASBA 1ULTA 3L8CA 4FTFA 2QVZX 1XRCA 4JI0C 4DUYH 3R44A 3GABA 4NOZA 4AQYH 4JI3H 2D1RA 4DR2H 3EZJA 5KYVA 4K0KC 1N34H 2VQEH 4ODJA 4LF5H 2JMPA 1FJGH 1MD9A 1XNRC 4LF6H 4KTVA 5IWAC 4X62C 5FLXW 2E5LC 3NYRA 2P2FA 5KEIA 3CW9A 4KHPH 1F0XA 2DPLA 1HR0C 5CZVA 3CW8X 5LMUC 4NZRM 4D4IA 1V25A 3E7XA 1J5EH 4L7IA 4U5YD 5AE2A 4JI4H 2D7VA 4D4GA 3T1YC 3NCVA 4JI0H 2UU9C 2DYJA 4L2ZA 4DV3C 1XNQC 4K0KH 5BUQA 1IBMC 1XNRH 4JI5C 3KDKA 4LF8C 3IMLA 5IWAH 1ODHA 2E8FA 1P7LA 5KYTA 4X62H 1USPB 1XMOH 1T5DX 2Y27A 4LFBC 2E7GA 2E5LH 4LF7C 5DT9A 1FKAH 2V7BA 3AF6A 3IEUA 4GKJC 4PDBA 1HR0H 5LMNC 2BJOA 5LMUH 5T8TA 1XMOC 3GR0A 2OO4A 5H9UA 3J80D 3T1YH 3DLPX 1X9ZA 2UU9H 1SEIA 4DCSA 2PROA 2VKCA 2UXCC 4DV3H 3VNQA 2D1TA 3OSSD 1IBMH 3SO4A 4B3MC 1O92A 1O9TA 4JI5H 4LF8H 1N34C 2VQEC 4DCUA 4XX2A 5LL6b 3J81D 4LFBH 5FLXD 4BC7A 4LF7H 2LF0A 1PG3A 3RF2A 1V26A 5BSUA 4GKJH 4G08A 5LMNH 4KHPC 1ML8A 4DR3C 4RLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 C;  4LF4 C;  2UXB C;  1KKG A;  4JI8 C;  1L2F A;  2E5L C;  2UUB C;  3R9W A;  1ZB9 A;  4LFA C;  4JI4 C;  4DR4 C;  1NYE A;  3LUS A;  2CXC A;  1N36 C;  4DV7 C;  4JI2 C;  1HR0 C;  4MTN A;  5LMU C;  2VQF C;  2QL8 A;  4DR7 C;  4JI1 C;  2YCB A;  4NXM C;  1HNX C;  1IBK C;  4YHH C;  4X66 C;  2CY1 A;  2UUA C;  2PN2 A;  2D7V A;  1MKY A;  3T1Y C;  3OTO C;  2E8C A;  4DR5 C;  2UU9 C;  2DYJ A;  2OPL A;  2OPL B;  4DV3 C;  3EER A;  1XNQ C;  1WF3 A;  1N2F A;  4B3R C;  1IBM C;  4B3T C;  1UKK A;  4OX9 C;  4JI6 C;  2UUC C;  2KZF A;  4JI5 C;  4GKK C;  4LF8 C;  1USP A;  4DV4 C;  2E8F A;  3GKU A;  1USP B;  4DR3 C;  4MH4 A;  4LFB C;  2E7G A;  2F4V C;  4LF7 C;  4X65 C;  1JOS A;  4DUY C;  4DR6 C;  4JI3 C;  4AQY C;  4DUZ C;  4LFC C;  4JI7 C;  4DR2 C;  3AF6 A;  1ZB8 A;  1K0R A;  3I07 A;  3IEU A;  1HNZ C;  2HHH C;  3IEV A;  3R9X A;  4GKJ C;  2HJG A;  5LMN C;  2BJO A;  4LF5 C;  4JV5 C;  1FJG C;  4LF6 C;  5A2Q D;  1XMO C;  1I94 C;  4DCT A;  2ATW A;  3J80 D;  5BR8 C;  1PA4 A;  2E8E A;  5IT9 D;  4DCS A;  3T1H C;  2UXC C;  4DV5 C;  3CJE A;  2UXD C;  4DCV A;  1LQL A;  4B3S C;  4DR1 C;  1N33 C;  1XMQ C;  4B3M C;  2EGT A;  4DV2 C;  3AF5 A;  1J5E C;  1VLA A;  1N34 C;  1WH9 A;  2VQE C;  4DCU A;  4XX2 A;  4DV0 C;  3J81 D;  4BSZ A;  2ASB A;  1QWI A;  2XR1 A;  5FLX D;  2ONF A;  4LF9 C;  4JYA C;  4DV1 C;  4NXN C;  1N32 C;  4JI0 C;  3JAM D;  4NOZ A;  4YY3 C;  1EGA A;  1HH2 P;  4K0K C;  2JMP A;  2ZM6 C;  2PT7 G;  1XNR C;  1IBL C;  4KHP C;  1HNW C;  1ML8 A;  4DV6 C;  4X64 C;  5IWA C; 
#chains in the Genus database with same CATH topology
 4NXN H;  1VIH A;  2UXB C;  1RG9 A;  1L2F A;  3KXW A;  4YY3 H;  4BA1 I;  3LGX A;  5JEA G;  2OPV A;  1ZZI A;  4PZP A;  4JI4 C;  4DR4 C;  2UXC H;  1N36 C;  1DTJ A;  3L95 X;  3LAX A;  3E7W A;  4B3M H;  2BH1 X;  1NXU A;  2CTF A;  2D28 C;  3TQI A;  1XRA A;  2PN2 A;  1WVN A;  2CTE A;  4PUI A;  1EC6 A;  2QW0 X;  1PQX A;  4GS5 A;  1J5K A;  1WHR A;  2JVZ A;  2D1S A;  4NDN A;  3EQ6 A;  1AN7 A;  2A1S A;  1VBI A;  3A25 A;  1MDF A;  1NY8 A;  1IB8 A;  1WF3 A;  2FMR A;  3A4I A;  1N2F A;  4YHH H;  4OX9 C;  3TUF A;  1MSZ A;  4DR3 H;  2UUC C;  2KZF A;  2CWF A;  2Z0S A;  1USP A;  4DV4 C;  2UXB H;  5K85 A;  3GKU A;  4MH4 A;  1TUA A;  2K1H A;  2F4V C;  4PUG A;  3ETC A;  5BUS A;  2P02 A;  3LNV A;  3UOW A;  4RM3 A;  4LFC C;  4DR4 H;  5A1G A;  1ZB8 A;  1K0R A;  3I07 A;  3PRO C;  1N36 H;  1HNZ C;  4GKK H;  4WS9 A;  2HHH C;  2HJG A;  2JA9 A;  4IR7 A;  1O93 A;  3VNS A;  2OBV A;  4WAN A;  1MXC A;  1FUG A;  3A9U A;  2QVY X;  4BBY A;  1UWD A;  3IPL A;  1XRB A;  2FPH X;  5BR8 C;  2HH3 A;  2E8E A;  4DG9 A;  2P2M A;  4HPV A;  3RG2 A;  4DCV A;  1LQL A;  5AE3 A;  3CQ3 A;  3AEV B;  3UZ0 A;  1DT4 A;  4LIJ A;  5A2Q W;  4PUH A;  5BUR A;  1XMQ C;  4OX9 H;  2MJH A;  2UUC H;  1VLA A;  1MXB A;  1WH9 A;  2D27 A;  4DV4 H;  4RMN A;  2QVX X;  1QWI A;  2ONF A;  5AE1 A;  3N2Q A;  4LF9 C;  2F4V H;  4NXN C;  2P2R A;  3J7A K;  4LFC H;  1N33 H;  2VZE A;  4YY3 C;  5T8S A;  2Z51 A;  1HNZ H;  1V8C A;  1HH2 P;  2HHH H;  4DV0 H;  2M5O A;  1XS3 A;  4FUT A;  4OXI A;  4PHT A;  4ISB A;  4D56 A;  1WCJ A;  2AYA A;  4X64 C;  4NBQ A;  2ANN A;  4DV1 H;  4OO1 G;  1N32 H;  1KKG A;  4JI8 C;  2AXY A;  2P2J A;  4G36 A;  1S03 G;  3JAM W;  3FCE A;  4EAT A;  2UUB C;  5BR8 H;  2M8W A;  5BSM A;  1AMU A;  3R9W A;  4TPS B;  4FJS A;  4LFA C;  3UX2 A;  4LE5 A;  1YJ7 A;  1NYE A;  4BCA A;  3LUS A;  5JRH A;  4WV3 A;  2M6Q A;  3PBK A;  4MTN A;  2VQF C;  1XMQ H;  4AIM A;  2YCB A;  4NXM C;  4NZT M;  1IBK C;  2CTL A;  4K0B A;  4YHH C;  3QD7 X;  4X66 C;  3I08 A;  4FUQ A;  1MXA A;  4LF9 H;  3OTO C;  4DR5 C;  2Y4O A;  1LCI A;  3CQ1 A;  2VSQ A;  2OPL B;  1ZTG A;  3EER A;  4OCH A;  4JI1 H;  2CTJ A;  3UOE A;  5ADZ A;  4JI6 C;  4X64 H;  4GKK C;  1XRH A;  3SB1 A;  2CU6 A;  3N54 B;  2YQR A;  3GPC A;  4JI8 H;  5CZX A;  2M5H A;  2UUB H;  4X65 C;  3S82 A;  1X0A A;  4DR6 C;  4LFA H;  4JI7 C;  2Y3M A;  5A19 A;  2YWC A;  2BA0 A;  1I6U A;  2D9I A;  4R0M A;  5BSW A;  2VQF H;  1O90 A;  4JVH A;  5A2Q D;  2CPQ A;  2KDN A;  2MCQ A;  3NYQ A;  4NXM H;  4DCT A;  1IBK H;  3RV2 A;  2WD9 A;  2X06 A;  4X66 H;  4DUZ H;  2Y4N A;  3DAY A;  3FCC A;  4GXR A;  4D57 A;  3UX3 A;  3VNR A;  3OTO H;  4DR5 H;  4GXQ A;  1PA4 A;  4E9J A;  4IFD G;  4ZJZ A;  2JNV A;  4JV5 H;  3KDG A;  4DV5 C;  3CJE A;  2UXD C;  3FAU A;  4B8T A;  3TR3 A;  4DR1 C;  1I94 H;  5A1I A;  2MM9 A;  3J81 W;  1N33 C;  2EGT A;  4JI6 H;  4DV2 C;  4EC5 A;  4DV0 C;  1WE8 A;  4DG8 A;  4G37 A;  1Z2I A;  4BSZ A;  3I0P A;  3T1H H;  4JYA C;  2XR1 A;  5IT9 W;  3CQ2 A;  2DGR A;  4DV1 C;  4B3S H;  1N32 C;  4X65 H;  3JAM D;  4DR6 H;  2CPM A;  4JI7 H;  1EGA A;  2ZM6 C;  2PT7 G;  1IBL C;  1HNW C;  3K6R A;  4DV6 C;  1M6X C;  1J4W A;  4LF4 C;  2P20 A;  1VIG A;  4KTT A;  2OPU A;  4JVY A;  2O4C A;  4R1M A;  1BA3 A;  1T5H X;  4ZLP A;  2D1Q A;  1ZB9 A;  4B8C D;  5BST A;  4R1L A;  4DV5 H;  4I9F A;  2UXD H;  2LTM A;  2CXC A;  4DR1 H;  4DV7 C;  4JI2 C;  4WAL A;  2PQU A;  2PY9 A;  3LNO A;  3DHV A;  2QL8 A;  3GR1 A;  2BL5 A;  4G1I A;  4DR7 C;  1X4M A;  4DV2 H;  4JI1 C;  1HNX C;  2CY1 A;  2UUA C;  1PG4 A;  4RLF A;  1S20 A;  1MKY A;  4JYA H;  2WP0 C;  1P4E C;  2E8C A;  2OPL A;  1K1G A;  3NPD A;  3AY0 A;  4AM3 A;  4JM1 A;  3PES A;  3TDE A;  4B3R C;  4I9G A;  5DV9 A;  2ZM6 H;  4B3T C;  3NI2 A;  1UKK A;  5K8F A;  1IBL H;  4H8A A;  1HNW H;  4DV6 H;  3OET A;  3C5E A;  4LF4 H;  5BSV A;  4BC9 A;  4PRO C;  5BSR A;  3UEB A;  4DUY C;  1JOS A;  2YWB A;  3H2T A;  2JZX A;  4L4Q A;  5IFI A;  1XNQ H;  3GR5 A;  4JI3 C;  4AQY C;  4DUZ C;  2P2B A;  4DR2 C;  2ANR A;  3A9V A;  1GPM A;  1XHJ A;  2YX1 A;  3B7W A;  4DV7 H;  3IEV A;  2NCL A;  3R9X A;  4JI2 H;  4LF5 C;  4JV5 C;  1FJG C;  1RY2 A;  4LF6 C;  3ETO A;  4BA2 I;  4DR7 H;  1I94 C;  4RM2 A;  2ZZN A;  4RVN A;  1HNX H;  2ATW A;  2JE6 I;  4RVO A;  2UUA H;  2ZQE A;  2E0G A;  4OYC A;  5E7Q A;  5IT9 D;  3T1H C;  2CWH A;  4B3S C;  2P2Q A;  2KZ0 A;  4IZ6 A;  4B3R H;  1MDB A;  4OD6 A;  4B3T H;  1QM4 A;  3AF5 A;  3G7S A;  1J5E C;  3J80 W;  1FLO A;  5GTD A;  2ASB A;  1ULT A;  3L8C A;  4FTF A;  2QVZ X;  1XRC A;  4JI0 C;  4DUY H;  1ZZJ A;  3R44 A;  3GAB A;  4NOZ A;  4AQY H;  4JI3 H;  2D1R A;  4DR2 H;  1WTJ A;  3EZJ A;  5KYV A;  4K0K C;  1N34 H;  2VQE H;  4ODJ A;  4LF5 H;  2JMP A;  3VKE A;  1FJG H;  1MD9 A;  1XNR C;  4LF6 H;  4KTV A;  3V69 A;  5IWA C;  4X62 C;  5FLX W;  2QND A;  2E5L C;  3NYR A;  2HH2 A;  2P2F A;  5KEI A;  3CW9 A;  2CTK A;  1KHM A;  4KHP H;  1F0X A;  2MMA B;  2DPL A;  1PU1 A;  1HR0 C;  5CZV A;  3CW8 X;  5LMU C;  1M6X A;  4NZR M;  4D4I A;  1V25 A;  3E7X A;  1J5E H;  4L7I A;  2E3U A;  4U5Y D;  5AE2 A;  4JI4 H;  2D7V A;  4D4G A;  3T1Y C;  1ZZK A;  3NCV A;  4JI0 H;  2UU9 C;  2DYJ A;  4L2Z A;  4DV3 C;  1XNQ C;  4K0K H;  1VEH A;  5BUQ A;  1IBM C;  2LTL A;  1XNR H;  4JI5 C;  3KDK A;  4LF8 C;  3IML A;  5IWA H;  1ODH A;  5LCI A;  2E8F A;  5KYT A;  1P7L A;  4X62 H;  2FFM A;  1USP B;  1XMO H;  1T5D X;  1P4E A;  2Y27 A;  4LFB C;  2E7G A;  2LRR A;  2E5L H;  4LF7 C;  1V60 A;  5DT9 A;  1FKA H;  2V7B A;  3AF6 A;  3IEU A;  2NN6 G;  4GKJ C;  4PDB A;  1HR0 H;  5LMN C;  2BJO A;  5LMU H;  5T8T A;  1XMO C;  3GR0 A;  4FJU A;  2OO4 A;  1TH5 A;  4QMF B;  5H9U A;  3J80 D;  3U1K A;  5C0X G;  3T1Y H;  3DLP X;  1X9Z A;  2UU9 H;  1SEI A;  4DCS A;  2JEB I;  2PRO A;  2VKC A;  2UXC C;  2CTM A;  4DV3 H;  3VNQ A;  2D1T A;  3OSS D;  2JEA I;  1IBM H;  2DHM A;  3SO4 A;  5K36 G;  4B3M C;  1O92 A;  1V9N A;  1O9T A;  3O2E A;  3L7Z C;  4JI5 H;  4LF8 H;  1N34 C;  2VQE C;  4DCU A;  4XX2 A;  1UG8 A;  1X4N A;  3A26 A;  5LL6 b;  3J81 D;  4LFB H;  5FLX D;  2G8Y A;  4BC7 A;  4LF7 H;  2LF0 A;  1PG3 A;  3RF2 A;  1V26 A;  5BSU A;  4GKJ H;  4G08 A;  5LMN H;  4KHP C;  1ML8 A;  2ZZM A;  4DR3 C;  4RLQ A; 
#chains in the Genus database with same CATH homology
 4NXN H;  2UXB C;  1RG9 A;  1L2F A;  3KXW A;  4YY3 H;  3LGX A;  4PZP A;  4JI4 C;  4DR4 C;  2UXC H;  1N36 C;  3L95 X;  3LAX A;  3E7W A;  4B3M H;  2BH1 X;  2D28 C;  3TQI A;  1XRA A;  2PN2 A;  2QW0 X;  4GS5 A;  2D1S A;  4NDN A;  3EQ6 A;  1AN7 A;  1MDF A;  1WF3 A;  3A4I A;  1N2F A;  4YHH H;  4OX9 C;  3TUF A;  4DR3 H;  2UUC C;  2KZF A;  1USP A;  4DV4 C;  2UXB H;  5K85 A;  3GKU A;  4MH4 A;  2F4V C;  3ETC A;  5BUS A;  2P02 A;  3LNV A;  3UOW A;  4RM3 A;  4LFC C;  4DR4 H;  5A1G A;  1ZB8 A;  1K0R A;  3I07 A;  3PRO C;  1N36 H;  1HNZ C;  4GKK H;  4WS9 A;  2HHH C;  2HJG A;  4IR7 A;  1O93 A;  3VNS A;  2OBV A;  1MXC A;  1FUG A;  3A9U A;  2QVY X;  4BBY A;  3IPL A;  1XRB A;  2FPH X;  5BR8 C;  2E8E A;  4DG9 A;  2P2M A;  4HPV A;  3RG2 A;  4DCV A;  1LQL A;  5AE3 A;  3UZ0 A;  5A2Q W;  5BUR A;  4OX9 H;  1XMQ C;  2UUC H;  1VLA A;  1MXB A;  1WH9 A;  2D27 A;  4DV4 H;  4RMN A;  2QVX X;  1QWI A;  2ONF A;  5AE1 A;  3N2Q A;  4LF9 C;  2F4V H;  4NXN C;  3J7A K;  4LFC H;  1N33 H;  2VZE A;  4YY3 C;  5T8S A;  1HNZ H;  1HH2 P;  2HHH H;  4DV0 H;  4FUT A;  4OXI A;  4PHT A;  4ISB A;  4D56 A;  4X64 C;  2AYA A;  4DV1 H;  1N32 H;  1KKG A;  4JI8 C;  2P2J A;  4G36 A;  1S03 G;  3JAM W;  3FCE A;  4EAT A;  2UUB C;  5BR8 H;  5BSM A;  1AMU A;  3R9W A;  4TPS B;  4LFA C;  4LE5 A;  1YJ7 A;  1NYE A;  4BCA A;  3LUS A;  5JRH A;  4WV3 A;  3PBK A;  4MTN A;  2VQF C;  1XMQ H;  2YCB A;  4NXM C;  4NZT M;  1IBK C;  4K0B A;  4YHH C;  3QD7 X;  4X66 C;  3I08 A;  4FUQ A;  1MXA A;  4LF9 H;  3OTO C;  4DR5 C;  2Y4O A;  1LCI A;  2VSQ A;  2OPL B;  3EER A;  4OCH A;  4JI1 H;  5ADZ A;  4JI6 C;  4X64 H;  4GKK C;  3SB1 A;  3N54 B;  3GPC A;  4JI8 H;  5CZX A;  2UUB H;  4X65 C;  3S82 A;  4DR6 C;  4LFA H;  4JI7 C;  2Y3M A;  5A19 A;  2YWC A;  1I6U A;  2D9I A;  4R0M A;  5BSW A;  2VQF H;  1O90 A;  5A2Q D;  3NYQ A;  4NXM H;  4DCT A;  1IBK H;  3RV2 A;  2WD9 A;  4X66 H;  4DUZ H;  2Y4N A;  3DAY A;  3FCC A;  4GXR A;  4D57 A;  3VNR A;  3OTO H;  4DR5 H;  4GXQ A;  1PA4 A;  4E9J A;  4ZJZ A;  4JV5 H;  3KDG A;  4DV5 C;  3CJE A;  2UXD C;  3FAU A;  1I94 H;  4DR1 C;  5A1I A;  3J81 W;  1N33 C;  2EGT A;  4JI6 H;  4DV2 C;  4EC5 A;  4DV0 C;  4DG8 A;  4G37 A;  4BSZ A;  3T1H H;  4JYA C;  2XR1 A;  5IT9 W;  4DV1 C;  4B3S H;  1N32 C;  4X65 H;  3JAM D;  4DR6 H;  4JI7 H;  1EGA A;  2ZM6 C;  2PT7 G;  1IBL C;  1HNW C;  4DV6 C;  4LF4 C;  2P20 A;  4KTT A;  2O4C A;  4R1M A;  1BA3 A;  1T5H X;  4ZLP A;  2D1Q A;  1ZB9 A;  4B8C D;  5BST A;  4R1L A;  4DV5 H;  4I9F A;  2UXD H;  2CXC A;  4DR1 H;  4DV7 C;  4JI2 C;  3DHV A;  2QL8 A;  3GR1 A;  4DV2 H;  4G1I A;  4DR7 C;  4JI1 C;  1HNX C;  2CY1 A;  2UUA C;  1PG4 A;  4RLF A;  1MKY A;  4JYA H;  2WP0 C;  2E8C A;  2OPL A;  3NPD A;  4JM1 A;  3PES A;  3TDE A;  4B3R C;  4I9G A;  5DV9 A;  2ZM6 H;  4B3T C;  3NI2 A;  1UKK A;  5K8F A;  1IBL H;  1HNW H;  4DV6 H;  3OET A;  3C5E A;  4LF4 H;  5BSV A;  4BC9 A;  4PRO C;  5BSR A;  4DUY C;  1JOS A;  2YWB A;  3H2T A;  1XNQ H;  4L4Q A;  5IFI A;  3GR5 A;  4JI3 C;  4AQY C;  4DUZ C;  2P2B A;  4DR2 C;  3A9V A;  1GPM A;  3B7W A;  4DV7 H;  3IEV A;  3R9X A;  4JI2 H;  4LF5 C;  4JV5 C;  1FJG C;  1RY2 A;  4LF6 C;  3ETO A;  4DR7 H;  1I94 C;  4RM2 A;  4RVN A;  1HNX H;  2ATW A;  4RVO A;  2UUA H;  2ZQE A;  2E0G A;  4OYC A;  5E7Q A;  5IT9 D;  3T1H C;  4B3S C;  2P2Q A;  4IZ6 A;  4B3R H;  1MDB A;  4OD6 A;  4B3T H;  1QM4 A;  3AF5 A;  3G7S A;  1J5E C;  3J80 W;  5GTD A;  2ASB A;  1ULT A;  3L8C A;  4FTF A;  2QVZ X;  1XRC A;  4JI0 C;  4DUY H;  3R44 A;  3GAB A;  4NOZ A;  4AQY H;  4JI3 H;  2D1R A;  4DR2 H;  3EZJ A;  5KYV A;  4K0K C;  1N34 H;  2VQE H;  4ODJ A;  4LF5 H;  2JMP A;  1FJG H;  1MD9 A;  1XNR C;  4LF6 H;  4KTV A;  5IWA C;  4X62 C;  5FLX W;  2E5L C;  3NYR A;  2P2F A;  5KEI A;  3CW9 A;  4KHP H;  1F0X A;  2DPL A;  1HR0 C;  5CZV A;  3CW8 X;  5LMU C;  4NZR M;  4D4I A;  1V25 A;  3E7X A;  1J5E H;  4L7I A;  4U5Y D;  5AE2 A;  4JI4 H;  2D7V A;  4D4G A;  3T1Y C;  3NCV A;  4JI0 H;  2UU9 C;  2DYJ A;  4L2Z A;  4DV3 C;  1XNQ C;  4K0K H;  5BUQ A;  1IBM C;  1XNR H;  4JI5 C;  3KDK A;  4LF8 C;  3IML A;  5IWA H;  1ODH A;  2E8F A;  1P7L A;  5KYT A;  4X62 H;  1USP B;  1XMO H;  1T5D X;  2Y27 A;  4LFB C;  2E7G A;  2E5L H;  4LF7 C;  5DT9 A;  1FKA H;  2V7B A;  3AF6 A;  3IEU A;  4GKJ C;  4PDB A;  1HR0 H;  5LMN C;  2BJO A;  5LMU H;  5T8T A;  1XMO C;  3GR0 A;  2OO4 A;  5H9U A;  3J80 D;  3T1Y H;  3DLP X;  1X9Z A;  2UU9 H;  1SEI A;  4DCS A;  2PRO A;  2VKC A;  2UXC C;  4DV3 H;  3VNQ A;  2D1T A;  3OSS D;  1IBM H;  3SO4 A;  4B3M C;  1O92 A;  1O9T A;  4JI5 H;  4LF8 H;  1N34 C;  2VQE C;  4DCU A;  4XX2 A;  5LL6 b;  3J81 D;  4LFB H;  5FLX D;  4BC7 A;  4LF7 H;  2LF0 A;  1PG3 A;  3RF2 A;  1V26 A;  5BSU A;  4GKJ H;  4G08 A;  5LMN H;  4KHP C;  1ML8 A;  4DR3 C;  4RLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...