2PT7G

Crystal structure of cag virb11 (hp0525) and an inhibitory protein (hp1451)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
145
structure length
145
Chain Sequence
b'KLHEIKQELKDLFSHLPYKINKVEVSLYEPGVLLIDIDGEDSALLIGEKGYRYKALSYLLFNWIHPTYGYSIRLEISTFLQNQEKVMDTQLQSVIMTVHEVGKGQMKAPDGVLTYIALKKLRKAFPNKYVSIKTNLNDEKYIVIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cag-alfa
publication title Identification, structure and mode of action of a new regulator of the Helicobacter pylori HP0525 ATPase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/protein binding
total genus 44
structure length 145
sequence length 145
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF18472 HP1451_C HP1451 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2pt7G01
3.30.1370.180 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2pt7G02
4MTNA 2EGTA 2JMPA 4DV1C 1EGAA 2UXDC 4LF7C 1N32C 1FJGC 4GKJC 4DR7C 4X64C 4NXNC 2E5LC 4DCTA 4DV3C 2BJOA 4NXMC 4LFBC 1MKYA 2YCBA 4DUZC 4DV2C 1IBLC 4MH4A 4DV6C 4K0KC 3J80D 4DR4C 1XNRC 2HJGA 4LF8C 2HHHC 4DV0C 4DV7C 1PA4A 1USPB 2VQEC 4DCVA 2UXCC 1HNXC 3R9XA 2CY1A 2DYJA 4B3SC 4DR6C 3CJEA 4DV4C 2UXBC 4DUYC 1XNQC 4JV5C 2E8CA 1ML8A 5A2QD 4JYAC 2PN2A 4X65C 4DV5C 2UUBC 1VLAA 1IBKC 3T1YC 3IEUA 2CXCA 1N2FA 2D7VA 2ASBA 2UUAC 4OX9C 2F4VC 4DCSA 3AF6A 1WH9A 1JOSA 1WF3A 4DR3C 1HNWC 1KKGA 2E7GA 1L2FA 5FLXD 1XMQC 3GKUA 3JAMD 3LUSA 1N33C 2OPLB 2ONFA 2E8FA 4AQYC 5BR8C 2UU9C 5LMUC 1ZB9A 4GKKC 4JI1C 2KZFA 4YY3C 2PT7G 2ZM6C 4X62C 4DCUA 1ZB8A 3OTOC 2ATWA 4JI6C 1N36C 2QL8A 4JI3C 1HH2P 5IWAC 1HNZC 4JI5C 3IEVA 4LFAC 1LQLA 4JI2C 4JI8C 4B3TC 4DR2C 4DR1C 1QWIA 1HR0C 3I07A 2E8EA 3T1HC 4JI7C 5LMNC 1USPA 4X66C 3EERA 4JI0C 1UKKA 2XR1A 4XX2A 4YHHC 1IBMC 2UUCC 3R9WA 1K0RA 1N34C 4B3MC 2OPLA 4LF4C 4DR5C 4JI4C 4KHPC 3AF5A 2VQFC 4LFCC 1XMOC 1J5EC 4NOZA 4LF9C 1I94C 3J81D 4LF6C 4B3RC 4LF5C 1NYEA 4BSZA 5IT9D
chains in the Genus database with same CATH superfamily
1KHMA 4MTNA 4LF8H 2F4VH 1FJGC 1O92A 3L95X 2P2RA 3DLPX 4X64C 2YQRA 2JE6I 3N2QA 3ETOA 2BH1X 4LFBC 1MKYA 4B3SH 2YCBA 1ZZKA 4AQYH 4DV2C 4RM3A 1V25A 4DUYH 1XNQH 5A2QW 1MXBA 4DR4C 2OPUA 4X62H 1XNRC 2HJGA 1J4WA 4DG8A 4PZPA 5BUQA 4I9FA 4DV0C 3S82A 3VNRA 1VBIA 2CWFA 3PBKA 2VQEC 4D4IA 5DV9A 4DR3H 2YX1A 1MSZA 1T5DX 4DV4C 2UXBC 3UX3A 2YWCA 4R0MA 1XMQH 3J7AK 3A9VA 1N33H 4DR5H 1IB8A 5LMUH 4GKKH 2P2MA 4YY3H 1DTJA 2ZM6H 4WALA 1WTJA 4EC5A 3TR3A 3J81W 2NN6G 4I9GA 1HNZH 4JI5H 4RVOA 1WH9A 2ZZNA 3L8CA 5IT9W 3O2EA 3GR1A 1F0XA 4JI8H 3VKEA 1NXUA 4RM2A 2OPLB 5BR8C 2UU9C 1WE8A 5CZVA 1IBMH 5A1GA 1N34H 1NY8A 2M6QA 4PDBA 3U1KA 4DUZH 4BC9A 4LFAC 4LIJA 2CTJA 1X9ZA 2M8WA 2QVYX 5GTDA 2X06A 3CW9A 1HR0C 2Y3MA 2HHHH 2JVZA 3EERA 4JI0C 2MMAB 4BA2I 4DV1H 2UXDH 1FKAH 4LF7H 1O90A 1N32H 2CPQA 4GKJH 2P02A 4K0BA 1XHJA 4JI4C 2BA0A 3AF5A 4FJSA 2VQFC 3RF2A 1J5EC 4DV3H 2P20A 3EZJA 2KZ0A 3KDKA 4H8AA 1XS3A 2OO4A 3J81D 1GPMA 3UOEA 4LF6C 2JEAI 3GABA 2AYAA 3TQIA 1M6XC 5IT9D 4JI1C 3LGXA 3NYQA 1PQXA 4DV7H 4TPSB 2NCLA 2HH3A 1LCIA 4PROC 4NXNC 4G08A 1P7LA 3KXWA 3JAMW 2LTMA 1UWDA 1VIHA 1IBLC 1AMUA 4JV5H 4DV6C 3N54B 3NI2A 4K0KC 3I0PA 4JYAH 5JEAG 4DV5H 4LF8C 1IBKH 4GXRA 2OPVA 4BBYA 4RMNA 5A19A 3NPDA 2PQUA 1YJ7A 1FLOA 3LAXA 3GPCA 1TUAA 1O93A 1MDFA 4D4GA 1SEIA 4G1IA 3VNSA 1HNWH 4B3SC 3AEVB 4DR6C 3CJEA 4RLQA 4DUYC 1XNQC 2E3UA 1MXCA 2ZQEA 3QD7X 1X4NA 2UUCH 1ZTGA 2DHMA 1MXAA 5LL6b 1VLAA 5JRHA 2Y4OA 1I6UA 1T5HX 3IEUA 1N2FA 4PHTA 2CPMA 3FAUA 1EC6A 2HH2A 5KYVA 4FJUA 4FTFA 4R1LA 3RG2A 5K36G 1N36H 1FUGA 3AF6A 4JI3H 5IWAH 1WF3A 4DR3C 1KKGA 4AIMA 4OD6A 4B3TH 2MCQA 1XMQC 2M5HA 1X4MA 3JAMD 4JI7H 1N33C 4WANA 2ONFA 5LMUC 1ZB9A 4GKKC 5CZXA 1RG9A 3L7ZC 4YHHH 4YY3C 2ZM6C 1Z2IA 3I08A 3OTOC 1ZB8A 3VNQA 4LFBH 4JI6C 3FCCA 4KHPH 5DT9A 4LFCH 1HH2P 1HNZC 4JI5C 4WV3A 2YWBA 4LF9H 2ANNA 1I94H 4JI8C 2VSQA 5AE1A 1ZZIA 4B3RH 5ADZA 4LF5H 2E8EA 3T1HC 2P2QA 1USPA 4X66C 4NZRM 2WD9A 5KEIA 2CTMA 4XX2A 1IBMC 3R9WA 5H9UA 5BUSA 1N34C 4DR7H 2OPLA 1V60A 1MDBA 3FCEA 2D1QA 3LNOA 4NXMH 2JA9A 4GXQA 2Y27A 4RLFA 2ZZMA 4BSZA 3CQ3A 5BSWA 2JMPA 4PUHA 4ZJZA 4DV1C 2UXDC 5IFIA 4LF7C 1N32C 4IR7A 5BSTA 4GKJC 2V7BA 1P4EC 2CWHA 2E5LC 2UXCH 1HNXH 3DAYA 4DV3C 1O9TA 3EQ6A 4FUQA 3CQ1A 4MH4A 2PY9A 2QW0X 4X65H 2UUBH 1QM4A 1PU1A 3T1YH 1P4EA 4DV7C 3CW8X 3A25A 1PA4A 4E9JA 1AN7A 2DPLA 2UUAH 4OX9H 3A9UA 3OSSD 3KDGA 2JEBI 2CY1A 2DYJA 2G8YA 3V69A 2P2BA 2VZEA 3DHVA 4JM1A 4B8TA 1PG3A 4JV5C 2E8CA 1ML8A 4JI0H 2P2JA 4JYAC 2CTEA 4R1MA 4DV5C 1WCJA 1M6XA 1IBKC 1DT4A 2M5OA 2CXCA 4KTVA 2CTLA 2D7VA 2CTKA 1J5EH 3IPLA 3NYRA 2ASBA 4D57A 2F4VC 4LF6H 1HNWC 4JI2H 4JI1H 1ZZJA 5E7QA 4NDNA 4DR2H 1J5KA 4DR1H 5C0XG 1WVNA 3LUSA 4IZ6A 2PROA 2FMRA 5LMNH 2E8FA 4AQYC 4ZLPA 2DGRA 5BSUA 2LF0A 2Z51A 2PT7G 2D9IA 4X62C 4DCUA 4B3MH 4LF4H 2P2FA 3UZ0A 1N36C 2QL8A 3UEBA 4JI3C 4U5YD 5IWAC 1XMOH 4DV6H 2K1HA 3J80W 1BA3A 3GR5A 4B3TC 2CU6A 1V8CA 1XRBA 2AXYA 4JI7C 3E7WA 3UX2A 2XR1A 4YHHC 2WP0C 1FJGH 4DR5C 4D56A 2JNVA 4X64H 1XRAA 4DR6H 2OBVA 4G37A 3SO4A 4DG9A 4KHPC 4LFCC 5BSMA 4NOZA 4LF9C 3B7WA 1I94C 3SB1A 5AE2A 2FPHX 3PESA 4JVYA 4B3RC 4DV2H 4LF5C 2QNDA 1NYEA 3IMLA 1VEHA 4DR4H 1XNRH 4FUTA 2EGTA 3R44A 1EGAA 4IFDG 3LNVA 1V26A 4WS9A 4DV0H 4DR7C 2VKCA 2LRRA 3K6RA 2VQEH 5FLXW 4RVNA 1WHRA 4ISBA 1RY2A 4DCTA 2BJOA 5T8SA 4OCHA 2D1RA 4NXMC 4G36A 2E0GA 3AY0A 4DUZC 4DV4H 2D28C 5BSRA 2UXBH 4OO1G 3J80D 5BURA 3OTOH 3RV2A 4JI6H 2HHHC 4BC7A 1V9NA 4BA1I 2LTLA 4AM3A 4L7IA 1USPB 3G7SA 4DCVA 2UXCC 5AE3A 1HNXC 2MM9A 3R9XA 4EATA 3T1HH 4OYCA 4X66H 1ULTA 5A2QD 1VIGA 2QVZX 2PN2A 4X65C 2FFMA 2Z0SA 2UUBC 3A26A 3A4IA 4OXIA 3T1YC 5BR8H 2ANRA 2UU9H 2UUAC 4OX9C 4DCSA 2KDNA 1JOSA 4LFAH 1K1GA 2E7GA 5LCIA 1L2FA 4KTTA 5FLXD 4L4QA 3ETCA 5K85A 2O4CA 1PG4A 4PUIA 1HR0H 3GKUA 4NZTM 3CQ2A 1XRHA 3H2TA 2KZFA 2E5LH 4LE5A 5K8FA 1XRCA 2Y4NA 4HPVA 2ATWA 4JI4H 3NCVA 2VQFH 3IEVA 3UOWA 4NBQA 1LQLA 2D1SA 4B8CD 5T8TA 4JI2C 3GR0A 1X0AA 2JZXA 2MJHA 3TUFA 4DR2C 4DR1C 2BL5A 1QWIA 3C5EA 3OETA 3I07A 4JVHA 5LMNC 2QVXX 5A1IA 2A1SA 1UKKA 4GS5A 2UUCC 4L2ZA 3TDEA 1ODHA 1K0RA 1S20A 4B3MC 4LF4C 4QMFB 3E7XA 2D27A 4NXNH 1MD9A 4PUGA 1XMOC 2CTFA 3PROC 2D1TA 1UG8A 4ODJA 1TH5A 5BSVA 1IBLH 5KYTA 4BCAA 1S03G 4K0KH
chains in the Genus database with same CATH topology
4MTNA 4LF8H 2F4VH 1FJGC 1O92A 3L95X 3DLPX 4X64C 3N2QA 3ETOA 2BH1X 4LFBC 1MKYA 4B3SH 2YCBA 4AQYH 4DV2C 4RM3A 1V25A 4DUYH 1XNQH 5A2QW 1MXBA 4DR4C 4X62H 1XNRC 2HJGA 4DG8A 4PZPA 5BUQA 4I9FA 4DV0C 3S82A 3VNRA 3PBKA 2VQEC 4D4IA 5DV9A 4DR3H 1T5DX 4DV4C 2UXBC 2YWCA 4R0MA 1XMQH 3J7AK 3A9VA 1N33H 4DR5H 5LMUH 4GKKH 2P2MA 4YY3H 2ZM6H 4EC5A 3J81W 4I9GA 1HNZH 4JI5H 4RVOA 1WH9A 5IT9W 3L8CA 3GR1A 1F0XA 4JI8H 4RM2A 2OPLB 5BR8C 2UU9C 5CZVA 1IBMH 5A1GA 1N34H 4PDBA 4DUZH 4BC9A 4LFAC 1X9ZA 2QVYX 5GTDA 3CW9A 1HR0C 2Y3MA 2HHHH 3EERA 4JI0C 4DV1H 2UXDH 1FKAH 4LF7H 1O90A 1N32H 4GKJH 2P02A 4K0BA 4JI4C 3AF5A 2VQFC 3RF2A 1J5EC 4DV3H 2P20A 3EZJA 3KDKA 2OO4A 3J81D 1GPMA 4LF6C 3GABA 2AYAA 3TQIA 5IT9D 4JI1C 3LGXA 3NYQA 4DV7H 4TPSB 1LCIA 4PROC 4NXNC 4G08A 1P7LA 3KXWA 3JAMW 1IBLC 1AMUA 4JV5H 4DV6C 3N54B 3NI2A 4K0KC 4JYAH 4DV5H 4LF8C 1IBKH 4GXRA 4BBYA 4RMNA 5A19A 3NPDA 1YJ7A 3LAXA 3GPCA 1O93A 1MDFA 4D4GA 1SEIA 4G1IA 3VNSA 1HNWH 4B3SC 4DR6C 3CJEA 4RLQA 4DUYC 1XNQC 2ZQEA 1MXCA 3QD7X 2UUCH 1MXAA 5LL6b 1VLAA 5JRHA 2Y4OA 1I6UA 1T5HX 3IEUA 1N2FA 4PHTA 3FAUA 5KYVA 4FTFA 4R1LA 3RG2A 1N36H 1FUGA 3AF6A 4JI3H 5IWAH 1WF3A 4DR3C 1KKGA 4OD6A 4B3TH 1XMQC 3JAMD 4JI7H 1N33C 2ONFA 5LMUC 1ZB9A 4GKKC 5CZXA 1RG9A 4YHHH 4YY3C 2ZM6C 3I08A 3OTOC 1ZB8A 3VNQA 4LFBH 4JI6C 3FCCA 4KHPH 5DT9A 4LFCH 1HH2P 1HNZC 4JI5C 4WV3A 2YWBA 4LF9H 1I94H 4JI8C 2VSQA 5AE1A 4B3RH 5ADZA 4LF5H 2E8EA 3T1HC 2P2QA 1USPA 4X66C 4NZRM 2WD9A 5KEIA 4XX2A 1IBMC 3R9WA 5H9UA 5BUSA 1N34C 4DR7H 2OPLA 1MDBA 3FCEA 2D1QA 4NXMH 4GXQA 2Y27A 4RLFA 4BSZA 5BSWA 2JMPA 4ZJZA 4DV1C 2UXDC 5IFIA 4LF7C 1N32C 4IR7A 5BSTA 4GKJC 2V7BA 2E5LC 2UXCH 1HNXH 3DAYA 4DV3C 1O9TA 3EQ6A 4FUQA 4MH4A 2QW0X 4X65H 2UUBH 1QM4A 3T1YH 4DV7C 3CW8X 1PA4A 4E9JA 1AN7A 2DPLA 2UUAH 4OX9H 3A9UA 3OSSD 3KDGA 2CY1A 2DYJA 2P2BA 2VZEA 3DHVA 4JM1A 4JI0H 1PG3A 4JV5C 2E8CA 1ML8A 2P2JA 4JYAC 4R1MA 4DV5C 1IBKC 2CXCA 4KTVA 1J5EH 2D7VA 3IPLA 3NYRA 2ASBA 4D57A 2F4VC 4LF6H 1HNWC 4JI2H 4JI1H 5E7QA 4NDNA 4DR2H 4DR1H 3LUSA 4IZ6A 2PROA 5LMNH 2E8FA 4AQYC 4ZLPA 5BSUA 2LF0A 2PT7G 2D9IA 4X62C 4DCUA 4B3MH 4LF4H 2P2FA 3UZ0A 1N36C 2QL8A 4JI3C 4U5YD 5IWAC 1XMOH 4DV6H 3J80W 1BA3A 3GR5A 4B3TC 1XRBA 4JI7C 3E7WA 2XR1A 4YHHC 2WP0C 1FJGH 4DR5C 4D56A 4X64H 1XRAA 4DR6H 2OBVA 4G37A 3SO4A 4DG9A 4KHPC 4LFCC 5BSMA 4NOZA 4LF9C 3B7WA 1I94C 3SB1A 5AE2A 2FPHX 3PESA 4B3RC 4DV2H 4LF5C 1NYEA 3IMLA 4DR4H 1XNRH 4FUTA 2EGTA 3R44A 1EGAA 3LNVA 1V26A 4WS9A 4DV0H 4DR7C 2VKCA 2VQEH 5FLXW 4RVNA 4ISBA 1RY2A 4DCTA 2BJOA 5T8SA 4OCHA 2D1RA 4NXMC 4G36A 2E0GA 4DUZC 4DV4H 2D28C 5BSRA 2UXBH 3J80D 5BURA 3OTOH 3RV2A 4JI6H 2HHHC 4BC7A 4L7IA 1USPB 3G7SA 4DCVA 2UXCC 5AE3A 1HNXC 3R9XA 4EATA 3T1HH 4OYCA 4X66H 1ULTA 5A2QD 2QVZX 2PN2A 4X65C 2UUBC 5BR8H 3A4IA 4OXIA 3T1YC 2UU9H 2UUAC 4OX9C 4DCSA 1JOSA 4LFAH 2E7GA 1L2FA 4KTTA 5FLXD 4L4QA 3ETCA 5K85A 2O4CA 1PG4A 1HR0H 3GKUA 4NZTM 3H2TA 2KZFA 2E5LH 4LE5A 5K8FA 1XRCA 2Y4NA 4HPVA 2ATWA 4JI4H 3NCVA 2VQFH 3IEVA 3UOWA 1LQLA 2D1SA 4B8CD 5T8TA 4JI2C 3GR0A 3TUFA 4DR2C 4DR1C 1QWIA 3C5EA 3OETA 3I07A 5LMNC 2QVXX 5A1IA 1UKKA 4GS5A 2UUCC 4L2ZA 3TDEA 1ODHA 1K0RA 4B3MC 4LF4C 3E7XA 2D27A 4NXNH 1MD9A 1XMOC 3PROC 2D1TA 4ODJA 5BSVA 1IBLH 5KYTA 4BCAA 1S03G 4K0KH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MTN A;  2EGT A;  2JMP A;  4DV1 C;  1EGA A;  2UXD C;  4LF7 C;  1N32 C;  1FJG C;  4GKJ C;  4DR7 C;  4X64 C;  4NXN C;  2E5L C;  4DCT A;  4DV3 C;  2BJO A;  4NXM C;  4LFB C;  1MKY A;  2YCB A;  4DUZ C;  4DV2 C;  1IBL C;  4MH4 A;  4DV6 C;  4K0K C;  3J80 D;  4DR4 C;  1XNR C;  2HJG A;  4LF8 C;  2HHH C;  4DV0 C;  4DV7 C;  1PA4 A;  1USP B;  2VQE C;  4DCV A;  2UXC C;  1HNX C;  3R9X A;  2CY1 A;  2DYJ A;  4B3S C;  4DR6 C;  3CJE A;  4DV4 C;  2UXB C;  4DUY C;  1XNQ C;  4JV5 C;  2E8C A;  1ML8 A;  5A2Q D;  4JYA C;  2PN2 A;  4X65 C;  4DV5 C;  2UUB C;  1VLA A;  1IBK C;  3T1Y C;  3IEU A;  2CXC A;  1N2F A;  2D7V A;  2ASB A;  2UUA C;  4OX9 C;  2F4V C;  4DCS A;  3AF6 A;  1WH9 A;  1JOS A;  1WF3 A;  4DR3 C;  1HNW C;  1KKG A;  2E7G A;  1L2F A;  5FLX D;  1XMQ C;  3GKU A;  3JAM D;  3LUS A;  1N33 C;  2OPL B;  2ONF A;  2E8F A;  4AQY C;  5BR8 C;  2UU9 C;  5LMU C;  1ZB9 A;  4GKK C;  4JI1 C;  2KZF A;  4YY3 C;  2PT7 G;  2ZM6 C;  4X62 C;  4DCU A;  1ZB8 A;  3OTO C;  2ATW A;  4JI6 C;  1N36 C;  2QL8 A;  4JI3 C;  1HH2 P;  5IWA C;  1HNZ C;  4JI5 C;  3IEV A;  4LFA C;  1LQL A;  4JI2 C;  4JI8 C;  4B3T C;  4DR2 C;  4DR1 C;  1QWI A;  1HR0 C;  3I07 A;  2E8E A;  3T1H C;  4JI7 C;  5LMN C;  1USP A;  4X66 C;  3EER A;  4JI0 C;  1UKK A;  2XR1 A;  4XX2 A;  4YHH C;  1IBM C;  2UUC C;  3R9W A;  1K0R A;  1N34 C;  4B3M C;  2OPL A;  4LF4 C;  4DR5 C;  4JI4 C;  4KHP C;  3AF5 A;  2VQF C;  4LFC C;  1XMO C;  1J5E C;  4NOZ A;  4LF9 C;  1I94 C;  3J81 D;  4LF6 C;  4B3R C;  4LF5 C;  1NYE A;  4BSZ A;  5IT9 D; 
#chains in the Genus database with same CATH topology
 1KHM A;  4MTN A;  4LF8 H;  2F4V H;  1FJG C;  1O92 A;  3L95 X;  2P2R A;  3DLP X;  4X64 C;  2YQR A;  2JE6 I;  3N2Q A;  3ETO A;  2BH1 X;  4LFB C;  1MKY A;  4B3S H;  2YCB A;  1ZZK A;  4AQY H;  4DV2 C;  4RM3 A;  1V25 A;  4DUY H;  1XNQ H;  5A2Q W;  1MXB A;  4DR4 C;  2OPU A;  4X62 H;  1XNR C;  2HJG A;  1J4W A;  4DG8 A;  4PZP A;  5BUQ A;  4I9F A;  4DV0 C;  3S82 A;  3VNR A;  1VBI A;  2CWF A;  3PBK A;  2VQE C;  4D4I A;  5DV9 A;  4DR3 H;  2YX1 A;  1MSZ A;  1T5D X;  4DV4 C;  2UXB C;  3UX3 A;  2YWC A;  4R0M A;  1XMQ H;  3J7A K;  3A9V A;  1N33 H;  4DR5 H;  1IB8 A;  5LMU H;  4GKK H;  2P2M A;  4YY3 H;  1DTJ A;  2ZM6 H;  4WAL A;  1WTJ A;  4EC5 A;  3TR3 A;  3J81 W;  2NN6 G;  4I9G A;  1HNZ H;  4JI5 H;  4RVO A;  1WH9 A;  2ZZN A;  3L8C A;  5IT9 W;  3O2E A;  3GR1 A;  1F0X A;  4JI8 H;  3VKE A;  1NXU A;  4RM2 A;  2OPL B;  5BR8 C;  2UU9 C;  1WE8 A;  5CZV A;  1IBM H;  5A1G A;  1N34 H;  1NY8 A;  2M6Q A;  4PDB A;  3U1K A;  4DUZ H;  4BC9 A;  4LFA C;  4LIJ A;  2CTJ A;  1X9Z A;  2M8W A;  2QVY X;  5GTD A;  2X06 A;  3CW9 A;  1HR0 C;  2Y3M A;  2HHH H;  2JVZ A;  3EER A;  4JI0 C;  2MMA B;  4BA2 I;  4DV1 H;  2UXD H;  1FKA H;  4LF7 H;  1O90 A;  1N32 H;  2CPQ A;  4GKJ H;  2P02 A;  4K0B A;  1XHJ A;  4JI4 C;  2BA0 A;  3AF5 A;  4FJS A;  2VQF C;  3RF2 A;  1J5E C;  4DV3 H;  2P20 A;  3EZJ A;  2KZ0 A;  3KDK A;  4H8A A;  1XS3 A;  2OO4 A;  3J81 D;  1GPM A;  3UOE A;  4LF6 C;  2JEA I;  3GAB A;  2AYA A;  3TQI A;  1M6X C;  5IT9 D;  4JI1 C;  3LGX A;  3NYQ A;  1PQX A;  4DV7 H;  4TPS B;  2NCL A;  2HH3 A;  1LCI A;  4PRO C;  4NXN C;  4G08 A;  1P7L A;  3KXW A;  3JAM W;  2LTM A;  1UWD A;  1VIH A;  1IBL C;  1AMU A;  4JV5 H;  4DV6 C;  3N54 B;  3NI2 A;  4K0K C;  3I0P A;  4JYA H;  5JEA G;  4DV5 H;  4LF8 C;  1IBK H;  4GXR A;  2OPV A;  4BBY A;  4RMN A;  5A19 A;  3NPD A;  2PQU A;  1YJ7 A;  1FLO A;  3LAX A;  3GPC A;  1TUA A;  1O93 A;  1MDF A;  4D4G A;  1SEI A;  4G1I A;  3VNS A;  1HNW H;  4B3S C;  3AEV B;  4DR6 C;  3CJE A;  4RLQ A;  4DUY C;  1XNQ C;  2E3U A;  1MXC A;  2ZQE A;  3QD7 X;  1X4N A;  2UUC H;  1ZTG A;  2DHM A;  1MXA A;  5LL6 b;  1VLA A;  5JRH A;  2Y4O A;  1I6U A;  1T5H X;  3IEU A;  1N2F A;  4PHT A;  2CPM A;  3FAU A;  1EC6 A;  2HH2 A;  5KYV A;  4FJU A;  4FTF A;  4R1L A;  3RG2 A;  5K36 G;  1N36 H;  1FUG A;  3AF6 A;  4JI3 H;  5IWA H;  1WF3 A;  4DR3 C;  1KKG A;  4AIM A;  4OD6 A;  4B3T H;  2MCQ A;  1XMQ C;  2M5H A;  1X4M A;  3JAM D;  4JI7 H;  1N33 C;  4WAN A;  2ONF A;  5LMU C;  1ZB9 A;  4GKK C;  5CZX A;  1RG9 A;  3L7Z C;  4YHH H;  4YY3 C;  2ZM6 C;  1Z2I A;  3I08 A;  3OTO C;  1ZB8 A;  3VNQ A;  4LFB H;  4JI6 C;  3FCC A;  4KHP H;  5DT9 A;  4LFC H;  1HH2 P;  1HNZ C;  4JI5 C;  4WV3 A;  2YWB A;  4LF9 H;  2ANN A;  1I94 H;  4JI8 C;  2VSQ A;  5AE1 A;  1ZZI A;  4B3R H;  5ADZ A;  4LF5 H;  2E8E A;  3T1H C;  2P2Q A;  1USP A;  4X66 C;  4NZR M;  2WD9 A;  5KEI A;  2CTM A;  4XX2 A;  1IBM C;  3R9W A;  5H9U A;  5BUS A;  1N34 C;  4DR7 H;  2OPL A;  1V60 A;  1MDB A;  3FCE A;  2D1Q A;  3LNO A;  4NXM H;  2JA9 A;  4GXQ A;  2Y27 A;  4RLF A;  2ZZM A;  4BSZ A;  3CQ3 A;  5BSW A;  2JMP A;  4PUH A;  4ZJZ A;  4DV1 C;  2UXD C;  5IFI A;  4LF7 C;  1N32 C;  4IR7 A;  5BST A;  4GKJ C;  2V7B A;  1P4E C;  2CWH A;  2E5L C;  2UXC H;  1HNX H;  3DAY A;  4DV3 C;  1O9T A;  3EQ6 A;  4FUQ A;  3CQ1 A;  4MH4 A;  2PY9 A;  2QW0 X;  4X65 H;  2UUB H;  1QM4 A;  1PU1 A;  3T1Y H;  1P4E A;  4DV7 C;  3CW8 X;  3A25 A;  1PA4 A;  4E9J A;  1AN7 A;  2DPL A;  2UUA H;  4OX9 H;  3A9U A;  3OSS D;  3KDG A;  2JEB I;  2CY1 A;  2DYJ A;  2G8Y A;  3V69 A;  2P2B A;  2VZE A;  3DHV A;  4JM1 A;  4B8T A;  1PG3 A;  4JV5 C;  2E8C A;  1ML8 A;  4JI0 H;  2P2J A;  4JYA C;  2CTE A;  4R1M A;  4DV5 C;  1WCJ A;  1M6X A;  1IBK C;  1DT4 A;  2M5O A;  2CXC A;  4KTV A;  2CTL A;  2D7V A;  2CTK A;  1J5E H;  3IPL A;  3NYR A;  2ASB A;  4D57 A;  2F4V C;  4LF6 H;  1HNW C;  4JI2 H;  4JI1 H;  1ZZJ A;  5E7Q A;  4NDN A;  4DR2 H;  1J5K A;  4DR1 H;  5C0X G;  1WVN A;  3LUS A;  4IZ6 A;  2PRO A;  2FMR A;  5LMN H;  2E8F A;  4AQY C;  4ZLP A;  2DGR A;  5BSU A;  2LF0 A;  2Z51 A;  2PT7 G;  2D9I A;  4X62 C;  4DCU A;  4B3M H;  4LF4 H;  2P2F A;  3UZ0 A;  1N36 C;  2QL8 A;  3UEB A;  4JI3 C;  4U5Y D;  5IWA C;  1XMO H;  4DV6 H;  2K1H A;  3J80 W;  1BA3 A;  3GR5 A;  4B3T C;  2CU6 A;  1V8C A;  1XRB A;  2AXY A;  4JI7 C;  3E7W A;  3UX2 A;  2XR1 A;  4YHH C;  2WP0 C;  1FJG H;  4DR5 C;  4D56 A;  2JNV A;  4X64 H;  1XRA A;  4DR6 H;  2OBV A;  4G37 A;  3SO4 A;  4DG9 A;  4KHP C;  4LFC C;  5BSM A;  4NOZ A;  4LF9 C;  3B7W A;  1I94 C;  3SB1 A;  5AE2 A;  2FPH X;  3PES A;  4JVY A;  4B3R C;  4DV2 H;  4LF5 C;  2QND A;  1NYE A;  3IML A;  1VEH A;  4DR4 H;  1XNR H;  4FUT A;  2EGT A;  3R44 A;  1EGA A;  4IFD G;  3LNV A;  1V26 A;  4WS9 A;  4DV0 H;  4DR7 C;  2VKC A;  2LRR A;  3K6R A;  2VQE H;  5FLX W;  4RVN A;  1WHR A;  4ISB A;  1RY2 A;  4DCT A;  2BJO A;  5T8S A;  4OCH A;  2D1R A;  4NXM C;  4G36 A;  2E0G A;  3AY0 A;  4DUZ C;  4DV4 H;  2D28 C;  5BSR A;  2UXB H;  4OO1 G;  3J80 D;  5BUR A;  3OTO H;  3RV2 A;  4JI6 H;  2HHH C;  4BC7 A;  1V9N A;  4BA1 I;  2LTL A;  4AM3 A;  4L7I A;  1USP B;  3G7S A;  4DCV A;  2UXC C;  5AE3 A;  1HNX C;  2MM9 A;  3R9X A;  4EAT A;  3T1H H;  4OYC A;  4X66 H;  1ULT A;  5A2Q D;  1VIG A;  2QVZ X;  2PN2 A;  4X65 C;  2FFM A;  2Z0S A;  2UUB C;  3A26 A;  3A4I A;  4OXI A;  3T1Y C;  5BR8 H;  2ANR A;  2UU9 H;  2UUA C;  4OX9 C;  4DCS A;  2KDN A;  1JOS A;  4LFA H;  1K1G A;  2E7G A;  5LCI A;  1L2F A;  4KTT A;  5FLX D;  4L4Q A;  3ETC A;  5K85 A;  2O4C A;  1PG4 A;  4PUI A;  1HR0 H;  3GKU A;  4NZT M;  3CQ2 A;  1XRH A;  3H2T A;  2KZF A;  2E5L H;  4LE5 A;  5K8F A;  1XRC A;  2Y4N A;  4HPV A;  2ATW A;  4JI4 H;  3NCV A;  2VQF H;  3IEV A;  3UOW A;  4NBQ A;  1LQL A;  2D1S A;  4B8C D;  5T8T A;  4JI2 C;  3GR0 A;  1X0A A;  2JZX A;  2MJH A;  3TUF A;  4DR2 C;  4DR1 C;  2BL5 A;  1QWI A;  3C5E A;  3OET A;  3I07 A;  4JVH A;  5LMN C;  2QVX X;  5A1I A;  2A1S A;  1UKK A;  4GS5 A;  2UUC C;  4L2Z A;  3TDE A;  1ODH A;  1K0R A;  1S20 A;  4B3M C;  4LF4 C;  4QMF B;  3E7X A;  2D27 A;  4NXN H;  1MD9 A;  4PUG A;  1XMO C;  2CTF A;  3PRO C;  2D1T A;  1UG8 A;  4ODJ A;  1TH5 A;  5BSV A;  1IBL H;  5KYT A;  4BCA A;  1S03 G;  4K0K H; 
#chains in the Genus database with same CATH homology
 4MTN A;  4LF8 H;  2F4V H;  1FJG C;  1O92 A;  3L95 X;  3DLP X;  4X64 C;  3N2Q A;  3ETO A;  2BH1 X;  4LFB C;  1MKY A;  4B3S H;  2YCB A;  4AQY H;  4DV2 C;  4RM3 A;  1V25 A;  4DUY H;  1XNQ H;  5A2Q W;  1MXB A;  4DR4 C;  4X62 H;  1XNR C;  2HJG A;  4DG8 A;  4PZP A;  5BUQ A;  4I9F A;  4DV0 C;  3S82 A;  3VNR A;  3PBK A;  2VQE C;  4D4I A;  5DV9 A;  4DR3 H;  1T5D X;  4DV4 C;  2UXB C;  2YWC A;  4R0M A;  1XMQ H;  3J7A K;  3A9V A;  1N33 H;  4DR5 H;  5LMU H;  4GKK H;  2P2M A;  4YY3 H;  2ZM6 H;  4EC5 A;  3J81 W;  4I9G A;  1HNZ H;  4JI5 H;  4RVO A;  1WH9 A;  5IT9 W;  3L8C A;  3GR1 A;  1F0X A;  4JI8 H;  4RM2 A;  2OPL B;  5BR8 C;  2UU9 C;  5CZV A;  1IBM H;  5A1G A;  1N34 H;  4PDB A;  4DUZ H;  4BC9 A;  4LFA C;  1X9Z A;  2QVY X;  5GTD A;  3CW9 A;  1HR0 C;  2Y3M A;  2HHH H;  3EER A;  4JI0 C;  4DV1 H;  2UXD H;  1FKA H;  4LF7 H;  1O90 A;  1N32 H;  4GKJ H;  2P02 A;  4K0B A;  4JI4 C;  3AF5 A;  2VQF C;  3RF2 A;  1J5E C;  4DV3 H;  2P20 A;  3EZJ A;  3KDK A;  2OO4 A;  3J81 D;  1GPM A;  4LF6 C;  3GAB A;  2AYA A;  3TQI A;  5IT9 D;  4JI1 C;  3LGX A;  3NYQ A;  4DV7 H;  4TPS B;  1LCI A;  4PRO C;  4NXN C;  4G08 A;  1P7L A;  3KXW A;  3JAM W;  1IBL C;  1AMU A;  4JV5 H;  4DV6 C;  3N54 B;  3NI2 A;  4K0K C;  4JYA H;  4DV5 H;  4LF8 C;  1IBK H;  4GXR A;  4BBY A;  4RMN A;  5A19 A;  3NPD A;  1YJ7 A;  3LAX A;  3GPC A;  1O93 A;  1MDF A;  4D4G A;  1SEI A;  4G1I A;  3VNS A;  1HNW H;  4B3S C;  4DR6 C;  3CJE A;  4RLQ A;  4DUY C;  1XNQ C;  2ZQE A;  1MXC A;  3QD7 X;  2UUC H;  1MXA A;  5LL6 b;  1VLA A;  5JRH A;  2Y4O A;  1I6U A;  1T5H X;  3IEU A;  1N2F A;  4PHT A;  3FAU A;  5KYV A;  4FTF A;  4R1L A;  3RG2 A;  1N36 H;  1FUG A;  3AF6 A;  4JI3 H;  5IWA H;  1WF3 A;  4DR3 C;  1KKG A;  4OD6 A;  4B3T H;  1XMQ C;  3JAM D;  4JI7 H;  1N33 C;  2ONF A;  5LMU C;  1ZB9 A;  4GKK C;  5CZX A;  1RG9 A;  4YHH H;  4YY3 C;  2ZM6 C;  3I08 A;  3OTO C;  1ZB8 A;  3VNQ A;  4LFB H;  4JI6 C;  3FCC A;  4KHP H;  5DT9 A;  4LFC H;  1HH2 P;  1HNZ C;  4JI5 C;  4WV3 A;  2YWB A;  4LF9 H;  1I94 H;  4JI8 C;  2VSQ A;  5AE1 A;  4B3R H;  5ADZ A;  4LF5 H;  2E8E A;  3T1H C;  2P2Q A;  1USP A;  4X66 C;  4NZR M;  2WD9 A;  5KEI A;  4XX2 A;  1IBM C;  3R9W A;  5H9U A;  5BUS A;  1N34 C;  4DR7 H;  2OPL A;  1MDB A;  3FCE A;  2D1Q A;  4NXM H;  4GXQ A;  2Y27 A;  4RLF A;  4BSZ A;  5BSW A;  2JMP A;  4ZJZ A;  4DV1 C;  2UXD C;  5IFI A;  4LF7 C;  1N32 C;  4IR7 A;  5BST A;  4GKJ C;  2V7B A;  2E5L C;  2UXC H;  1HNX H;  3DAY A;  4DV3 C;  1O9T A;  3EQ6 A;  4FUQ A;  4MH4 A;  2QW0 X;  4X65 H;  2UUB H;  1QM4 A;  3T1Y H;  4DV7 C;  3CW8 X;  1PA4 A;  4E9J A;  1AN7 A;  2DPL A;  2UUA H;  4OX9 H;  3A9U A;  3OSS D;  3KDG A;  2CY1 A;  2DYJ A;  2P2B A;  2VZE A;  3DHV A;  4JM1 A;  4JI0 H;  1PG3 A;  4JV5 C;  2E8C A;  1ML8 A;  2P2J A;  4JYA C;  4R1M A;  4DV5 C;  1IBK C;  2CXC A;  4KTV A;  1J5E H;  2D7V A;  3IPL A;  3NYR A;  2ASB A;  4D57 A;  2F4V C;  4LF6 H;  1HNW C;  4JI2 H;  4JI1 H;  5E7Q A;  4NDN A;  4DR2 H;  4DR1 H;  3LUS A;  4IZ6 A;  2PRO A;  5LMN H;  2E8F A;  4AQY C;  4ZLP A;  5BSU A;  2LF0 A;  2PT7 G;  2D9I A;  4X62 C;  4DCU A;  4B3M H;  4LF4 H;  2P2F A;  3UZ0 A;  1N36 C;  2QL8 A;  4JI3 C;  4U5Y D;  5IWA C;  1XMO H;  4DV6 H;  3J80 W;  1BA3 A;  3GR5 A;  4B3T C;  1XRB A;  4JI7 C;  3E7W A;  2XR1 A;  4YHH C;  2WP0 C;  1FJG H;  4DR5 C;  4D56 A;  4X64 H;  1XRA A;  4DR6 H;  2OBV A;  4G37 A;  3SO4 A;  4DG9 A;  4KHP C;  4LFC C;  5BSM A;  4NOZ A;  4LF9 C;  3B7W A;  1I94 C;  3SB1 A;  5AE2 A;  2FPH X;  3PES A;  4B3R C;  4DV2 H;  4LF5 C;  1NYE A;  3IML A;  4DR4 H;  1XNR H;  4FUT A;  2EGT A;  3R44 A;  1EGA A;  3LNV A;  1V26 A;  4WS9 A;  4DV0 H;  4DR7 C;  2VKC A;  2VQE H;  5FLX W;  4RVN A;  4ISB A;  1RY2 A;  4DCT A;  2BJO A;  5T8S A;  4OCH A;  2D1R A;  4NXM C;  4G36 A;  2E0G A;  4DUZ C;  4DV4 H;  2D28 C;  5BSR A;  2UXB H;  3J80 D;  5BUR A;  3OTO H;  3RV2 A;  4JI6 H;  2HHH C;  4BC7 A;  4L7I A;  1USP B;  3G7S A;  4DCV A;  2UXC C;  5AE3 A;  1HNX C;  3R9X A;  4EAT A;  3T1H H;  4OYC A;  4X66 H;  1ULT A;  5A2Q D;  2QVZ X;  2PN2 A;  4X65 C;  2UUB C;  5BR8 H;  3A4I A;  4OXI A;  3T1Y C;  2UU9 H;  2UUA C;  4OX9 C;  4DCS A;  1JOS A;  4LFA H;  2E7G A;  1L2F A;  4KTT A;  5FLX D;  4L4Q A;  3ETC A;  5K85 A;  2O4C A;  1PG4 A;  1HR0 H;  3GKU A;  4NZT M;  3H2T A;  2KZF A;  2E5L H;  4LE5 A;  5K8F A;  1XRC A;  2Y4N A;  4HPV A;  2ATW A;  4JI4 H;  3NCV A;  2VQF H;  3IEV A;  3UOW A;  1LQL A;  2D1S A;  4B8C D;  5T8T A;  4JI2 C;  3GR0 A;  3TUF A;  4DR2 C;  4DR1 C;  1QWI A;  3C5E A;  3OET A;  3I07 A;  5LMN C;  2QVX X;  5A1I A;  1UKK A;  4GS5 A;  2UUC C;  4L2Z A;  3TDE A;  1ODH A;  1K0R A;  4B3M C;  4LF4 C;  3E7X A;  2D27 A;  4NXN H;  1MD9 A;  1XMO C;  3PRO C;  2D1T A;  4ODJ A;  5BSV A;  1IBL H;  5KYT A;  4BCA A;  1S03 G;  4K0K H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...