2PT7G

Crystal structure of cag virb11 (hp0525) and an inhibitory protein (hp1451)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
145
structure length
145
Chain Sequence
KLHEIKQELKDLFSHLPYKINKVEVSLYEPGVLLIDIDGEDSALLIGEKGYRYKALSYLLFNWIHPTYGYSIRLEISTFLQNQEKVMDTQLQSVIMTVHEVGKGQMKAPDGVLTYIALKKLRKAFPNKYVSIKTNLNDEKYIVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cag-alfa
publication title Identification, structure and mode of action of a new regulator of the Helicobacter pylori HP0525 ATPase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/protein binding
total genus 44
structure length 145
sequence length 145
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF18472 HP1451_C HP1451 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2pt7G01
3.30.1370.180 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2pt7G02
2OPLA 4DUZC 3R9WA 3CJEA 2VQEC 1ML8A 2UXCC 5LMUC 4NXNC 3GKUA 4BSZA 2CXCA 4X65C 1I94C 2HHHC 4DR7C 4MTNA 2E7GA 4DUYC 1KKGA 4JV5C 4LF6C 3AF5A 2E5LC 4NOZA 2E8FA 1USPB 1VLAA 5A2QD 4JI8C 4DV6C 1PA4A 4DV2C 1K0RA 3IEUA 5BR8C 1HNXC 4B3TC 4B3RC 4LF7C 3LUSA 4JI7C 4JYAC 2KZFA 4DV0C 2F4VC 4DV1C 2DYJA 4MH4A 1WF3A 4JI5C 3JAMD 1N33C 4LF4C 1NYEA 4DR5C 1IBKC 4KHPC 1HNZC 4X64C 3T1HC 2UUAC 4GKKC 3T1YC 4DR2C 2EGTA 3OTOC 4DV4C 1ZB9A 4JI6C 1HNWC 3R9XA 4YHHC 2QL8A 4XX2A 2OPLB 2YCBA 4DR1C 2ASBA 4DCVA 2E8EA 2UXBC 4LFCC 5LMNC 4JI4C 3EERA 4B3MC 2VQFC 4DV7C 2UUBC 4DR6C 4DCUA 4DV3C 2ZM6C 1N36C 1XMQC 4YY3C 1LQLA 2E8CA 4OX9C 2BJOA 2CY1A 2ONFA 3J80D 1EGAA 4LF5C 2D7VA 4X62C 4K0KC 1IBLC 4NXMC 1IBMC 2HJGA 2UUCC 1UKKA 1USPA 4AQYC 4JI0C 5IWAC 1HH2P 5IT9D 1QWIA 1L2FA 4DR3C 4X66C 2JMPA 1ZB8A 4DR4C 1JOSA 4DCTA 4B3SC 4LFBC 2UU9C 2ATWA 1MKYA 1XNRC 4JI1C 4DV5C 1N2FA 4LF9C 4DCSA 4LF8C 1XNQC 2UXDC 1FJGC 2XR1A 5FLXD 3J81D 2PT7G 3IEVA 4LFAC 1XMOC 1N34C 1WH9A 2PN2A 4GKJC 1HR0C 3AF6A 4JI3C 1J5EC 1N32C 3I07A 4JI2C
chains in the Genus database with same CATH superfamily
5T8SA 1AN7A 2JZXA 1KHMA 4GKKH 2JA9A 4E9JA 4LF6H 1FLOA 2FFMA 4DV4H 3CQ3A 4L4QA 2CXCA 3CQ2A 4G37A 1J5KA 4BBYA 1I94C 4DR7C 4DUYC 1MXBA 4JV5C 2WD9A 1T5DX 2CU6A 4GS5A 5T8TA 1RG9A 2HH3A 2PQUA 1PU1A 1XRAA 5AE3A 1QM4A 1P4EC 2F4VH 1PQXA 1VLAA 5A2QD 4DV1H 4R1MA 2LTMA 1XMQH 3RG2A 1HNXC 1TUAA 2P2JA 1XRHA 4PUGA 4LF5H 4X62H 2UUAH 4PUHA 1WCJA 3NPDA 3UX3A 1NXUA 1IBKC 2M6QA 5IWAH 4JVYA 2HH2A 2X06A 4DR1H 2D1TA 3RF2A 5IFIA 3T1YC 4DR2C 3S82A 3A26A 2CWHA 2YWBA 4JI6C 1VBIA 5DV9A 3VNQA 1HNWC 4H8AA 4YHHC 3KDGA 4YY3H 3AEVB 2E8EA 2UXBC 4LFCC 1WVNA 2KDNA 1M6XC 1XHJA 4LF9H 3EERA 5A1GA 2VQFC 2YQRA 1FJGH 1PG3A 2Y27A 2ZM6C 3IMLA 3TDEA 4OX9C 2K1HA 2ONFA 3J80D 2UUCH 3OETA 2D7VA 2OO4A 4NXMC 2QVXX 4U5YD 4X66H 1Z2IA 4DR4H 1EC6A 2HJGA 4PZPA 2O4CA 1USPA 1YJ7A 5H9UA 2MCQA 1HH2P 5IT9D 2DGRA 3GR1A 4DR7H 4DUYH 3UOWA 2D28C 1JOSA 4B3SC 4BA1I 2UXDH 4I9FA 3R44A 3K6RA 3LGXA 1XNRC 5K8FA 1NY8A 3C5EA 5BSVA 2ZZNA 1X9ZA 2M8WA 4DV5C 1N2FA 3NCVA 2P02A 4JM1A 2PT7G 1N34C 1WH9A 4TPSB 2CTJA 4WANA 4OO1G 2ZZMA 1HR0C 1LCIA 4JI3C 5LMNC 2OPLA 1IBKH 4X65H 1J4WA 4G36A 2VQEC 2QNDA 1PG4A 1ML8A 2CPQA 3GKUA 4DR2H 4WV3A 2JNVA 5E7QA 1V8CA 2CTKA 4JI6H 4BSZA 3IPLA 4RLQA 4YHHH 1X0AA 4OCHA 4OXIA 5DT9A 5BR8H 4LFCH 4BA2I 4JI7H 2P20A 2VQFH 3A9VA 3IEUA 2JEBI 2D1QA 4LF7C 3LUSA 4OX9H 2KZFA 4DV0C 3TR3A 4X64H 4G08A 4G1IA 3UEBA 4IFDG 4FTFA 4JI5C 1V26A 3JAMW 4LF4C 3N54B 5BSWA 1P4EA 1MXCA 1MSZA 4KHPC 1ZZKA 4WS9A 1HNZC 4AIMA 3CW8X 3G7SA 2MJHA 2DPLA 3T1HC 1WHRA 3OTOC 3B7WA 4JI4H 2QW0X 4DV7H 4B3SH 2QL8A 4WALA 4D4IA 1V9NA 1WE8A 4DCVA 4EC5A 4DV5H 2CTMA 4B3MC 4RM3A 5ADZA 2UUBC 4DR6C 4DCUA 4DV3C 4K0KH 1N36C 1N34H 1O9TA 5JRHA 3PESA 5LCIA 5BUQA 4JI3H 1FUGA 4DR3H 1IBLC 4PDBA 1T5HX 1IBMC 1V25A 3KXWA 2Y4OA 1M6XA 4RVNA 4RMNA 1UKKA 3OSSD 4AQYC 4JI0C 2E3UA 3J7AK 1QWIA 3FCCA 4ZLPA 3DLPX 4JI1H 2LTLA 4IR7A 4GXRA 1FKAH 1DT4A 4ZJZA 4DCTA 2ATWA 3A9UA 3NYRA 5BUSA 2WP0C 3ETOA 4EATA 4LF8C 4LF7H 1XNQC 4DV0H 3J81D 5FLXW 4OD6A 1TH5A 4GKJC 1XMOC 3SO4A 1UG8A 2D9IA 4LF4H 3PROC 5A1IA 3AF6A 1J5EC 4K0BA 2D27A 5GTDA 1N32C 4JI2C 4LFBC 4KHPH 4PUIA 1I94H 4DUZC 1HNZH 2Z0SA 3R9WA 2NN6G 3CJEA 4JV5H 3T1HH 2UXCC 5LMUC 3L8CA 4DG8A 1VIGA 2MMAB 1S20A 3OTOH 5CZVA 3EQ6A 3H2TA 2JEAI 2HHHC 1KKGA 2P2BA 4D57A 1HNXH 4LIJA 4LF6C 3DHVA 3AF5A 4OYCA 3NI2A 2YX1A 3L7ZC 2E8FA 4B3MH 2UUBH 1XRCA 1SEIA 4DV3H 2AYAA 5A2QW 1PA4A 3TUFA 4DV2C 1K0RA 3V69A 4B3RC 1GPMA 3VNRA 5KEIA 5KYTA 2P2MA 4JYAC 2OBVA 2F4VC 3LAXA 3AY0A 4DV1C 1IBLH 2DYJA 4MH4A 4QMFB 2M5HA 3T1YH 4BCAA 1N33C 2OPUA 1ZTGA 1S03G 4R0MA 2FMRA 4DR5C 3RV2A 1HNWH 4AQYH 4JI0H 4NBQA 2V7BA 2Y4NA 4PROC 2UUAC 2ZQEA 4B8CD 2UXBH 1AMUA 4D4GA 2P2QA 1ZB9A 1ULTA 4ISBA 3R9XA 2ZM6H 2YCBA 4DR1C 2ASBA 4KTTA 4PHTA 2ANNA 1F0XA 1RY2A 2LF0A 4LF8H 4NXMH 4JVHA 2Y3MA 3CQ1A 5C0XG 4YY3C 5BSTA 2NCLA 1LQLA 4AM3A 2E8CA 2BJOA 2CWFA 3J80W 1J5EH 2FPHX 1N32H 4LFBH 1O93A 3NYQA 4D56A 2UXCH 4L7IA 5LMUH 5BSUA 2UUCC 3FAUA 3QD7X 1VIHA 1MXAA 1L2FA 5IT9W 1XNRH 2VZEA 2HHHH 1ZZIA 4X66C 2JMPA 2YWCA 4DR4C 2LRRA 2AXYA 3L95X 2Z51A 2UU9C 2P2RA 3GR0A 2G8YA 4DV2H 2M5OA 1HR0H 4B3RH 5AE2A 2UXDC 4JYAH 2CTFA 5LMNH 1XRBA 4B8TA 2E0GA 4LFAC 2PN2A 3UZ0A 2D1SA 3GABA 2QVYX 2VQEH 3UX2A 2CTLA 3PBKA 4KTVA 1N33H 3GPCA 2PY9A 4DR5H 3I07A 4DV6C 1X4MA 2VKCA 4NZTM 4BC7A 3E7WA 1X4NA 4NXNC 5BSRA 3ETCA 4X65C 3KDKA 4MTNA 2E7GA 3E7XA 5KYVA 1XS3A 2E5LC 4NOZA 1USPB 5AE1A 4JI8C 1DTJA 4JI5H 5BURA 5BR8C 4B3TC 4JI7C 4FJSA 1VEHA 4DG9A 4IZ6A 5BSMA 1WF3A 3DAYA 3JAMD 2BA0A 5JEAG 4I9GA 4RVOA 1NYEA 1K1GA 5A19A 1MDBA 4X64C 4GKKC 3U1KA 3I08A 2D1RA 2EGTA 4DV4C 4DR6H 3A4IA 2UU9H 3N2QA 4XX2A 2OPLB 4GXQA 1N36H 2MM9A 3VKEA 2VSQA 4ODJA 1I6UA 2P2FA 3TQIA 4JI4C 4DV7C 3I0PA 1BA3A 3A25A 1V60A 2JVZA 3EZJA 4LFAH 3SB1A 1XMQC 1IBMH 1O90A 2QVZX 1UWDA 3LNOA 3LNVA 2A1SA 2CY1A 2CTEA 2OPVA 1EGAA 3GR5A 4LF5C 4X62C 4K0KC 4DV6H 2KZ0A 4RM2A 2ANRA 4FJUA 1MD9A 4NZRM 5K36G 4NXNH 4NDNA 4FUQA 5IWAC 3CW9A 4HPVA 1IB8A 4DR3C 1O92A 2BL5A 1MDFA 1ZB8A 3O2EA 1XNQH 3FCEA 2E5LH 2CPMA 1ZZJA 2DHMA 1MKYA 4BC9A 4GKJH 1XMOH 4JI1C 4JI8H 1ODHA 2JE6I 5LL6b 4RLFA 4B3TH 4LF9C 5CZXA 4DCSA 1P7LA 3UOEA 2BH1X 1FJGC 2XR1A 5FLXD 4JI2H 3VNSA 3J81W 3IEVA 5K85A 4FUTA 4DUZH 4LE5A 2PROA 4R1LA 4L2ZA 1WTJA
chains in the Genus database with same CATH topology
5T8SA 1AN7A 4GKKH 4E9JA 4LF6H 4DV4H 4L4QA 2CXCA 4G37A 4BBYA 1I94C 4DR7C 4DUYC 1MXBA 4JV5C 2WD9A 1T5DX 4GS5A 5T8TA 1RG9A 1XRAA 5AE3A 1QM4A 2F4VH 1VLAA 5A2QD 4DV1H 4R1MA 1XMQH 3RG2A 1HNXC 2P2JA 4LF5H 4X62H 2UUAH 3NPDA 1IBKC 5IWAH 4DR1H 2D1TA 3RF2A 5IFIA 3T1YC 4DR2C 3S82A 2YWBA 4JI6C 5DV9A 3VNQA 1HNWC 4YHHC 3KDGA 4YY3H 2E8EA 2UXBC 4LFCC 4LF9H 3EERA 5A1GA 2VQFC 1FJGH 1PG3A 2Y27A 2ZM6C 3IMLA 3TDEA 4OX9C 2ONFA 3J80D 2UUCH 3OETA 2D7VA 2OO4A 4NXMC 2QVXX 4U5YD 4X66H 4DR4H 2HJGA 4PZPA 2O4CA 1USPA 1YJ7A 5H9UA 1HH2P 5IT9D 3GR1A 4DR7H 4DUYH 3UOWA 2D28C 1JOSA 4B3SC 2UXDH 4I9FA 3R44A 3LGXA 1XNRC 5K8FA 5BSVA 3C5EA 1X9ZA 4DV5C 1N2FA 3NCVA 2P02A 4JM1A 2PT7G 1N34C 1WH9A 4TPSB 1HR0C 1LCIA 4JI3C 5LMNC 2OPLA 1IBKH 4X65H 4G36A 2VQEC 1PG4A 1ML8A 3GKUA 4DR2H 4WV3A 5E7QA 4JI6H 4BSZA 3IPLA 4RLQA 4YHHH 4OCHA 4OXIA 5DT9A 5BR8H 4LFCH 4JI7H 2P20A 2VQFH 3A9VA 3IEUA 2D1QA 4LF7C 3LUSA 4OX9H 2KZFA 4DV0C 4X64H 4G08A 4G1IA 4FTFA 4JI5C 1V26A 3JAMW 4LF4C 3N54B 5BSWA 1MXCA 4KHPC 4WS9A 1HNZC 3CW8X 3G7SA 2DPLA 3T1HC 3OTOC 3B7WA 4JI4H 2QW0X 4DV7H 4B3SH 2QL8A 4D4IA 4DCVA 4EC5A 4DV5H 4B3MC 4RM3A 5ADZA 2UUBC 4DR6C 4DCUA 4DV3C 4K0KH 1N36C 1N34H 1O9TA 5JRHA 3PESA 5BUQA 4JI3H 1FUGA 4DR3H 1IBLC 4PDBA 1T5HX 1IBMC 1V25A 3KXWA 2Y4OA 4RVNA 4RMNA 1UKKA 3OSSD 4AQYC 4JI0C 3J7AK 1QWIA 3FCCA 4ZLPA 3DLPX 4JI1H 4IR7A 4GXRA 1FKAH 4ZJZA 4DCTA 2ATWA 3A9UA 3NYRA 5BUSA 2WP0C 3ETOA 4EATA 4LF8C 4LF7H 1XNQC 4DV0H 3J81D 5FLXW 4OD6A 4GKJC 1XMOC 3SO4A 2D9IA 4LF4H 3PROC 5A1IA 3AF6A 1J5EC 4K0BA 2D27A 5GTDA 1N32C 4JI2C 4LFBC 4KHPH 1I94H 4DUZC 1HNZH 3R9WA 3CJEA 4JV5H 3T1HH 2UXCC 5LMUC 3L8CA 4DG8A 3OTOH 5CZVA 3EQ6A 3H2TA 2HHHC 1KKGA 2P2BA 4D57A 1HNXH 4LF6C 3DHVA 3AF5A 4OYCA 3NI2A 2E8FA 4B3MH 2UUBH 1XRCA 1SEIA 4DV3H 2AYAA 5A2QW 1PA4A 3TUFA 4DV2C 1K0RA 4B3RC 1GPMA 3VNRA 5KEIA 5KYTA 2P2MA 4JYAC 2OBVA 2F4VC 3LAXA 4DV1C 1IBLH 2DYJA 4MH4A 3T1YH 4BCAA 1N33C 1S03G 4R0MA 4DR5C 3RV2A 1HNWH 4AQYH 4JI0H 2V7BA 2Y4NA 4PROC 2UUAC 2ZQEA 4B8CD 2UXBH 1AMUA 4D4GA 2P2QA 1ZB9A 1ULTA 4ISBA 3R9XA 2ZM6H 2YCBA 4DR1C 2ASBA 4KTTA 4PHTA 1F0XA 1RY2A 2LF0A 4LF8H 4NXMH 2Y3MA 4YY3C 5BSTA 1LQLA 2E8CA 2BJOA 3J80W 1J5EH 2FPHX 1N32H 4LFBH 1O93A 3NYQA 4D56A 2UXCH 4L7IA 5LMUH 5BSUA 2UUCC 3FAUA 3QD7X 1MXAA 1L2FA 5IT9W 1XNRH 2VZEA 2HHHH 4X66C 2JMPA 2YWCA 4DR4C 3L95X 2UU9C 3GR0A 4DV2H 1HR0H 4B3RH 5AE2A 2UXDC 4JYAH 5LMNH 1XRBA 2E0GA 4LFAC 2PN2A 3UZ0A 2D1SA 3GABA 2QVYX 2VQEH 3PBKA 4KTVA 1N33H 3GPCA 4DR5H 4DV6C 3I07A 2VKCA 4NZTM 4BC7A 3E7WA 4NXNC 5BSRA 3ETCA 4X65C 3KDKA 4MTNA 2E7GA 3E7XA 5KYVA 2E5LC 4NOZA 1USPB 5AE1A 4JI8C 4JI5H 5BURA 5BR8C 4B3TC 4JI7C 4DG9A 4IZ6A 5BSMA 1WF3A 3DAYA 3JAMD 4I9GA 4RVOA 1NYEA 5A19A 1MDBA 4X64C 4GKKC 3I08A 2D1RA 2EGTA 4DV4C 4DR6H 3A4IA 2UU9H 3N2QA 4XX2A 2OPLB 4GXQA 1N36H 2VSQA 4ODJA 1I6UA 2P2FA 3TQIA 4JI4C 4DV7C 1BA3A 3EZJA 4LFAH 3SB1A 1XMQC 1IBMH 1O90A 2QVZX 3LNVA 2CY1A 1EGAA 3GR5A 4LF5C 4X62C 4K0KC 4DV6H 4RM2A 1MD9A 4NZRM 4NXNH 4NDNA 4FUQA 5IWAC 3CW9A 4HPVA 4DR3C 1O92A 1MDFA 1ZB8A 1XNQH 3FCEA 2E5LH 1MKYA 4BC9A 4GKJH 1XMOH 4JI1C 4JI8H 1ODHA 5LL6b 4RLFA 4B3TH 4LF9C 5CZXA 4DCSA 1P7LA 2BH1X 1FJGC 2XR1A 5FLXD 4JI2H 3VNSA 3J81W 3IEVA 5K85A 4FUTA 4DUZH 4LE5A 2PROA 4R1LA 4L2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPL A;  4DUZ C;  3R9W A;  3CJE A;  2VQE C;  1ML8 A;  2UXC C;  5LMU C;  4NXN C;  3GKU A;  4BSZ A;  2CXC A;  4X65 C;  1I94 C;  2HHH C;  4DR7 C;  4MTN A;  2E7G A;  4DUY C;  1KKG A;  4JV5 C;  4LF6 C;  3AF5 A;  2E5L C;  4NOZ A;  2E8F A;  1USP B;  1VLA A;  5A2Q D;  4JI8 C;  4DV6 C;  1PA4 A;  4DV2 C;  1K0R A;  3IEU A;  5BR8 C;  1HNX C;  4B3T C;  4B3R C;  4LF7 C;  3LUS A;  4JI7 C;  4JYA C;  2KZF A;  4DV0 C;  2F4V C;  4DV1 C;  2DYJ A;  4MH4 A;  1WF3 A;  4JI5 C;  3JAM D;  1N33 C;  4LF4 C;  1NYE A;  4DR5 C;  1IBK C;  4KHP C;  1HNZ C;  4X64 C;  3T1H C;  2UUA C;  4GKK C;  3T1Y C;  4DR2 C;  2EGT A;  3OTO C;  4DV4 C;  1ZB9 A;  4JI6 C;  1HNW C;  3R9X A;  4YHH C;  2QL8 A;  4XX2 A;  2OPL B;  2YCB A;  4DR1 C;  2ASB A;  4DCV A;  2E8E A;  2UXB C;  4LFC C;  5LMN C;  4JI4 C;  3EER A;  4B3M C;  2VQF C;  4DV7 C;  2UUB C;  4DR6 C;  4DCU A;  4DV3 C;  2ZM6 C;  1N36 C;  1XMQ C;  4YY3 C;  1LQL A;  2E8C A;  4OX9 C;  2BJO A;  2CY1 A;  2ONF A;  3J80 D;  1EGA A;  4LF5 C;  2D7V A;  4X62 C;  4K0K C;  1IBL C;  4NXM C;  1IBM C;  2HJG A;  2UUC C;  1UKK A;  1USP A;  4AQY C;  4JI0 C;  5IWA C;  1HH2 P;  5IT9 D;  1QWI A;  1L2F A;  4DR3 C;  4X66 C;  2JMP A;  1ZB8 A;  4DR4 C;  1JOS A;  4DCT A;  4B3S C;  4LFB C;  2UU9 C;  2ATW A;  1MKY A;  1XNR C;  4JI1 C;  4DV5 C;  1N2F A;  4LF9 C;  4DCS A;  4LF8 C;  1XNQ C;  2UXD C;  1FJG C;  2XR1 A;  5FLX D;  3J81 D;  2PT7 G;  3IEV A;  4LFA C;  1XMO C;  1N34 C;  1WH9 A;  2PN2 A;  4GKJ C;  1HR0 C;  3AF6 A;  4JI3 C;  1J5E C;  1N32 C;  3I07 A;  4JI2 C; 
#chains in the Genus database with same CATH topology
 5T8S A;  1AN7 A;  2JZX A;  1KHM A;  4GKK H;  2JA9 A;  4E9J A;  4LF6 H;  1FLO A;  2FFM A;  4DV4 H;  3CQ3 A;  4L4Q A;  2CXC A;  3CQ2 A;  4G37 A;  1J5K A;  4BBY A;  1I94 C;  4DR7 C;  4DUY C;  1MXB A;  4JV5 C;  2WD9 A;  1T5D X;  2CU6 A;  4GS5 A;  5T8T A;  1RG9 A;  2HH3 A;  2PQU A;  1PU1 A;  1XRA A;  5AE3 A;  1QM4 A;  1P4E C;  2F4V H;  1PQX A;  1VLA A;  5A2Q D;  4DV1 H;  4R1M A;  2LTM A;  1XMQ H;  3RG2 A;  1HNX C;  1TUA A;  2P2J A;  1XRH A;  4PUG A;  4LF5 H;  4X62 H;  2UUA H;  4PUH A;  1WCJ A;  3NPD A;  3UX3 A;  1NXU A;  1IBK C;  2M6Q A;  5IWA H;  4JVY A;  2HH2 A;  2X06 A;  4DR1 H;  2D1T A;  3RF2 A;  5IFI A;  3T1Y C;  4DR2 C;  3S82 A;  3A26 A;  2CWH A;  2YWB A;  4JI6 C;  1VBI A;  5DV9 A;  3VNQ A;  1HNW C;  4H8A A;  4YHH C;  3KDG A;  4YY3 H;  3AEV B;  2E8E A;  2UXB C;  4LFC C;  1WVN A;  2KDN A;  1M6X C;  1XHJ A;  4LF9 H;  3EER A;  5A1G A;  2VQF C;  2YQR A;  1FJG H;  1PG3 A;  2Y27 A;  2ZM6 C;  3IML A;  3TDE A;  4OX9 C;  2K1H A;  2ONF A;  3J80 D;  2UUC H;  3OET A;  2D7V A;  2OO4 A;  4NXM C;  2QVX X;  4U5Y D;  4X66 H;  1Z2I A;  4DR4 H;  1EC6 A;  2HJG A;  4PZP A;  2O4C A;  1USP A;  1YJ7 A;  5H9U A;  2MCQ A;  1HH2 P;  5IT9 D;  2DGR A;  3GR1 A;  4DR7 H;  4DUY H;  3UOW A;  2D28 C;  1JOS A;  4B3S C;  4BA1 I;  2UXD H;  4I9F A;  3R44 A;  3K6R A;  3LGX A;  1XNR C;  5K8F A;  1NY8 A;  3C5E A;  5BSV A;  2ZZN A;  1X9Z A;  2M8W A;  4DV5 C;  1N2F A;  3NCV A;  2P02 A;  4JM1 A;  2PT7 G;  1N34 C;  1WH9 A;  4TPS B;  2CTJ A;  4WAN A;  4OO1 G;  2ZZM A;  1HR0 C;  1LCI A;  4JI3 C;  5LMN C;  2OPL A;  1IBK H;  4X65 H;  1J4W A;  4G36 A;  2VQE C;  2QND A;  1PG4 A;  1ML8 A;  2CPQ A;  3GKU A;  4DR2 H;  4WV3 A;  2JNV A;  5E7Q A;  1V8C A;  2CTK A;  4JI6 H;  4BSZ A;  3IPL A;  4RLQ A;  4YHH H;  1X0A A;  4OCH A;  4OXI A;  5DT9 A;  5BR8 H;  4LFC H;  4BA2 I;  4JI7 H;  2P20 A;  2VQF H;  3A9V A;  3IEU A;  2JEB I;  2D1Q A;  4LF7 C;  3LUS A;  4OX9 H;  2KZF A;  4DV0 C;  3TR3 A;  4X64 H;  4G08 A;  4G1I A;  3UEB A;  4IFD G;  4FTF A;  4JI5 C;  1V26 A;  3JAM W;  4LF4 C;  3N54 B;  5BSW A;  1P4E A;  1MXC A;  1MSZ A;  4KHP C;  1ZZK A;  4WS9 A;  1HNZ C;  4AIM A;  3CW8 X;  3G7S A;  2MJH A;  2DPL A;  3T1H C;  1WHR A;  3OTO C;  3B7W A;  4JI4 H;  2QW0 X;  4DV7 H;  4B3S H;  2QL8 A;  4WAL A;  4D4I A;  1V9N A;  1WE8 A;  4DCV A;  4EC5 A;  4DV5 H;  2CTM A;  4B3M C;  4RM3 A;  5ADZ A;  2UUB C;  4DR6 C;  4DCU A;  4DV3 C;  4K0K H;  1N36 C;  1N34 H;  1O9T A;  5JRH A;  3PES A;  5LCI A;  5BUQ A;  4JI3 H;  1FUG A;  4DR3 H;  1IBL C;  4PDB A;  1T5H X;  1IBM C;  1V25 A;  3KXW A;  2Y4O A;  1M6X A;  4RVN A;  4RMN A;  1UKK A;  3OSS D;  4AQY C;  4JI0 C;  2E3U A;  3J7A K;  1QWI A;  3FCC A;  4ZLP A;  3DLP X;  4JI1 H;  2LTL A;  4IR7 A;  4GXR A;  1FKA H;  1DT4 A;  4ZJZ A;  4DCT A;  2ATW A;  3A9U A;  3NYR A;  5BUS A;  2WP0 C;  3ETO A;  4EAT A;  4LF8 C;  4LF7 H;  1XNQ C;  4DV0 H;  3J81 D;  5FLX W;  4OD6 A;  1TH5 A;  4GKJ C;  1XMO C;  3SO4 A;  1UG8 A;  2D9I A;  4LF4 H;  3PRO C;  5A1I A;  3AF6 A;  1J5E C;  4K0B A;  2D27 A;  5GTD A;  1N32 C;  4JI2 C;  4LFB C;  4KHP H;  4PUI A;  1I94 H;  4DUZ C;  1HNZ H;  2Z0S A;  3R9W A;  2NN6 G;  3CJE A;  4JV5 H;  3T1H H;  2UXC C;  5LMU C;  3L8C A;  4DG8 A;  1VIG A;  2MMA B;  1S20 A;  3OTO H;  5CZV A;  3EQ6 A;  3H2T A;  2JEA I;  2HHH C;  1KKG A;  2P2B A;  4D57 A;  1HNX H;  4LIJ A;  4LF6 C;  3DHV A;  3AF5 A;  4OYC A;  3NI2 A;  2YX1 A;  3L7Z C;  2E8F A;  4B3M H;  2UUB H;  1XRC A;  1SEI A;  4DV3 H;  2AYA A;  5A2Q W;  1PA4 A;  3TUF A;  4DV2 C;  1K0R A;  3V69 A;  4B3R C;  1GPM A;  3VNR A;  5KEI A;  5KYT A;  2P2M A;  4JYA C;  2OBV A;  2F4V C;  3LAX A;  3AY0 A;  4DV1 C;  1IBL H;  2DYJ A;  4MH4 A;  4QMF B;  2M5H A;  3T1Y H;  4BCA A;  1N33 C;  2OPU A;  1ZTG A;  1S03 G;  4R0M A;  2FMR A;  4DR5 C;  3RV2 A;  1HNW H;  4AQY H;  4JI0 H;  4NBQ A;  2V7B A;  2Y4N A;  4PRO C;  2UUA C;  2ZQE A;  4B8C D;  2UXB H;  1AMU A;  4D4G A;  2P2Q A;  1ZB9 A;  1ULT A;  4ISB A;  3R9X A;  2ZM6 H;  2YCB A;  4DR1 C;  2ASB A;  4KTT A;  4PHT A;  2ANN A;  1F0X A;  1RY2 A;  2LF0 A;  4LF8 H;  4NXM H;  4JVH A;  2Y3M A;  3CQ1 A;  5C0X G;  4YY3 C;  5BST A;  2NCL A;  1LQL A;  4AM3 A;  2E8C A;  2BJO A;  2CWF A;  3J80 W;  1J5E H;  2FPH X;  1N32 H;  4LFB H;  1O93 A;  3NYQ A;  4D56 A;  2UXC H;  4L7I A;  5LMU H;  5BSU A;  2UUC C;  3FAU A;  3QD7 X;  1VIH A;  1MXA A;  1L2F A;  5IT9 W;  1XNR H;  2VZE A;  2HHH H;  1ZZI A;  4X66 C;  2JMP A;  2YWC A;  4DR4 C;  2LRR A;  2AXY A;  3L95 X;  2Z51 A;  2UU9 C;  2P2R A;  3GR0 A;  2G8Y A;  4DV2 H;  2M5O A;  1HR0 H;  4B3R H;  5AE2 A;  2UXD C;  4JYA H;  2CTF A;  5LMN H;  1XRB A;  4B8T A;  2E0G A;  4LFA C;  2PN2 A;  3UZ0 A;  2D1S A;  3GAB A;  2QVY X;  2VQE H;  3UX2 A;  2CTL A;  3PBK A;  4KTV A;  1N33 H;  3GPC A;  2PY9 A;  4DR5 H;  3I07 A;  4DV6 C;  1X4M A;  2VKC A;  4NZT M;  4BC7 A;  3E7W A;  1X4N A;  4NXN C;  5BSR A;  3ETC A;  4X65 C;  3KDK A;  4MTN A;  2E7G A;  3E7X A;  5KYV A;  1XS3 A;  2E5L C;  4NOZ A;  1USP B;  5AE1 A;  4JI8 C;  1DTJ A;  4JI5 H;  5BUR A;  5BR8 C;  4B3T C;  4JI7 C;  4FJS A;  1VEH A;  4DG9 A;  4IZ6 A;  5BSM A;  1WF3 A;  3DAY A;  3JAM D;  2BA0 A;  5JEA G;  4I9G A;  4RVO A;  1NYE A;  1K1G A;  5A19 A;  1MDB A;  4X64 C;  4GKK C;  3U1K A;  3I08 A;  2D1R A;  2EGT A;  4DV4 C;  4DR6 H;  3A4I A;  2UU9 H;  3N2Q A;  4XX2 A;  2OPL B;  4GXQ A;  1N36 H;  2MM9 A;  3VKE A;  2VSQ A;  4ODJ A;  1I6U A;  2P2F A;  3TQI A;  4JI4 C;  4DV7 C;  3I0P A;  1BA3 A;  3A25 A;  1V60 A;  2JVZ A;  3EZJ A;  4LFA H;  3SB1 A;  1XMQ C;  1IBM H;  1O90 A;  2QVZ X;  1UWD A;  3LNO A;  3LNV A;  2A1S A;  2CY1 A;  2CTE A;  2OPV A;  1EGA A;  3GR5 A;  4LF5 C;  4X62 C;  4K0K C;  4DV6 H;  2KZ0 A;  4RM2 A;  2ANR A;  4FJU A;  1MD9 A;  4NZR M;  5K36 G;  4NXN H;  4NDN A;  4FUQ A;  5IWA C;  3CW9 A;  4HPV A;  1IB8 A;  4DR3 C;  1O92 A;  2BL5 A;  1MDF A;  1ZB8 A;  3O2E A;  1XNQ H;  3FCE A;  2E5L H;  2CPM A;  1ZZJ A;  2DHM A;  1MKY A;  4BC9 A;  4GKJ H;  1XMO H;  4JI1 C;  4JI8 H;  1ODH A;  2JE6 I;  5LL6 b;  4RLF A;  4B3T H;  4LF9 C;  5CZX A;  4DCS A;  1P7L A;  3UOE A;  2BH1 X;  1FJG C;  2XR1 A;  5FLX D;  4JI2 H;  3VNS A;  3J81 W;  3IEV A;  5K85 A;  4FUT A;  4DUZ H;  4LE5 A;  2PRO A;  4R1L A;  4L2Z A;  1WTJ A; 
#chains in the Genus database with same CATH homology
 5T8S A;  1AN7 A;  4GKK H;  4E9J A;  4LF6 H;  4DV4 H;  4L4Q A;  2CXC A;  4G37 A;  4BBY A;  1I94 C;  4DR7 C;  4DUY C;  1MXB A;  4JV5 C;  2WD9 A;  1T5D X;  4GS5 A;  5T8T A;  1RG9 A;  1XRA A;  5AE3 A;  1QM4 A;  2F4V H;  1VLA A;  5A2Q D;  4DV1 H;  4R1M A;  1XMQ H;  3RG2 A;  1HNX C;  2P2J A;  4LF5 H;  4X62 H;  2UUA H;  3NPD A;  1IBK C;  5IWA H;  4DR1 H;  2D1T A;  3RF2 A;  5IFI A;  3T1Y C;  4DR2 C;  3S82 A;  2YWB A;  4JI6 C;  5DV9 A;  3VNQ A;  1HNW C;  4YHH C;  3KDG A;  4YY3 H;  2E8E A;  2UXB C;  4LFC C;  4LF9 H;  3EER A;  5A1G A;  2VQF C;  1FJG H;  1PG3 A;  2Y27 A;  2ZM6 C;  3IML A;  3TDE A;  4OX9 C;  2ONF A;  3J80 D;  2UUC H;  3OET A;  2D7V A;  2OO4 A;  4NXM C;  2QVX X;  4U5Y D;  4X66 H;  4DR4 H;  2HJG A;  4PZP A;  2O4C A;  1USP A;  1YJ7 A;  5H9U A;  1HH2 P;  5IT9 D;  3GR1 A;  4DR7 H;  4DUY H;  3UOW A;  2D28 C;  1JOS A;  4B3S C;  2UXD H;  4I9F A;  3R44 A;  3LGX A;  1XNR C;  5K8F A;  5BSV A;  3C5E A;  1X9Z A;  4DV5 C;  1N2F A;  3NCV A;  2P02 A;  4JM1 A;  2PT7 G;  1N34 C;  1WH9 A;  4TPS B;  1HR0 C;  1LCI A;  4JI3 C;  5LMN C;  2OPL A;  1IBK H;  4X65 H;  4G36 A;  2VQE C;  1PG4 A;  1ML8 A;  3GKU A;  4DR2 H;  4WV3 A;  5E7Q A;  4JI6 H;  4BSZ A;  3IPL A;  4RLQ A;  4YHH H;  4OCH A;  4OXI A;  5DT9 A;  5BR8 H;  4LFC H;  4JI7 H;  2P20 A;  2VQF H;  3A9V A;  3IEU A;  2D1Q A;  4LF7 C;  3LUS A;  4OX9 H;  2KZF A;  4DV0 C;  4X64 H;  4G08 A;  4G1I A;  4FTF A;  4JI5 C;  1V26 A;  3JAM W;  4LF4 C;  3N54 B;  5BSW A;  1MXC A;  4KHP C;  4WS9 A;  1HNZ C;  3CW8 X;  3G7S A;  2DPL A;  3T1H C;  3OTO C;  3B7W A;  4JI4 H;  2QW0 X;  4DV7 H;  4B3S H;  2QL8 A;  4D4I A;  4DCV A;  4EC5 A;  4DV5 H;  4B3M C;  4RM3 A;  5ADZ A;  2UUB C;  4DR6 C;  4DCU A;  4DV3 C;  4K0K H;  1N36 C;  1N34 H;  1O9T A;  5JRH A;  3PES A;  5BUQ A;  4JI3 H;  1FUG A;  4DR3 H;  1IBL C;  4PDB A;  1T5H X;  1IBM C;  1V25 A;  3KXW A;  2Y4O A;  4RVN A;  4RMN A;  1UKK A;  3OSS D;  4AQY C;  4JI0 C;  3J7A K;  1QWI A;  3FCC A;  4ZLP A;  3DLP X;  4JI1 H;  4IR7 A;  4GXR A;  1FKA H;  4ZJZ A;  4DCT A;  2ATW A;  3A9U A;  3NYR A;  5BUS A;  2WP0 C;  3ETO A;  4EAT A;  4LF8 C;  4LF7 H;  1XNQ C;  4DV0 H;  3J81 D;  5FLX W;  4OD6 A;  4GKJ C;  1XMO C;  3SO4 A;  2D9I A;  4LF4 H;  3PRO C;  5A1I A;  3AF6 A;  1J5E C;  4K0B A;  2D27 A;  5GTD A;  1N32 C;  4JI2 C;  4LFB C;  4KHP H;  1I94 H;  4DUZ C;  1HNZ H;  3R9W A;  3CJE A;  4JV5 H;  3T1H H;  2UXC C;  5LMU C;  3L8C A;  4DG8 A;  3OTO H;  5CZV A;  3EQ6 A;  3H2T A;  2HHH C;  1KKG A;  2P2B A;  4D57 A;  1HNX H;  4LF6 C;  3DHV A;  3AF5 A;  4OYC A;  3NI2 A;  2E8F A;  4B3M H;  2UUB H;  1XRC A;  1SEI A;  4DV3 H;  2AYA A;  5A2Q W;  1PA4 A;  3TUF A;  4DV2 C;  1K0R A;  4B3R C;  1GPM A;  3VNR A;  5KEI A;  5KYT A;  2P2M A;  4JYA C;  2OBV A;  2F4V C;  3LAX A;  4DV1 C;  1IBL H;  2DYJ A;  4MH4 A;  3T1Y H;  4BCA A;  1N33 C;  1S03 G;  4R0M A;  4DR5 C;  3RV2 A;  1HNW H;  4AQY H;  4JI0 H;  2V7B A;  2Y4N A;  4PRO C;  2UUA C;  2ZQE A;  4B8C D;  2UXB H;  1AMU A;  4D4G A;  2P2Q A;  1ZB9 A;  1ULT A;  4ISB A;  3R9X A;  2ZM6 H;  2YCB A;  4DR1 C;  2ASB A;  4KTT A;  4PHT A;  1F0X A;  1RY2 A;  2LF0 A;  4LF8 H;  4NXM H;  2Y3M A;  4YY3 C;  5BST A;  1LQL A;  2E8C A;  2BJO A;  3J80 W;  1J5E H;  2FPH X;  1N32 H;  4LFB H;  1O93 A;  3NYQ A;  4D56 A;  2UXC H;  4L7I A;  5LMU H;  5BSU A;  2UUC C;  3FAU A;  3QD7 X;  1MXA A;  1L2F A;  5IT9 W;  1XNR H;  2VZE A;  2HHH H;  4X66 C;  2JMP A;  2YWC A;  4DR4 C;  3L95 X;  2UU9 C;  3GR0 A;  4DV2 H;  1HR0 H;  4B3R H;  5AE2 A;  2UXD C;  4JYA H;  5LMN H;  1XRB A;  2E0G A;  4LFA C;  2PN2 A;  3UZ0 A;  2D1S A;  3GAB A;  2QVY X;  2VQE H;  3PBK A;  4KTV A;  1N33 H;  3GPC A;  4DR5 H;  4DV6 C;  3I07 A;  2VKC A;  4NZT M;  4BC7 A;  3E7W A;  4NXN C;  5BSR A;  3ETC A;  4X65 C;  3KDK A;  4MTN A;  2E7G A;  3E7X A;  5KYV A;  2E5L C;  4NOZ A;  1USP B;  5AE1 A;  4JI8 C;  4JI5 H;  5BUR A;  5BR8 C;  4B3T C;  4JI7 C;  4DG9 A;  4IZ6 A;  5BSM A;  1WF3 A;  3DAY A;  3JAM D;  4I9G A;  4RVO A;  1NYE A;  5A19 A;  1MDB A;  4X64 C;  4GKK C;  3I08 A;  2D1R A;  2EGT A;  4DV4 C;  4DR6 H;  3A4I A;  2UU9 H;  3N2Q A;  4XX2 A;  2OPL B;  4GXQ A;  1N36 H;  2VSQ A;  4ODJ A;  1I6U A;  2P2F A;  3TQI A;  4JI4 C;  4DV7 C;  1BA3 A;  3EZJ A;  4LFA H;  3SB1 A;  1XMQ C;  1IBM H;  1O90 A;  2QVZ X;  3LNV A;  2CY1 A;  1EGA A;  3GR5 A;  4LF5 C;  4X62 C;  4K0K C;  4DV6 H;  4RM2 A;  1MD9 A;  4NZR M;  4NXN H;  4NDN A;  4FUQ A;  5IWA C;  3CW9 A;  4HPV A;  4DR3 C;  1O92 A;  1MDF A;  1ZB8 A;  1XNQ H;  3FCE A;  2E5L H;  1MKY A;  4BC9 A;  4GKJ H;  1XMO H;  4JI1 C;  4JI8 H;  1ODH A;  5LL6 b;  4RLF A;  4B3T H;  4LF9 C;  5CZX A;  4DCS A;  1P7L A;  2BH1 X;  1FJG C;  2XR1 A;  5FLX D;  4JI2 H;  3VNS A;  3J81 W;  3IEV A;  5K85 A;  4FUT A;  4DUZ H;  4LE5 A;  2PRO A;  4R1L A;  4L2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...