2PT7G

Crystal structure of cag virb11 (hp0525) and an inhibitory protein (hp1451)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
145
structure length
145
Chain Sequence
KLHEIKQELKDLFSHLPYKINKVEVSLYEPGVLLIDIDGEDSALLIGEKGYRYKALSYLLFNWIHPTYGYSIRLEISTFLQNQEKVMDTQLQSVIMTVHEVGKGQMKAPDGVLTYIALKKLRKAFPNKYVSIKTNLNDEKYIVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification, structure and mode of action of a new regulator of the Helicobacter pylori HP0525 ATPase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/protein binding
molecule keywords Cag-alfa
total genus 44
structure length 145
sequence length 145
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF18472 HP1451_C HP1451 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2pt7G01
3.30.1370.180 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2pt7G02
4DV4C 1UKKA 2E8FA 2JMPA 1MKYA 4LFBC 1N32C 4MTNA 2ATWA 4JV5C 1EGAA 4X66C 1KKGA 1USPA 4BSZA 3T1YC 2E8EA 4KHPC 2ZM6C 4DR5C 4JI2C 3T1HC 3I07A 4JYAC 5FLXD 1HNZC 4JI6C 4LF5C 1QWIA 1ZB8A 5IWAC 1WH9A 4DR6C 1N36C 2QL8A 5LMNC 2UUAC 4NXNC 3IEVA 4YY3C 3J80D 4B3SC 1NYEA 4XX2A 4LF8C 3AF6A 4DV1C 4DUZC 4YHHC 2HHHC 4DCTA 1IBMC 1N2FA 2CXCA 2D7VA 2OPLA 4DCVA 5IT9D 4DV6C 2ONFA 4X65C 5BR8C 1ZB9A 4X62C 1HNWC 2E5LC 2OPLB 4DCSA 2XR1A 4DV7C 2VQEC 2KZFA 4DV5C 1IBLC 1IBKC 2CY1A 2UXCC 1PA4A 2UU9C 4LFAC 4LF6C 5LMUC 1HNXC 1XMQC 4DR2C 2F4VC 5A2QD 3R9XA 2PT7G 4LFCC 4LF7C 3R9WA 1N34C 4JI7C 2UUCC 3OTOC 2BJOA 4DCUA 1XNQC 3EERA 1WF3A 4GKJC 1HR0C 1JOSA 4K0KC 4NOZA 4JI4C 3LUSA 4GKKC 1N33C 4B3MC 2HJGA 4MH4A 4DV2C 2E7GA 1FJGC 4JI0C 2UXDC 4LF9C 3GKUA 2PN2A 4X64C 2UXBC 4DV3C 3J81D 4DR3C 4JI1C 4JI3C 1LQLA 4DR7C 2VQFC 4DR4C 3JAMD 3AF5A 4B3TC 3CJEA 1VLAA 1K0RA 2ASBA 2UUBC 3IEUA 1J5EC 4AQYC 1USPB 1XMOC 1ML8A 2YCBA 4JI5C 4JI8C 2DYJA 4LF4C 4DR1C 4OX9C 2E8CA 1I94C 4B3RC 4DV0C 1XNRC 4NXMC 1L2FA 4DUYC 1HH2P 2EGTA
chains in the Genus database with same CATH superfamily
1PQXA 4DV4C 1UKKA 2JMPA 1DTJA 4EC5A 1MKYA 4BA2I 3T1HH 4JI1H 5C0XG 4NZTM 4RVOA 3KXWA 4OD6A 2ATWA 4X66C 3NI2A 1N34H 1XNQH 2A1SA 1HNWH 3UEBA 1VIHA 3EQ6A 2LTLA 2QL8A 3PESA 4BA1I 3QD7X 4AQYH 4B3MH 4JVHA 4LF8C 4DV1C 4B3RH 1MSZA 2MM9A 2CXCA 2Y4OA 2D7VA 2OPLA 1O90A 4IR7A 4ODJA 1N36H 3A9UA 4X62C 1HNWC 3GR0A 4ZLPA 4LF4H 4G1IA 4DCSA 2CTFA 2VQEC 3GR5A 2DPLA 2YWBA 4B8CD 1XRHA 5LCIA 3NYRA 3TDEA 3VNRA 1XRBA 1WHRA 2P2RA 2ZZNA 1NY8A 4BBYA 5A2QD 4NBQA 2LTMA 3R9WA 3SB1A 4E9JA 2UUCC 3OTOC 2BJOA 4BCAA 3G7SA 1IBMH 2UU9H 3LNOA 5DV9A 1XNQC 1WF3A 2CTJA 4JI4H 4GKKC 4WANA 1PU1A 3R44A 3KDKA 1DT4A 4MH4A 4DV2C 2P02A 5JEAG 1FJGC 4K0BA 4JI0C 3VNSA 3DAYA 4IFDG 3FAUA 2M5OA 4LF9C 2CWHA 3GKUA 4X64C 2OO4A 1TUAA 4X64H 3J81D 1X4NA 1XMOH 3N54B 2VQFC 1J4WA 4RM3A 2VQFH 1ULTA 2D1TA 4ISBA 4B3TC 3AEVB 3UX2A 2KDNA 4WALA 3J81W 3IEUA 2OPVA 4D56A 1USPB 1XMOC 5K8FA 4AIMA 4JI3H 4PDBA 4LF4C 3RF2A 1I94C 4DV0C 4DUYH 4B3TH 4DR4C 4DUYC 1YJ7A 4KHPH 2MJHA 3I08A 5BSWA 2P20A 3UOWA 3CW8X 1UWDA 4LFBC 1XMQH 4DR7H 2M5HA 4LF5H 4MTNA 1HNZH 4X66H 1EGAA 3A26A 1KKGA 1EC6A 4BSZA 3T1YC 4KHPC 4PROC 3T1HC 3RG2A 1J5EH 4DG9A 2YX1A 2NN6G 4L4QA 4JYAC 4JI6C 2P2JA 4LF5C 3KDGA 2UXDH 1XNRH 4ZJZA 1XHJA 1ZB8A 5IWAC 2JA9A 2VQEH 2VZEA 1IBKH 1WH9A 2BL5A 5AE2A 1N33H 5BUQA 5LMNC 4NXNC 3IEVA 3UOEA 3GPCA 4XX2A 2E5LH 4YHHC 2QVXX 1IBMC 1N2FA 4BC9A 2BH1X 1BA3A 5IT9D 4X65C 5BR8C 4X62H 1ZB9A 4AM3A 1HNXH 4JI8H 2OPLB 1FJGH 2XR1A 4DV7C 4DV7H 3OETA 1RY2A 5CZVA 4DR4H 1IBKC 2CY1A 1ZZJA 1PA4A 4LFAC 4RLQA 3ETCA 4LF6C 2JVZA 3PROC 5LMUC 4X65H 1S03G 4D4IA 3R9XA 2CWFA 4LFCC 4JVYA 4JI7C 3GR1A 3NPDA 5A1GA 4GKJC 2DHMA 1WE8A 4NOZA 5LMNH 1N33C 1LCIA 5LMUH 1KHMA 4B3MC 2HJGA 3K6RA 4R1LA 1VIGA 2E7GA 1T5DX 1MDFA 2E0GA 4FUQA 2OBVA 2QNDA 3E7WA 2ZQEA 3E7XA 3PBKA 2UUBH 3UZ0A 4DV6H 4GKKH 4DV2H 1LQLA 1VBIA 4DR7C 2PY9A 3AF5A 5GTDA 1K0RA 1X4MA 5BSRA 4R1MA 4LFAH 5H9UA 2UUBC 3FCEA 5JRHA 1J5EC 1PG3A 3LAXA 4DR3H 1XRAA 3A25A 2BA0A 2JE6I 3AY0A 4I9GA 1NXUA 4JI8C 1V26A 1XNRC 5A2QW 1L2FA 2PN2A 2UU9C 2YQRA 2E8FA 3GABA 1P4EC 4OO1G 3CQ1A 5BSTA 4JV5C 4DV0H 4RVNA 3TQIA 1M6XA 4JI7H 4KTVA 4GS5A 1USPA 1IB8A 2ANNA 2D1QA 2CPMA 2E8EA 2ZM6H 2ZM6C 5IT9W 4PZPA 2Y3MA 2F4VH 5FLXD 1ZZKA 1WCJA 2CTMA 4DR1H 1QWIA 4DR6H 4JM1A 4D4GA 2M8WA 4YY3C 3J80D 4B3SC 1NYEA 2D9IA 4NXMH 3FCCA 3O2EA 3B7WA 3AF6A 3A9VA 5FLXW 4R0MA 1FKAH 1X0AA 4LF7H 3CQ3A 4DCTA 4G08A 2D1RA 2Y27A 4DCVA 4DV6C 2LRRA 2ONFA 2CU6A 2FFMA 4NXNH 2D1SA 1MDBA 2M6QA 4B3SH 4OX9H 1P7LA 2VKCA 4G36A 5T8SA 2KZFA 3L7ZC 2Z0SA 3T1YH 4RMNA 2NCLA 1MXBA 3LNVA 1O93A 1UG8A 1HNXC 2E3UA 2UUAH 2JEAI 4DR2C 2F4VC 1ZZIA 2FPHX 4QMFB 1N32H 2PT7G 4D57A 4LF7C 2O4CA 3EZJA 4H8AA 1P4EA 4DCUA 3EERA 4BC7A 1HR0C 5CZXA 4K0KH 3LUSA 2OPUA 2D27A 2Z51A 4NDNA 3SO4A 2PQUA 5BSMA 4LFCH 3DHVA 1XRCA 1QM4A 4GXRA 3C5EA 5IWAH 4OXIA 3VNQA 4FJSA 2UXBC 5AE3A 4DV3C 2UXBH 3L8CA 2P2FA 5AE1A 4JI5H 5K36G 4DUZH 4JV5H 4NZRM 1F0XA 3J7AK 3V69A 4WS9A 5K85A 5KEIA 5ADZA 4LIJA 4DV3H 4G37A 4LF6H 1T5HX 4L7IA 2G8YA 1TH5A 4AQYC 2K1HA 2YCBA 5KYVA 4OX9C 2JZXA 4RM2A 2ANRA 2E8CA 2YWCA 4FTFA 1IBLH 2UXCH 4IZ6A 2P2BA 1HR0H 4EATA 4RLFA 3N2QA 5LL6b 1N32C 4LE5A 5T8TA 2LF0A 4YHHH 3TUFA 4JI6H 3OTOH 5E7QA 1X9ZA 1M6XC 4DR5C 4JI2C 2P2QA 1VEHA 4FUTA 3I07A 4PHTA 1V9NA 1K1GA 3NYQA 4LF8H 1MXCA 1HNZC 3U1KA 2QVZX 1V60A 3RV2A 2UUCH 5A1IA 4LF9H 4DR6C 1N36C 1S20A 2VSQA 3NCVA 2UUAC 5DT9A 1MXAA 4DG8A 2JEBI 4DV1H 4DUZC 2DGRA 2CTEA 4TPSB 2HHHC 1PG4A 2CPQA 1SEIA 3CQ2A 1FLOA 3VKEA 3I0PA 5KYTA 1GPMA 4GXQA 1ODHA 2MCQA 2E5LC 3UX3A 2AYAA 5BSVA 2MMAB 1AN7A 4FJUA 2WD9A 2HH2A 5BSUA 3OSSD 1XS3A 4DV5C 1IBLC 2UXCC 2FMRA 4DV4H 1O9TA 2P2MA 2PROA 5BR8H 5IFIA 4HPVA 2WP0C 2CTKA 1XMQC 4WV3A 4LFBH 4OCHA 3LGXA 4JI0H 1ZTGA 1O92A 5BURA 1N34C 2X06A 4OYCA 1Z2IA 4PUIA 2AXYA 1J5KA 1JOSA 4K0KC 4JI4C 3S82A 4PUGA 4YY3H 4B8TA 4JYAH 2QW0X 3DLPX 1WTJA 2UXDC 4DV5H 3H2TA 3IMLA 4GKJH 1V25A 3A4IA 4KTTA 1FUGA 4JI2H 1AMUA 4DR3C 4JI1C 1WVNA 2Y4NA 4JI3C 2ZZMA 3JAMD 2JNVA 3CW9A 1RG9A 3IPLA 3ETOA 2HHHH 3CJEA 1VLAA 5A19A 5BUSA 3L95X 2ASBA 1MD9A 2CTLA 2V7BA 4DR5H 2QVYX 1ML8A 4DR2H 4JI5C 2HH3A 4U5YD 2DYJA 4I9FA 3TR3A 4DR1C 4B3RC 1I6UA 3JAMW 4PUHA 1I94H 1V8CA 4NXMC 4L2ZA 2KZ0A 3J80W 1HH2P 2D28C 2EGTA
chains in the Genus database with same CATH topology
4DV4C 1UKKA 2JMPA 4EC5A 1MKYA 3T1HH 4JI1H 4NZTM 4RVOA 3KXWA 4OD6A 2ATWA 4X66C 3NI2A 1N34H 1XNQH 1HNWH 3EQ6A 2QL8A 3PESA 3QD7X 4AQYH 4B3MH 4LF8C 4DV1C 4B3RH 2CXCA 2Y4OA 2D7VA 2OPLA 1O90A 4IR7A 4ODJA 1N36H 3A9UA 4X62C 1HNWC 3GR0A 4ZLPA 4LF4H 4G1IA 4DCSA 2VQEC 3GR5A 2DPLA 2YWBA 4B8CD 3NYRA 3TDEA 3VNRA 1XRBA 4BBYA 5A2QD 3R9WA 3SB1A 4E9JA 2UUCC 3OTOC 2BJOA 4BCAA 3G7SA 1IBMH 2UU9H 5DV9A 1XNQC 1WF3A 4JI4H 4GKKC 3R44A 3KDKA 4MH4A 4DV2C 2P02A 1FJGC 4K0BA 4JI0C 3DAYA 3VNSA 3FAUA 4LF9C 3GKUA 4X64C 2OO4A 4X64H 3J81D 1XMOH 3N54B 2VQFC 4RM3A 2VQFH 1ULTA 2D1TA 4ISBA 4B3TC 3J81W 3IEUA 4D56A 1USPB 1XMOC 5K8FA 4JI3H 4PDBA 4LF4C 3RF2A 1I94C 4DV0C 4DUYH 4B3TH 4DR4C 4DUYC 1YJ7A 4KHPH 3I08A 5BSWA 2P20A 3UOWA 3CW8X 4LFBC 1XMQH 4DR7H 4LF5H 4MTNA 1HNZH 4X66H 1EGAA 1KKGA 4BSZA 3T1YC 4KHPC 4PROC 3T1HC 3RG2A 1J5EH 4DG9A 4L4QA 4JYAC 4JI6C 2P2JA 4LF5C 3KDGA 2UXDH 1XNRH 4ZJZA 1ZB8A 5IWAC 2VQEH 2VZEA 1IBKH 1WH9A 5AE2A 1N33H 5BUQA 5LMNC 4NXNC 3IEVA 3GPCA 4XX2A 2E5LH 4YHHC 2QVXX 1IBMC 1N2FA 4BC9A 2BH1X 1BA3A 5IT9D 4X65C 5BR8C 4X62H 1ZB9A 1HNXH 4JI8H 2OPLB 1FJGH 2XR1A 4DV7C 4DV7H 3OETA 1RY2A 5CZVA 4DR4H 1IBKC 2CY1A 1PA4A 4LFAC 4RLQA 3ETCA 4LF6C 3PROC 5LMUC 4X65H 1S03G 4D4IA 3R9XA 4LFCC 4JI7C 3GR1A 3NPDA 5A1GA 4GKJC 4NOZA 5LMNH 1N33C 1LCIA 5LMUH 4B3MC 2HJGA 4R1LA 2E7GA 1T5DX 1MDFA 2E0GA 4FUQA 2OBVA 3E7WA 2ZQEA 3E7XA 3PBKA 2UUBH 3UZ0A 4DV6H 4GKKH 4DV2H 1LQLA 4DR7C 3AF5A 5GTDA 1K0RA 5BSRA 4R1MA 4LFAH 5H9UA 2UUBC 3FCEA 5JRHA 1J5EC 1PG3A 3LAXA 4DR3H 1XRAA 4I9GA 4JI8C 1V26A 1XNRC 5A2QW 1L2FA 2PN2A 2UU9C 2E8FA 3GABA 5BSTA 4JV5C 4DV0H 4RVNA 3TQIA 4JI7H 4KTVA 4GS5A 1USPA 2D1QA 2E8EA 2ZM6H 2ZM6C 5IT9W 4PZPA 2Y3MA 2F4VH 5FLXD 4DR1H 1QWIA 4DR6H 4JM1A 4D4GA 4YY3C 3J80D 4B3SC 1NYEA 2D9IA 3FCCA 3B7WA 3AF6A 3A9VA 5FLXW 4R0MA 1FKAH 4LF7H 4DCTA 4G08A 2D1RA 2Y27A 4DCVA 4DV6C 2ONFA 4NXNH 2D1SA 1MDBA 4B3SH 4OX9H 1P7LA 2VKCA 4G36A 5T8SA 2KZFA 3T1YH 4RMNA 1MXBA 3LNVA 1O93A 1HNXC 2UUAH 4DR2C 2F4VC 2FPHX 1N32H 2PT7G 4D57A 4LF7C 2O4CA 3EZJA 4DCUA 3EERA 4BC7A 1HR0C 5CZXA 4K0KH 3LUSA 2D27A 4NDNA 3SO4A 4LFCH 5BSMA 3DHVA 1XRCA 1QM4A 4GXRA 3C5EA 5IWAH 4OXIA 3VNQA 2UXBC 5AE3A 4DV3C 2UXBH 3L8CA 2P2FA 5AE1A 4JI5H 4DUZH 4JV5H 4NZRM 1F0XA 3J7AK 4WS9A 5K85A 5KEIA 5ADZA 4DV3H 4G37A 4LF6H 1T5HX 4L7IA 4AQYC 2YCBA 5KYVA 4OX9C 4RM2A 2E8CA 2YWCA 4FTFA 1IBLH 2UXCH 4IZ6A 2P2BA 1HR0H 4EATA 4RLFA 3N2QA 5LL6b 1N32C 4LE5A 5T8TA 2LF0A 4YHHH 3TUFA 4JI6H 3OTOH 5E7QA 1X9ZA 4DR5C 4JI2C 2P2QA 4FUTA 3I07A 4PHTA 3NYQA 4LF8H 1MXCA 1HNZC 2QVZX 3RV2A 2UUCH 5A1IA 4LF9H 4DR6C 1N36C 2VSQA 3NCVA 2UUAC 5DT9A 1MXAA 4DG8A 4DV1H 4DUZC 4TPSB 2HHHC 1PG4A 1SEIA 5KYTA 1GPMA 4GXQA 1ODHA 2E5LC 2AYAA 5BSVA 1AN7A 2WD9A 5BSUA 3OSSD 4DV5C 1IBLC 2UXCC 4DV4H 1O9TA 2P2MA 2PROA 5BR8H 5IFIA 4HPVA 2WP0C 1XMQC 4WV3A 4LFBH 4OCHA 3LGXA 4JI0H 1O92A 5BURA 1N34C 4OYCA 1JOSA 4K0KC 4JI4C 3S82A 4YY3H 4JYAH 2QW0X 3DLPX 2UXDC 4DV5H 3H2TA 3IMLA 4GKJH 1V25A 3A4IA 4KTTA 1FUGA 4JI2H 1AMUA 4DR3C 4JI1C 2Y4NA 4JI3C 3JAMD 3CW9A 1RG9A 3IPLA 3ETOA 2HHHH 3CJEA 1VLAA 5A19A 5BUSA 3L95X 2ASBA 1MD9A 2V7BA 4DR5H 2QVYX 1ML8A 4DR2H 4JI5C 4U5YD 2DYJA 4I9FA 4DR1C 4B3RC 1I6UA 3JAMW 1I94H 4NXMC 4L2ZA 3J80W 4NXMH 1HH2P 2D28C 2EGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 C;  1UKK A;  2E8F A;  2JMP A;  1MKY A;  4LFB C;  1N32 C;  4MTN A;  2ATW A;  4JV5 C;  1EGA A;  4X66 C;  1KKG A;  1USP A;  4BSZ A;  3T1Y C;  2E8E A;  4KHP C;  2ZM6 C;  4DR5 C;  4JI2 C;  3T1H C;  3I07 A;  4JYA C;  5FLX D;  1HNZ C;  4JI6 C;  4LF5 C;  1QWI A;  1ZB8 A;  5IWA C;  1WH9 A;  4DR6 C;  1N36 C;  2QL8 A;  5LMN C;  2UUA C;  4NXN C;  3IEV A;  4YY3 C;  3J80 D;  4B3S C;  1NYE A;  4XX2 A;  4LF8 C;  3AF6 A;  4DV1 C;  4DUZ C;  4YHH C;  2HHH C;  4DCT A;  1IBM C;  1N2F A;  2CXC A;  2D7V A;  2OPL A;  4DCV A;  5IT9 D;  4DV6 C;  2ONF A;  4X65 C;  5BR8 C;  1ZB9 A;  4X62 C;  1HNW C;  2E5L C;  2OPL B;  4DCS A;  2XR1 A;  4DV7 C;  2VQE C;  2KZF A;  4DV5 C;  1IBL C;  1IBK C;  2CY1 A;  2UXC C;  1PA4 A;  2UU9 C;  4LFA C;  4LF6 C;  5LMU C;  1HNX C;  1XMQ C;  4DR2 C;  2F4V C;  5A2Q D;  3R9X A;  2PT7 G;  4LFC C;  4LF7 C;  3R9W A;  1N34 C;  4JI7 C;  2UUC C;  3OTO C;  2BJO A;  4DCU A;  1XNQ C;  3EER A;  1WF3 A;  4GKJ C;  1HR0 C;  1JOS A;  4K0K C;  4NOZ A;  4JI4 C;  3LUS A;  4GKK C;  1N33 C;  4B3M C;  2HJG A;  4MH4 A;  4DV2 C;  2E7G A;  1FJG C;  4JI0 C;  2UXD C;  4LF9 C;  3GKU A;  2PN2 A;  4X64 C;  2UXB C;  4DV3 C;  3J81 D;  4DR3 C;  4JI1 C;  4JI3 C;  1LQL A;  4DR7 C;  2VQF C;  4DR4 C;  3JAM D;  3AF5 A;  4B3T C;  3CJE A;  1VLA A;  1K0R A;  2ASB A;  2UUB C;  3IEU A;  1J5E C;  4AQY C;  1USP B;  1XMO C;  1ML8 A;  2YCB A;  4JI5 C;  4JI8 C;  2DYJ A;  4LF4 C;  4DR1 C;  4OX9 C;  2E8C A;  1I94 C;  4B3R C;  4DV0 C;  1XNR C;  4NXM C;  1L2F A;  4DUY C;  1HH2 P;  2EGT A; 
#chains in the Genus database with same CATH topology
 1PQX A;  4DV4 C;  1UKK A;  2JMP A;  1DTJ A;  4EC5 A;  1MKY A;  4BA2 I;  3T1H H;  4JI1 H;  5C0X G;  4NZT M;  4RVO A;  3KXW A;  4OD6 A;  2ATW A;  4X66 C;  3NI2 A;  1N34 H;  1XNQ H;  2A1S A;  1HNW H;  3UEB A;  1VIH A;  3EQ6 A;  2LTL A;  2QL8 A;  3PES A;  4BA1 I;  3QD7 X;  4AQY H;  4B3M H;  4JVH A;  4LF8 C;  4DV1 C;  4B3R H;  1MSZ A;  2MM9 A;  2CXC A;  2Y4O A;  2D7V A;  2OPL A;  1O90 A;  4IR7 A;  4ODJ A;  1N36 H;  3A9U A;  4X62 C;  1HNW C;  3GR0 A;  4ZLP A;  4LF4 H;  4G1I A;  4DCS A;  2CTF A;  2VQE C;  3GR5 A;  2DPL A;  2YWB A;  4B8C D;  1XRH A;  5LCI A;  3NYR A;  3TDE A;  3VNR A;  1XRB A;  1WHR A;  2P2R A;  2ZZN A;  1NY8 A;  4BBY A;  5A2Q D;  4NBQ A;  2LTM A;  3R9W A;  3SB1 A;  4E9J A;  2UUC C;  3OTO C;  2BJO A;  4BCA A;  3G7S A;  1IBM H;  2UU9 H;  3LNO A;  5DV9 A;  1XNQ C;  1WF3 A;  2CTJ A;  4JI4 H;  4GKK C;  4WAN A;  1PU1 A;  3R44 A;  3KDK A;  1DT4 A;  4MH4 A;  4DV2 C;  2P02 A;  5JEA G;  1FJG C;  4K0B A;  4JI0 C;  3VNS A;  3DAY A;  4IFD G;  3FAU A;  2M5O A;  4LF9 C;  2CWH A;  3GKU A;  4X64 C;  2OO4 A;  1TUA A;  4X64 H;  3J81 D;  1X4N A;  1XMO H;  3N54 B;  2VQF C;  1J4W A;  4RM3 A;  2VQF H;  1ULT A;  2D1T A;  4ISB A;  4B3T C;  3AEV B;  3UX2 A;  2KDN A;  4WAL A;  3J81 W;  3IEU A;  2OPV A;  4D56 A;  1USP B;  1XMO C;  5K8F A;  4AIM A;  4JI3 H;  4PDB A;  4LF4 C;  3RF2 A;  1I94 C;  4DV0 C;  4DUY H;  4B3T H;  4DR4 C;  4DUY C;  1YJ7 A;  4KHP H;  2MJH A;  3I08 A;  5BSW A;  2P20 A;  3UOW A;  3CW8 X;  1UWD A;  4LFB C;  1XMQ H;  4DR7 H;  2M5H A;  4LF5 H;  4MTN A;  1HNZ H;  4X66 H;  1EGA A;  3A26 A;  1KKG A;  1EC6 A;  4BSZ A;  3T1Y C;  4KHP C;  4PRO C;  3T1H C;  3RG2 A;  1J5E H;  4DG9 A;  2YX1 A;  2NN6 G;  4L4Q A;  4JYA C;  4JI6 C;  2P2J A;  4LF5 C;  3KDG A;  2UXD H;  1XNR H;  4ZJZ A;  1XHJ A;  1ZB8 A;  5IWA C;  2JA9 A;  2VQE H;  2VZE A;  1IBK H;  1WH9 A;  2BL5 A;  5AE2 A;  1N33 H;  5BUQ A;  5LMN C;  4NXN C;  3IEV A;  3UOE A;  3GPC A;  4XX2 A;  2E5L H;  4YHH C;  2QVX X;  1IBM C;  1N2F A;  4BC9 A;  2BH1 X;  1BA3 A;  5IT9 D;  4X65 C;  5BR8 C;  4X62 H;  1ZB9 A;  4AM3 A;  1HNX H;  4JI8 H;  2OPL B;  1FJG H;  2XR1 A;  4DV7 C;  4DV7 H;  3OET A;  1RY2 A;  5CZV A;  4DR4 H;  1IBK C;  2CY1 A;  1ZZJ A;  1PA4 A;  4LFA C;  4RLQ A;  3ETC A;  4LF6 C;  2JVZ A;  3PRO C;  5LMU C;  4X65 H;  1S03 G;  4D4I A;  3R9X A;  2CWF A;  4LFC C;  4JVY A;  4JI7 C;  3GR1 A;  3NPD A;  5A1G A;  4GKJ C;  2DHM A;  1WE8 A;  4NOZ A;  5LMN H;  1N33 C;  1LCI A;  5LMU H;  1KHM A;  4B3M C;  2HJG A;  3K6R A;  4R1L A;  1VIG A;  2E7G A;  1T5D X;  1MDF A;  2E0G A;  4FUQ A;  2OBV A;  2QND A;  3E7W A;  2ZQE A;  3E7X A;  3PBK A;  2UUB H;  3UZ0 A;  4DV6 H;  4GKK H;  4DV2 H;  1LQL A;  1VBI A;  4DR7 C;  2PY9 A;  3AF5 A;  5GTD A;  1K0R A;  1X4M A;  5BSR A;  4R1M A;  4LFA H;  5H9U A;  2UUB C;  3FCE A;  5JRH A;  1J5E C;  1PG3 A;  3LAX A;  4DR3 H;  1XRA A;  3A25 A;  2BA0 A;  2JE6 I;  3AY0 A;  4I9G A;  1NXU A;  4JI8 C;  1V26 A;  1XNR C;  5A2Q W;  1L2F A;  2PN2 A;  2UU9 C;  2YQR A;  2E8F A;  3GAB A;  1P4E C;  4OO1 G;  3CQ1 A;  5BST A;  4JV5 C;  4DV0 H;  4RVN A;  3TQI A;  1M6X A;  4JI7 H;  4KTV A;  4GS5 A;  1USP A;  1IB8 A;  2ANN A;  2D1Q A;  2CPM A;  2E8E A;  2ZM6 H;  2ZM6 C;  5IT9 W;  4PZP A;  2Y3M A;  2F4V H;  5FLX D;  1ZZK A;  1WCJ A;  2CTM A;  4DR1 H;  1QWI A;  4DR6 H;  4JM1 A;  4D4G A;  2M8W A;  4YY3 C;  3J80 D;  4B3S C;  1NYE A;  2D9I A;  4NXM H;  3FCC A;  3O2E A;  3B7W A;  3AF6 A;  3A9V A;  5FLX W;  4R0M A;  1FKA H;  1X0A A;  4LF7 H;  3CQ3 A;  4DCT A;  4G08 A;  2D1R A;  2Y27 A;  4DCV A;  4DV6 C;  2LRR A;  2ONF A;  2CU6 A;  2FFM A;  4NXN H;  2D1S A;  1MDB A;  2M6Q A;  4B3S H;  4OX9 H;  1P7L A;  2VKC A;  4G36 A;  5T8S A;  2KZF A;  3L7Z C;  2Z0S A;  3T1Y H;  4RMN A;  2NCL A;  1MXB A;  3LNV A;  1O93 A;  1UG8 A;  1HNX C;  2E3U A;  2UUA H;  2JEA I;  4DR2 C;  2F4V C;  1ZZI A;  2FPH X;  4QMF B;  1N32 H;  2PT7 G;  4D57 A;  4LF7 C;  2O4C A;  3EZJ A;  4H8A A;  1P4E A;  4DCU A;  3EER A;  4BC7 A;  1HR0 C;  5CZX A;  4K0K H;  3LUS A;  2OPU A;  2D27 A;  2Z51 A;  4NDN A;  3SO4 A;  2PQU A;  5BSM A;  4LFC H;  3DHV A;  1XRC A;  1QM4 A;  4GXR A;  3C5E A;  5IWA H;  4OXI A;  3VNQ A;  4FJS A;  2UXB C;  5AE3 A;  4DV3 C;  2UXB H;  3L8C A;  2P2F A;  5AE1 A;  4JI5 H;  5K36 G;  4DUZ H;  4JV5 H;  4NZR M;  1F0X A;  3J7A K;  3V69 A;  4WS9 A;  5K85 A;  5KEI A;  5ADZ A;  4LIJ A;  4DV3 H;  4G37 A;  4LF6 H;  1T5H X;  4L7I A;  2G8Y A;  1TH5 A;  4AQY C;  2K1H A;  2YCB A;  5KYV A;  4OX9 C;  2JZX A;  4RM2 A;  2ANR A;  2E8C A;  2YWC A;  4FTF A;  1IBL H;  2UXC H;  4IZ6 A;  2P2B A;  1HR0 H;  4EAT A;  4RLF A;  3N2Q A;  5LL6 b;  1N32 C;  4LE5 A;  5T8T A;  2LF0 A;  4YHH H;  3TUF A;  4JI6 H;  3OTO H;  5E7Q A;  1X9Z A;  1M6X C;  4DR5 C;  4JI2 C;  2P2Q A;  1VEH A;  4FUT A;  3I07 A;  4PHT A;  1V9N A;  1K1G A;  3NYQ A;  4LF8 H;  1MXC A;  1HNZ C;  3U1K A;  2QVZ X;  1V60 A;  3RV2 A;  2UUC H;  5A1I A;  4LF9 H;  4DR6 C;  1N36 C;  1S20 A;  2VSQ A;  3NCV A;  2UUA C;  5DT9 A;  1MXA A;  4DG8 A;  2JEB I;  4DV1 H;  4DUZ C;  2DGR A;  2CTE A;  4TPS B;  2HHH C;  1PG4 A;  2CPQ A;  1SEI A;  3CQ2 A;  1FLO A;  3VKE A;  3I0P A;  5KYT A;  1GPM A;  4GXQ A;  1ODH A;  2MCQ A;  2E5L C;  3UX3 A;  2AYA A;  5BSV A;  2MMA B;  1AN7 A;  4FJU A;  2WD9 A;  2HH2 A;  5BSU A;  3OSS D;  1XS3 A;  4DV5 C;  1IBL C;  2UXC C;  2FMR A;  4DV4 H;  1O9T A;  2P2M A;  2PRO A;  5BR8 H;  5IFI A;  4HPV A;  2WP0 C;  2CTK A;  1XMQ C;  4WV3 A;  4LFB H;  4OCH A;  3LGX A;  4JI0 H;  1ZTG A;  1O92 A;  5BUR A;  1N34 C;  2X06 A;  4OYC A;  1Z2I A;  4PUI A;  2AXY A;  1J5K A;  1JOS A;  4K0K C;  4JI4 C;  3S82 A;  4PUG A;  4YY3 H;  4B8T A;  4JYA H;  2QW0 X;  3DLP X;  1WTJ A;  2UXD C;  4DV5 H;  3H2T A;  3IML A;  4GKJ H;  1V25 A;  3A4I A;  4KTT A;  1FUG A;  4JI2 H;  1AMU A;  4DR3 C;  4JI1 C;  1WVN A;  2Y4N A;  4JI3 C;  2ZZM A;  3JAM D;  2JNV A;  3CW9 A;  1RG9 A;  3IPL A;  3ETO A;  2HHH H;  3CJE A;  1VLA A;  5A19 A;  5BUS A;  3L95 X;  2ASB A;  1MD9 A;  2CTL A;  2V7B A;  4DR5 H;  2QVY X;  1ML8 A;  4DR2 H;  4JI5 C;  2HH3 A;  4U5Y D;  2DYJ A;  4I9F A;  3TR3 A;  4DR1 C;  4B3R C;  1I6U A;  3JAM W;  4PUH A;  1I94 H;  1V8C A;  4NXM C;  4L2Z A;  2KZ0 A;  3J80 W;  1HH2 P;  2D28 C;  2EGT A; 
#chains in the Genus database with same CATH homology
 4DV4 C;  1UKK A;  2JMP A;  4EC5 A;  1MKY A;  3T1H H;  4JI1 H;  4NZT M;  4RVO A;  3KXW A;  4OD6 A;  2ATW A;  4X66 C;  3NI2 A;  1N34 H;  1XNQ H;  1HNW H;  3EQ6 A;  2QL8 A;  3PES A;  3QD7 X;  4AQY H;  4B3M H;  4LF8 C;  4DV1 C;  4B3R H;  2CXC A;  2Y4O A;  2D7V A;  2OPL A;  1O90 A;  4IR7 A;  4ODJ A;  1N36 H;  3A9U A;  4X62 C;  1HNW C;  3GR0 A;  4ZLP A;  4LF4 H;  4G1I A;  4DCS A;  2VQE C;  3GR5 A;  2DPL A;  2YWB A;  4B8C D;  3NYR A;  3TDE A;  3VNR A;  1XRB A;  4BBY A;  5A2Q D;  3R9W A;  3SB1 A;  4E9J A;  2UUC C;  3OTO C;  2BJO A;  4BCA A;  3G7S A;  1IBM H;  2UU9 H;  5DV9 A;  1XNQ C;  1WF3 A;  4JI4 H;  4GKK C;  3R44 A;  3KDK A;  4MH4 A;  4DV2 C;  2P02 A;  1FJG C;  4K0B A;  4JI0 C;  3DAY A;  3VNS A;  3FAU A;  4LF9 C;  3GKU A;  4X64 C;  2OO4 A;  4X64 H;  3J81 D;  1XMO H;  3N54 B;  2VQF C;  4RM3 A;  2VQF H;  1ULT A;  2D1T A;  4ISB A;  4B3T C;  3J81 W;  3IEU A;  4D56 A;  1USP B;  1XMO C;  5K8F A;  4JI3 H;  4PDB A;  4LF4 C;  3RF2 A;  1I94 C;  4DV0 C;  4DUY H;  4B3T H;  4DR4 C;  4DUY C;  1YJ7 A;  4KHP H;  3I08 A;  5BSW A;  2P20 A;  3UOW A;  3CW8 X;  4LFB C;  1XMQ H;  4DR7 H;  4LF5 H;  4MTN A;  1HNZ H;  4X66 H;  1EGA A;  1KKG A;  4BSZ A;  3T1Y C;  4KHP C;  4PRO C;  3T1H C;  3RG2 A;  1J5E H;  4DG9 A;  4L4Q A;  4JYA C;  4JI6 C;  2P2J A;  4LF5 C;  3KDG A;  2UXD H;  1XNR H;  4ZJZ A;  1ZB8 A;  5IWA C;  2VQE H;  2VZE A;  1IBK H;  1WH9 A;  5AE2 A;  1N33 H;  5BUQ A;  5LMN C;  4NXN C;  3IEV A;  3GPC A;  4XX2 A;  2E5L H;  4YHH C;  2QVX X;  1IBM C;  1N2F A;  4BC9 A;  2BH1 X;  1BA3 A;  5IT9 D;  4X65 C;  5BR8 C;  4X62 H;  1ZB9 A;  1HNX H;  4JI8 H;  2OPL B;  1FJG H;  2XR1 A;  4DV7 C;  4DV7 H;  3OET A;  1RY2 A;  5CZV A;  4DR4 H;  1IBK C;  2CY1 A;  1PA4 A;  4LFA C;  4RLQ A;  3ETC A;  4LF6 C;  3PRO C;  5LMU C;  4X65 H;  1S03 G;  4D4I A;  3R9X A;  4LFC C;  4JI7 C;  3GR1 A;  3NPD A;  5A1G A;  4GKJ C;  4NOZ A;  5LMN H;  1N33 C;  1LCI A;  5LMU H;  4B3M C;  2HJG A;  4R1L A;  2E7G A;  1T5D X;  1MDF A;  2E0G A;  4FUQ A;  2OBV A;  3E7W A;  2ZQE A;  3E7X A;  3PBK A;  2UUB H;  3UZ0 A;  4DV6 H;  4GKK H;  4DV2 H;  1LQL A;  4DR7 C;  3AF5 A;  5GTD A;  1K0R A;  5BSR A;  4R1M A;  4LFA H;  5H9U A;  2UUB C;  3FCE A;  5JRH A;  1J5E C;  1PG3 A;  3LAX A;  4DR3 H;  1XRA A;  4I9G A;  4JI8 C;  1V26 A;  1XNR C;  5A2Q W;  1L2F A;  2PN2 A;  2UU9 C;  2E8F A;  3GAB A;  5BST A;  4JV5 C;  4DV0 H;  4RVN A;  3TQI A;  4JI7 H;  4KTV A;  4GS5 A;  1USP A;  2D1Q A;  2E8E A;  2ZM6 H;  2ZM6 C;  5IT9 W;  4PZP A;  2Y3M A;  2F4V H;  5FLX D;  4DR1 H;  1QWI A;  4DR6 H;  4JM1 A;  4D4G A;  4YY3 C;  3J80 D;  4B3S C;  1NYE A;  2D9I A;  3FCC A;  3B7W A;  3AF6 A;  3A9V A;  5FLX W;  4R0M A;  1FKA H;  4LF7 H;  4DCT A;  4G08 A;  2D1R A;  2Y27 A;  4DCV A;  4DV6 C;  2ONF A;  4NXN H;  2D1S A;  1MDB A;  4B3S H;  4OX9 H;  1P7L A;  2VKC A;  4G36 A;  5T8S A;  2KZF A;  3T1Y H;  4RMN A;  1MXB A;  3LNV A;  1O93 A;  1HNX C;  2UUA H;  4DR2 C;  2F4V C;  2FPH X;  1N32 H;  2PT7 G;  4D57 A;  4LF7 C;  2O4C A;  3EZJ A;  4DCU A;  3EER A;  4BC7 A;  1HR0 C;  5CZX A;  4K0K H;  3LUS A;  2D27 A;  4NDN A;  3SO4 A;  4LFC H;  5BSM A;  3DHV A;  1XRC A;  1QM4 A;  4GXR A;  3C5E A;  5IWA H;  4OXI A;  3VNQ A;  2UXB C;  5AE3 A;  4DV3 C;  2UXB H;  3L8C A;  2P2F A;  5AE1 A;  4JI5 H;  4DUZ H;  4JV5 H;  4NZR M;  1F0X A;  3J7A K;  4WS9 A;  5K85 A;  5KEI A;  5ADZ A;  4DV3 H;  4G37 A;  4LF6 H;  1T5H X;  4L7I A;  4AQY C;  2YCB A;  5KYV A;  4OX9 C;  4RM2 A;  2E8C A;  2YWC A;  4FTF A;  1IBL H;  2UXC H;  4IZ6 A;  2P2B A;  1HR0 H;  4EAT A;  4RLF A;  3N2Q A;  5LL6 b;  1N32 C;  4LE5 A;  5T8T A;  2LF0 A;  4YHH H;  3TUF A;  4JI6 H;  3OTO H;  5E7Q A;  1X9Z A;  4DR5 C;  4JI2 C;  2P2Q A;  4FUT A;  3I07 A;  4PHT A;  3NYQ A;  4LF8 H;  1MXC A;  1HNZ C;  2QVZ X;  3RV2 A;  2UUC H;  5A1I A;  4LF9 H;  4DR6 C;  1N36 C;  2VSQ A;  3NCV A;  2UUA C;  5DT9 A;  1MXA A;  4DG8 A;  4DV1 H;  4DUZ C;  4TPS B;  2HHH C;  1PG4 A;  1SEI A;  5KYT A;  1GPM A;  4GXQ A;  1ODH A;  2E5L C;  2AYA A;  5BSV A;  1AN7 A;  2WD9 A;  5BSU A;  3OSS D;  4DV5 C;  1IBL C;  2UXC C;  4DV4 H;  1O9T A;  2P2M A;  2PRO A;  5BR8 H;  5IFI A;  4HPV A;  2WP0 C;  1XMQ C;  4WV3 A;  4LFB H;  4OCH A;  3LGX A;  4JI0 H;  1O92 A;  5BUR A;  1N34 C;  4OYC A;  1JOS A;  4K0K C;  4JI4 C;  3S82 A;  4YY3 H;  4JYA H;  2QW0 X;  3DLP X;  2UXD C;  4DV5 H;  3H2T A;  3IML A;  4GKJ H;  1V25 A;  3A4I A;  4KTT A;  1FUG A;  4JI2 H;  1AMU A;  4DR3 C;  4JI1 C;  2Y4N A;  4JI3 C;  3JAM D;  3CW9 A;  1RG9 A;  3IPL A;  3ETO A;  2HHH H;  3CJE A;  1VLA A;  5A19 A;  5BUS A;  3L95 X;  2ASB A;  1MD9 A;  2V7B A;  4DR5 H;  2QVY X;  1ML8 A;  4DR2 H;  4JI5 C;  4U5Y D;  2DYJ A;  4I9F A;  4DR1 C;  4B3R C;  1I6U A;  3JAM W;  1I94 H;  4NXM C;  4L2Z A;  3J80 W;  4NXM H;  1HH2 P;  2D28 C;  2EGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...