4IFDG

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
236
structure length
236
Chain Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKSGVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 50
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ifdG01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ifdG02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4ifdG03
4X62L 1H9SA 1LUZA 4DV6Q 4GOPB 1SMYC 1CKNA 3E9HA 2ZTCA 4PZ6A 1PH5A 1S3OA 2CWPA 2Q2HA 1N34Q 3WDNA 3OPOA 1AE3A 1X6OA 4QL5A 1I94Q 2NN6I 4JI0L 4YHHQ 3HOZG 4L8JA 1KAWA 1BKBA 2E76C 1KL9A 4A3JG 4HJ8A 3T1YQ 1N32L 1YHAA 2F4VQ 4A4IA 2FMRA 3RN5A 3TS2A 3S1MH 1H9MA 3OOCA 3I4NG 1I50H 4ALPA 1VDZA 3CCRA 4IQZA 1Q1EA 4G7HC 3TEHB 3PV0A 1HZAA 4RMFA 3GTOH 5ELNA 2D5DA 2KENA 4JI3L 3CQZH 3EIVA 2IT1A 2RHQB 1JE5A 1H95A 1VQBA 1S40A 1VQEA 3JAMi 1ZTGA 4HJ5A 2E8GA 4XIGS 2E5LQ 4BY7H 3B6YA 4GKKQ 1UE7A 3UDGA 3NENA 2D2CC 5IYCH 1C9OA 4DR6Q 2WFWA 4UPAA 1I6HH 4DV7Q 2YTYA 1WJJA 4IOCA 4QGUA 1SMXA 4IO9A 1IXRA 1BBWA 4LF8Q 1Q8KA 4A3DH 3HOVH 4A3KG 3SDZA 3M4YA 2GN5A 1EOVA 2P2RA 1JJCB 2QA4A 1EQQA 3J7ZC 2PMZE 3IFTA 1MJEA 5IYDG 3HGBA 1K0RA 2A68D 4B8TA 4GN5A 1OTCA 4JI8Q 2UXCQ 3I4MG 2BA1A 5FLXc 4LF7L 4FDBA 2KCTA 4DV6L 1EYGA 4A3MH 2JA6H 4GNXB 2WB1G 3JC66 1GJXA 4DAYB 2B29A 3BG3A 3KLWA 4NB3A 2NN6H 1N34L 3SE0A 4NBQA 3HKZG 2Q2UA 1KHIA 4TKOB 4KN7C 2F3IA 2JA9A 3HOXH 3CCLA 5FLMH 3I55A 1KRSA 4IPDA 3STBC 2WB1E 1VIGA 1XTDA 4KMUC 3HOWG 2F4VL 1HZCA 5M3MH 1PYSB 3HOYG 1Y8OB 3MEFA 4YY3Q 2YYZA 2PQAA 3HFZB 1ZKOA 3I4LA 2JEAI 4KKTA 1R9TH 2JA7G 1PFSA 1BBUA 2ANNA 2QEXA 1YJ9A 4YCUA 3RNUA 3F2BA 2CTLA 4GN4B 1JJGA 1I6VC 2K5VA 1BVSA 3I7FA 3S16H 3F2DA 2A8VA 4LFBL 2I5MX 1GO3E 1MIUA 4DK1A 1VCIA 4IFDJ 4QY7A 4DV0Q 2LMCB 3RN2A 4KN4C 2EQSA 4PG3A 3ULJA 4DR1Q 2E5LL 1SN8A 4R4OA 3T1HL 4LF9Q 3OTOQ 1Y1VG 4IPCA 3FPPA 2JA8H 3K8AA 4GOPC 1E1TA 2XGTA 2K7VA 2IHFA 4B3TL 3UE0A 3PO2H 4B3MQ 1N33L 3K7UC 3K7AH 3TRZA 1OXVA 4YCVA 2LXKA 5C0XI 2A19A 3J81i 2UUCQ 4LK1C 1WE8A 3TZUA 2CTMA 1RIPA 1P16A 5C44G 2R7ZH 2EXDA 2JQOA 2DNEA 2FXQA 3T56B 5C0XJ 2BH2A 1PH9A 3BJUA 4OWXB 3OW7A 5IT9c 4GLXA 2K5NA 1LTLA 3W1BA 5FJ8G 3GTQH 1K1GA 3QIAA 3U58A 2OQ0A 3M9BA 4PZ7A 1EUJA 2N78A 1IBKQ 4UP8A 3QJYA 2AMCB 1B70B 1PV4A 1QVFA 4MTNA 4JC0A 2KCMA 1HJPA 5IYCG 1IYJB 4DV3L 1HNZQ 1V8QA 2NZOA 5C4XH 1E2WA 1GUOA 3VR3A 5GADC 4LFCQ 3V69A 5IP7H 1IBMQ 4X6AH 1GUGA 4LJZC 1ZZKA 5LMUQ 1QUQB 3CRLC 1Y8NB 1Z7TA 2Z6KA 1OXUA 2UUBL 3VR4A 3F2CA 3ND9A 3T53B 3STBD 1TWGH 1IYUA 3EN2A 4JI5Q 3FKIG 4LF5Q 4JYAL 3LGJA 1K3RA 2UUAL 4DV5L 2D0OA 5IP9H 3VDYA 3A0JA 4X65Q 2OQKA 4X62Q 2JE6I 3D0FA 3HOUH 1W3SA 4WALA 4JI1Q 3A8JE 2D0PA 2IX0A 4JVYA 2PCFB 3M7NA 1G6PA 4GNXC 1OXXK 2R93H 2Q2IA 4JI0Q 2B8FA 4B3ML 1HR0W 3RLNA 1LM0A 4JI7L 3AFQA 1Z47A 1QJOA 1X9NA 4POGA 5JEAJ 5C0XH 4DR2L 1N32Q 3RLOA 1YJNA 3J81j 2ZJPA 1YI2A 1G291 1YHQA 4R4QA 2ID0A 3CCVA 3KDFB 1VS0A 4A3IG 4H02A 5A35A 2VUMH 1VQFA 2BL5A 1TWFH 1DGSA 3KF6B 2DUDA 4IJHA 4JI3Q 3PSIA 2MO1A 3S1RH 2WP8J 2EJFC 1GHJA 4BY1G 1TWCH 1ZZJA 4OO1I 4DUYQ 4EX5A 3CCSA 2ALYB 2A6HC 1PA6A 2OPVA 3CPFA 5DLQE 4DNIA 1EQRA 1HNZL 1PMRA 1Q1BA 3A74A 2I0QA 2HQLA 3PO3H 1NY4A 1CSQA 1QZHA 1IBML 2D62A 2GVBA 1RL2A 4L5TA 4P71A 1VQ5A 1KXLA 3FHWA 4X64L 3PF5A 4DK0A 1VQIA 1Q81C 1TKWB 1Y14B 5LMNL 2EDGA 3GTPH 5IYBH 2AUJD 1LYLA 4EQ5A 2B63H 3A7AB 2BE5C 1L1OC 3ICEA 1ZYRC 1H9KA 3CCJA 4GN3B 3KF8B 4J15A 2KHIA 5C3EG 3KJOA 4LF7Q 3AEVA 3I56A 5HY6A 3JAMc 1VQHA 5JEAH 3S1NH 4XTCS 1E22A 3QG1A 4JI1L 1CFMA 1EIYB 4H13C 2NVXH 2CFMA 2R7FA 5K36G 4GZYC 1CKOA 3W5OA 4MZ9A 1Y1WH 1PVOA 5H1SE 3MFYA 1Z6HA 2CWAA 1XPOA 3DLLA 5IY0A 4HIMA 2RF4A 4IFDG 4A3FH 5BN3A 1EWIA 2IY5B 4KKSA 2KCCA 3IKJA 3VA7A 1N36L 5KNBA 3ER0A 4A3LG 1DD2A 1YIJA 4DR4L 4LF6L 1Q12A 5M3FG 4OO1H 4GLVB 1P8LA 2E3UA 4PZ8A 1VQLA 4LFBQ 1PH4A 4DUYL 1K83H 4A93H 3TQYA 1BDOA 2KBNA 1CKMA 4WJ4A 1DXMA 3T1HQ 1VQ7A 3VR2A 3A5ZB 3MXNB 3G6EA 4LF4Q 4BBRH 3AQQA 1VQJA 2EIFA 4B3TQ 1Q86C 1HNWQ 2E2JH 1I3QH 1PHJA 1N33Q 4GS3A 2JZXA 3PIOA 2V4DA 3DXJC 2A6HD 5GAGC 4IJLA 4NPSA 4AM3A 4DUZQ 1OXTA 2VUMG 1IZ6A 4UP9A 1D7QA 4P72A 4A3BH 4TVAB 1V9PA 1T9HA 1GVPA 1TUAA 1FJGL 2K32A 3CC4A 1PH8A 1M90C 2K4KA 5M5XH 3K80C 2K50A 5EAYA 1LABA 1M1KC 4AH6A 1J4WA 4A3EH 3S14H 4BBSG 3S15H 2BE5D 4R4IA 2JA5H 1VQ9A 3KLRA 3CCUA 5J3BA 4IOAA 3HKZE 4O0AA 4DV3Q 3GO5A 3J7A5 5KNCA 2E74C 3RZOH 4A3CH 3K81C 4RG1A 3U1KA 3CC2A 1QUQA 4QJFA 2R92H 3J81c 1W2BA 3M4OH 2HHHQ 2UUBQ 4LUVA 4BXXG 3CP0A 1PH7A 3J80i 4APVA 4GKJL 1YZ6A 4P75A 4NXML 4OXPA 3GTJH 5HGQA 2A1AA 2C35B 4JBWA 1O78A 4HIKA 4JYAQ 3H0GG 2UUAQ 4DV5Q 3G71A 1WCMH 1NTGA 3D4RA 4JV5L 2JEBI 3N6RA 1E24A 1K8AC 4LF4L 4H44C 1X56A 1YJWA 1YITA 1O7IA 1UEBA 2VQEQ 3PF4A 1HNWL 1E2ZA 3A7LA 2WAQG 4X66L 4JI7Q 1L1OB 1QVCA 1KIXA 1YNJC 1DCZA 2E2HH 4DR2Q 4P74A 2YV5A 4DUZL 3KDFA 5JJLA 4B3SQ 2WAQE 5JJIA 4OX9L 2BA0A 2ZM6Q 1ZZIA 1DT4A 1K8OA 4KHPL 3KF6A 2QGQA 1Y8PB 4IPGA 4PMWA 1PH3A 4DR3L 4DK6C 4G7ZC 3PUVA 4DR5L 4JOIC 3RZDH 3TS0A 1B8AA 4YWKA 3A8KE 3GD7A 1PH2A 4A75A 2EJGC 2NZHA 1QZGA 2MFIA 4BY7G 4JI2L 1EC6A 2E2IH 1NMGA 2VY3A 1K8GA 3FP9A 3NELA 2JVZA 2MNAA 4L5QA 2BDOA 2UXBL 2PNHA 2VQFQ 1XNQQ 3VR6A 3HOZH 2A69C 2DGRA 4A3JH 4A3DG 1JT8A 2CTEA 3HOVG 5GQOA 2JJQA 4DK3C 4X64Q 2HH3A 3CAMA 3ERSX 5LMNQ 2AXYA 1X65A 3G48A 2PQAB 2HHHL 2UU9L 2VL6A 3U4VA 2O5JC 2CCZA 1ASZA 1SRUA 4DNRB 1A8VA 4HJAA 4WJ3M 4DV2Q 3RLFA 1YEZA 1FGUA 3CXCA 2KHJA 3SGIA 4GOPA 4A3MG 4R4CA 2JA6G 2HH2A 3S17H 2UXDQ 1X4MA 3BZKA 4H0LC 2NN6G 1WYDA 3BDOA 1IYVA 1UE1A 2VQEL 1ONLA 3HOXG 4Y7NH 5FLMG 2IX1A 4HR7B 1GD7A 1NJIC 4DV4Q 2HT1A 2Q8IB 5M3MG 1J5KA 1AE2A 2XTIA 1JB7A 1K8MA 2MO0A 2ZJQA 2K5HA 4B3SL 4A3KH 4JI6L 4IPHA 1YHBA 1XNRL 2ZM6L 2R92G 3CMEA 1GHKA 3PUZA 3ULPA 1N36Q 3CD6A 1U5KA 5BR8L 1NE3A 4DR4Q 5IYDH 4LF6Q 4DPGA 4NXNL 3I4MH 2DNCA 3A8IE 3CC7A 3GTGH 5KNDA 2CKZB 1KHMA 1XPRA 3F8TA 1UE6A 2PNRC 1S72A 1HNXQ 2CW0C 2JA8G 5GROA 1I5FA 2VQFL 1KRTA 1XNQL 4QQBX 4KI0A 3PO2G 1CTMA 4JVHA 1EIFA 1FL0A 4YCWA 4C3IH 3VKEA 3NBHB 4A3GH 2I5LX 3HOYH 4DV1L 2B8GA 3UDXA 2N8NA 4WANA 1N8RC 1O7LA 3W3AA 2Q2TA 3W1GA 2JA7H 3OW2A 1GKHA 4ME3A 2R7ZG 4DV2L 3OYYA 3BZCA 3Q8DA 3KYHC 2YU9H 2K52A 1CSPA 5IWAQ 2A69D 3ZJYC 4GNXA 2UXDL 5BN5A 2PPBC 1FJGQ 1WOCA 1UE5A 3CCMA 4QIWE 3LWUA 1N9WA 3E0EA 1E2VA 1CUKA 3PUWA 4R4TA 2A6EC 1VQPA 2JK8A 4DV4L 3AFPA 1VF7A 1HCZA 4BA1I 1Q46A 2AWOA 3M85A 3I2ZA 4PV1C 5BN4A 1Y1VH 2RCNA 1YNXA 5C4XG 1YBYA 4L5RC 3E9IA 4AQYQ 1HH2P 1CI3M 1WI5A 4QMFB 2F52A 5IP7G 4AYBG 3CPWA 1J5EL 4KHZA 3PIPA 1VQKA 1C7YA 3GQBA 3ULLA 2NVQH 4YWLA 4JBKA 1H9JA 4GKJQ 3L0OA 2NVYH 4OWWB 4HIDA 4AYBE 5C44H 3M3YH 4NXMQ 1SE8A 1MKHA 1WFQA 4C2MH 5IP9G 4A76A 3LNNA 4LIJA 1K9MC 4BA2I 3HOUG 4JV5Q 4OWTB 5FJ8H 1HNXL 1GUTA 1VQAA 1Z9FA 3S2DH 4JI4L 2R93G 1T5EA 3S2HH 1HR0L 4LFAL 1VF5C 1U0LA 4X66Q 1L1OA 5C0XG 1X4NA 3ND8A 2VW9A 3DM3A 1E1OA 2OTLA 1FYCA 1QVGA 4MNOA 3NE5B 4B3RL 1Q90A 4OX9Q 1MJCA 3U9SA 3J80c 4OGQC 2H5XA 2JXMB 5IWAL 1FVIA 3FMCA 1A6XA 4KHPQ 3K0XA 4DR3Q 4DR5Q 3CCQA 4DR7Q 4LUZA 4O2DA 3S1QH 1ASYA 1XMOL 2PI2E 3FKIH 1VQ4A 1SLJA 3UDIA 3WWVA 4P73A 3UDFA 1E7ZA 2ZT9C 1HZBA 1DTJA 1NMFA 5ELOA 1B9MA 1SR3A 3AEVB 1H9SB 1HTPA 1CKNB 1IL2A 4R1JA 4JI2Q 1VQ6A 1XJVA 4LNQA 4RCNA 1I94L 4L5SA 4YHHL 3U50C 4JK1C 4AQYL 2UXBQ 1E3PA 3PO3G 2L15A 1X3FA 1OXSC 2VNUD 1EWHA 3T1YL 4LWCA 2VZAA 1KC8C 1KQSA 2AKWB 2MQHA 4A3GG 3CW2C 5IYBG 2ANRA 2A6ED 3AYHB 4GLAC 2YTVA 2UU9Q 2PY9A 2B63G 3TREA 3CCEA 4A3IH 3KJPA 1A62A 1G51A 3GTMH 1X54A 4IFDI 1SFOH 3MXUA 2AWNA 1D8LA 2Y0SG 1X55A 5JEAG 2ZTEA 2ASBA 3GTKH 1HPCA 3F1ZA 4UP7A 2EVBA 1TWAH 4BY1H 1L2FA 4DAMA 2V1CC 2Z6KC 4JG2A 1GUSA 4LUOA 1VQGA 2Y0SE 2NVTH 3D31A 3PGZA 1K73C 4GKKL 1Y1WG 2GVAA 4DR6L 3CRKC 3M4QA 4C3JH 3CF5A 3VR5A 4DV7L 3H3VI 2EJMA 4JBMA 1KD1C 5C4JH 1X3EA 4LF8L 1VIHA 2CTFA 3T51B 4A3FG 2DGYA 2AHOB 4AIMA 3P20A 4JI6Q 2R7DA 1XNRQ 1PYBA 3BU2A 2HIVA 5LMNW 5IE8A 3GDEA 2QNDA 1Q82C 2R6GA 5BR8Q 4DR7L 3L7ZC 4JI8L 2Z0SA 4OO1G 2UXCL 1VQOA 1HZ9A 3HKSA 3AB9A 4NXNQ 2VS1A 2K33A 4C3HH 5AJ3Q 4A93G 4DNTB 1PH6A 2B3GA 5C3EH 4K0KQ 3H94A 3L2PA 1UWVA 1A63A 3UE1A 2LSSA 4UY8C 2HIXA 2CQOA 1YNNC 4BBRG 3PUYA 5K36H 2N49A 2MJHA 2ATWA 3S24A 2OCEA 3EBEA 1IW7C 1VQDA 2RHSB 3H15A 2OTJA 2PQUA 2OPUA 2YQRA 4YY3L 1HQMC 2LXJA 4DV1Q 4DKAC 1IBLQ 1V1QA 1VQCA 3I4NH 2QF7A 4IFDH 2L5TA 4A3BG 1B9NA 2I5HA 1YVCA 4A3LH 2PI2A 3M4PA 1JJ2A 5M3FH 2F1MA 1SROA 4DV0L 2ZTDA 1XMQQ 1FR3A 4DR1L 3I73A 1TXYA 4A3EG 2AUKA 4TQUS 2ZJRA 3PUXA 4LF9L 3PCOB 1TWHH 5M5WH 3OTOL 2JA5G 2O5IC 3H3VH 2E75C 1Y69U 3CMAA 5JJKA 4YWMA 3GTLH 4A3CG 4JOIA 2N3SA 2CTKA 1J5EQ 2BH8A 1AH9A 1TU2B 3U4ZA 1X3GA 3I4OA 2UUCL 1NBWA 4G7OC 2KA7A 5AJ3L 4JCVE 2K75A 3RR5A 1VQ8A 3NEMA 1JMCA 4K0KL 1PH1A 4JBJA 1WCMG 1XPUA 3A5UA 1B7YB 4LW1A 1GM5A 5M5YH 2CPQA 2IHEA 1GUNA 1IBKL 4POFA 4JI4Q 3KFUA 1EFWA 1LACA 1H9RA 4BBSH 1HR0Q 2YTXA 4LFAQ 3I72A 4I7ZC 1Q7YC 2A68C 1A0IA 4OONA 4Y52H 2CTJA 3HOWH 5GAEC 1VQMA 3IRBA 3KOJA 3G4SA 1J6QA 1IBLL 5GAHC 4LFCL 2DN8A 4HIOA 5LMUL 4HJ9A 4B3RQ 1WVNA 2ES2A 4KKUA 3EQLC 1IW7D 1V43A 4BXXH 4KLKA 2OWOA 1L0WA 4JI5L 5E7NA 4LF5L 1XMOQ 1XMQL 2K14A 1C0AA 4HJ7A 4X65L 3H0GH 1VQNA
chains in the Genus database with same CATH superfamily
5EKIA 1EY7A 1CK1A 1H9SA 4X62L 1LUZA 4DV6Q 5DNFA 4GOPB 1SMYC 2J0TD 1CKNA 1TS2A 1U4RA 3I4MB 2K5WA 3E9HA 1SEBD 3EVQA 3F2UA 2ZTCA 4PZ6A 1PH5A 1S3OA 3BYYB 2CWPA 5KYLA 2Q2HA 1N34Q 3GTGB 3WDNA 2Q8RE 3OPOA 1AE3A 1X6OA 4QL5A 1SNPA 3SK8A 1I94Q 2NN6I 4QMGA 4YHHQ 4JI0L 2WB1B 3HOZG 4L8JA 3DWAA 1KAWA 1BKBA 1KL9A 2E76C 4A3JG 1KDCA 5L37A 2F0JA 1J8IA 2M8WA 5M5YB 4HJ8A 3KDGA 2HDLA 5EKLA 3T1YQ 3HKZB 2PO4A 1N32L 1YHAA 3VYRA 5EGTA 1I4XA 1LV9A 2D9UA 2F4VQ 3K59A 3SK6A 4A4IA 2FMRA 3RN5A 3TS2A 4ILWA 3J80W 4DV3H 3S1MH 1H9MA 3OOCA 2B2UC 3I4NG 1I50H 2R3ZA 4ALPA 4C3IB 3HOWB 1EZ6A 1VDZA 1TR5A 4XQJA 1EY4A 1SYDA 1R4QB 3CCRA 3HOYB 1D2BA 1JOQA 5DT9A 1EYDA 4IQZA 1Q1EA 4G7HC 2RVLA 3TEHB 2B2YA 1HZAA 1KDAA 3PV0A 2AQ1B 4RMFA 3GTOH 1SNDA 2HHHH 5ELNA 2D5DA 2JA7B 2KENA 1LTAD 2UUBH 4FJSA 1IKLA 4NMZA 4JI3L 3CQZH 1S5DD 4L6TB 3EIVA 2IT1A 5C3XA 1CA5A 2RHQB 1JE5A 1H95A 1VQBA 2YU9B 2F03A 1U9RA 1S40A 1VQEA 3OIPA 5E4WC 5CV8A 3JAMi 1ZTGA 2GA4B 4HJ5A 2XVSA 2E8GA 4JYAH 2UUAH 4K6LA 4DV5H 2F0UA 3NWSA 2LF0A 4XIGS 2E5LQ 4QUCA 4B9WA 1X3PA 3B6YA 4BY7H 1SAPA 4GKKQ 1UE7A 3UDGA 4G4KA 3R3OA 3NENA 2D2CC 3G7LA 3EROA 5IYCH 1RCVD 1C9OA 4DR6Q 2WFWA 4UPAA 2CH4A 2K1BA 1FGBD 1I6HH 4DV7Q 2YTYA 1PZKD 1WJJA 4IOCA 2RSOA 4QGUA 1SMXA 2WINB 4IO9A 1IXRA 1BBWA 4LF8Q 1Q8KA 4A3DH 4HN7A 3HOVH 4B3MH 4A3KG 3SDZA 1Y1VB 2GN5A 1EOVA 3M4YA 4JI7H 2P2RA 1JJCB 4RAUC 3HS0C 1F9RA 2A1SA 4ZYSA 4DR2H 1FNUA 1EWCA 1LLRD 2QA4A 1EQQA 3J7ZC 2PMZE 1F77A 3IFTA 1MJEA 5IYDG 2OT2A 1B1ZA 5DEHA 1BUVT 4X3KA 3HGBA 1K0RA 4TSSA 2A68D 4B8TA 4GN5A 1OTCA 4JI8Q 4ZCKA 2IPKD 2UXCQ 4B3SH 3NQIA 1D1KA 2EZVA 3I4MG 2BA1A 2NVQB 5FLXc 4I65A 2I07B 4LF7L 4FDBA 2KCTA 3J7YW 4DV6L 1EYGA 4A3MH 2JA6H 4GNXB 2NVYB 1QNKA 2WB1G 3JC66 2F0HA 4CJ2C 4DAYB 5C44B 1GJXA 2B29A 1C8CA 3M3YB 3BG3A 3KLWA 4NB3A 2NN6H 2PQEA 1N34L 1PDQA 3SE0A 4C2MB 4ZQ3A 3SK4A 4NBQA 4HMIA 4FF2A 5CMDA 1EFID 2KEEA 3HKZG 2Q2UA 1D5ZC 1KHIA 4TKOB 4KN7C 4FF3A 2F3IA 2JA9A 3R8BA 3UI2A 3HOXH 5IGGA 1STNA 3DUZA 3CCLA 5FLMH 4K5WA 3I55A 3V05A 1WTQA 4IUTA 1ZYRD 1KRSA 3MXPA 4NZTM 4IPDA 3STBC 4RGMA 1IL8A 2WB1E 1VIGA 1XTDA 3S2DB 2KVMA 4HSVA 4C3IG 2ZXRA 4KMUC 3HOWG 2F4VL 1HZCA 5M3MH 1PYSB 3S2HB 3HOYG 1Y8OB 3MEFA 3NSWA 4YY3Q 2PQAA 2YYZA 1PTOH 4QB4A 1HNZH 1SMYD 3HFZB 1ZKOA 1ILQA 1XNQH 3I4LA 1PFBA 1SNCA 3EFXD 2JEAI 4KKTA 3GV3A 1R9TH 2JA7G 1PFSA 2NYZD 1BBUA 2ANNA 3D6CA 1IBMH 3K0YA 1ILPA 4X64H 4RGNA 3I70A 2QEXA 1PLFA 5LMNH 1ESRA 4CJ1B 4U673 1YJ9A 4YCUA 3RNUA 3F2BA 3J80E 1RTOA 4GN4B 1JJGA 2CTLA 3H3VC 1GOZA 2N88A 4HTHA 1I6VC 2DJFC 2K5VA 1BVSA 3I7FA 3S16H 2OXPA 1JWSD 3F2DA 2A8VA 3NK9A 3GR5A 3PIO3 4LFBL 2I5MX 1GO3E 1MIUA 4DK1A 3HZXA 2L11A 1VCIA 4IFDJ 4QY7A 4DV0Q 2LMCB 3RN2A 1XYIA 1VMPA 4KN4C 2EQSA 4PG3A 1EY9A 3ULJA 2K1HA 4DR1Q 2BCOA 4ULLA 2E5LL 3NTKA 3C2PA 1SN8A 4R4OA 3S1QB 1A2UA 3DM1A 5K5PA 3T1HL 2SOBA 4LF9Q 3FKIB 2UXDH 4E6IA 5ELCA 3OTOQ 4JI1H 2EYLA 2XWJB 3TP8A 3X3MA 1Y1VG 2BOSA 5A2QW 2EYHA 4IPCA 3FPPA 4J8QA 3K5MA 2JA8H 3K8AA 4GOPC 1E1TA 2QCPX 2XGTA 2K7VA 2IHFA 4K5XA 4B3TL 4UAIA 1WTVA 3UE0A 1CT1D 5E3FA 3PO2H 4B3MQ 1N33L 5LL6S 1F2ZA 5I2XA 3Q6SA 4DAPA 3K7UC 3K7AH 5CORA 3HP3A 5COYA 5FLXL 3TRZA 1OXVA 1LT3D 1QB5D 4YCVA 4CDCC 2LXKA 4KHVA 3G6JB 3KBGA 1HFGA 2L0CA 1S03G 5C0XI 2A19A 3J81i 2UUCQ 4LK1C 1FD7D 1WE8A 1EYCA 3TZUA 1NAPA 2CTMA 1RIPA 5CV6A 2WKCA 1P16A 5C44G 2R7ZH 1HA6A 2LTLA 3K5LA 2EXDA 2JQOA 1N36H 2DNEA 2FXQA 3NQTA 3T56B 5C0XJ 3C3LA 2BH2A 4A3IB 1PH9A 1CZWA 3E6ZX 3BJUA 3V96A 4OWXB 4DR4H 3OW7A 5IT9c 3GTMB 4GLXA 4LF6H 5D3IB 2K5NA 1LTLA 2PZUA 2BDNA 1HRJA 2LTMA 1AEXA 1OO9B 3W1BA 5FJ8G 3GTQH 1AFPA 3OIQA 1SFOB 1K1GA 3QIAA 3U58A 2OQ0A 3M9BA 4PZ7A 1PRTB 1EUJA 1DYQA 2EYPA 2N78A 4DUYH 1GXDC 1IBKQ 5AFWA 4UP8A 3QJYA 5C4HA 1STYA 4OIKA 3GTKB 1G8ZD 2AMCB 1B70B 1PV4A 1G91A 3E3XA 4B9XA 1TWAB 4OIJA 1QVFA 4BY1B 1QWYA 4MTNA 4JC0A 1PFMA 2Z4HA 2RQXA 2KCMA 1HJPA 3DEPA 4DGZA 2E2DC 5IYCG 3J81L 1IYJB 4DXGA 4DV3L 1HNZQ 1V8QA 2NZOA 5C4XH 1E2WA 1GUOA 3VR3A 1HUMA 2EY2A 5GADC 3PMFA 1K3BC 5ELDA 1A3VA 4LFCQ 3V69A 2CHBD 5IP7H 1IBMQ 4X6AH 1GUGA 4LJZC 1ZZKA 3TDQA 1HUNA 5LMUQ 1QUQB 3CRLC 3W2DA 1Y8NB 1Z7TA 4KY5A 5C4JB 5CBEE 2Z6KA 1OXUA 4HCEA 5E4XA 2KHSA 2UUBL 1DOLA 3VR4A 3F2CA 1KTKA 3ND9A 3T53B 3STBD 1TWGH 3K7AB 4H8AA 2KUMA 2JSOA 1IYUA 2R61A 3CU7A 3EN2A 4JI5Q 4DAVA 3FKIG 2M00A 3BS1A 5IGBA 4LF5Q 3ITPA 4JYAL 3LGJA 2K28A 1K3RA 3MVVA 2UUAL 4EVOA 4DV5L 1LTSD 2D0OA 5IP9H 3VDYA 3A0JA 2PW5A 3TP6A 4X65Q 3AU7A 2OQKA 4X62Q 4QIWB 2JE6I 3D0FA 1XRHA 3HOUH 3MA2B 1FJGH 1B2TA 1DM0B 1W3SA 4C3HB 4WALA 4JI1Q 3A8JE 4OD6A 2FFMA 1STHA 2D0PA 4DXFA 2IX0A 3QOLA 3KUPA 4JVYA 2PCFB 3M7NA 1G6PA 4GNXC 4TRDA 1OXXK 2R93H 1I4PA 2Q2IA 4JI0Q 1ET6A 1ET9A 1B4OA 2B8FA 4B3ML 1HR0W 3RLNA 1LM0A 4JI7L 3M7GA 1JC7A 3AFQA 1Z47A 1QJOA 1X9NA 1SJHD 5JEAJ 4POGA 5C0XH 4DR2L 1N32Q 2Z1CA 3NPPA 3RLOA 1YJNA 3J81j 2ZJPA 1B53A 1YI2A 5FO9B 1G291 2QDLA 4R4QA 5KRUA 1YHQA 3BYTB 1S5ED 2ID0A 3CCVA 2MPMA 5IT9L 3KDFB 1VS0A 3ZYYX 4A3IG 4FVMA 4H02A 5A35A 1SE4A 3N52A 1U4MA 2VUMH 1VQFA 2F0IA 5CGKA 5IGEA 2BL5A 4J6HA 1TWFH 1DGSA 4NP5A 3H6MA 3KF6B 2FFKB 2DUDA 2EY6A 1K0SA 2B2TC 4IJHA 4JI3Q 5KIXA 3PSIA 4GKJH 5EPJA 1PZJD 2MO1A 3S1RH 2WP8J 2CVRA 2EJFC 4X3TA 1GHJA 4BY1G 1TWCH 1ZZJA 4NXMH 4OO1I 2CQAA 4DUYQ 2PZWA 2G9HD 4EX5A 1O7YA 3CCSA 4V0BA 2MJ8A 1WHRA 1M8AA 2X69A 2ALYB 5M3FB 1B3AA 2A6HC 4Z9CB 1PA6A 1LO5D 2OPVA 5JPMC 1KDBA 4JV5H 4N9TA 3CPFA 2AQ3B 2EYJA 5DLQE 4DNIA 1EQRA 2B2YC 1HNZL 1PMRA 4LF4H 4XT3B 1Q1BA 5EBCA 3A74A 2I0QA 2HQLA 1TWHB 2XSCA 5M5WB 3HOUB 3PO3H 3SHLA 4F8MA 1NY4A 3T16A 1CSQA 1HNWH 2FHTA 1QZHA 2KOLA 2D62A 2GVBA 1RL2A 1ML0D 4HEDA 4L5TA 4P71A 3FHWA 1IBML 4X64L 1VQ5A 1KXLA 2KCNA 4X66H 3PF5A 1VQIA 4DK0A 2JP1A 1Q81C 5C6AA 1SDFA 3E0JA 1TKWB 1Y14B 5LMNL 2EDGA 2NB0A 3KBXA 4CKCA 3GTPH 3GV6A 2K05A 5IYBH 1X9ZA 2AUJD 3GTLB 1LYLA 4JPBW 4OL7A 4EQ5A 2B63H 1LT4D 4R8NA 1F9SA 2B2WA 3A7AB 4DUZH 4EQNA 2BE5C 1L1OC 4XT1B 3ICEA 2ZXOA 1ZYRC 1H9KA 2D9IA 4C3HG 1KAAA 5FO7B 3X3NA 3CCJA 1AZPA 4OX9H 4GN3B 3KF8B 4J15A 1NCVA 2KHIA 5C3EG 3KJOA 4LF7Q 3AEVA 3I56A 4KHPH 2F0DA 5HY6A 4JW0A 3JAMc 1VQHA 4DR3H 1R4PB 2VUMB 5JEAH 4DR5H 2SEBD 4RHSA 3S1NH 4XTCS 1E22A 3QG1A 1AN8A 3HRZC 4JI1L 1CFMA 1EIYB 3P75A 4PDBA 4H13C 2NVXH 1ENAA 2CFMA 4R8IA 2CPMA 2R7FA 5K36G 5TSSA 1CM9A 3DEOA 4GZYC 1CKOA 2EPBA 1JCKB 3RUZA 2KJXA 3W5OA 4MZ9A 5CV7A 1Y1WH 4JI2H 1PRTC 1BOSA 1PVOA 4ZLTF 5H1SE 3MZ5A 4BBSB 3MFYA 1Z6HA 2CWAA 2HCIA 1XPOA 5EPLA 4QUFA 1JICA 5D65A 1UNSA 3DLLA 2UXBH 5IY0A 1LTID 4BS9A 4HIMA 3UOEA 2RF4A 4A3FH 4IFDG 5BN3A 3LWEA 1EWIA 1LTBD 2TSSA 4KKSA 2IY5B 2KCCA 3IKJA 5JAVA 3VA7A 5LL6X 1N36L 5KNBA 3ER0A 3URYA 5FLXW 4A3LG 1MI2A 1DD2A 3LX0A 4C1NI 2XNAC 1YIJA 2UU9H 4DR4L 5ELEA 4LF6L 4PQXA 1Q12A 4ZKCB 5M3FG 4OO1H 1LTGD 2FINB 4GLVB 1P8LA 2E3UA 4ZUIA 2QILA 4PZ8A 1VQLA 4LFBQ 2NUCA 1PH4A 4DUYL 1K83H 4A93H 1ESFA 3TQYA 1BDOA 1ZXTA 2WKDA 1TS5A 3OHXC 5CBAE 2KBNA 1XWEA 3IAYA 1ICFB 1CKMA 1S5BD 4WJ4A 5DM73 1UG8A 3D4DA 1DXMA 2F0SA 3T1HQ 3C1FA 1W6JA 1VQ7A 3VA5A 4LAAA 3VR2A 3A5ZB 3H0GB 3MXNB 2LFNA 4N8X1 3G6EA 4LF4Q 4BBRH 3RZOB 4FJUA 3AQQA 1MBYA 1VQJA 2EIFA 2VQEH 3VYSA 2LRRA 4X3SA 5G3LD 4B3TQ 1Q86C 4Q0FA 3E5SA 1HNWQ 2E2JH 1I3QH 1PHJA 3D6WA 3IL8A 1L0XB 3MEHA 5ISRA 2F3WA 4GS3A 1N33Q 3PIOA 2JZXA 3IFDA 2VXWA 1V1PA 2V4DA 4O42A 3DXJC 1QNUA 2A6HD 3TBIB 1A3TA 5CV5A 5GAGC 2WAQB 4IJLA 3JAML 2F0LA 2XN9C 4NPSA 4AM3A 4DUZQ 1OXTA 2RDFA 2VUMG 4ZKBB 1IZ6A 4UP9A 4JI6H 1D7QA 1LTRD 4P72A 1G2TA 2ZM6H 4A3BH 3S1MB 1XNRH 4TVAB 2PYKA 1I50B 1V9PA 1T9HA 1STGA 1W6KA 1GVPA 3KLSA 1TUAA 2L12A 2NTSA 5BR8H 1FJGL 1MSHA 2K32A 3CC4A 1PH8A 1A15A 4XYOA 1M90C 2K4KA 3KLSX 5M5XH 4QF4A 3K80C 4IUPA 3PIP3 4NXNH 2K50A 1DONA 5EAYA 1WTXA 1LABA 1M1KC 3GTOB 4AH6A 1J4WA 2RA4A 1EEFD 5DM63 4A3EH 3CQZB 3S14H 4BBSG 3S15H 2BE5D 2ZXPA 4H7BA 2B2UA 4EGVA 4R4IA 4K8JA 2JA5H 4CJ0B 1VQ9A 3KLRA 3CCUA 4KK7A 2EOTA 4WFN3 5J3BA 4BWGB 1RHPA 4IOAA 4S3SA 2SNMA 3HKZE 2B2VC 4O0AA 4DV3Q 2EY1A 3GO5A 3J7A5 4BY7B 2VQFH 5KNCA 2E74C 3FDTA 1PTOD 3RZOH 4A3CH 2F0MA 4IN3A 3K81C 4RG1A 1J9OA 3FVQA 1XTCD 1G2SA 3U1KA 3CC2A 1QUQA 4QJFA 4OHJA 2R92H 3J81c 1I6HB 5G3LF 4I7AA 1EL0A 4F87A 1W2BA 4DV1H 1LTTD 4A3DB 3M4OH 2HHHQ 3HOVB 2UUBQ 4LUVA 4BXXG 3CP0A 1PH7A 3J80i 2XIWA 5IGFA 4APVA 1WD0A 4GKJL 1PRTD 3Q0AA 1YZ6A 4P75A 5IT9W 2FPHX 3C1EA 4OXPA 3GTJH 2K5QA 5HGQA 2A1AA 2C35B 4JBWA 1AZQA 4NXML 4CBVA 1O78A 4HIKA 4JYAQ 4DV2H 1K28A 1EQVA 3H0GG 5FLXE 2UUAQ 4DV5Q 3BVMA 3O13A 4IUQA 2K01A 4WJWA 1WCMH 1NTGA 3G71A 3D4RA 3AMUA 3GABA 4JV5L 5C5LA 1HXYD 2G9DA 2JEBI 3N6RA 1E24A 1EEID 2F0EA 1NSNS 2EYOA 4RKBA 1K8AC 1UUPA 4A3MB 4LF4L 1XMQH 2JA6B 4H44C 4ID6A 4YIJA 2VKCA 1X56A 1YJWA 1CHPD 4G08A 1YITA 1O7IA 5I4DA 1UEBA 2VQEQ 3PF4A 2HDMA 3FRPB 1HNWL 2PW7A 2M9VA 5D3DA 1E2ZA 1ICWA 2WAQG 3A7LA 4X66L 5IGCA 4DV4H 4JI7Q 4IUUA 3TP7A 1SNOA 4XQNA 1BQQT 1L1OB 1QVCA 4NW2A 3DMUA 1KIXA 1YNJC 1DCZA 3EA6A 2E2HH 3HOXB 4DR2Q 4P74A 1X32A 1RD9D 3KK7A 4J1MA 3T13A 2YV5A 1E0BA 4K14A 4R9WA 3KDFA 4DUZL 1TS4A 2AQ2B 5KEEA 5JJLA 4B3SQ 5M3MB 2WAQE 5JJIA 1WTJA 1PTOB 4OX9L 1J5EH 2BA0A 2ZM6Q 5JVH3 4FF1A 4UHVA 1ZZIA 1DT4A 1K8OA 1V9NA 4KHPL 1BO0A 3CKIB 3KF6A 2QGQA 1Y8PB 3MC0B 4IPGA 4PMWA 3J81E 4DR3L 1PH3A 1LT5D 4DK6C 2EXZA 1R9TB 4G7ZC 3PUVA 4DR5L 2VB2X 3OWFA 5J22A 1I4GA 2P5ZX 4JOIC 1EY0A 3RZDH 2RCFA 2R92B 3TS0A 3D4WA 1ZEQX 2F0OA 1B8AA 4YWKA 3A8KE 3GD7A 1PH2A 4A75A 1MD2D 5IGDA 1PRTF 3S16B 2EJGC 2NZHA 1QZGA 2MFIA 1BXTA 4BY7G 1QOHA 4JI2L 1EC6A 2E2IH 1NMGA 1TT2A 2VY3A 1K8GA 4FXDA 3FP9A 4QCLA 3NELA 2JVZA 1HNXH 3I0PA 5FOBB 2MNAA 4L5QA 3ERQA 2BDOA 2UXBL 2PNHA 4JI4H 3QOJA 2VQFQ 1STBA 3VR6A 1XNQQ 3HOZH 1HR0H 2A69C 2DGRA 4A3JH 4A3DG 4NZRM 1JT8A 2CTEA 3HOVG 3R2IA 4LFAH 5GQOA 2JJQA 3SXHA 2KQ3A 5LHY1 4DK3C 4X64Q 1SE2A 2JA8B 2X6GA 2HH3A 2C5CA 3CAMA 3ERSX 4XQQA 1TY0A 3U9OA 5LMNQ 2AXYA 1X65A 1BR9A 3G48A 4RA8A 1UAPA 2PQAB 5KYIA 2HHHL 2UU9L 2VL6A 3U4VA 2PT7G 3PO2B 5I6YA 4HCSA 2O5JC 2EYFA 2CCZA 1ASZA 4EC5A 1SRUA 3K57A 4DNRB 3MAQA 2E2HB 3KDKA 1A8VA 1AP0A 1F2MA 4HJAA 4EQPA 4WJ3M 4B3RH 4L63B 5IOCA 2A5HA 1SYCA 4DV2Q 3RLFA 4KJNA 1YEZA 1S5FD 1FGUA 2DJGC 3CXCA 4NDXA 2KHJA 3SGIA 5IWAH 2MHVA 4GOPA 4A3MG 4R4CA 2JA6G 3NUCA 4IALA 2HH2A 3S17H 2UXDQ 2Q8TA 1X4MA 3BZKA 2R7ZB 1D5MC 4H0LC 2NN6G 5IT9E 1WYDA 1PZID 5EBDA 1XMOH 4N8FA 3BDOA 5I6WA 1UE1A 1IYVA 2X6LA 1SYEA 4Q5VA 2VQEL 3CHBD 4HMJA 1ONLA 3HOXG 1X0AA 4Y7NH 5FLMG 1GUWA 3DHQA 3GTQB 2IX1A 1GD7A 4HR7B 4XXEA 1NJIC 4RGTA 4DV4Q 2HT1A 1A2TA 2Q8IB 5M3MG 1J5KA 1AE2A 2XTIA 4FF4A 1I94H 4YHHH 2OEOA 5I9OA 1JB7A 4AQYH 1K8MA 2MO0A 2ZJQA 2K5HA 1C4QA 4B3SL 1KLUD 4A3KH 4JI6L 3BVZA 3T1YH 1ODHA 4IPHA 5M9OA 1YHBA 4WRDA 1XNRL 2ZM6L 5C4XB 2R92G 3CMEA 2O4CA 1GHKA 3PUZA 4KY6A 2EE1A 3ULPA 1N36Q 4OELB 3QD7X 3CD6A 1U5KA 5BR8L 1NE3A 4DR4Q 5IYDH 4LF6Q 4DPGA 5I2YA 4AYBB 2SDFA 3JAMW 1JB3A 5CYUA 5CV9A 4NXNL 1Z2IA 1YNJD 4KY7A 3I4MH 2DNCA 1SSOA 3A8IE 2CWHA 4IUNA 1NR4A 3MFGA 3CC7A 1F9QA 3GTGH 1TWGB 5KNDA 1TVXA 2F0WA 3H91A 3P1HA 2CKZB 2JYOA 1U4LA 1KHMA 1SYBA 5FK9C 3QR8A 5A2QL 1XPRA 3F8TA 2ICEC 1UE6A 4KJOA 2PNRC 3MXNA 1S72A 1HNXQ 2CW0C 2JA8G 5GROA 1I5FA 2VQFL 1KRTA 1XNQL 4QQBX 2E5LH 1EIHA 4KI0A 3H09A 5ELFA 4DFAA 1HFNA 1F9PA 3PO2G 1CTMA 4JVHA 1EIFA 4GKKH 1FL0A 4YCWA 4C3IH 3VKEA 3NBHB 4DU9A 4A3GH 2I5LX 2R93B 3HOYH 4DV1L 1DZ1A 4DR6H 5HURA 2B8GA 3UDXA 2N8NA 4WANA 5C3WA 1N8RC 3NXWA 2ZQEA 4DV7H 5IIFA 1S4ZA 1O7LA 1MHWC 4LF8H 3W3AA 2Q2TA 3GKUA 1ENCA 5CV4A 1D5XC 1EZ8A 3W1GA 2JA7H 3OW2A 3FAUA 1GKHA 1I6UA 4RCOA 4NKLA 4ME3A 4MIUA 2LKVA 2K6AA 2R7ZG 2F0NA 4DV2L 3OYYA 3BZCA 4K5VA 4MHEA 3Q8DA 1QILA 3KYHC 4F88A 5JVG3 2YU9H 2XWBB 1EYAA 3D3RA 2K52A 1CSPA 1CA6A 1IKMA 5IWAQ 2F0VA 2A69D 3ZJYC 4ABNA 4GNXA 4B8CD 2UXDL 4DAYA 1O80A 5BN5A 4DR7H 2PPBC 3GP7A 1WOCA 1PTOC 1UE5A 3DWQA 5EJWA 5JOBA 1FJGQ 3CCMA 4FYDA 4JI8H 2UXCH 3FEWX 4QIWE 1TWFB 3EJIA 5NUCA 3LWUA 1N9WA 2RBMA 3E0EA 1E2VA 1CUKA 5C4ZA 3PUWA 4R4TA 1KABA 1JOKA 4RGOS 2A6EC 5T1IA 4ZUJA 2DY7A 1VQPA 2JK8A 3S1RB 4DV4L 2XRQD 3AFPA 1VF7A 1HCZA 3Q23A 4BA1I 1Q46A 2AWOA 1TWCB 3I2ZA 3M85A 2CWFA 5JPNC 4FP5D 1QCBD 4PV1C 5BN4A 1Y1VH 2RCNA 1YNXA 3C46A 5C4XG 1YBYA 4L5RC 1PQXA 2F0FA 3E9IA 2TMPA 1KLGD 4AQYQ 1D1IA 1NXUA 2M6QA 1HH2P 1CI3M 1WI5A 1TIID 4QMFB 2F52A 2B2TA 1JR0D 5IP7G 1SYGA 1XXGA 1IHZA 4AYBG 1V1OA 3CPWA 1J5EL 3EZJA 4KHZA 3PIPA 1VQKA 1SE3A 1D6EC 1TY2A 1X3QA 2VB3X 1C7YA 3GQBA 4XYQA 3PO3B 4YY3H 3ULLA 2NVQH 4YWLA 4EQOA 4JBKA 1H9JA 2A74C 4GKJQ 3L0OA 2NWGA 2NVYH 4A3GB 2X06A 4PMBA 4OWWB 3GTPB 4HIDA 4FXGC 4AYBE 2ENBA 5C44H 3M3YH 1VMCA 4NXMQ 1SE8A 1MKHA 1WFQA 4C2MH 5IP9G 2Z9HA 4A76A 2B63B 1STEA 4RHRA 4CKBA 3LNNA 1RKNA 4LIJA 1WTHA 1K9MC 2N55A 1I4RA 4FNFA 3RF2A 4BA2I 3HOUG 3NCVA 3JAME 2K03A 4JV5Q 2ICIA 4OWTB 1CQVA 2HD3A 5FJ8H 1PXUA 5I9PA 1HNXL 1S5CD 1GUTA 1VQAA 2Y0SB 1Z9FA 3S2DH 4DV0H 5T1GA 4JI4L 2F0TA 2M2LA 1DOKA 1WTRA 1T5EA 3S2HH 2R93G 3S1NB 4DR1H 3VYUA 3MHBA 1HR0L 5J1ZA 1B44D 4HAEA 1U0LA 1VF5C 4LFAL 1B50A 2NVXB 4DN4M 4LF9H 4X66Q 1L1OA 2A73B 3OTOH 2QDBA 3BZDB 5C0XG 1X4NA 3ND8A 2VW9A 1BCPC 3DM3A 4ME5A 2K5DA 3QO2A 1E1OA 2OTLA 3J81W 1FYCA 3K5OA 2EY5A 1QVGA 1Y1WB 3BVGA 4MNOA 2EYMA 3K58A 3A56A 4JVZA 3RMHA 3NE5B 4B3RL 1Q90A 2CW0D 4OX9Q 1MJCA 3U9SA 3J80c 3TP5A 1HTLD 2H5XA 4OGQC 2JXMB 1WTOA 5IWAL 1WTWA 1FVIA 3FMCA 4KHPQ 4K2KA 1A6XA 3K0XA 4DR3Q 4A3FB 1CZGA 4DR5Q 4OCHA 1RODA 2UUCH 1DOMA 3CCQA 4DR7Q 4LUZA 4V190 4O2DA 3S1QH 1ASYA 1XMOL 2SNSA 2PI2E 3FKIH 1VQ4A 2Y3MA 5LL6b 1SLJA 2NBFA 3UDIA 4P73A 3WWVA 3UDFA 1I4QA 1MSZA 1E7ZA 2ZT9C 1HZBA 4ODGA 1NMFA 5J39A 1DTJA 4K0KH 1HQRD 1B9MA 1SR3A 2XRSD 1H9SB 5ELOA 3AEVB 1HTPA 2HCCA 2G8YA 1CKNB 1IL2A 1EY5A 1K83B 4A93B 4R1JA 4JI2Q 1EY8A 1VQ6A 1NUCA 1UEAB 1XJVA 4LNQA 4RCNA 1I94L 4L5SA 2F0PA 4RWSC 4YHHL 1IBKH 4LMQD 1DJRD 3U50C 4JK1C 4AQYL 2UXBQ 2DY8A 1E3PA 3PO3G 2L15A 1X3FA 3NTIA 1OXSC 2VNUD 3S9WA 4K2LA 1EWHA 3T1YL 1FNVA 4LWCA 2VZAA 5EPKA 2L9HA 1KC8C 1KQSA 1SNMA 2L1BA 2AKWB 4BBRB 2MQHA 4WORA 4A3GG 3CW2C 2PZTA 4DF7A 4B08A 5IYBG 2ANRA 2A6ED 1EQTA 3NBIA 2WV6D 3AYHB 4GLAC 2E2JB 1I3QB 2YTVA 3R2TA 2UU9Q 2F4IA 2PY9A 2B63G 1T5XD 3TREA 4KTAA 3CCEA 1IBLH 5CC4A 3SR1A 3OSSD 3VYTA 3ONAB 4A3IH 4CDDC 4LFCH 3KJPA 1A62A 1G51A 1KNEA 2MGSA 3SEBA 3GTMH 2L55A 2NZ1D 1X54A 2IJ0A 5LMUH 3MTSA 2FJ2A 4IFDI 3SK5A 1SFOH 2AWNA 2Y0SG 1D8LA 3FPUB 3MXUA 1X55A 1QG7A 2H4OA 2ZTEA 5JEAG 1RTNA 1RJTA 2ASBA 2FMMA 1F2LA 1HPCA 3F1ZA 3GTKH 4UP7A 4A3BB 4JI5H 3L3OC 1SJED 2EVBA 1TWAH 4LF5H 4BY1H 1L2FA 3WOEA 2V1CC 4DAMA 2Z6KC 4JG2A 1GUSA 2LY7A 3BDLA 4G57A 4X65H 2WACA 4X62H 4LUOA 1VQGA 2Y0SE 2O4XA 5D14A 2NVTH 3D31A 2L4NA 2IX3A 5M5XB 2F0QA 3TZDA 3PGZA 3TMEA 1K73C 4GKKL 1Y1WG 1NR2A 2CH4W 1HHVA 4IZ8A 4C56C 3A55A 1F2YA 2IWHA 2LS01 2GVAA 1AN7A 4A3EB 2MUYA 4DR6L 3J80L 3S14B 3CRKC 3M4QA 4C3JH 3S15B 3CF5A 3VR5A 4DV7L 3H3VI 2EJMA 4JBMA 1O7ZA 1KD1C 4CHTB 5C4JH 2QEJC 4JI0H 2JA5B 1X3EA 2Z8LA 4LF8L 3NTHA 1VIHA 2CTFA 3T51B 4A3FG 2DGYA 4ZRZA 2AHOB 4FO2A 4AIMA 1BF4A 5KGUA 1SYFA 3NHHA 3P20A 4P2CB 3T4AC 4JI6Q 2R7DA 4KD3A 1XNRQ 3R93A 1N32H 1PTOF 1PYBA 1SBBB 1V1PB 4X3UA 3BU2A 2HIVA 5LMNW 5IODA 5CR3A 1KNAA 3GDEA 4N9PA 5IE8A 1WTPA 1Q82C 2QNDA 5HGTA 2R6GA 2IW3A 5BR8Q 4DR7L 5FO8B 3L7ZC 4JI8L 2Z0SA 4OO1G 2UXCL 1F0XA 2MP1A 3D8GA 4U68A 1VQOA 1HZ9A 3HKSA 3AB9A 1BCPD 1EU3A 4NXNQ 1LT6D 2VS1A 2RKSA 1U4PA 5EKKA 4HSPA 2K33A 4C3HH 5AJ3Q 4A93G 4DNTB 3M4OB 3BDCA 1PH6A 4OEMB 2B3GA 5C3EH 5JJZA 1V8CA 1A3UA 4K0KQ 2B2VA 1JOOA 3H94A 4CGYB 3L2PA 1UWVA 1A63A 1EU4A 2Z6BA 3UE1A 3MWYW 2LSSA 2H1EA 4C1NK 5FKAC 3GTJB 4JI3H 2HUGA 4F7XA 4UY8C 1SEIA 1SXTA 2HIXA 2K04A 2CQOA 1YNNC 4M8AA 4BBRG 3PUYA 1WCMB 5K36H 2N49A 3TN2A 2MJHA 1CQFA 3OSOA 2ATWA 3S24A 1TQOA 2J7ZA 2KEDA 3J7AF 5ELBA 2OCEA 3DWPA 1JE4A 3EBEA 1IW7C 1VQDA 2RHSB 3H15A 2OTJA 1SNQA 2C9OA 3NBHA 3OMGA 2PQUA 4ZK9B 2OPUA 2YQRA 1MSGA 4YY3L 3SB1A 1JQYD 1HQMC 2G5DA 2LXJA 3Q24A 2NVTB 4DV1Q 5C5MA 1S20A 3J7AK 4DKAC 1IBLQ 1V1QA 1VQCA 3I4NH 2QF7A 5E1FA 4IFDH 1FNWA 3NP8A 2L5TA 4C3JB 3KF8A 4A3BG 1C48A 1B9NA 3OWEB 2I5HA 2QKIC 1YVCA 4A3LH 4IURA 2PI2A 1TS3A 4DA2A 2B39A 3Q22A 2NTTA 3M4PA 4RH6A 1XX8A 1JJ2A 2RDHA 5M3FH 2F1MA 3I91A 1SROA 4PMCA 3I3CA 4DV0L 2ZTDA 1XMQQ 4KV6A 1FR3A 1HA5A 4DR1L 3I73A 1TXYA 1BCPB 2OF1A 2AUKA 4PNYA 4A3EG 2WIIB 4TQUS 4LF7H 4DV6H 1BCPF 2ZJRA 3RZDB 1BBXC 1RDPD 3PUXA 2B2WC 4LF9L 3PCOB 1TWHH 5M5WH 1WVLA 1EIGA 3OTOL 2JA5G 2O5IC 5F2DA 2E75C 1Y69U 3H3VH 3CMAA 5JJKA 5C3EB 1M4VA 3K6OA 3OETA 1N34H 4O1NA 2FMCA 3PQIA 1EOTA 3HG9A 2E2IB 4YWMA 3GTLH 4A3CG 4JOIA 1FKAH 3SVMA 2N3SA 2CTKA 1J5EQ 2BH8A 1QE6A 1AH9A 5A2QE 1TU2B 3U4ZA 2F4VH 3OMCA 1X3GA 3HOZB 1RF2D 1JORA 4A3JB 3I4OA 2UUCL 1STAA 1NBWA 1JWMD 2QW7A 4G7OC 2KA7A 5AJ3L 4JCVE 2K75A 3RR5A 1VQ8A 4CDFC 2F0KA 3NEMA 1JMCA 4K0KL 1PH1A 3I4NB 4JBJA 1WCMG 4KD4A 2I46A 1XPUA 3A5UA 1Q3LA 1B7YB 3HEJA 5EQ0A 3L9AX 3P7JA 4LW1A 4M1UB 1GM5A 5M5YH 2CPQA 4LFBH 1ENFA 2F0GA 1B3QA 1AW7A 2IHEA 2J4XA 1GUNA 1L0YB 4POFA 1IBKL 3J7AV 3V2TA 1I4HA 1Q8IA 1CHQD 4JI4Q 3KFUA 3S17B 1EFWA 1LACA 3QWNA 1H9RA 4BBSH 4K6DA 1HR0Q 2YTXA 4IUVA 4LFAQ 3I72A 4I7ZC 1PFNA 1Q7YC 1BNZA 3T1HH 1MGSA 2A68C 1A0IA 4MN3A 4MTKA 4OONA 4Y52H 2CTJA 3HOWH 1PYWD 5GAEC 3I90A 2IL8A 3I8ZA 4Y7NB 2HQEA 4RKLA 4C3JG 1NNXA 1VQMA 3MXGA 3K5NA 4RFBA 3IRBA 3KOJA 4CDEC 3G4SA 1VBIA 3NWTA 1J6QA 1IBLL 4ZAIA 5GAHC 4UDUC 4B3TH 2O2LD 4LFCL 2Z4IA 1JWUD 1EY6A 2RDGA 3TSSA 2DN8A 1YNND 3WOFA 1N33H 4FXKC 4HIOA 5LMUL 4HJ9A 2KECA 4B3RQ 2PMZB 1WVNA 4CKEA 2ES2A 4KKUA 3EQLC 2JN4A 3RD4A 1IW7D 4A3KB 1V43A 1WD1A 4BXXH 4KLKA 2OWOA 5DAUA 3QB3A 1G6ZA 1L0WA 4JI5L 5E7NA 4XDXA 4LF5L 1XMOQ 1XMQL 2K14A 1C0AA 2F3VA 4K8IA 1II3A 4HJ7A 4E9JA 2RSNA 3A54A 4X65L 3H0GH 1VQNA
chains in the Genus database with same CATH topology
5EKIA 1EY7A 1CK1A 1H9SA 4X62L 1LUZA 4DV6Q 5DNFA 4GOPB 1SMYC 2J0TD 1CKNA 1TS2A 1U4RA 3I4MB 2K5WA 3E9HA 1SEBD 3EVQA 3F2UA 2ZTCA 4PZ6A 1PH5A 1S3OA 3BYYB 2CWPA 5KYLA 2Q2HA 1N34Q 3GTGB 3WDNA 2Q8RE 3OPOA 1AE3A 1X6OA 4QL5A 1SNPA 3SK8A 1I94Q 2NN6I 4QMGA 4YHHQ 4JI0L 2WB1B 3HOZG 4L8JA 3DWAA 1KAWA 1BKBA 2E76C 1KL9A 4A3JG 1KDCA 2F0JA 1J8IA 5M5YB 4HJ8A 2HDLA 5EKLA 3T1YQ 3HKZB 2PO4A 1N32L 1YHAA 3VYRA 5EGTA 1I4XA 1LV9A 2D9UA 2F4VQ 3K59A 3SK6A 4A4IA 2FMRA 3RN5A 3TS2A 4ILWA 3S1MH 1H9MA 3OOCA 2B2UC 3I4NG 1I50H 2R3ZA 4ALPA 4C3IB 3HOWB 1EZ6A 1VDZA 1TR5A 4XQJA 1EY4A 1SYDA 1R4QB 3CCRA 3HOYB 1D2BA 1JOQA 1EYDA 4IQZA 1Q1EA 4G7HC 2RVLA 3TEHB 2B2YA 1KDAA 3PV0A 1HZAA 2AQ1B 4RMFA 3GTOH 1SNDA 5ELNA 2D5DA 2JA7B 2KENA 1LTAD 1IKLA 4NMZA 4JI3L 4L6TB 1S5DD 1CA5A 3CQZH 2IT1A 5C3XA 3EIVA 2RHQB 1JE5A 1H95A 1VQBA 2YU9B 2F03A 1U9RA 1S40A 3OIPA 5E4WC 1VQEA 5CV8A 3JAMi 1ZTGA 2GA4B 4HJ5A 2XVSA 2E8GA 4K6LA 2F0UA 3NWSA 4XIGS 2E5LQ 4QUCA 4B9WA 1X3PA 3B6YA 4BY7H 1SAPA 4GKKQ 1UE7A 3UDGA 4G4KA 3R3OA 3NENA 2D2CC 3G7LA 3EROA 5IYCH 1RCVD 1C9OA 4DR6Q 2WFWA 4UPAA 2K1BA 1FGBD 1I6HH 4DV7Q 2YTYA 1PZKD 1WJJA 4IOCA 2RSOA 4QGUA 1SMXA 2WINB 4IO9A 1IXRA 1BBWA 4LF8Q 1Q8KA 4A3DH 4HN7A 3HOVH 4A3KG 3SDZA 1Y1VB 3M4YA 1EOVA 2GN5A 2P2RA 1JJCB 4RAUC 3HS0C 1F9RA 4ZYSA 1FNUA 1EWCA 1LLRD 2QA4A 1EQQA 3J7ZC 2PMZE 1F77A 3IFTA 1MJEA 5IYDG 2OT2A 1B1ZA 5DEHA 1BUVT 4X3KA 3HGBA 1K0RA 4TSSA 2A68D 4B8TA 4GN5A 1OTCA 4JI8Q 2IPKD 2UXCQ 3NQIA 1D1KA 2EZVA 3I4MG 2BA1A 2NVQB 5FLXc 4I65A 2I07B 4LF7L 4FDBA 2KCTA 3J7YW 4DV6L 1EYGA 4A3MH 2JA6H 4GNXB 2NVYB 1QNKA 2WB1G 3JC66 2F0HA 4CJ2C 1GJXA 5C44B 4DAYB 2B29A 1C8CA 3M3YB 3BG3A 3KLWA 4NB3A 2NN6H 2PQEA 1N34L 1PDQA 3SE0A 4C2MB 4ZQ3A 3SK4A 4NBQA 4HMIA 4FF2A 5CMDA 1EFID 2KEEA 3HKZG 2Q2UA 1D5ZC 1KHIA 4TKOB 4KN7C 4FF3A 2F3IA 2JA9A 3R8BA 3UI2A 3HOXH 5IGGA 1STNA 3DUZA 3CCLA 5FLMH 4K5WA 3I55A 3V05A 1WTQA 4IUTA 1ZYRD 1KRSA 3MXPA 4IPDA 3STBC 4RGMA 1IL8A 2WB1E 1VIGA 1XTDA 3S2DB 2KVMA 4HSVA 4C3IG 2ZXRA 4KMUC 3HOWG 2F4VL 1HZCA 5M3MH 1PYSB 3S2HB 3HOYG 1Y8OB 3MEFA 3NSWA 4YY3Q 2YYZA 2PQAA 1PTOH 4QB4A 1SMYD 3HFZB 1ZKOA 1ILQA 3I4LA 1PFBA 1SNCA 3EFXD 2JEAI 4KKTA 3GV3A 1R9TH 2JA7G 2NYZD 1PFSA 1BBUA 2ANNA 3D6CA 3K0YA 1ILPA 4RGNA 3I70A 2QEXA 1PLFA 1ESRA 4CJ1B 4U673 1YJ9A 4YCUA 3RNUA 3F2BA 3J80E 1RTOA 4GN4B 1JJGA 2CTLA 3H3VC 1GOZA 2N88A 4HTHA 1I6VC 2K5VA 1BVSA 3I7FA 3S16H 2OXPA 1JWSD 3F2DA 2A8VA 3NK9A 3PIO3 4LFBL 2I5MX 1GO3E 1MIUA 4DK1A 3HZXA 2L11A 1VCIA 4IFDJ 4QY7A 4DV0Q 2LMCB 3RN2A 1XYIA 1VMPA 4KN4C 2EQSA 4PG3A 1EY9A 3ULJA 4DR1Q 2BCOA 4ULLA 2E5LL 3NTKA 3C2PA 1SN8A 3S1QB 4R4OA 1A2UA 3DM1A 5K5PA 3T1HL 2SOBA 4LF9Q 3FKIB 4E6IA 5ELCA 3OTOQ 2EYLA 2XWJB 3TP8A 3X3MA 1Y1VG 2BOSA 2EYHA 4IPCA 3FPPA 4J8QA 3K5MA 2JA8H 3K8AA 4GOPC 1E1TA 2QCPX 2XGTA 2K7VA 2IHFA 4K5XA 4B3TL 4UAIA 1WTVA 3UE0A 1CT1D 5E3FA 3PO2H 4B3MQ 1N33L 5LL6S 1F2ZA 5I2XA 3Q6SA 4DAPA 3K7UC 3K7AH 5CORA 3HP3A 5COYA 5FLXL 3TRZA 1OXVA 1LT3D 1QB5D 4YCVA 2LXKA 4KHVA 3G6JB 3KBGA 1HFGA 2L0CA 5C0XI 2A19A 3J81i 2UUCQ 4LK1C 1FD7D 1WE8A 1EYCA 3TZUA 1NAPA 2CTMA 1RIPA 5CV6A 2WKCA 1P16A 5C44G 2R7ZH 1HA6A 3K5LA 2EXDA 2JQOA 2DNEA 2FXQA 3NQTA 3T56B 5C0XJ 3C3LA 2BH2A 4A3IB 1PH9A 1CZWA 3E6ZX 3BJUA 3V96A 4OWXB 3OW7A 3GTMB 5IT9c 4GLXA 5D3IB 2K5NA 2PZUA 1LTLA 2BDNA 1HRJA 1AEXA 1OO9B 3W1BA 5FJ8G 3GTQH 1AFPA 3OIQA 1SFOB 1K1GA 3QIAA 3U58A 2OQ0A 3M9BA 4PZ7A 1PRTB 1EUJA 1DYQA 2EYPA 2N78A 1GXDC 1IBKQ 5AFWA 4UP8A 3QJYA 5C4HA 1STYA 4OIKA 3GTKB 1G8ZD 2AMCB 1G91A 1B70B 1PV4A 4B9XA 1TWAB 4OIJA 1QVFA 4BY1B 1QWYA 4MTNA 4JC0A 1PFMA 2Z4HA 2RQXA 2KCMA 1HJPA 3DEPA 4DGZA 2E2DC 3J81L 5IYCG 1IYJB 4DXGA 4DV3L 1HNZQ 1V8QA 2NZOA 5C4XH 1E2WA 1GUOA 3VR3A 1HUMA 2EY2A 5GADC 3PMFA 5ELDA 1A3VA 4LFCQ 3V69A 2CHBD 5IP7H 1IBMQ 4X6AH 1GUGA 4LJZC 1ZZKA 3TDQA 1HUNA 5LMUQ 3W2DA 3CRLC 1QUQB 1Y8NB 1Z7TA 4KY5A 5C4JB 5CBEE 2Z6KA 1OXUA 4HCEA 5E4XA 2KHSA 2UUBL 1DOLA 3VR4A 3F2CA 1KTKA 3ND9A 3T53B 3STBD 1TWGH 3K7AB 2KUMA 2JSOA 1IYUA 2R61A 3CU7A 3EN2A 4JI5Q 4DAVA 3FKIG 2M00A 3BS1A 5IGBA 4LF5Q 3ITPA 4JYAL 3LGJA 2K28A 3MVVA 1K3RA 2UUAL 4EVOA 4DV5L 1LTSD 2D0OA 5IP9H 3VDYA 3A0JA 2PW5A 3TP6A 4X65Q 3AU7A 2OQKA 4X62Q 4QIWB 2JE6I 3D0FA 3HOUH 3MA2B 1B2TA 1DM0B 4C3HB 1W3SA 4WALA 4JI1Q 3A8JE 1STHA 2D0PA 4DXFA 2IX0A 3QOLA 3KUPA 4JVYA 2PCFB 3M7NA 1G6PA 4GNXC 4TRDA 1OXXK 2R93H 1I4PA 2Q2IA 4JI0Q 1ET6A 1ET9A 1B4OA 2B8FA 4B3ML 1HR0W 3RLNA 1LM0A 4JI7L 3M7GA 1JC7A 3AFQA 1Z47A 1QJOA 1X9NA 1SJHD 5JEAJ 4POGA 5C0XH 4DR2L 1N32Q 2Z1CA 3NPPA 3RLOA 1YJNA 3J81j 2ZJPA 1B53A 1YI2A 5FO9B 1G291 1YHQA 5KRUA 4R4QA 3BYTB 1S5ED 2ID0A 3CCVA 2MPMA 5IT9L 3KDFB 3ZYYX 1VS0A 4A3IG 4FVMA 4H02A 5A35A 1SE4A 3N52A 1U4MA 2VUMH 2F0IA 1VQFA 5CGKA 5IGEA 2BL5A 4J6HA 1TWFH 1DGSA 4NP5A 3H6MA 3KF6B 2FFKB 2DUDA 2EY6A 2B2TC 4IJHA 4JI3Q 5KIXA 3PSIA 5EPJA 1PZJD 2MO1A 3S1RH 2WP8J 2CVRA 2EJFC 4X3TA 1GHJA 4BY1G 1TWCH 1ZZJA 4OO1I 2CQAA 4DUYQ 2PZWA 2G9HD 4EX5A 1O7YA 3CCSA 4V0BA 2MJ8A 1M8AA 2X69A 5M3FB 2ALYB 1B3AA 2A6HC 4Z9CB 1PA6A 1LO5D 2OPVA 5JPMC 1KDBA 4N9TA 3CPFA 2AQ3B 2EYJA 5DLQE 4DNIA 1EQRA 2B2YC 1HNZL 1PMRA 4XT3B 1Q1BA 5EBCA 3A74A 2I0QA 2HQLA 1TWHB 2XSCA 5M5WB 3HOUB 3PO3H 3SHLA 4F8MA 1NY4A 3T16A 1CSQA 2FHTA 1QZHA 2KOLA 2D62A 2GVBA 1RL2A 1ML0D 4HEDA 4L5TA 4P71A 3FHWA 1IBML 4X64L 1VQ5A 1KXLA 2KCNA 3PF5A 4DK0A 1VQIA 2JP1A 1Q81C 5C6AA 1SDFA 3E0JA 1TKWB 1Y14B 5LMNL 2EDGA 2NB0A 3KBXA 4CKCA 3GTPH 3GV6A 2K05A 5IYBH 2AUJD 3GTLB 1LYLA 4OL7A 4EQ5A 2B63H 1LT4D 4R8NA 1F9SA 2B2WA 3A7AB 4EQNA 2BE5C 1L1OC 4XT1B 3ICEA 2ZXOA 1ZYRC 1H9KA 4C3HG 1KAAA 5FO7B 3X3NA 1AZPA 3CCJA 4GN3B 3KF8B 4J15A 1NCVA 2KHIA 5C3EG 3KJOA 4LF7Q 3AEVA 3I56A 2F0DA 5HY6A 3JAMc 1VQHA 1R4PB 2VUMB 5JEAH 2SEBD 4RHSA 3S1NH 4XTCS 1E22A 3QG1A 1AN8A 3HRZC 4JI1L 1CFMA 1EIYB 3P75A 4H13C 2NVXH 1ENAA 2CFMA 4R8IA 2R7FA 5K36G 5TSSA 1CM9A 3DEOA 4GZYC 1CKOA 2EPBA 1JCKB 3RUZA 2KJXA 3W5OA 5CV7A 4MZ9A 1Y1WH 1PRTC 1BOSA 1PVOA 4ZLTF 5H1SE 3MZ5A 4BBSB 3MFYA 1Z6HA 2HCIA 2CWAA 1XPOA 5EPLA 4QUFA 1JICA 5D65A 1UNSA 3DLLA 5IY0A 1LTID 4BS9A 4HIMA 2RF4A 4IFDG 4A3FH 5BN3A 3LWEA 1EWIA 1LTBD 2TSSA 4KKSA 2IY5B 2KCCA 3IKJA 5JAVA 3VA7A 5LL6X 1N36L 5KNBA 3ER0A 3URYA 4A3LG 1MI2A 1DD2A 3LX0A 4C1NI 2XNAC 1YIJA 4DR4L 5ELEA 4LF6L 4PQXA 1Q12A 4ZKCB 5M3FG 4OO1H 1LTGD 2FINB 4GLVB 1P8LA 2E3UA 4ZUIA 2QILA 4PZ8A 1VQLA 4LFBQ 2NUCA 1PH4A 4DUYL 1K83H 4A93H 1ESFA 3TQYA 1BDOA 1ZXTA 2WKDA 1TS5A 3OHXC 5CBAE 2KBNA 1XWEA 3IAYA 1CKMA 1S5BD 4WJ4A 5DM73 3D4DA 1DXMA 2F0SA 3T1HQ 3C1FA 1W6JA 1VQ7A 3VA5A 4LAAA 3VR2A 3A5ZB 3H0GB 3MXNB 2LFNA 3G6EA 4LF4Q 4BBRH 3AQQA 1MBYA 1VQJA 2EIFA 3VYSA 4X3SA 5G3LD 4B3TQ 1Q86C 4Q0FA 3E5SA 1HNWQ 2E2JH 1I3QH 1PHJA 3D6WA 3IL8A 1FJGQ 1L0XB 3MEHA 5ISRA 2F3WA 4GS3A 1N33Q 3PIOA 2JZXA 3IFDA 2VXWA 1V1PA 2V4DA 4O42A 3DXJC 1QNUA 2A6HD 3TBIB 1A3TA 5CV5A 5GAGC 2WAQB 4IJLA 3JAML 2F0LA 2XN9C 4NPSA 4AM3A 4DUZQ 1OXTA 2RDFA 2VUMG 4ZKBB 1IZ6A 4UP9A 1D7QA 1LTRD 1G2TA 4P72A 4A3BH 3S1MB 4TVAB 2PYKA 1I50B 1V9PA 1T9HA 1STGA 1W6KA 1GVPA 3KLSA 1TUAA 2L12A 2NTSA 1FJGL 1MSHA 2K32A 3CC4A 1PH8A 1A15A 4XYOA 1M90C 2K4KA 3KLSX 5M5XH 4QF4A 3K80C 4IUPA 3PIP3 2K50A 1DONA 5EAYA 1WTXA 1LABA 1M1KC 3GTOB 4AH6A 1J4WA 2RA4A 1EEFD 5DM63 4A3EH 3CQZB 3S14H 4BBSG 3S15H 2BE5D 2ZXPA 4H7BA 2B2UA 4EGVA 4R4IA 4K8JA 2JA5H 4CJ0B 1VQ9A 3KLRA 3CCUA 4KK7A 2EOTA 4WFN3 4BWGB 5J3BA 1RHPA 4IOAA 4S3SA 2SNMA 3HKZE 2B2VC 4O0AA 4DV3Q 2EY1A 3GO5A 3J7A5 4BY7B 5KNCA 2E74C 3FDTA 1PTOD 3RZOH 4A3CH 2F0MA 4IN3A 3K81C 4RG1A 1J9OA 3FVQA 1XTCD 1G2SA 3U1KA 3CC2A 1QUQA 4QJFA 4OHJA 2R92H 3J81c 1I6HB 5G3LF 1EL0A 4F87A 1W2BA 1LTTD 4A3DB 3M4OH 2HHHQ 3HOVB 2UUBQ 4LUVA 4BXXG 3CP0A 1PH7A 3J80i 2XIWA 5IGFA 4APVA 1WD0A 4GKJL 1PRTD 3Q0AA 1YZ6A 4P75A 3C1EA 4OXPA 3GTJH 2K5QA 5HGQA 2A1AA 1AZQA 4JBWA 2C35B 4NXML 4CBVA 1O78A 4HIKA 4JYAQ 1EQVA 5FLXE 3H0GG 2UUAQ 4DV5Q 3BVMA 3O13A 4IUQA 2K01A 4WJWA 1WCMH 1NTGA 3G71A 3D4RA 3AMUA 4JV5L 5C5LA 1HXYD 2G9DA 2JEBI 3N6RA 1EEID 2F0EA 1E24A 1NSNS 2EYOA 4RKBA 1K8AC 1UUPA 4A3MB 4LF4L 2JA6B 4H44C 4ID6A 4YIJA 1X56A 1YJWA 1CHPD 1YITA 1O7IA 5I4DA 1UEBA 2VQEQ 3PF4A 2HDMA 3FRPB 1HNWL 2PW7A 2M9VA 5D3DA 1E2ZA 1ICWA 3A7LA 2WAQG 4X66L 5IGCA 4JI7Q 4IUUA 3TP7A 1SNOA 4XQNA 1BQQT 1L1OB 1QVCA 4NW2A 3DMUA 1KIXA 1YNJC 1DCZA 3EA6A 2E2HH 3HOXB 4DR2Q 4P74A 1X32A 1RD9D 3KK7A 4J1MA 3T13A 2YV5A 1E0BA 4K14A 4R9WA 3KDFA 4DUZL 1TS4A 2AQ2B 5KEEA 5JJLA 4B3SQ 5M3MB 2WAQE 5JJIA 1PTOB 4OX9L 2BA0A 2ZM6Q 5JVH3 4FF1A 1ZZIA 1DT4A 1K8OA 4KHPL 1BO0A 3CKIB 3MC0B 3RZOB 1Y8PB 4PMWA 3J81E 2QGQA 3KF6A 4IPGA 4DR3L 1PH3A 1LT5D 1R9TB 2EXZA 4DK6C 4G7ZC 3PUVA 4DR5L 2VB2X 3OWFA 5J22A 1I4GA 4JOIC 1EY0A 3RZDH 2R92B 3TS0A 3D4WA 1ZEQX 2F0OA 1B8AA 4YWKA 3A8KE 3GD7A 1PH2A 4A75A 1MD2D 5IGDA 1PRTF 3S16B 2EJGC 2NZHA 1QZGA 2MFIA 1BXTA 4BY7G 1QOHA 4JI2L 1EC6A 2E2IH 1TT2A 1NMGA 2VY3A 4QCLA 4FXDA 3FP9A 1K8GA 3NELA 2JVZA 5FOBB 2MNAA 4L5QA 3ERQA 2BDOA 2UXBL 2PNHA 3QOJA 2VQFQ 1STBA 3VR6A 1XNQQ 3HOZH 2A69C 2DGRA 4A3JH 4A3DG 1JT8A 2CTEA 3HOVG 3R2IA 3SXHA 2JJQA 5GQOA 2KQ3A 5LHY1 4DK3C 4X64Q 1SE2A 2JA8B 2X6GA 2HH3A 2C5CA 3CAMA 3ERSX 4XQQA 1TY0A 3U9OA 5LMNQ 2AXYA 1X65A 1BR9A 3G48A 4RA8A 1UAPA 2PQAB 5KYIA 2HHHL 2UU9L 2VL6A 3U4VA 3PO2B 5I6YA 4HCSA 2O5JC 2EYFA 2CCZA 1ASZA 1SRUA 3K57A 4DNRB 3MAQA 2E2HB 1AP0A 1A8VA 1F2MA 4HJAA 4EQPA 3H0GH 4WJ3M 4L63B 5IOCA 2A5HA 1SYCA 4DV2Q 3RLFA 4KJNA 1YEZA 1S5FD 1FGUA 3CXCA 4NDXA 2KHJA 3SGIA 2MHVA 4GOPA 4A3MG 4R4CA 2JA6G 3NUCA 4IALA 2HH2A 3S17H 2UXDQ 2Q8TA 1X4MA 3BZKA 2R7ZB 1D5MC 4H0LC 2NN6G 5IT9E 1WYDA 1PZID 5EBDA 3BDOA 5I6WA 1IYVA 1UE1A 2X6LA 1SYEA 4Q5VA 2VQEL 3CHBD 4HMJA 1ONLA 3HOXG 4Y7NH 1GUWA 5FLMG 3DHQA 3GTQB 2IX1A 4HR7B 1GD7A 4XXEA 1NJIC 4RGTA 4DV4Q 2HT1A 1A2TA 2Q8IB 5M3MG 1J5KA 1AE2A 2XTIA 4FF4A 2OEOA 5I9OA 1JB7A 1K8MA 2MO0A 2ZJQA 2K5HA 1C4QA 4B3SL 1KLUD 4A3KH 4JI6L 3BVZA 4IPHA 5M9OA 4WRDA 1YHBA 1XNRL 2ZM6L 5C4XB 2R92G 3CMEA 1GHKA 3PUZA 4KY6A 2EE1A 3ULPA 1N36Q 3CD6A 1U5KA 5BR8L 1NE3A 4DR4Q 5IYDH 4LF6Q 5I2YA 4DPGA 4AYBB 2SDFA 1JB3A 5CYUA 5CV9A 4NXNL 1YNJD 4KY7A 3I4MH 2DNCA 1SSOA 3A8IE 4IUNA 1NR4A 3MFGA 3CC7A 1F9QA 3GTGH 1TWGB 5KNDA 1TVXA 2F0WA 3H91A 3P1HA 2CKZB 2JYOA 1U4LA 1KHMA 1SYBA 5FK9C 5A2QL 1XPRA 3F8TA 2ICEC 4KJOA 1UE6A 2PNRC 3MXNA 1S72A 1HNXQ 2CW0C 2JA8G 5GROA 1I5FA 2VQFL 1KRTA 1XNQL 4QQBX 1EIHA 4KI0A 3H09A 5ELFA 4DFAA 1HFNA 1F9PA 3PO2G 1CTMA 4JVHA 1EIFA 1FL0A 4YCWA 4C3IH 3VKEA 4DU9A 3NBHB 4A3GH 2R93B 2I5LX 3HOYH 1DZ1A 4DV1L 5HURA 2B8GA 3UDXA 2N8NA 4WANA 5C3WA 1N8RC 3NXWA 5IIFA 1S4ZA 1O7LA 3W3AA 2Q2TA 1ENCA 5CV4A 1D5XC 1EZ8A 3W1GA 2JA7H 3OW2A 1GKHA 4RCOA 4NKLA 4ME3A 4MIUA 2LKVA 2K6AA 2R7ZG 2F0NA 4DV2L 3OYYA 4K5VA 3BZCA 4MHEA 3Q8DA 1QILA 3KYHC 4F88A 5JVG3 2YU9H 2XWBB 1EYAA 3D3RA 2K52A 1CSPA 1CA6A 1IKMA 5IWAQ 2F0VA 2A69D 3ZJYC 4ABNA 4GNXA 2UXDL 4DAYA 1O80A 5BN5A 2PPBC 3GP7A 4FYDA 1PTOC 1UE5A 3DWQA 5EJWA 5JOBA 1WOCA 3CCMA 3FEWX 4QIWE 1TWFB 3EJIA 5NUCA 3LWUA 1N9WA 2RBMA 3E0EA 1E2VA 1CUKA 5C4ZA 3PUWA 4R4TA 1KABA 1JOKA 4RGOS 2A6EC 5T1IA 4ZUJA 2DY7A 1VQPA 2JK8A 3S1RB 4DV4L 2XRQD 3AFPA 1VF7A 1HCZA 3Q23A 4BA1I 1Q46A 2AWOA 1TWCB 3M85A 3I2ZA 5JPNC 4FP5D 1QCBD 4PV1C 5BN4A 1Y1VH 2RCNA 1YNXA 3C46A 5C4XG 1YBYA 4L5RC 2F0FA 3E9IA 2TMPA 1KLGD 4AQYQ 1D1IA 1HH2P 1CI3M 1WI5A 1TIID 4QMFB 2F52A 2B2TA 1JR0D 5IP7G 1SYGA 1XXGA 1IHZA 4AYBG 1V1OA 3CPWA 1J5EL 4KHZA 3PIPA 1VQKA 1SE3A 1D6EC 1TY2A 1X3QA 2VB3X 3PO3B 3GQBA 4XYQA 1C7YA 3ULLA 2NVQH 4YWLA 4EQOA 4JBKA 1H9JA 2A74C 4GKJQ 2NWGA 3L0OA 2NVYH 4A3GB 4PMBA 4OWWB 3GTPB 4HIDA 4FXGC 4AYBE 2ENBA 5C44H 3M3YH 1VMCA 4NXMQ 1SE8A 1MKHA 1WFQA 4C2MH 5IP9G 4A76A 2B63B 1STEA 4RHRA 4CKBA 3LNNA 1RKNA 4LIJA 1K9MC 2N55A 1I4RA 4FNFA 4BA2I 3HOUG 3JAME 2K03A 4JV5Q 2ICIA 4OWTB 1CQVA 5FJ8H 1PXUA 5I9PA 1HNXL 1S5CD 1GUTA 2Y0SB 1VQAA 1Z9FA 3S2DH 5T1GA 4JI4L 2F0TA 2M2LA 1DOKA 1WTRA 1T5EA 3S2HH 2R93G 3S1NB 3VYUA 3MHBA 1HR0L 5J1ZA 1B44D 4HAEA 1VF5C 1B50A 1U0LA 4LFAL 2NVXB 4DN4M 4X66Q 1L1OA 2A73B 2QDBA 3BZDB 5C0XG 1X4NA 3ND8A 2VW9A 1BCPC 3DM3A 4ME5A 2K5DA 3QO2A 1E1OA 2OTLA 1FYCA 3K5OA 2EY5A 1QVGA 1Y1WB 3BVGA 4MNOA 2EYMA 3K58A 3A56A 3RMHA 3NE5B 4B3RL 1Q90A 2CW0D 4OX9Q 1MJCA 3U9SA 3J80c 3TP5A 1HTLD 4OGQC 1WTOA 2JXMB 1WTWA 2H5XA 5IWAL 1FVIA 3FMCA 1A6XA 4K2KA 4KHPQ 3K0XA 4DR3Q 4A3FB 1CZGA 4DR5Q 1RODA 1DOMA 3CCQA 4DR7Q 4LUZA 4V190 4O2DA 3S1QH 1ASYA 1XMOL 2SNSA 2PI2E 3FKIH 1VQ4A 2NBFA 1SLJA 3UDIA 4P73A 3WWVA 3UDFA 1I4QA 1E7ZA 2ZT9C 4ODGA 1HZBA 5J39A 1NMFA 1DTJA 1HQRD 1B9MA 2XRSD 1SR3A 1H9SB 5ELOA 3AEVB 1HTPA 2HCCA 1CKNB 1IL2A 1EY5A 1K83B 4A93B 4R1JA 4JI2Q 1EY8A 1VQ6A 1NUCA 1UEAB 1XJVA 4LNQA 4RCNA 1I94L 4L5SA 2F0PA 4RWSC 4YHHL 4LMQD 1DJRD 3U50C 4JK1C 4AQYL 2UXBQ 2DY8A 1E3PA 3PO3G 2L15A 1X3FA 3NTIA 1OXSC 2VNUD 3S9WA 4K2LA 1EWHA 3T1YL 1FNVA 4LWCA 2VZAA 5EPKA 2L9HA 1KC8C 1KQSA 1SNMA 2L1BA 4BBRB 2AKWB 2MQHA 4WORA 4A3GG 3CW2C 2PZTA 4DF7A 4B08A 5IYBG 2ANRA 2A6ED 1EQTA 3NBIA 2WV6D 3AYHB 4GLAC 2E2JB 1I3QB 3R2TA 2YTVA 2UU9Q 2F4IA 2PY9A 2B63G 1T5XD 3TREA 4KTAA 3CCEA 5CC4A 3SR1A 3VYTA 3ONAB 4A3IH 3KJPA 1A62A 1G51A 1KNEA 2MGSA 3SEBA 3GTMH 2L55A 2NZ1D 1X54A 2IJ0A 3MTSA 2FJ2A 4IFDI 3SK5A 1SFOH 2AWNA 3MXUA 3FPUB 1D8LA 2Y0SG 1X55A 1QG7A 2H4OA 5JEAG 2ZTEA 1RTNA 1RJTA 2ASBA 2FMMA 1F2LA 1HPCA 3F1ZA 3GTKH 4UP7A 4A3BB 3L3OC 1SJED 2EVBA 1TWAH 4BY1H 1L2FA 3WOEA 2V1CC 4DAMA 2Z6KC 4JG2A 1GUSA 2LY7A 3BDLA 4G57A 2WACA 4LUOA 5D14A 1VQGA 2O4XA 2Y0SE 2NVTH 3D31A 2L4NA 2IX3A 5M5XB 2F0QA 3TZDA 3TMEA 3PGZA 1K73C 4GKKL 1Y1WG 1NR2A 1HHVA 4IZ8A 4C56C 3A55A 1F2YA 2IWHA 2LS01 2GVAA 4A3EB 2MUYA 4DR6L 3J80L 3S14B 3CRKC 3M4QA 3S15B 4C3JH 3CF5A 3VR5A 4DV7L 3H3VI 2EJMA 4JBMA 1O7ZA 1KD1C 4CHTB 5C4JH 2QEJC 2JA5B 1X3EA 2Z8LA 4LF8L 3NTHA 1VIHA 2CTFA 3T51B 4A3FG 2DGYA 4ZRZA 2AHOB 4FO2A 4AIMA 1BF4A 5KGUA 1SYFA 3NHHA 3P20A 4P2CB 3T4AC 4JI6Q 2R7DA 4KD3A 1XNRQ 3R93A 1PTOF 1PYBA 1SBBB 1V1PB 4X3UA 3BU2A 2HIVA 5LMNW 5CR3A 1KNAA 3GDEA 4N9PA 5IE8A 1WTPA 1Q82C 2QNDA 5HGTA 2R6GA 2IW3A 5BR8Q 4DR7L 5FO8B 3L7ZC 4JI8L 2Z0SA 4OO1G 2UXCL 2MP1A 3D8GA 4U68A 1VQOA 1HZ9A 3HKSA 3AB9A 1BCPD 1EU3A 4NXNQ 1LT6D 2VS1A 2RKSA 1U4PA 5EKKA 4HSPA 2K33A 4C3HH 5AJ3Q 4A93G 4DNTB 3M4OB 3BDCA 1PH6A 2B3GA 5C3EH 5JJZA 1A3UA 4K0KQ 2B2VA 1JOOA 3H94A 4CGYB 3L2PA 1UWVA 1A63A 1EU4A 3UE1A 3MWYW 2LSSA 2H1EA 4C1NK 5FKAC 3GTJB 2HUGA 4F7XA 4UY8C 1SXTA 2HIXA 2K04A 2CQOA 1YNNC 4M8AA 4BBRG 3PUYA 1WCMB 5K36H 2N49A 3TN2A 2MJHA 1CQFA 3OSOA 2ATWA 3S24A 1TQOA 2J7ZA 2KEDA 3J7AF 5ELBA 3DWPA 2OCEA 1JE4A