4IFDG

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
236
structure length
236
Chain Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKSGVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 50
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ifdG01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ifdG02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4ifdG03
4OO1G 3H3VH 3EQLC 1VQEA 1EFWA 2CTMA 1G51A 2YTVA 3WDNA 5J3BA 3HKZG 4A3JG 4A3BG 3CXCA 3HKSA 3QJYA 2UXCQ 1SE8A 1KL9A 1X3EA 3A74A 1VQFA 3K7UC 4DV2Q 2Z6KA 2ZJQA 3UDGA 4LF5Q 3S15H 3T53B 2IHFA 5H1SE 2OCEA 4BY7H 4LUOA 4K0KQ 3KDFA 3T51B 2CTKA 3J81i 1PH3A 3KLRA 2H5XA 1VIHA 4KN7C 1TXYA 4HJ5A 4AIMA 4POGA 1K0RA 1OXUA 1V1QA 4IQZA 3J80c 4B3MQ 4DR1Q 3T1HQ 2E75C 5M5WH 4DV3Q 3STBC 4LFCL 2ZJPA 3CCVA 4A3IH 1YJ9A 4A3CH 2JEAI 2P2RA 2UU9L 3H15A 2I0QA 4MTNA 2ID0A 2HHHQ 2KENA 4JYAL 1LM0A 3CC7A 2HQLA 1VQPA 3KJOA 1Q46A 4JCVE 4G7HC 2AUJD 1BKBA 1Z7TA 4LUVA 1HZAA 3UDXA 4DV5Q 1E24A 3B6YA 1HNXL 4A3LH 4B8TA 3L2PA 4QQBX 3AFPA 1N36L 4OX9Q 3OYYA 3I7FA 2AXYA 3GQBA 2OWOA 3PUZA 1CKMA 3S1RH 4BBSH 2K75A 4LF6L 2L5TA 4X66L 2PQAB 5HGQA 1HH2P 4QY7A 4DR5Q 4LF9L 2V4DA 2IY5B 2E5LL 3S1MH 4XTCS 4JI6Q 4JI1Q 1N36Q 4RCNA 5M5XH 4A3DH 4QGUA 3PGZA 1PH8A 1XNRQ 1YZ6A 2A69D 3CP0A 3TZUA 4NB3A 1YBYA 1LUZA 3OTOQ 3HKZE 4DV2L 3PF5A 3BG3A 1U5KA 1PHJA 4GKKL 2KCTA 2MO1A 1L0WA 2KBNA 2UXCL 4IFDI 1IZ6A 4Y7NH 1YHAA 1HZ9A 3PSIA 4P71A 4DKAC 4A3FG 4DUYL 4LF5L 5IYDH 5IYCH 4JI3Q 2HT1A 2D2CC 3OOCA 2AKWB 3T1YQ 1R9TH 3I4NG 4KKTA 3ND9A 4B3RL 4KHPQ 2PMZE 4Y52H 1H95A 1HNZQ 4JBMA 2MO0A 4YY3L 3VA7A 1T5EA 2ALYB 4NPSA 1X56A 3CCLA 3HOWG 3D4RA 4PV1C 1B7YB 4JBJA 4DR4L 3H0GH 2UUCQ 1QJOA 1BBUA 2KCMA 5KNCA 1X54A 1B9NA 3PIOA 4GNXB 4LNQA 2CTFA 1G6PA 1QVGA 1OTCA 4LF8L 4JVHA 5FLXc 1JE5A 1IBLL 2AHOB 1HNZL 1X4MA 3CRKC 3W1BA 4YY3Q 4DR3Q 2R7ZH 2K50A 1CKOA 2IX1A 2DN8A 4JV5Q 1DGSA 5A35A 3CCMA 1A8VA 2R7FA 2BE5D 2NVYH 2R7DA 4DNIA 5FLMG 5GADC 3QIAA 1IBKQ 1EIYB 1YI2A 2UUBL 3CCQA 2E2IH 1BDOA 1EWHA 1IBMQ 3P20A 4DV7L 4JI8L 1YITA 2WB1G 5GAHC 4B3TL 3Q8DA 1XNRL 3OW7A 1I5FA 1WCMG 4BXXG 2VQEL 1Y8PB 2K33A 1M90C 1H9SA 4B3TQ 1K73C 4B3SQ 1Q82C 1IBML 1VQIA 4GN5A 4IPHA 4KLKA 1ZYRC 2Q2TA 2WFWA 2YU9H 4J15A 4DR6Q 4RMFA 1FJGL 2JXMB 1D8LA 3IKJA 3T56B 1Z47A 3FPPA 3M9BA 1N8RC 2ANRA 1C9OA 1QUQB 1O7LA 3A5ZB 4NXNQ 2YV5A 1WJJA 5GQOA 1WFQA 2JJQA 4R4OA 4JI6L 2VQFL 2UUAL 3TQYA 4X64Q 3DM3A 3U1KA 4UP9A 1Q81C 1NE3A 4YCUA 3U4VA 1X9NA 1VQAA 3I72A 2Q2IA 4YWKA 4BY1G 3DLLA 3CC4A 5JEAJ 3NE5B 2I5MX 3CAMA 3BDOA 4OWXB 2Y0SE 2OTLA 4AQYL 2UU9Q 1VQGA 4P75A 4LFAL 4GLAC 3VDYA 3S17H 4OO1I 1Q86C 1UE6A 4UP7A 3CCUA 4IFDJ 1KD1C 3SGIA 5IYCG 1J5EQ 4KN4C 2RCNA 4H02A 4JI3L 2LMCB 4DNRB 1PH7A 2DGRA 1SR3A 1VQCA 1L1OC 2L15A 1X6OA 2JA6G 4HIKA 2NN6I 1VS0A 2A6EC 2AWOA 2D62A 3RLOA 1J5EL 1B70B 5BN5A 3GTMH 1E2WA 3M4QA 3CC2A 3SE0A 1EWIA 2HIVA 4QJFA 1KIXA 3I4MH 3NELA 1PFSA 3H0GG 5C44H 2XTIA 2OPUA 1X55A 3AEVA 4YWLA 4R4IA 4A3EG 2A6ED 2NZHA 4HIOA 4LFBQ 1KAWA 3I4MG 1PH6A 3K80C 3F2CA 2F1MA 3TS2A 2BH2A 2RHSB 4A3MH 3G48A 5LMUL 4DV4L 1SROA 4HJ7A 2ATWA 1VQ5A 2D0OA 3H3VI 4BY7G 4DK0A 2OQ0A 1IYJB 1CKNB 4JVYA 2PQAA 1CTMA 1E7ZA 3BJUA 1KHIA 4IJLA 3JAMc 1DD2A 2PI2A 1OXSC 1Y69U 1SN8A 1VDZA 4H44C 4JBWA 2JA9A 2KHIA 1GUGA 2PNHA 4R4CA 5BR8L 1IBLQ 4LF8Q 2V1CC 5BN3A 1UEBA 2DNCA 4JI2L 1GVPA 2CKZB 4IPCA 2B63H 5IYBG 2HHHL 2JE6I 2ZTDA 3CPWA 1N33Q 4B3SL 1I3QH 2KHJA 2NVXH 3GDEA 3MFYA 2CQOA 4JG2A 4X65L 2N8NA 4B3RQ 2B63G 1SLJA 3VR2A 1YHBA 1HNWL 4JI2Q 2MNAA 5JJKA 4GN4B 2RF4A 1XMQL 1VQ8A 1VQBA 3K7AH 2K52A 3IFTA 5M5YH 4WJ4A 4FDBA 1Y8OB 1WOCA 4PMWA 3A8JE 2KCCA 1NMFA 2DUDA 2K4KA 1VQJA 4LW1A 4A3MG 4LF7Q 3S16H 2BL5A 2CWAA 2HIXA 1YNJC 3OPOA 1LTLA 2JEBI 1P8LA 3FP9A 3KF6A 1PH4A 2GN5A 4YHHL 4IPDA 1FVIA 4DR2Q 4JI4L 2NVQH 2E5LQ 1VQ6A 1PVOA 1PYSB 2AUKA 1A63A 2IHEA 3AQQA 1N34L 1JJ2A 4NXML 5IP7H 4YHHQ 3EBEA 3W1GA 1H9MA 2QF7A 1TKWB 4JI0L 3J7A5 4GKJQ 2UUAQ 3AYHB 4OX9L 4G7ZC 3VR3A 2K5VA 2BE5C 1FL0A 3GTJH 1CFMA 1S72A 4L5TA 3PUYA 4YCWA 2DNEA 1UE1A 5FLMH 4WANA 4C2MH 4DV6L 3CD6A 2PI2E 2OQKA 1VCIA 4RG1A 5IP9H 5AJ3L 2D5DA 1MJEA 3PO2G 1HPCA 4DR6L 4IJHA 2R6GA 3HOXH 1H9SB 4PZ8A 1NTGA 4A3LG 4OO1H 1TU2B 1I6HH 1X3GA 1S40A 3K8AA 3F2BA 1GUNA 4EX5A 3GTOH 3QG1A 3U4ZA 5BN4A 4DUZL 4A75A 4IPGA 1X65A 1I94L 1H9KA 2EJMA 2AMCB 2QA4A 4X64L 2DGYA 5LMNW 3PO3G 4DUYQ 4DR5L 1MIUA 4LF9Q 3M4PA 2K32A 4L8JA 3GTGH 5JJIA 3U50C 1ZKOA 4DV1L 4LIJA 1GKHA 4OONA 4KHPL 1HR0L 2B3GA 3H94A 2D0PA 4ME3A 4AH6A 2E74C 2YTXA 4POFA 2QNDA 2K14A 2I5LX 4R4QA 3ULLA 3FHWA 3OTOL 3IRBA 1JMCA 2VW9A 1VF7A 1CI3M 2A6HD 2BH8A 1L2FA 1UWVA 2EXDA 4DV5L 4A3KH 1HR0W 1QVFA 5M3FH 3CQZH 1K8OA 2OTJA 3I73A 4DR2L 2A8VA 1YJNA 4KKUA 2VQEQ 3J80i 1GM5A 4AYBG 3TS0A 1X4NA 3AFQA 3GD7A 1PH1A 4GLXA 4JBKA 1ZZKA 3VR6A 2CWPA 2JA8G 1K8GA 4TVAB 1WVNA 3E0EA 2MJHA 3A7AB 2UXBL 2C35B 5AJ3Q 3I56A 2WP8J 5C4XG 2YQRA 1IXRA 2ZTCA 1NY4A 4K0KL 1TUAA 2R92H 1GO3E 3F1ZA 2ZJRA 4HIMA 4DR7Q 2R93G 1VIGA 1EOVA 4A3JH 3M85A 3EIVA 1SMYC 4DK1A 2A19A 1BVSA 3K0XA 1A6XA 3CW2C 2QEXA 3OW2A 4JV5L 5C4JH 1KXLA 3VR4A 1E1TA 3I55A 4GKJL 3EN2A 4TQUS 5KNDA 4LK1C 1K83H 2WB1E 4A3DG 4IO9A 3UDFA 3RZOH 4GKKQ 4GS3A 4BA1I 5M3FG 1PH2A 3FMCA 1TWAH 4TKOB 4DV3L 1LYLA 1PYBA 2ANNA 1Y1WH 3KF8B 2E2HH 4JOIA 1DCZA 3I4OA 5LMNL 2JZXA 1JT8A 4GOPA 4A3GG 1XPRA 2I5HA 3S24A 4JOIC 4APVA 5E7NA 1PA6A 3RN2A 1SFOH 1Y1VH 3UDIA 2PCFB 4UPAA 1WYDA 4ALPA 4UP8A 4DV4Q 3CCRA 4KI0A 1OXXK 1SMXA 2AWNA 2LXKA 4DUZQ 1I94Q 1RIPA 1AE3A 4OWTB 2HH2A 4JI5Q 1YIJA 1WE8A 4DV0Q 3S1NH 4O2DA 4DV7Q 4AYBE 2K5HA 1E1OA 4DPGA 2CFMA 3AB9A 2WAQG 2JVZA 3M7NA 3D31A 1NMGA 5C3EG 3NEMA 1QUQA 2UXDQ 2EQSA 4UY8C 3CMEA 1N32Q 1IYVA 1HCZA 5ELNA 3A5UA 4OWWB 2ES2A 3TEHB 1TWCH 2A69C 1KC8C 3HOYH 1K3RA 3E9IA 2IT1A 4GOPC 4A3GH 3I2ZA 1HQMC 1QZHA 1ZTGA 4X62L 1NBWA 1E2ZA 1V43A 2PNRC 1V8QA 4HJ9A 1YNNC 3RLNA 2B8FA 4A76A 3I4LA 5IP7G 2JA8H 4HJAA 2FMRA 2EVBA 4LJZC 1I6VC 2VQFQ 4XIGS 2E2JH 4LFCQ 2ZT9C 3MXUA 5K36H 3ER0A 3S2DH 2PQUA 3HOZH 4X62Q 3I4NH 1JJGA 2CW0C 3RN5A 1IL2A 1RL2A 3D0FA 3HOWH 2RHQB 4JK1C 4YCVA 1QZGA 5C0XJ 1Z6HA 2R93H 1LABA 1VQNA 2K5NA 5IYDG 1FR3A 4YWMA 1VQLA 1UE5A 3JC66 3UE1A 2CTEA 4QIWE 2Q2HA 3PIPA 1HR0Q 1PH5A 1I50H 4GOPB 3BU2A 4DR3L 3N6RA 1TWFH 4MNOA 3CMAA 2R7ZG 4IFDH 2CTLA 1U0LA 2JA5G 1K9MC 3NENA 4R4TA 1GUTA 1E2VA 1E22A 4P73A 3V69A 3M3YH 2CPQA 2JQOA 5JEAG 3RR5A 5M3MG 2GVAA 2JA5H 3KFUA 4JC0A 1Q7YC 2ZTEA 4PZ6A 1VQ9A 3DXJC 3F8TA 4O0AA 4LWCA 1Z9FA 5IYBH 1UE7A 2EIFA 5C0XI 4DR1L 2NN6H 5GAGC 3PF4A 1K1GA 2B8GA 2UXDL 3AEVB 1EYGA 3MXNB 4KHZA 1M1KC 3CRLC 1XTDA 4A4IA 2VUMG 2LSSA 4HIDA 4GNXA 1VQKA 4DR4Q 2NN6G 1J5KA 1FYCA 3KJPA 2B29A 4OXPA 4WALA 4HJ8A 1W2BA 2NVTH 5LMNQ 1GJXA 3HOUH 1TWGH 3RLFA 2GVBA 4A3EH 3M4OH 3W5OA 2VNUD 2Q8IB 4GLVB 4DAYB 2VS1A 1WCMH 4LFAQ 5C44G 2F3IA 3T1HL 4A3IG 4A93H 1CUKA 3L0OA 1EQRA 2Z6KC 1L1OB 1GHJA 3CPFA 1D7QA 4HR7B 4IFDG 2KA7A 3PUXA 2LXJA 4PG3A 3JAMi 3HOXG 1IYUA 1E3PA 2N78A 3CF5A 1ASZA 2E76C 4X66Q 3GTLH 4LF4L 3PO2H 4X6AH 1CSPA 4KMUC 4BA2I 4A3FH 1IBKL 1DTJA 4DAMA 1O78A 1H9RA 3A0JA 5C4XH 1ONLA 3J81c 3HOYG 4L5SA 4BBRG 3RZDH 2R92G 2A1AA 1O7IA 2O5IC 3PCOB 3ZJYC 3STBD 4H13C 5IWAL 1VQ4A 1KQSA 4QMFB 3MEFA 3KLWA 5C3EH 2EDGA 2YYZA 1TWHH 1YHQA 1PH9A 3PO3H 3VKEA 4P72A 4AM3A 2OPVA 1IW7C 1EQQA 2NZOA 4BY1H 4A3BH 3K81C 1W3SA 5K36G 4LFBL 1KRTA 1XPUA 4QL5A 5DLQE 4L5QA 3G4SA 4DV0L 3TRZA 4A93G 3A8KE 1HZBA 3GTPH 1EC6A 1LACA 1B9MA 4C3IH 3TREA 4A3KG 5KNBA 2EJFC 3SDZA 1YNXA 5GAEC 2CTJA 1BBWA 3G6EA 1PMRA 4GNXC 3HGBA 4OGQC 3NBHB 1T9HA 1FJGQ 3HOVG 2K7VA 1HJPA 1OXTA 2Q2UA 3S2HH 2PPBC 2N49A 1MJCA 2F4VQ 1Q90A 1J4WA 3HFZB 1GUSA 3ULJA 5JEAH 2FXQA 1PV4A 1Q1BA 3ND8A 4P74A 1MKHA 3HOVH 2VY3A 4C3HH 1VF5C 5IY0A 2ZM6Q 4JI7L 4AQYQ 1Y8NB 1P16A 4LF7L 1ZZJA 1EIFA 3LGJA 1Q1EA 4GZYC 1GD7A 4IOAA 2PY9A 3M4YA 1A62A 5ELOA 2ZM6L 4PZ7A 1J6QA 1S3OA 1ASYA 2UUCL 2UUBQ 2EJGC 4JI7Q 4L5RC 5HY6A 2ASBA 3W3AA 3E9HA 1KHMA 2MFIA 2WAQE 3U9SA 4JI8Q 1WI5A 1K8AC 1L1OA 4WJ3M 1DT4A 4NXNL 1Y1VG 1IW7D 4DNTB 4DV1Q 1OXVA 1XMQQ 4G7OC 2UXBQ 2F52A 5IT9c 2YTYA 5EAYA 3U58A 2E8GA 2IX0A 1H9JA 1VQMA 3KOJA 4JYAQ 3ICEA 1QVCA 3L7ZC 3J7ZC 1GHKA 1HTPA 1CSQA 5C0XH 3LNNA 1DXMA 4H0LC 3RNUA 3BZKA 1C0AA 3ERSX 4B3ML 2JK8A 2CCZA 3LWUA 2JA7G 4KKSA 5C0XG 1N34Q 4NXMQ 1K8MA 3A8IE 2XGTA 3HOUG 2A68C 2HH3A 4DV6Q 2BA1A 2BA0A 4JI4Q 3GTKH 5IWAQ 1YVCA 4LF6Q 3KDFB 2N3SA 4R1JA 4BBRH 3BZCA 3FKIH 5FJ8H 3ULPA 1N9WA 4DK6C 1VQ7A 2F4VL 1Q12A 1FGUA 1JB7A 3CCJA 3CCSA 1Y1WG 3PV0A 3F2DA 1AE2A 4LF4Q 4DR7L 2Z0SA 1VQOA 1CKNA 3A7LA 2O5JC 1A0IA 1XJVA 2QGQA 1Q8KA 5JJLA 1GUOA 3WWVA 5M3MH 1VQHA 1N33L 3HOZG 1XPOA 2BDOA 4BXXH 1HNWQ 1ZZIA 1G291 4MZ9A 5IE8A 1V9PA 4X65Q 4BBSG 3VR5A 4NBQA 5GROA 2JA6H 3S1QH 1YEZA 2A6HC 3PUWA 1YJWA 1XNQL 3KF6B 4LUZA 3S14H 3CCEA 2VL6A 1NJIC 2MQHA 1XMOL 1C7YA 2VUMH 5BR8Q 2E3UA 4IOCA 1HZCA 5IP9G 3KYHC 3UE0A 1N32L 1AH9A 3FKIG 5FJ8G 2VZAA 1XMOQ 1EUJA 3GTQH 1HNXQ 1Y14B 1VQDA 1XNQQ 1KRSA 4GN3B 4EQ5A 3G71A 4I7ZC 5LMUQ 2A68D 1X3FA 4C3JH 4JI5L 2JA7H 4A3CG 1B8AA 4JI0Q 2Y0SG 3J81j 1JJCB 1SRUA 3PUVA 4JI1L 3T1YL 3GO5A 4DK3C
chains in the Genus database with same CATH superfamily
3QOJA 1EFWA 2YTVA 3WDNA 2OXPA 2IL8A 1PTOB 1XTCD 3QJYA 1SE8A 1KL9A 4LF5Q 1NCVA 2LFNA 4NXMH 3T51B 1SE4A 3J81i 1PH3A 1VIHA 4KN7C 1K0RA 3J80c 3D4DA 4IQZA 2PW7A 4DV3Q 2P2RA 2JEAI 3H15A 2ID0A 2KENA 1LM0A 1HFGA 1Q46A 1X3QA 1BKBA 1Z7TA 1HNWH 1LTBD 1MGSA 3UDXA 3L2PA 3KUPA 5CV7A 1CKMA 4RHSA 2KCNA 3K5LA 3OWEB 2V4DA 4XTCS 3NTIA 5M5XH 4A3DH 4QGUA 3PGZA 2XRSD 4AYBB 5KGUA 4X66H 3KK7A 3CP0A 4K8IA 1YBYA 3BDCA 3T16A 1KNEA 1L0WA 2MO1A 1M8AA 2FINB 2KBNA 5KEEA 2UXCL 4Y7NH 2F0NA 4M8AA 1YHAA 4LF5L 2HD3A 4C3IG 3OOCA 1R9TH 3T1YQ 4KKTA 4KHPQ 1H95A 4NPSA 3D4RA 3PIOA 1S5BD 1QVGA 5FLXc 1CT1D 2AHOB 4DR3Q 2M2LA 1CKOA 1I6HB 2DN8A 4JV5Q 3CCMA 2R7DA 2NVYH 3QIAA 1MD2D 1EY8A 1EWHA 1CM9A 1F2YA 1O7YA 5GAHC 3GP7A 2XN9C 4BXXG 1Y8PB 5COYA 2B2WA 5TSSA 1H9SA 1JOQA 3FPUB 4JI8H 2VXWA 4KLKA 2VQEH 2JXMB 1SSOA 1D8LA 2EXZA 3GTLB 2ANRA 1C9OA 2F0GA 4NXNQ 4R4OA 1JE4A 3DM3A 3U4VA 1BCPD 3I72A 1QWYA 2Q2IA 5CV9A 2ZXOA 1AN7A 2CH4A 4LFAL 4DGZA 4IFDJ 1SYCA 4UP7A 3CCUA 2FMMA 1XYIA 1KD1C 4DUYH 4KN4C 4LFBH 2L15A 5I9PA 4HIKA 1WCMB 1VS0A 2AWOA 3PO2B 2GA4B 2HIVA 2WIIB 1BBXC 1X55A 4YWLA 5A2QW 2A6ED 2B2UC 2B39A 1ICFB 4LFBQ 1KAWA 3I4MG 2NTTA 1TY0A 3F2CA 1LLRD 2F1MA 1KTKA 1GOZA 2RHSB 5LL6S 4EGVA 4XQJA 1Q3LA 3QO2A 1KHMA 1E7ZA 4JPBW 4DR4L 1VDZA 2JA9A 4LF8Q 2HH3A 1IBLQ 1BCPB 1GVPA 2L4NA 1S03G 1X3PA 2JE6I 1EEID 2RSNA 2F0HA 2F0MA 3GDEA 1ODHA 2N8NA 4B3RQ 2B63G 1FJGH 1HUMA 3VR2A 2MNAA 1LO5D 4WJWA 2Y3MA 1PRTB 5C3WA 1J9OA 1SXTA 4RHRA 1LT4D 2KCCA 5I9OA 1TQOA 1SJHD 1AN8A 1LTLA 1P8LA 2JEBI 2GN5A 1PVOA 2NVQH 1FVIA 2CW0D 2N88A 1VQ6A 2E5LQ 3I4MB 3K58A 4K6DA 2IHEA 3AQQA 1JJ2A 1G2TA 5ELFA 4F7XA 4HTHA 3EBEA 4HSVA 2K5QA 3J7A5 2RQXA 1PRTC 2FPHX 1FL0A 3GTJH 3MHBA 3PUYA 4YCWA 5FLMH 1IL8A 2NBFA 4DV6L 3S1QB 2WINB 5LMNH 1I3QB 2KJXA 3TSSA 1NTGA 3P1HA 3VYSA 4PQXA 1E0BA 1S40A 2X69A 3U4ZA 1IKLA 2B2TC 5BN4A 1I94L 4FF3A 3FVQA 2AMCB 2B2VA 2DGYA 3M4PA 4LIJA 3G7LA 1GKHA 4C3JB 1HR0L 3H94A 3NXWA 4AH6A 3GTPB 2QNDA 4LF7H 1PTOD 2CHBD 2I5LX 3FHWA 3CCLA 2VW9A 3S16B 3NCVA 2FMCA 4KHPH 5M3FH 4FF1A 3I73A 4DR7H 1Z2IA 1YJNA 2B2YC 4AYBG 3RD4A 1WTXA 3AFQA 1PH1A 3VR6A 4B3RH 2L0CA 3A7AB 2F0SA 5C4XG 1LT6D 5C4ZA 4HCEA 2R92H 4DR7Q 1VIGA 3TP7A 2EYPA 4A3JH 2A19A 1A6XA 5CV4A 3I55A 4HEDA 2WB1E 4LK1C 5LL6X 1CQFA 4GS3A 2G8YA 3NP8A 4ZYSA 2ANNA 4JOIA 2ZM6H 3S2DB 4DAPA 4A3GG 4JOIC 4APVA 4QB4A 2EYOA 1OXXK 1SMXA 1K28A 1MSZA 3SVMA 3S1NH 2SEBD 1JORA 1E1OA 5FLXW 2CFMA 2JVZA 3M7NA 5EKKA 1NMGA 3J7AK 5C3EG 2UXDQ 1A3VA 3J81W 2A73B 1IYVA 2O4XA 3A5UA 1ZTGA 1XXGA 1KC8C 2M9VA 1K3RA 3I2ZA 3D6CA 3RUZA 1NBWA 2E2DC 3RZOB 1O7ZA 4OHJA 2AQ2B 1JOOA 3TP5A 1XRHA 2I46A 1U4LA 4LFCQ 5K36H 1EZ8A 1V8CA 2PQUA 4X62Q 1JJGA 3RN5A 4MN3A 1PFBA 2R93H 5HGTA 1VQNA 1XNRH 4OD6A 4PNYA 1FGBD 2ZXRA 1VQLA 2NTSA 2SNMA 1KLGD 3CMAA 4B9WA 2JA5G 1B2TA 2I07B 1GUTA 4P73A 4I65A 5M3MG 1HNXH 3QR8A 3GTQB 1VQ9A 4PZ6A 4O0AA 5IYBH 4RGNA 4CDCC 5FLXL 1EYAA 4CKEA 1K1GA 2UUCH 4DR6H 1EYGA 1STBA 4DR4Q 1G2SA 1VQKA 1FYCA 3KJPA 3HOUH 1TWGH 3EA6A 2K6AA 3RLFA 1M4VA 3M4OH 3UI2A 3I4NB 5EGTA 3P7JA 1EQVA 3IL8A 5L37A 2VS1A 3HOWB 2KUMA 3L0OA 1EQRA 1GHJA 2F0PA 2LXJA 3PUXA 3CF5A 1IYUA 1E3PA 1ASZA 4JI6H 4LF4L 4KMUC 3GKUA 1I4RA 3HOYG 3J81c 1ONLA 1W6JA 4BBRG 3BDLA 3RZDH 1U9RA 2R92G 1UG8A 1O7IA 3PCOB 3STBD 4H13C 1EYCA 1EY0A 3MEFA 1DM0B 4FYDA 3VKEA 1IW7C 4BY1H 2QKIC 1KRTA 1XPUA 4QL5A 3G4SA 4A93G 1UEAB 3GTPH 1XMQH 5KNBA 5GAEC 4V0BA 3SDZA 4GNXC 2F0QA 1TIID 3HGBA 3NBHB 1HJPA 3WOFA 1OXTA 2Q2UA 1MJCA 1Q90A 3HFZB 2JSOA 4Y7NB 1GUSA 2E2HB 3HOVH 1MKHA 2Z4IA 2VY3A 5IT9W 1ZZJA 1P16A 1GD7A 1KDAA 3M4YA 1ASYA 4L5RC 3OWFA 2EJGC 4GKKH 5HY6A 2UUBH 1RF2D 3U9SA 3MXGA 3F2UA 4WJ3M 1IW7D 4DNTB 1MHWC 2LS01 3BYYB 2UXBQ 2F52A 1R4QB 3U58A 1DOMA 2HQEA 2WV6D 3ZYYX 2LY7A 2QILA 1GHKA 1CSQA 1I94H 4H0LC 1LV9A 3RNUA 2O4CA 3BZKA 3NBHA 2C9OA 1B4OA 1PDQA 2JA7G 4OL7A 4DV1H 1N34Q 1K8MA 2HCCA 3A8IE 1V9NA 2A68C 4JI4Q 3MFGA 2N3SA 4BBRH 3BZCA 1N9WA 1QE6A 2DJGC 4BY7B 3CCJA 3CCSA 3K0YA 3F2DA 4LF4Q 4DR7L 4UDUC 2QGQA 3I0PA 1HA6A 1XPOA 4BXXH 2KEEA 1HNWQ 2F03A 5IE8A 5IT9L 4A3KB 4BBSG 4HAEA 2RDFA 4NMZA 1SYFA 3NQTA 2JA6H 3MWYW 3PUWA 1YJWA 4LUZA 1NJIC 3H3VC 3CU7A 1W6KA 3BVZA 3SK8A 1XMOQ 3GTQH 1Y14B 2OT2A 5CC4A 3G71A 4A3CG 1B8AA 4JI0Q 3PMFA 1SJED 1JJCB 3PUVA 3PIP3 4DK3C 2J4XA 4KD4A 1VQEA 5EJWA 5J3BA 4A3JG 4K5WA 3D8GA 1WD0A 3HKSA 5DM63 2DY8A 3K7UC 4DV2Q 3DMUA 4Q0FA 3KDGA 1EOTA 3HS0C 2NVYB 2OCEA 2CTKA 2MJ8A 4POGA 4TSSA 4B3MQ 3TP6A 3I91A 4LFCL 2ZJPA 3NBIA 1YJ9A 4R8NA 1TS3A 5IGDA 4G57A 4JYAL 2HQLA 3KJOA 1TVXA 3PO3B 2AUJD 3B6YA 1HNXL 4RAUC 1TS2A 3FRPB 5C4JB 4QQBX 4DF7A 4FXDA 2Y0SB 3OYYA 1ESFA 3PUZA 3S1RH 2FHTA 2OWOA 4OX9H 2K75A 5HGQA 5M3MB 1Y1WB 3S1MH 3J80W 2XSCA 4JV5H 4F88A 1PH8A 1KNAA 2H1EA 4NB3A 1LUZA 1EU3A 3HKZE 1U5KA 2KCTA 3P75A 1STHA 2LRRA 1HZ9A 4JI5H 5C6AA 5IYCH 4JI3Q 2HT1A 2D2CC 3I4NG 4QMFB 3HOWG 3VA7A 1T5EA 1TT2A 1X56A 4PV1C 2KCMA 1X54A 4GNXB 4G08A 2R61A 4YY3Q 2K50A 2M00A 5J1ZA 5A35A 1HR0H 2WKCA 2UUBL 3CCQA 2F0EA 1WTPA 4DV7L 4DU9A 4JI8L 1YITA 2WB1G 3Q8DA 1I5FA 3OW7A 1EY9A 4FP5D 1M90C 4B3TQ 4KY5A 3J80L 1Q82C 1IBML 2Q2TA 4J15A 4RMFA 1JWUD 3IKJA 1Z47A 3T56B 3OETA 1O7LA 1LTGD 3A5ZB 1WFQA 1S5CD 2F0IA 3TQYA 3U1KA 4UP9A 4YCUA 4NKLA 5D3DA 1X9NA 4A3BG 2XWBB 3CAMA 4QCLA 2L11A 3BDOA 1HHVA 4P75A 4O1NA 4GLAC 3SGIA 4H02A 1K83B 2LMCB 4DNRB 3KLSX 1PH7A 2DGRA 1SR3A 1L1OC 1X6OA 3R2IA 1PFNA 1EIHA 2A6EC 1C8CA 1ENAA 1CHQD 5BN5A 1E2WA 3M4QA 1KIXA 5JPMC 3NELA 1I6UA 4A3EG 5G3LF 5I6YA 2BH2A 2ATWA 5LMUL 4DV4L 1VQ5A 3H3VI 2OQ0A 4ABNA 1CKNB 1ET6A 3BJUA 1CTMA 2Z6BA 2JYOA 4ZQ3A 3JAMc 2F0JA 2PNHA 4H44C 4A3BB 2EOTA 2KHIA 4R4CA 2F0OA 3I3CA 5IYBG 2ZTDA 3CPWA 4B3SL 3MFYA 2LF0A 2CQOA 3GABA 4X65L 1CZGA 1ET9A 4JI2H 3MA2B 1SNMA 2Q8TA 4EVOA 2K5WA 4GN4B 1VQBA 1JOKA 3K7AH 4LFCH 5M5YH 3IFTA 4WJ4A 4FDBA 1WOCA 1NMFA 4JYAH 2B2WC 1PH4A 4BS9A 5D14A 4DR2Q 1TS4A 4FO2A 1PYSB 3I90A 1A63A 4NXML 3DWPA 1F9PA 3J7YW 1WTHA 2QF7A 2UUAQ 4OX9L 5IWAH 4K6LA 4FVMA 4WANA 4C2MH 3CD6A 4NXNH 5IP9H 1VCIA 3MC0B 5KYIA 4DR6L 4IJHA 1JC7A 2R6GA 1C4QA 1STEA 1H9SB 1F2MA 2XVSA 4CHTB 5J39A 1TU2B 5JVG3 1GUNA 4EX5A 3GTOH 3QG1A 3BVMA 2F0FA 4N9TA 2EYMA 3PO3G 1J5EH 4DR5L 4LF9Q 3SK6A 1ZKOA 1B50A 3BS1A 1RTNA 2EYLA 4POFA 4JI7H 4R4QA 3IRBA 1VF7A 1IHZA 2CQAA 2NWGA 1L2FA 2EXDA 2RVLA 4CJ1B 3JAMW 1HR0W 1AW7A 1K8OA 3MXPA 2OTJA 4MTKA 4KD3A 2A8VA 2QW7A 4KKUA 3E6ZX 3H09A 1GM5A 2KHSA 5C4HA 3SHLA 1X4NA 2YU9B 4JBKA 1X9ZA 4TVAB 3G6JB 1WVNA 3LWEA 2MJHA 1IXRA 2ZTCA 4X65H 1WTOA 1ENFA 3F1ZA 3M85A 4DK1A 4M1UB 2QEXA 3CW2C 3OW2A 1FD7D 1LT5D 2C5CA 2JP1A 4TQUS 1K83H 1QILA 4OELB 2UXDH 4GKKQ 3FMCA 4TKOB 1LYLA 3KF8B 2E2HH 1VMPA 5ELBA 5LHY1 3S24A 1PA6A 3RN2A 1SFOH 5DNFA 1K0SA 4HMIA 4ALPA 4KY6A 3CCRA 4DUZQ 4OWTB 4C1NK 1R9TB 4DV0Q 1PTOF 1S20A 4DV4H 3D31A 1B44D 2R92B 3NEMA 1QUQA 3R8BA 3CMEA 1N32Q 1N33H 2CTFA 2F3WA 3TEHB 2HCIA 2IT1A 1QZHA 1EQTA 4OIJA 2L12A 1V1OA 1E2ZA 3NSWA 5D3IB 2EZVA 3C3LA 4DV7H 1YNNC 5JPNC 4A76A 5IP7G 2JA8H 5HURA 1VBIA 2VQFQ 2ZT9C 3MXUA 2D9IA 4X3UA 5C44B 4A3IB 3D0FA 4A93B 3C46A 4JK1C 1QZGA 1G91A 1Z6HA 1MI2A 2Z8LA 4XYQA 5IYDG 4ILWA 3JC66 3UE1A 5CYUA 2N55A 3BU2A 4MNOA 3H0GB 5DEHA 3OHXC 4IFDH 3NENA 1E2VA 2RSOA 1E22A 4RGTA 2NB0A 2JQOA 4IUUA 2IW3A 4RA8A 3RR5A 3DXJC 1TWCB 5NUCA 4DR1L 4PMCA 4A3GB 2UXDL 5EKLA 1R4PB 1M1KC 1XTDA 1DJRD 2B2VC 1Y1VB 4A4IA 4HIDA 1J5KA 5DT9A 1V1PA 4OXPA 2A74C 5LMNQ 4XYOA 1J8IA 3A55A 2VNUD 2Q8IB 5I6WA 4DAYB 1L1OB 3NWSA 4DA2A 4HMJA 2N78A 1NUCA 4K5XA 2E76C 5E1FA 3PO2H 1CSPA 5KIXA 1O78A 1H9RA 2WAQB 3A0JA 2E5LH 4L5SA 5I2XA 2R3ZA 4QF4A 5IWAL 1VQ4A 4QUCA 1G6ZA 2CVRA 3KLWA 1TWHH 2YYZA 3QWNA 3PO3H 4P72A 1D5ZC 4LFBL 4WFN3 5K36G 2E2JB 4U68A 1RD9D 3S1RB 3TRZA 3SXHA 4DV0L 4L5QA 1B9MA 1LACA 5BR8H 4C3IH 3GV6A 4KHVA 1YNXA 1BBWA 3G6EA 1DONA 1FJGQ 4OGQC 1T9HA 3DWAA 4B3TH 1PZID 1TWGB 4CDEC 2K04A 2N49A 4KJNA 2F4VQ 3PIO3 5JEAH 1Q1BA 3JAME 1TWAB 2ZM6Q 3W2DA 3BYTB 5I4DA 4LF7L 5M5YB 3DWQA 4GZYC 1A62A 5ELOA 1PXUA 3HOVG 1S3OA 2M8WA 2F0WA 2SNSA 4RH6A 5K5PA 5CBAE 1L1OA 1K8AC 4FJSA 4NXNL 4A3JB 3SR1A 2A1SA 3S14B 1OXVA 2X6GA 4G7OC 5IT9c 2YTYA 2SDFA 4DR1H 1JQYD 1H9JA 3KOJA 1RJTA 5AFWA 1PZJD 1HTPA 3HP3A 5C0XH 1DXMA 3SEBA 3OSOA 5T1IA 2K5DA 3ERSX 1C0AA 2JK8A 2CCZA 3LWUA 2G9HD 5C0XG 2XGTA 3HOYB 4DV6Q 2BA1A 2BA0A 3GTKH 2UUAH 4IUTA 1EY6A 1JCKB 1SYGA 3FKIH 2F4VL 3HEJA 3FEWX 1EEFD 3PV0A 4OCHA 1AE2A 1FNUA 1VQOA 3A7LA 5FOBB 1A0IA 3HOVB 4RGOS 5EPKA 1Q8KA 4CKCA 5CGKA 1N33L 5M5WB 4DV6H 2F0DA 4MZ9A 3VA5A 1V9PA 3VR5A 1HQRD 3S1QH 1YEZA 2A6HC 1XNQL 3CCEA 2VL6A 5BR8Q 4DXGA 2FFKB 1HZCA 5IP9G 3KYHC 3UE0A 4EQPA 5FJ8G 1EUJA 1MSGA 3NPPA 1LT3D 4I7ZC 1IBLH 5CR3A 2F0LA 5C44H 4A3IH 4FF4A 3LX0A 3OIPA 3H3VH 4OO1G 3EQLC 4IZ8A 2CTMA 1G51A 3HKZG 1X3EA 3A74A 1VQFA 2Z6KA 4J1MA 3S15H 3MZ5A 1N34H 4K2KA 4BY7H 4LUOA 4OEMB 4K0KQ 1F0XA 2H5XA 1TXYA 3SK4A 4HJ5A 4DV5H 5CMDA 1OXUA 1V1QA 3WOEA 4DR1Q 3T1HQ 2E75C 5M5WH 2EY6A 2Z1CA 3CCVA 2JA7B 3DUZA 2UU9L 2B2YA 1EZ6A 4MTNA 3TMEA 3EFXD 2HHHQ 5C5MA 3CC7A 1VQPA 1EFID 4DV5Q 4J6HA 4A3LH 2MHVA 4XQQA 3HOUB 3AFPA 4OX9Q 3I7FA 4X3TA 5F2DA 4X64H 3T13A 3DEPA 4X66L 2PQAB 1HH2P 1KAAA 1QNKA 1ZXTA 2IY5B 3HKZB 1SEIA 4C56C 3OSSD 2BDNA 2A69D 2Z9HA 4WALA 4DV2L 3NUCA 1L0YB 1AZPA 4JI0H 1WTVA 2JA8B 2VUMB 3K57A 1CK1A 3PSIA 4P71A 1HA5A 4DKAC 5IYDH 4DUYL 1SE2A 2AKWB 1WHRA 3ND9A 1HNZQ 4JBMA 2ALYB 3MXNA 3CQZB 4JBJA 1QJOA 2RKSA 1MBYA 5KNCA 1B9NA 4LNQA 1OTCA 2WACA 4YY3H 1JE5A 1SDFA 4WRDA 1IBLL 1X4MA 3CRKC 4FJUA 2IX1A 1BQQT 1N36H 4JI1H 1D6EC 2R7FA 1Q8IA 5GADC 1II3A 1IBKQ 1EIYB 1A3UA 1YI2A 3EZJA 5C3XA 1BDOA 1U4PA 3P20A 1IBMH 4B3TL 5FLXE 4ZUIA 1XNRL 1WCMG 2EYHA 2K33A 2VQEL 5EPJA 5DM73 1EIGA 4UAIA 4GN5A 1WTQA 2KEDA 2WFWA 1FNVA 1STGA 4A3MB 2YU9H 3Q0AA 4DR6Q 1FJGL 2X6LA 3J7AV 1KABA 2YV5A 5GQOA 5C5LA 2JJQA 3R2TA 2VQFL 2UUAL 1SYBA 1TS5A 3QOLA 4X64Q 2F0KA 1VQAA 4YWKA 3DLLA 5JEAJ 4OWXB 2I5MX 2OTLA 2LKVA 2UU9Q 4RKBA 3S17H 3VDYA 4LF6H 3BVGA 1G8ZD 1J5EQ 2RCNA 4DV3H 4JI3L 5FK9C 4V190 1VQCA 2EY1A 2JA6G 2NN6I 2D62A 3RLOA 2IX3A 1J5EL 1BUVT 1FNWA 3GTMH 1S4ZA 3V05A 2OPUA 1PFSA 3AEVA 4R4IA 1DOLA 2CPMA 2NZHA 1LTRD 3PQIA 3AU7A 4X62H 1PZKD 4F8MA 4A3MH 4XDXA 3G48A 1SROA 2FJ2A 4DR2H 2QDBA 2PQAA 4A3LG 4JVYA 1KHIA 1DD2A 2PI2A 1OXSC 1SN8A 4DV4Q 2J7ZA 2LTMA 1GUGA 3N52A 4GKKL 2V1CC 5BN3A 2F3VA 2DNCA 4IPCA 2B63H 2HHHL 1N33Q 1N32H 1I3QH 2KHJA 1I50B 4L63B 4IUPA 1SLJA 3S2HB 2QCPX 1YHBA 1EWCA 4JI2Q 3M3YB 2HDLA 1VQ8A 4QMGA 4ZKBB 3GR5A 1PFMA 5E4WC 4PMWA 3A8JE 4ZKCB 2DUDA 2K4KA 4FF2A 4C1NI 5JAVA 4BBRB 3KF6A 2HIXA 5EBCA 3OPOA 1ML0D 5IGEA 3K5MA 2JA7H 5M5XB 4YHHL 2A5HA 2H4OA 2RCFA 3OMCA 2AUKA 1F9RA 1IBKH 5IP7H 4YHHQ 1H9MA 4JI0L 1TKWB 1RHPA 3AYHB 4JI4H 3VR3A 2BE5C 1CFMA 3MTSA 4L5TA 1S72A 2PW5A 4B9XA 4HCSA 2OEOA 2D5DA 5CV5A 4DAVA 5C4XB 3HOXH 2B63B 4PZ8A 4OO1H 1X3GA 3K8AA 2J0TD 4A75A 4B8CD 1I4GA 1H9KA 2QA4A 5EKIA 1GXDC 3GTGH 4ZLTF 5JJIA 1EL0A 2HDMA 4A3EB 4KHPL 1K3BC 2D0PA 4EQNA 4IUVA 2E2IB 3OTOL 4N9PA 1QNUA 2A6HD 3SB1A 1UNSA 2BH8A 1QVFA 4DV5L 4RCOA 2MUYA 3CQZH 4DR2L 3JAML 4EQOA 3IFDA 3TS0A 1A15A 1DYQA 2CWFA 3GD7A 3Q6SA 2CWPA 2JA8G 1K8GA 4DAYA 3VYRA 1SMYD 5AJ3Q 2PZTA 4K0KL 1B3QA 2ZJRA 4HIMA 4DXFA 5ELEA 4CJ2C 3EIVA 1SMYC 3K0XA 1BVSA 4B3MH 1L0XB 3O13A 4XXEA 5C4JH 1E1TA 4GKJL 1ZYRD 3EN2A 5M9OA 3C1EA 5KNDA 1RCVD 3UDFA 5IGFA 1PH2A 3T4AC 1TWAH 4DV3L 1PYBA 1LTTD 3L9AX 1Y1WH 3S1MB 1DCZA 3GTMB 5EBDA 2I5HA 1LTSD 3T1HH 3UDIA 2PCFB 4UPAA 1WYDA 4KI0A 1SNQA 2LXKA 1RIPA 1AE3A 4WORA 2EY5A 5T1GA 2HH2A 4JI5Q 1YIJA 1STYA 2JA5B 2WAQG 2K01A 3ITPA 1WVLA 4OWWB 2ES2A 3E9IA 1V43A 1V8QA 3RLNA 3DEOA 2PQEA 2FMRA 1D2BA 4LJZC 1D1IA 2E2JH 3GV3A 1PQXA 4LF9H 3ER0A 3S2DH 4H7BA 2CW0C 4Z9CB 1IL2A 3HOWH 1SEBD 1TY2A 2K5NA 1FR3A 4YWMA 3TP8A 4QIWE 2Q2HA 3PIPA 1I50H 4GOPB 4DR3L 3N6RA 1C48A 2CTLA 1U0LA 1DOKA 4C3HG 1AZQA 2L55A 1VMCA 3S9WA 4HSPA 2GVAA 1Q7YC 3K7AB 3F8TA 3J81E 2P5ZX 1Z9FA 5C0XI 1UE7A 1JWMD 4CDFC 3V96A 2MPMA 3MXNB 3CRLC 4IALA 2LSSA 4GNXA 1BCPC 2NN6G 4KY7A 1CZWA 2B29A 1SYDA 3HRZC 4HJ8A 1W2BA 2NVTH 2CH4W 4A3EH 3R3OA 1WCMH 4LFAQ 3T1HL 2F3IA 1CUKA 2Z6KC 3CPFA 1D7QA 4IFDG 2KA7A 4RGMA 3HOXG 3QB3A 3Q23A 3GTLH 4X6AH 1IBKL 1DTJA 4DAMA 5C4XH 2EE1A 2Q8RE 1WTJA 2VKCA 1WE8A 2A1AA 2O5IC 3ZJYC 4LF4H 1KQSA 1XWEA 2EDGA 4AM3A 1YHQA 1PH9A 1EY4A 5IGBA 2OPVA 3I8ZA 2NZOA 4A3BH 3VYTA 3K81C 4P2CB 4I7AA 2JN4A 4IN3A 1S5FD 5DLQE 5CORA 3HOZB 1B53A 3A8KE 4KJOA 4RFBA 4AQYH 3BZDB 2RBMA 1PMRA 2K7VA 2R7ZB 3D3RA 1J4WA 1JWSD 4YHHH 5KYLA 3ULJA 4LF8H 3DM1A 3ND8A 4JW0A 4C3HH 1VF5C 4JI7L 4AQYQ 1Y8NB 2B2TA 1EIFA 2MGSA 4JI7Q 1J6QA 1QCBD 4DR3H 4C3JG 2QEJC 3W3AA 3E9HA 2MFIA 2WAQE 4YIJA 1ENCA 1WI5A 1EYDA 1Y1VG 1LTAD 5D65A 4DV1Q 3S15B 2E8GA 3X3MA 2KECA 2EPBA 1AEXA 3LNNA 4NXMQ 3HOUG 4RKLA 1SFOB 1YVCA 4CJ0B 1VQ7A 4N8FA 5FJ8H 4DK6C 1FGUA 1JB7A 4KV6A 4DR5H 1CKNA 5FKAC 1GUOA 4N8X1 5M3MH 1VQHA 2RA4A 5CV8A 1G291 4L6TB 3Q22A 2BCOA 4NBQA 4K8JA 4C2MB 3FDTA 2VB3X 3S14H 2DY7A 3KF6B 4JV5L 4JVHA 1C7YA 2VUMH 5ISRA 4IOCA 1AH9A 3FKIG 4JI3H 1D1KA 1XNQQ 3GTOB 4GN3B 3HZXA 5LMUQ 2PT7G 4JI5L 2Y0SG 3J81j 5J22A 1SRUA 1HUNA 3D4WA 4JI1L 3T1YL 1N36L 3GO5A 5EPLA 1I4PA 4XT3B 4FXKC 1IKMA 3J80E 1BO0A 3CXCA 1D5XC 1T5XD 2UXCQ 1CA5A 2ZJQA 3K59A 4F87A 3UDGA 2F4IA 2IHFA 3T53B 2ICIA 3FAUA 5H1SE 3KDFA 2B2UA 3KLRA 4AIMA 2XRQD 2XWJB 1HRJA 2L1BA 4A3FB 3E5SA 3STBC 4A3CH 3K6OA 2I0QA 3KDKA 5IOCA 1DZ1A 1AFPA 4JCVE 4G7HC 3RMHA 4LUVA 1HZAA 5I2YA 1E24A 4B8TA 4ZRZA 1EY7A 2AXYA 3GQBA 3KLSA 4BBSH 4LF6L 2L5TA 1BR9A 4ULLA 4QY7A 4DR5Q 4LF9L 1BOSA 2E5LL 5FO7B 4JI6Q 4JI1Q 1N36Q 4RCNA 3ERQA 1XNRQ 1NNXA 4R9WA 1YZ6A 4BWGB 3TZUA 3OTOQ 1PHJA 3PF5A 3BG3A 4IFDI 1IZ6A 1TWHB 4J8QA 4Q5VA 5CBEE 4A3FG 2R93B 3TZDA 4Y52H 3A54A 4B3RL 2PMZE 2AQ3B 2MO0A 4YY3L 2K1HA 4LF5H 1B7YB 4KTAA 3HOXB 4IUQA 3H0GH 2UUCQ 1BBUA 1U4MA 4QUFA 1G6PA 4LF8L 1F2ZA 4DN4M 4IURA 4XQNA 1HNZL 3W1BA 2R7ZH 1DGSA 4HN7A 3KF8A 1A8VA 2NZ1D 2BE5D 4DNIA 2DJFC 5FLMG 1I4HA 2FFMA 2E2IH 3DHQA 1IBMQ 4S3SA 3NK9A 3EVQA 2IJ0A 5ELCA 3TBIB 3CHBD 1NR4A 1K73C 4ZAIA 4B3SQ 2NUCA 1VQIA 4IPHA 1TWFB 1ZYRC 1QG7A 1HXYD 3A56A 3FPPA 3M9BA 1N8RC 3K5OA 1WTWA 1D5MC 1QUQB 1WJJA 4JI6L 4ZCKA 5IIFA 2LTLA 4OIKA 1Q81C 1NE3A 4BY1G 3CC4A 3NE5B 2Y0SE 1UAPA 4AQYL 1VQGA 3S1NB 1Q86C 1UE6A 4OO1I 3CKIB 4NP5A 4NZTM 5IYCG 4K2LA 4C3IB 2K1BA 1XX8A 2WB1B 1A2UA 5A2QL 1B70B 3CC2A 3MAQA 3SE0A 1EWIA 3I4MH 4QJFA 1I4QA 3H0GG 1AP0A 2XTIA 3NTHA 1CA6A 2K03A 3RZDB 1B1ZA 1CHPD 1RDPD 4HIOA 1PH6A 3K80C 3TS2A 2G5DA 2X06A 3C1FA 4HJ7A 2D0OA 4BY7G 4DK0A 1IYJB 4IJLA 1N32L 4QIWB 1BCPF 1Y69U 4JBWA 4BY1B 1HNZH 5BR8L 2YQRA 5LMUH 1UEBA 3MEHA 2G9DA 4JI2L 2CKZB 4O42A 2ZXPA 2NVXH 2KOLA 4DR4H 4JG2A 2TMPA 4X3KA 1HNWL 5JJKA 1XMQL 2RF4A 2PYKA 2K52A 1Y8OB 2UU9H 3S16H 4LW1A 4A3MG 1VQJA 2O2LD 2PMZB 2BL5A 2CWAA 1YNJC 1SNPA 2M6QA 1RTOA 3FP9A 3GTKB 4IPDA 2BOSA 4JI4L 4PDBA 3KBXA 1N34L 2F4VH 4UHVA 3W1GA 4GKJQ 2F0VA 1SNCA 2K5VA 4G7ZC 1ILPA 2SOBA 1X32A 4MIUA 1WTRA 1UE1A 2DNEA 2JA6B 3X3NA 2PI2E 2OQKA 1U4RA 4RG1A 5AJ3L 1MJEA 3PO2G 1HPCA 1SYEA 1JICA 3T1YH 1I6HH 3F2BA 1QB5D 5C3EB 2NVTB 4DUZL 3IAYA 4IPGA 1X65A 4FNFA 2EJMA 5IGCA 2Z4HA 4X64L 5LMNW 4DUYQ 1MIUA 2K32A 4L8JA 3U50C 4DV1L 1B3AA 2TSSA 4OONA 2B3GA 4ME3A 2E74C 2YTXA 2K14A 4DFAA 3ULLA 1JMCA 1CI3M 4A3KH 1UWVA 1PRTD 4ZUJA 5FO8B 4ID6A 4G4KA 2HUGA 3J80i 2VQEQ 1STNA 2IPKD 1ZZKA 1KDBA 4GLXA 3K5NA 3E0EA 5JJZA 2UXBL 2C35B 3I56A 2WP8J 1NY4A 1TUAA 2EYFA 1GO3E 2R93G 1EOVA 1KXLA 2IWHA 1ICWA 3VR4A 2NVQB 3V2TA 4A3DG 4IO9A 1FKAH 3RZOH 4NDXA 4BA1I 5M3FG 4DV2H 4C3HB 3J7AF 2F0TA 1EU4A 1A2TA 3I4OA 1CQVA 5LMNL 2NYZD 1JT8A 2JZXA 4GOPA 1XPRA 5E7NA 1Y1VH 4K5VA 1MSHA 3NTKA 4UP8A 3H6MA 2AWNA 1S5DD 1I94Q 2K05A 2EYJA 1EY5A 1XMOH 4O2DA 4DV7Q 4AYBE 2K5HA 3J81L 4DPGA 1SNOA 3AB9A 3OMGA 2MP1A 2RDGA 2EQSA 4UY8C 3QD7X 1HCZA 5ELNA 2VB2X 1TWCH 2A69C 3HOYH 4A3GH 4GOPC 4A3DB 2XNAC 4PMBA 4CDDC 1HQMC 3D6WA 3M7GA 4X62L 2PNRC 4HJ9A 5M3FB 2B8FA 2PO4A 3I4LA 4HJAA 3M4OB 1JB3A 2EVBA 1ZEQX 1I6VC 4JVZA 4XIGS 2PZWA 1HFNA 3HOZH 3I4NH 1I4XA 1RL2A 2XIWA 3OIQA 5E4XA 1JR0D 2ZQEA 2RHQB 2WKDA 4YCVA 4H8AA 5C0XJ 1LABA 1PTOH 4R8IA 2CTEA 1UE5A 3C2PA 2VQFH 1HR0Q 1PH5A 4CGYB 1KLUD 2R7ZG 1O80A 2K28A 1TWFH 2NVXB 3EJIA 1K9MC 4LAAA 1F9SA 4R4TA 3GTJB 3V69A 3URYA 3M3YH 2CPQA 1BXTA 5JEAG 1LTID 4ODGA 1BF4A 2JA5H 4JC0A 1HTLD 1TR5A 2ZTEA 3HG9A 4E6IA 3KFUA 1F9QA 2HHHH 4LWCA 2ENBA 2EIFA 2NN6H 5GAGC 3PF4A 3AEVB 2B8GA 4KHZA 2VUMG 4NZRM 5EQ0A 4KK7A 4K14A 3S17B 2RDHA 1NR2A 3H91A 4EC5A 1GJXA 1WD1A 2GVBA 4DUZH 2QDLA 3I70A 3W5OA 1KDCA 4GLVB 5C44G 4MHEA 4A3IG 1PV4A 4A93H 3L3OC 4HR7B 4PG3A 3JAMi 2EY2A 4X66Q 3KBGA 4BA2I 4A3FH 3NWTA 4TRDA 3UOEA 2F0UA 1PRTF 4LMQD 5C3EH 4U673 4ZK9B 1F2LA 1RODA 1SNDA 1EQQA 1NAPA 1W3SA 3GTGB 1PLFA 1NXUA 3AMUA 1PTOC 1HZBA 1V1PB 1EC6A 1YNND 3R93A 3TREA 3EROA 4A3KG 4BBSB 2EJFC 2CTJA 4LFAH 4DV0H 3Q24A 2D9UA 3S2HH 4FXGC 2PPBC 5KRUA 4ME5A 3VYUA 3NHHA 3FKIB 2FXQA 4P74A 1ESRA 4E9JA 2OF1A 1UUPA 5IY0A 1X0AA 3NQIA 1NSNS 3LGJA 1Q1EA 2KQ3A 4IOAA 2PY9A 1PYWD 2ZM6L 4PZ7A 2UUBQ 2UUCL 4LF7Q 2ASBA 4JI8Q 1DT4A 1XMQQ 3E3XA 4NW2A 1QOHA 5EAYA 1VQMA 2IX0A 2UXBH 5IODA 3SK5A 4JYAQ 3ICEA 1QVCA 3L7ZC 3J7ZC 5JVH3 3RF2A 1A3TA 3TN2A 1SAPA 1OO9B 1YNJD 4B3SH 2PZUA 4B3ML 4X3SA 4KKSA 4GKJH 5IWAQ 5IGGA 1GUWA 4LF6Q 3KDFB 3MVVA 5LL6b 4R1JA 3OTOH 3ULPA 1F77A 5E3FA 1Q12A 5CV6A 5JOBA 1RKNA 1BNZA 1Y1WG 2Z0SA 5A2QE 2O5JC 5ELDA 1XJVA 2ICEC 5JJLA 3WWVA 1SBBB 3HOZG 1ZZIA 2BDOA 2UXCH 5FO9B 4X65Q 1ILQA 4IUNA 1STAA 3ONAB 5G3LD 5GROA 2MQHA 1XMOL 2E3UA 2CWHA 4B08A 4RWSC 3E0JA 4CBVA 3U9OA 2VZAA 1XNQH 5IT9E 4CKBA 4XT1B 1HNXQ 5DAUA 1SE3A 1VQDA 1KRSA 4EQ5A 2A68D 1X3FA 4C3JH 2AQ1B 2KVMA 3TDQA 1S5ED 4K0KH 2L9HA
chains in the Genus database with same CATH topology
3QOJA 1EFWA 2YTVA 3WDNA 2OXPA 2IL8A 1PTOB 1XTCD 3QJYA 1SE8A 1KL9A 4LF5Q 1NCVA 2LFNA 3T51B 1SE4A 3J81i 1PH3A 1VIHA 4KN7C 1K0RA 3J80c 3D4DA 4IQZA 2PW7A 4DV3Q 2P2RA 2JEAI 3H15A 2ID0A 2KENA 1LM0A 1HFGA 1Q46A 1X3QA 1BKBA 1Z7TA 1LTBD 1MGSA 3UDXA 3L2PA 3KUPA 5CV7A 1CKMA 4RHSA 2KCNA 3K5LA 3OWEB 2V4DA 4XTCS 3NTIA 5M5XH 4A3DH 4QGUA 3PGZA 2XRSD 4AYBB 5KGUA 3KK7A 3CP0A 4K8IA 1YBYA 3BDCA 3T16A 1KNEA 1L0WA 5KEEA 1M8AA 2FINB 2KBNA 2MO1A 2UXCL 4Y7NH 2F0NA 4M8AA 1YHAA 4LF5L 4C3IG 3OOCA 1R9TH 3T1YQ 4KKTA 4KHPQ 1H95A 4NPSA 3D4RA 3PIOA 1S5BD 1QVGA 5FLXc 1CT1D 2AHOB 4DR3Q 2M2LA 1CKOA 1I6HB 2DN8A 4JV5Q 3CCMA 2R7DA 2NVYH 3QIAA 1EY8A 1MD2D 1EWHA 1CM9A 1F2YA 1O7YA 5GAHC 3GP7A 2XN9C 4BXXG 1Y8PB 5COYA 2B2WA 5TSSA 1H9SA 1JOQA 3FPUB 2VXWA 4KLKA 2JXMB 1SSOA 1D8LA 2EXZA 3GTLB 2ANRA 1C9OA 2F0GA 4NXNQ 4R4OA 1JE4A 3DM3A 3U4VA 1BCPD 3I72A 1QWYA 2Q2IA 5CV9A 2ZXOA 4LFAL 4DGZA 4IFDJ 1SYCA 4UP7A 3CCUA 2FMMA 1XYIA 1KD1C 4KN4C 2L15A 5I9PA 4HIKA 1WCMB 1VS0A 2AWOA 3PO2B 2GA4B 2HIVA 2WIIB 1BBXC 1X55A 4YWLA 2A6ED 2B2UC 2B39A 4LFBQ 1KAWA 3I4MG 2NTTA 1TY0A 3F2CA 1LLRD 2F1MA 1KTKA 1GOZA 2RHSB 5LL6S 4EGVA 4XQJA 1Q3LA 3QO2A 1KHMA 1E7ZA 4DR4L 1VDZA 2JA9A 4LF8Q 2HH3A 1IBLQ 1BCPB 1GVPA 2L4NA 1X3PA 2JE6I 1EEID 2RSNA 2F0HA 2F0MA 3GDEA 2N8NA 4B3RQ 2B63G 1HUMA 3VR2A 2MNAA 1LO5D 4WJWA 1PRTB 5C3WA 1J9OA 1SXTA 4RHRA 1LT4D 2KCCA 5I9OA 1TQOA 1SJHD 1AN8A 1LTLA 1P8LA 2JEBI 2GN5A 1PVOA 2NVQH 2N88A 2CW0D 3I4MB 1FVIA 2E5LQ 1VQ6A 3K58A 4K6DA 1G2TA 2IHEA 3AQQA 1JJ2A 5ELFA 4F7XA 4HTHA 3EBEA 4HSVA 2K5QA 3J7A5 2RQXA 1PRTC 1FL0A 3GTJH 3MHBA 3PUYA 4YCWA 5FLMH 1IL8A 2NBFA 3S1QB 4DV6L 2WINB 1I3QB 2KJXA 3TSSA 3P1HA 3VYSA 1NTGA 4PQXA 1E0BA 1S40A 2X69A 3U4ZA 1IKLA 2B2TC 5BN4A 1I94L 4FF3A 3FVQA 2AMCB 2B2VA 2DGYA 3M4PA 4LIJA 3G7LA 1GKHA 4C3JB 1HR0L 3H94A 3NXWA 4AH6A 3GTPB 2QNDA 1PTOD 2CHBD 2I5LX 3FHWA 3CCLA 2VW9A 3S16B 2FMCA 5M3FH 4FF1A 3I73A 1YJNA 2B2YC 4AYBG 3RD4A 1WTXA 3AFQA 1PH1A 3VR6A 2L0CA 3A7AB 2F0SA 5C4XG 1LT6D 5C4ZA 4HCEA 2R92H 4DR7Q 1VIGA 3TP7A 2EYPA 4A3JH 2A19A 1A6XA 5CV4A 3I55A 4HEDA 4LK1C 2WB1E 5LL6X 1CQFA 4GS3A 3NP8A 4ZYSA 2ANNA 4JOIA 3S2DB 4DAPA 4A3GG 4JOIC 4APVA 4QB4A 2EYOA 1OXXK 1SMXA 3SVMA 3S1NH 2SEBD 1JORA 1E1OA 2CFMA 2JVZA 3M7NA 5EKKA 1NMGA 5C3EG 2UXDQ 1A3VA 2A73B 1IYVA 2O4XA 3A5UA 1ZTGA 1XXGA 1KC8C 2M9VA 1K3RA 3I2ZA 3D6CA 3RUZA 2E2DC 1NBWA 3RZOB 1O7ZA 4OHJA 2AQ2B 1JOOA 3TP5A 2I46A 1U4LA 4LFCQ 5K36H 1EZ8A 2PQUA 4X62Q 1JJGA 3RN5A 4MN3A 1PFBA 2R93H 5HGTA 1VQNA 4PNYA 1FGBD 2ZXRA 1VQLA 2NTSA 2SNMA 1KLGD 3CMAA 4B9WA 2JA5G 1B2TA 2I07B 1GUTA 4P73A 4I65A 5M3MG 3GTQB 1VQ9A 4PZ6A 4O0AA 5IYBH 4RGNA 5FLXL 1EYAA 4CKEA 1K1GA 1EYGA 1STBA 4DR4Q 1G2SA 1VQKA 1FYCA 3KJPA 3HOUH 1TWGH 3EA6A 2K6AA 3RLFA 1M4VA 3M4OH 3UI2A 3I4NB 5EGTA 3P7JA 1EQVA 3IL8A 2VS1A 3HOWB 2KUMA 3L0OA 1EQRA 1GHJA 2F0PA 3PUXA 2LXJA 3CF5A 1IYUA 1E3PA 1ASZA 4LF4L 4KMUC 1I4RA 3HOYG 3J81c 1ONLA 1W6JA 4BBRG 3BDLA 3RZDH 1U9RA 2R92G 1O7IA 3PCOB 3STBD 4H13C 1EYCA 1EY0A 3MEFA 1DM0B 4FYDA 3VKEA 1IW7C 4BY1H 2QKIC 1KRTA 1XPUA 4QL5A 3G4SA 4A93G 1UEAB 3GTPH 5KNBA 5GAEC 4V0BA 3SDZA 4GNXC 2F0QA 1TIID 3HGBA 3NBHB 1HJPA 3WOFA 1OXTA 2Q2UA 1MJCA 1Q90A 3HFZB 2JSOA 4Y7NB 1GUSA 2E2HB 3HOVH 1MKHA 2Z4IA 2VY3A 1ZZJA 1P16A 1GD7A 1KDAA 3M4YA 1ASYA 4L5RC 3OWFA 2EJGC 5HY6A 1RF2D 3U9SA 3MXGA 3F2UA 4WJ3M 1IW7D 4DNTB 2LS01 3BYYB 2UXBQ 2F52A 1R4QB 3U58A 1DOMA 2HQEA 3ZYYX 2WV6D 2LY7A 2QILA 1GHKA 1CSQA 4H0LC 1LV9A 3RNUA 3BZKA 3NBHA 2C9OA 1B4OA 1PDQA 2JA7G 4OL7A 1N34Q 1K8MA 2HCCA 3A8IE 2A68C 4JI4Q 3MFGA 2N3SA 4BBRH 3BZCA 1N9WA 1QE6A 4BY7B 3CCJA 3CCSA 3K0YA 3F2DA 4LF4Q 4DR7L 4UDUC 2QGQA 1HA6A 1XPOA 4BXXH 2KEEA 1HNWQ 2F03A 5IE8A 5IT9L 4A3KB 4BBSG 4HAEA 2RDFA 4NMZA 1SYFA 3NQTA 2JA6H 3MWYW 3PUWA 1YJWA 4LUZA 1NJIC 3H3VC 3CU7A 1W6KA 3BVZA 3SK8A 1XMOQ 3GTQH 2OT2A 1Y14B 5CC4A 3G71A 4A3CG 1B8AA 4JI0Q 3PMFA 1SJED 1JJCB 3PUVA 3PIP3 4DK3C 2J4XA 4KD4A 1VQEA 5EJWA 5J3BA 4A3JG 4K5WA 3D8GA 1WD0A 3HKSA 5DM63 2DY8A 3K7UC 4DV2Q 3DMUA 4Q0FA 1EOTA 3HS0C 2NVYB 2OCEA 2CTKA 2MJ8A 4POGA 4TSSA 4B3MQ 3TP6A 3I91A 4LFCL 2ZJPA 3NBIA 1YJ9A 4R8NA 1TS3A 5IGDA 4G57A 4JYAL 2HQLA 3KJOA 1TVXA 3PO3B 2AUJD 3B6YA 1HNXL 4RAUC 1TS2A 3FRPB 5C4JB 4QQBX 4DF7A 4FXDA 2Y0SB 3OYYA 1ESFA 3PUZA 3S1RH 2FHTA 2OWOA 2K75A 5HGQA 5M3MB 1Y1WB 3S1MH 2XSCA 4F88A 1PH8A 1KNAA 2H1EA 4NB3A 1LUZA 1EU3A 3HKZE 1U5KA 2KCTA 3P75A 1STHA 1HZ9A 5C6AA 5IYCH 4JI3Q 2HT1A 2D2CC 3I4NG 4QMFB 3HOWG 3VA7A 1T5EA 1TT2A 1X56A 4PV1C 2KCMA 1X54A 4GNXB 2R61A 4YY3Q 2K50A 2M00A 5J1ZA 5A35A 2WKCA 2UUBL 1WTPA 2F0EA 3CCQA 4DV7L 4DU9A 4JI8L 1YITA 2WB1G 3Q8DA 3OW7A 1I5FA 1EY9A 4FP5D 1M90C 4B3TQ 4KY5A 3J80L 1Q82C 1IBML 2Q2TA 4J15A 4RMFA 1JWUD 3IKJA 1Z47A 3T56B 1O7LA 1LTGD 3A5ZB 1WFQA 1S5CD 2F0IA 3TQYA 3U1KA 4UP9A 4YCUA 4NKLA 5D3DA 1X9NA 4A3BG 2XWBB 4QCLA 3CAMA 2L11A 3BDOA 1HHVA 4P75A 4O1NA 4GLAC 3SGIA 4H02A 1K83B 2LMCB 4DNRB 3KLSX 1PH7A 2DGRA 1SR3A 1L1OC 1X6OA 3R2IA 1PFNA 1EIHA 2A6EC 1C8CA 1ENAA 1CHQD 5BN5A 1E2WA 3M4QA 1KIXA 5JPMC 3NELA 4A3EG 5G3LF 5I6YA 2BH2A 2ATWA 5LMUL 4DV4L 1VQ5A 3H3VI 2OQ0A 4ABNA 1CKNB 1ET6A 1CTMA 3BJUA 2JYOA 4ZQ3A 3JAMc 2F0JA 2PNHA 4H44C 4A3BB 2EOTA 2KHIA 4R4CA 2F0OA 3I3CA 5IYBG 2ZTDA 3CPWA 4B3SL 3MFYA 2CQOA 4X65L 1CZGA 1ET9A 3MA2B 1SNMA 2Q8TA 4EVOA 2K5WA 4GN4B 1VQBA 1JOKA 3K7AH 5M5YH 3IFTA 4WJ4A 4FDBA 1WOCA 1NMFA 2B2WC 1PH4A 4BS9A 5D14A 4DR2Q 1TS4A 4FO2A 3I90A 1PYSB 1A63A 4NXML 3DWPA 1F9PA 3J7YW 2QF7A 2UUAQ 4OX9L 4K6LA 4FVMA 4WANA 4C2MH 3CD6A 5IP9H 1VCIA 3MC0B 5KYIA 4DR6L 4IJHA 1JC7A 2R6GA 1C4QA 1STEA 1H9SB 1F2MA 2XVSA 4CHTB 5J39A 1TU2B 5JVG3 1GUNA 4EX5A 3GTOH 3QG1A 3BVMA 2F0FA 4N9TA 2EYMA 3PO3G 4DR5L 4LF9Q 3SK6A 1ZKOA 1B50A 3BS1A 1RTNA 2EYLA 4POFA 4R4QA 3IRBA 1VF7A 1IHZA 2CQAA 2NWGA 4CJ1B 1L2FA 2RVLA 2EXDA 1HR0W 1AW7A 1K8OA 3MXPA 2OTJA 4KD3A 2A8VA 4KKUA 3E6ZX 3H09A 1GM5A 2KHSA 5C4HA 3SHLA 1X4NA 2YU9B 4JBKA 4TVAB 3G6JB 1WVNA 3LWEA 2MJHA 1IXRA 2ZTCA 1WTOA 1ENFA 3F1ZA 3M85A 4DK1A 4M1UB 2QEXA 3CW2C 3OW2A 1FD7D 1LT5D 2C5CA 2JP1A 4TQUS 1K83H 1QILA 4GKKQ 3FMCA 4TKOB 1LYLA 3KF8B 2E2HH 1VMPA 5ELBA 5LHY1 3S24A 1PA6A 3RN2A 1SFOH 5DNFA 4HMIA 4ALPA 4KY6A 3CCRA 4DUZQ 4OWTB 4C1NK 1R9TB 4DV0Q 1PTOF 3D31A 1B44D 2R92B 3NEMA 1QUQA 3R8BA 3CMEA 1N32Q 2CTFA 2F3WA 3TEHB 2HCIA 2IT1A 1QZHA 1EQTA 2L12A 1V1OA 3NSWA 1E2ZA 4OIJA 5D3IB 3C3LA 2EZVA 1YNNC 5JPNC 4A76A 5IP7G 2JA8H 5HURA 2VQFQ 2ZT9C 3MXUA 4X3UA 5C44B 4A3IB 3D0FA 4A93B 3C46A 4JK1C 1QZGA 1G91A 1Z6HA 1MI2A 2Z8LA 4XYQA 5IYDG 4ILWA 3JC66 3UE1A 5CYUA 2N55A 3BU2A 4MNOA 3H0GB 5DEHA 3OHXC 4IFDH 3NENA 1E2VA 2RSOA 1E22A 4RGTA 2NB0A 2JQOA 4IUUA 2IW3A 4RA8A 3RR5A 3DXJC 1TWCB 5NUCA 4A3GB 4PMCA 4DR1L 2UXDL 5EKLA 1R4PB 1M1KC 1XTDA 1DJRD 2B2VC 1Y1VB 4A4IA 4HIDA 1J5KA 1V1PA 4OXPA 2A74C 5LMNQ 4XYOA 1J8IA 3A55A 2VNUD 2Q8IB 5I6WA 4DAYB 1L1OB 3NWSA 4DA2A 4HMJA 4K5XA 1NUCA 2N78A 2E76C 5E1FA 3PO2H 1CSPA 5KIXA 1O78A 1H9RA 2WAQB 3A0JA 4L5SA 5I2XA 2R3ZA 4QF4A 5IWAL 1VQ4A 4QUCA 1G6ZA 2CVRA 3KLWA 2YYZA 3QWNA 1TWHH 3PO3H 4P72A 1D5ZC 4LFBL 4WFN3 5K36G 2E2JB 4U68A 1RD9D 3S1RB 3TRZA 3SXHA 4DV0L 4L5QA 1B9MA 1LACA 4C3IH 3GV6A 4KHVA 1YNXA 1BBWA 3G6EA 1DONA 1FJGQ 4OGQC 1T9HA 3DWAA 1PZID 1TWGB 2K04A 4KJNA 2N49A 2F4VQ 3PIO3 5JEAH 1Q1BA 3JAME 1TWAB 2ZM6Q 3W2DA 3BYTB 5I4DA 4LF7L 5M5YB 3DWQA 4GZYC 1A62A 5ELOA 1PXUA 3HOVG 1S3OA 2F0WA 2SNSA 4RH6A 5K5PA 5CBAE 1L1OA 1K8AC 4NXNL 4A3JB 3SR1A 3S14B 1OXVA 2X6GA 4G7OC 5IT9c 2YTYA 2SDFA 1JQYD 1H9JA 3KOJA 1RJTA 5AFWA 1PZJD 1HTPA 3HP3A 5C0XH 1DXMA 3SEBA 3OSOA 5T1IA 2K5DA 3ERSX 1C0AA 2JK8A 2CCZA 3LWUA 2G9HD 5C0XG 2XGTA 3HOYB 4DV6Q 2BA1A 2BA0A 3GTKH 4IUTA 1EY6A 1JCKB 1SYGA 3FKIH 2F4VL 3HEJA 3FEWX 1EEFD 3PV0A 1AE2A 1FNUA 1VQOA 3A7LA 5FOBB 3HOVB 1A0IA 4RGOS 5EPKA 1Q8KA 4CKCA 5CGKA 1N33L 5M5WB 2F0DA 4MZ9A 3VA5A 1V9PA 3VR5A 1HQRD 3S1QH 1YEZA 2A6HC 1XNQL 3CCEA 2VL6A 5BR8Q 4DXGA 2FFKB 1HZCA 5IP9G 3KYHC 3UE0A 4EQPA 5FJ8G 1EUJA 1MSGA 3NPPA 1LT3D 4I7ZC 5CR3A 2F0LA 4FF4A 5C44H 4A3IH 3LX0A 3OIPA 4OO1G 3H3VH 3EQLC 4IZ8A 2CTMA 1G51A 3HKZG 1X3EA 3A74A 1VQFA 2Z6KA 4J1MA 3S15H 3MZ5A 4K2KA 4BY7H 4LUOA 4K0KQ 2H5XA 3SK4A 1TXYA 4HJ5A 5CMDA 1OXUA 3WOEA 1V1QA 4DR1Q 3T1HQ 2E75C 5M5WH 2EY6A 2Z1CA 2JA7B 3CCVA 3DUZA 2UU9L 2B2YA 1EZ6A 3TMEA 4MTNA 3EFXD 2HHHQ 5C5MA 3CC7A 1VQPA 1EFID 4DV5Q 4J6HA 4A3LH 2MHVA 4XQQA 3HOUB 3AFPA 4OX9Q 3I7FA 4X3TA 5F2DA 3T13A 3DEPA 4X66L 2PQAB 1KAAA 1QNKA 1ZXTA 1HH2P 2IY5B 3HKZB 4C56C 2BDNA 2A69D 4WALA 4DV2L 3NUCA 1L0YB 1AZPA 1WTVA 2JA8B 2VUMB 3K57A 1CK1A 3PSIA 4P71A 1HA5A 4DKAC 5IYDH 4DUYL 1SE2A 2AKWB 3ND9A 1HNZQ 4JBMA 2ALYB 3MXNA 3CQZB 4JBJA 1QJOA 2RKSA 1MBYA 5KNCA 1B9NA 4LNQA 1OTCA 2WACA 1JE5A 1SDFA 4WRDA 1IBLL 1X4MA 3CRKC 2IX1A 1BQQT 1D6EC 2R7FA 1Q8IA 5GADC 1II3A 1IBKQ 1EIYB 1A3UA 1YI2A 5C3XA 1BDOA 1U4PA 3P20A 4B3TL 5FLXE 4ZUIA 1XNRL 1WCMG 2EYHA 2K33A 2VQEL 5EPJA 5DM73 1EIGA 4UAIA 4GN5A 1WTQA 2KEDA 2WFWA 1FNVA 1STGA 4A3MB 2YU9H 3Q0AA 4DR6Q 1FJGL 2X6LA 3J7AV 1KABA 2YV5A 5GQOA 5C5LA 3R2TA 2JJQA 2VQFL 2UUAL 1SYBA 1TS5A 3QOLA 4X64Q 2F0KA 1VQAA 4YWKA 3DLLA 5JEAJ 4OWXB 2I5MX 2OTLA 2LKVA 2UU9Q 4RKBA 3S17H 3VDYA 3BVGA 1G8ZD 1J5EQ 2RCNA 4JI3L 5FK9C 4V190 1VQCA 2EY1A 2JA6G 2NN6I 2D62A 2IX3A 3RLOA 1J5EL 1BUVT 1FNWA 3GTMH 1S4ZA 3V05A 2OPUA 1PFSA 3AEVA 4R4IA 1DOLA 2NZHA 1LTRD 3AU7A 1PZKD 4F8MA 4A3MH 4XDXA 3G48A 1SROA 2FJ2A 2QDBA 2PQAA 4A3LG 4JVYA 1KHIA 1DD2A 2PI2A 1OXSC 1SN8A 4DV4Q 2J7ZA 1GUGA 3N52A 4GKKL 2V1CC 5BN3A 2F3VA 2DNCA 4IPCA 2B63H 2HHHL 1N33Q 1I3QH 2KHJA 1I50B 4L63B 4IUPA 3S2HB 1SLJA 2QCPX 1YHBA 1EWCA 4JI2Q 3M3YB 2HDLA 1VQ8A 4QMGA 4ZKBB 1PFMA 5E4WC 4PMWA 3A8JE 4ZKCB 2DUDA 2K4KA 4FF2A 4C1NI 5JAVA 4BBRB 2HIXA 5EBCA 5IGEA 1ML0D 3OPOA 3K5MA 3KF6A 2JA7H 5M5XB 4YHHL 2A5HA 2H4OA 3OMCA 2AUKA 1F9RA 5IP7H 4YHHQ 1H9MA 4JI0L 1TKWB 1RHPA 3AYHB 3VR3A 2BE5C 1CFMA 3MTSA 4L5TA 1S72A 2PW5A 4B9XA 4HCSA 2OEOA 2D5DA 5CV5A 4DAVA 5C4XB 3HOXH 2B63B 4PZ8A 4OO1H 1X3GA 3K8AA 2J0TD 4A75A 1I4GA 1H9KA 2QA4A 5EKIA 1GXDC 3GTGH 4ZLTF 5JJIA 1EL0A 2HDMA 4A3EB 4KHPL 2D0PA 4EQNA 4IUVA 2E2IB 3OTOL 4N9PA 1QNUA 2A6HD 1UNSA 2BH8A 1QVFA 4DV5L 4RCOA 2MUYA 3CQZH 4DR2L 3JAML 4EQOA 3IFDA 3TS0A 1A15A 1DYQA 3GD7A 3Q6SA 2CWPA 2JA8G 1K8GA 4DAYA 3VYRA 1SMYD 5AJ3Q 2PZTA 4K0KL 2ZJRA 4HIMA 4DXFA 5ELEA 4CJ2C 3EIVA 1SMYC 3K0XA 1BVSA 1L0XB 3O13A 4XXEA 5C4JH 1E1TA 4GKJL 1ZYRD 5M9OA 3EN2A 3C1EA 5KNDA 1RCVD 3UDFA 5IGFA 1PH2A 3T4AC 1TWAH 4DV3L 1PYBA 1LTTD 3L9AX 3S1MB 1Y1WH 1DCZA 3GTMB 5EBDA 2I5HA 1LTSD 3UDIA 2PCFB 4UPAA 1WYDA 4KI0A 1SNQA 2LXKA 1RIPA 4WORA 5T1GA 2EY5A 1AE3A 2HH2A 4JI5Q 1YIJA 1STYA 2JA5B 2WAQG 2K01A 3ITPA 1WVLA 4OWWB 2ES2A 3E9IA 1V43A 1V8QA 3RLNA 3DEOA 2PQEA 2FMRA 1D2BA 4LJZC 1D1IA 2E2JH 3GV3A 3ER0A 3S2DH 4H7BA 2CW0C 4Z9CB 1IL2A 3HOWH 1SEBD 1TY2A 2K5NA 1FR3A 4YWMA 3TP8A 4QIWE 2Q2HA 3PIPA 1I50H 4GOPB 4DR3L 3N6RA 1C48A 2CTLA 1U0LA 1DOKA 4C3HG 1AZQA 2L55A 3S9WA 1VMCA 4HSPA 2GVAA 1Q7YC 3K7AB 3J81E 3F8TA 5C0XI 1Z9FA 1UE7A 1JWMD 3V96A 2MPMA 3MXNB 3CRLC 4IALA 2LSSA 4GNXA 1BCPC 2NN6G 4KY7A 1CZWA 2B29A 1SYDA 3HRZC 4HJ8A 1W2BA 2NVTH 4A3EH 3R3OA 1WCMH 4LFAQ 3T1HL 2F3IA 1CUKA 2Z6KC 3CPFA 1D7QA 4IFDG 2KA7A 4RGMA 3HOXG 3QB3A 3Q23A 3GTLH 4X6AH 1IBKL 1DTJA 4DAMA 5C4XH 2EE1A 2Q8RE 1WE8A 2A1AA 2O5IC 3ZJYC 1KQSA 1XWEA 2EDGA 4AM3A 1YHQA 1PH9A 1EY4A 5IGBA 2OPVA 3I8ZA 2NZOA 4A3BH 3VYTA 3K81C 4P2CB 4IN3A 1S5FD 5DLQE 5CORA 3HOZB 1B53A 3A8KE 4KJOA 4RFBA 3BZDB 2RBMA 1PMRA 2K7VA 2R7ZB 3D3RA 1J4WA 1JWSD 5KYLA 3ULJA 3DM1A 3ND8A 4C3HH 1VF5C 4JI7L 4AQYQ 1Y8NB 2B2TA 1EIFA 2MGSA 4JI7Q 1J6QA 1QCBD 4C3JG 2QEJC 3W3AA 3E9HA 2MFIA 2WAQE 4YIJA 1ENCA 1WI5A 1EYDA 1Y1VG 1LTAD 5D65A 3S15B 4DV1Q 3X3MA 2E8GA 2KECA 2EPBA 1AEXA 3LNNA 4NXMQ 3HOUG 4RKLA 1SFOB 4CJ0B 1YVCA 1VQ7A 5FJ8H 4DK6C 1FGUA 1JB7A 4KV6A 5FKAC 1CKNA 1GUOA 5M3MH 1VQHA 2RA4A 5CV8A 1G291 4L6TB 3Q22A 2BCOA 4NBQA 4K8JA 4C2MB 3FDTA 2VB3X 3S14H 2DY7A 3KF6B 4JV5L 4JVHA 1C7YA 2VUMH 5ISRA 4IOCA 1AH9A 3FKIG 1D1KA 3GTOB 1XNQQ 4GN3B 3HZXA 5LMUQ 4JI5L 2Y0SG 3J81j 5J22A 1HUNA 1SRUA 3D4WA 4JI1L 3T1YL 1N36L 3GO5A 5EPLA 1I4PA 4XT3B 4FXKC 1IKMA 3J80E 1BO0A 3CXCA 1D5XC 1T5XD 2UXCQ 1CA5A 2ZJQA 3K59A 4F87A 3UDGA 2F4IA 3T53B 2IHFA 2ICIA 5H1SE 3KDFA 2B2UA 3KLRA 4AIMA 2XRQD 2XWJB 1HRJA 2L1BA 4A3FB 3E5SA 3STBC 4A3CH 3K6OA 2I0QA 5IOCA 1DZ1A 1AFPA 4JCVE 4G7HC 3RMHA 4LUVA 1HZAA 5I2YA 1E24A 4B8TA 4ZRZA 1EY7A 2AXYA 3GQBA 3KLSA 4BBSH 4LF6L 2L5TA 1BR9A 4ULLA 4QY7A 4DR5Q 4LF9L 1BOSA 2E5LL 5FO7B 4JI6Q 4JI1Q 1N36Q 4RCNA 3ERQA 1XNRQ 4R9WA 1YZ6A 4BWGB 3TZUA 3OTOQ 1PHJA 3PF5A 3BG3A 4IFDI 1IZ6A 1TWHB 4J8QA 4Q5VA 5CBEE 4A3FG 2R93B 3TZDA 4Y52H 3A54A 4B3RL 2PMZE 2AQ3B 2MO0A 4YY3L 1B7YB 4KTAA 3HOXB 4IUQA 3H0GH 2UUCQ 1BBUA 1U4MA 4QUFA 1G6PA 4LF8L 1F2ZA 4DN4M 4IURA 4XQNA 1HNZL 3W1BA 2R7ZH 1DGSA 4HN7A 3KF8A 1A8VA 2NZ1D 2BE5D 4DNIA 5FLMG 1I4HA 2E2IH 3DHQA 1IBMQ 4S3SA 3NK9A 3EVQA 2IJ0A 5ELCA 3TBIB 3CHBD 1NR4A 1K73C 4ZAIA 4B3SQ 2NUCA 1VQIA 4IPHA 1TWFB 1ZYRC 1QG7A 1HXYD 3A56A 3FPPA 3M9BA 1N8RC 3K5OA 1WTWA 1D5MC 1QUQB 1WJJA 4JI6L 5IIFA 4OIKA 1Q81C 1NE3A 4BY1G 3CC4A 3NE5B 2Y0SE 1UAPA 4AQYL 1VQGA 3S1NB 4OO1I 1UE6A 1Q86C 3CKIB 4NP5A 5IYCG 4K2LA 4C3IB 2K1BA 1XX8A 2WB1B 1A2UA 5A2QL 1B70B 3CC2A 3MAQA 3SE0A 1EWIA 3I4MH 4QJFA 1I4QA 3H0GG 1AP0A 2XTIA 3NTHA 1CA6A 2K03A 3RZDB 1B1ZA 1CHPD 1RDPD 4HIOA 1PH6A 3K80C 3TS2A 3C1FA 4HJ7A 2D0OA 4BY7G 4DK0A 1IYJB 4IJLA 1N32L 4QIWB 1BCPF 1Y69U 4JBWA 4BY1B 5BR8L 2YQRA 1UEBA 3MEHA 2G9DA 4JI2L 2CKZB 4O42A 2ZXPA 2NVXH 2KOLA 4JG2A 2TMPA 4X3KA 1HNWL 5JJKA 1XMQL 2RF4A 2PYKA 2K52A 1Y8OB 3S16H 4LW1A 4A3MG 1VQJA 2O2LD 2PMZB 2BL5A 2CWAA 1YNJC 1SNPA 1RTOA 3FP9A 3GTKB 2BOSA 4IPDA 4JI4L 3KBXA 1N34L 3W1GA 4GKJQ 2F0VA 1SNCA 4G7ZC 1ILPA 2K5VA 2SOBA 1X32A 4MIUA 1WTRA 2DNEA 1UE1A 2JA6B 3X3NA 2PI2E 2OQKA 1U4RA 4RG1A 5AJ3L 1MJEA 3PO2G 1HPCA 1SYEA 1JICA 1I6HH 3F2BA 1QB5D 5C3EB 2NVTB 4DUZL 3IAYA 4IPGA 4FNFA 1X65A 2EJMA 5IGCA 2Z4HA 4X64L 5LMNW 4DUYQ 1MIUA 2K32A 4L8JA 3U50C 4DV1L 1B3AA 2TSSA 4OONA 2B3GA 4ME3A 2E74C 2YTXA 2K14A 4DFAA 3ULLA 1JMCA 1CI3M 4A3KH 1UWVA 1PRTD 4ZUJA 5FO8B 4ID6A 4G4KA 2HUGA 3J80i 2VQEQ 1STNA 2IPKD 1ZZKA 1KDBA 4GLXA 3K5NA 3E0EA 5JJZA 2UXBL 2C35B 3I56A 2WP8J 1NY4A 1TUAA 2EYFA 1GO3E 2R93G 1EOVA 1KXLA 2IWHA 1ICWA 3VR4A 2NVQB 3V2TA 4A3DG 4IO9A 3RZOH 4NDXA 4BA1I 5M3FG 4C3HB 3J7AF 2F0TA 1EU4A 1A2TA 3I4OA 1CQVA 5LMNL 2NYZD 1JT8A 2JZXA 4GOPA 1XPRA 5E7NA 1Y1VH 4K5VA 1MSHA 3NTKA 4UP8A 3H6MA 2AWNA 1S5DD 1I94Q 2K05A 2EYJA 1EY5A 4O2DA 4DV7Q