4IFDG

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
236
structure length
236
Chain Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKSGVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 50
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ifdG01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ifdG02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4ifdG03
2R93H 1YZ6A 1RIPA 1O7IA 4GNXC 3CCQA 4DV7Q 3RZOH 2WB1G 4JI4Q 1NMGA 1LUZA 1L0WA 4YWLA 1B7YB 4OGQC 5C44H 4Y7NH 1UE7A 4LF7L 4IO9A 4OO1I 1OXSC 1JJ2A 4DR6L 3UDGA 3HKZG 4UPAA 1FJGL 1K0RA 1ZYRC 1XPOA 2AWOA 3CPFA 1VIHA 2MFIA 4A3IH 4G7OC 4LFAQ 4LF6Q 4GZYC 4POFA 4B3RL 2HQLA 2Q2IA 1VIGA 1XTDA 1XPUA 3J81i 5KNCA 4XTCS 3S24A 4JI3Q 2QNDA 1NY4A 3PUZA 5IP9G 3TRZA 4BBRG 1Q8KA 2WB1E 4L8JA 1KXLA 1LM0A 3HOZG 1CTMA 1G6PA 3PIPA 1L2FA 2JA5H 3WWVA 2UXDL 4LJZC 3BDOA 3HKZE 2D0OA 2OCEA 4GN4B 4LFBL 5C4XG 2CCZA 3CD6A 4B3SQ 1VDZA 4A3KG 4A3GH 2E75C 1Y8PB 4P72A 3T1HL 3EBEA 3VR5A 1ZTGA 4DR4L 1OXVA 1HR0W 3KJPA 4BA1I 3EIVA 1ZZJA 3BG3A 1AE3A 1NTGA 1VS0A 3M4OH 3ER0A 5E7NA 4JBJA 3NENA 2JA9A 2HHHL 5FLMG 4DUYQ 4JK1C 4JG2A 5C44G 3CPWA 2OQ0A 2GN5A 3EN2A 3FKIH 1VQ4A 2MO1A 4DV1Q 4P71A 2N3SA 4JI8L 5IE8A 4EQ5A 4APVA 4GKKL 4P74A 4GLXA 4A3JH 3A8JE 2N78A 1XMQQ 1X56A 2IX1A 1PH9A 2BA0A 2CTEA 4NPSA 3CCEA 4A4IA 5ELOA 2O5IC 4DUZL 1SE8A 2IHEA 1Y8NB 2FMRA 1YJ9A 2B63G 3CC2A 1OXTA 4C3JH 1H9MA 3KJOA 3M4YA 3EQLC 4IPCA 4DV0Q 2ASBA 2JA6H 3T56B 3K80C 1N36L 2B29A 3OW7A 1VQ9A 1I6HH 1Y69U 3CCVA 1QZGA 2AWNA 1K9MC 2OTJA 1PYBA 2NN6G 5JEAJ 1WVNA 3E0EA 3W1BA 1OTCA 1Y1VG 1IYJB 1I94Q 5BR8L 2GVBA 4HJ7A 3RLNA 1E2VA 3K0XA 3PO2H 4JOIA 2VQFL 5KNDA 1L1OA 1NMFA 5JEAG 1JE5A 1B8AA 2UUBL 1GO3E 2VS1A 4B3ML 2E2JH 4NXNQ 1VQCA 1IBLL 1N9WA 2ANRA 2A69C 1K1GA 5KNBA 3PF5A 5M3MH 4A3FG 2A68D 4JI2Q 1VQNA 2A68C 1DXMA 2DGYA 3S16H 2KCMA 4B3TL 1LACA 4TQUS 3OTOQ 1IBML 2Y0SE 2AUKA 1UEBA 3PIOA 4LF9Q 4GLVB 3GTJH 5J3BA 5LMNL 4DV4L 3A8IE 2YYZA 1TKWB 4A3CH 4MNOA 4HIKA 1DTJA 1U5KA 1H95A 3M4PA 1YNXA 3GD7A 3H94A 2MNAA 5GADC 1AE2A 4K0KQ 1X54A 2R92G 3A8KE 3T53B 2EJMA 1D8LA 1SRUA 2ZTCA 1PH4A 4JCVE 1EC6A 3AYHB 3J80i 2IX0A 4OX9Q 4DK0A 4DNRB 1VQAA 4EX5A 2E3UA 5BN5A 3G48A 4A3MG 3CRLC 1KHMA 2XTIA 3U4VA 1XMOQ 2A19A 3KF6B 2PCFB 5HY6A 2PQAB 4TVAB 1H9RA 2BL5A 2L5TA 2I5HA 1SFOH 4DV5L 1BKBA 5C0XH 5M3FG 4DV2Q 3K7AH 1A6XA 1Z47A 3PV0A 3PSIA 2ZM6L 2K32A 2JK8A 4JOIC 1IXRA 2Z6KA 4A3DH 1Q7YC 1XNRL 1V9PA 1L1OC 2CWPA 3VA7A 4KHZA 3DLLA 1IBKL 1VQ7A 3HOWH 4JI5Q 4HJ8A 2N49A 1L1OB 2ZTEA 4JI6L 1PHJA 3F2BA 4IFDJ 4KHPL 1B9NA 5IWAL 1CSQA 1WCMG 1EWIA 2VL6A 2UXCL 3QG1A 1X3GA 1GUSA 3N6RA 4AH6A 3F1ZA 1HNZQ 3L0OA 4A3EG 3UDXA 2PI2A 4J15A 1K73C 3GQBA 2PNHA 2XGTA 1YHAA 2JA8G 4GOPC 2RHSB 4RMFA 4H13C 1GUGA 1YNNC 3OYYA 1PH6A 4X64L 4NB3A 3MFYA 4KKUA 2KENA 2KCCA 4IPDA 1XJVA 3NEMA 3I55A 2YU9H 3A0JA 2ID0A 4LUZA 1HNWL 3UDIA 4P75A 5JJIA 1FJGQ 1I50H 4DR5L 4JI0Q 2C35B 1FVIA 3JAMi 1FR3A 2R7FA 2JA7G 1CKOA 4JI7L 3HOZH 1S3OA 1YEZA 5IP7H 2BDOA 3HOXG 4DK3C 4B3RQ 4KN4C 3CP0A 3I73A 1EQQA 3CAMA 5C0XG 2GVAA 3HOVG 1P8LA 2CTLA 5C4XH 1VQ5A 5LMUL 4A3KH 1HCZA 1T5EA 3GTKH 4WJ3M 1HR0L 2Z6KC 1H9SA 3HOWG 2PPBC 4RG1A 1WI5A 5C3EG 4R4OA 3VR4A 2WP8J 4LF4L 3BJUA 1MKHA 3HOYG 2UXDQ 4KLKA 1VF5C 4UP8A 5BN3A 4YWMA 5FLMH 2A6HC 4LFBQ 3ZJYC 1LABA 4GNXB 5IYBG 2QA4A 2L15A 1EFWA 4BY7G 4YHHQ 3T1HQ 1PH3A 1XNQL 1ONLA 1V1QA 3I56A 2OTLA 4WJ4A 1I6VC 3QIAA 4DR4Q 1VF7A 2Q2TA 3S14H 1PVOA 2CTKA 3HOUG 2BH8A 3IFTA 1I5FA 2K4KA 3VR2A 1VQHA 4JV5L 1IYUA 4A76A 4IOCA 3I4NG 4H0LC 2ATWA 3ND8A 2E2HH 1N34L 2B63H 4JI8Q 1Q82C 2AXYA 3W3AA 3GTQH 1YI2A 2ZT9C 2HT1A 1J6QA 1E7ZA 4GKKQ 3S1NH 1PH7A 5ELNA 5IP7G 1DCZA 2CTMA 1CKNA 1X4MA 3H3VH 2EQSA 4LF8L 3S2HH 3TZUA 5JJLA 4YY3L 4DUZQ 1KHIA 1XPRA 3RR5A 3DM3A 2F4VL 2VUMG 1QVFA 5DLQE 2NN6H 3E9IA 2V1CC 1ZKOA 2D5DA 1Y1VH 2K52A 2AHOB 4NXML 4GN5A 3F2CA 1K8GA 3RN2A 1X65A 1G51A 5AJ3Q 1VQMA 3CMEA 5JEAH 3K8AA 1Q90A 1PH8A 4GS3A 3CCUA 4PMWA 2H5XA 3W1GA 4QL5A 1YIJA 1D7QA 2KHJA 4A75A 4A3FH 2JJQA 4LFAL 5BR8Q 3G4SA 3T1YQ 1V43A 3I4LA 2OQKA 2VQFQ 4DV6L 4R4CA 3GTLH 3HKSA 4DR3L 1WYDA 4R4QA 2JEBI 2UUBQ 3VDYA 1CFMA 3I2ZA 4R1JA 4B3MQ 1OXUA 1X9NA 4L5TA 3CXCA 1VQBA 5C0XI 3PUWA 3CMAA 1T9HA 2YTYA 4AYBG 2K33A 1A62A 3FPPA 1S40A 4QJFA 4BA2I 2R92H 1VCIA 2NVXH 4B3TQ 3A74A 2RCNA 3SDZA 4G7HC 1E3PA 1IBMQ 4HIMA 1N33L 1S72A 2MQHA 2ZJPA 3K81C 2B8GA 1WE8A 4DV4Q 4X6AH 4LUVA 1O7LA 4A3MH 5HGQA 1GHKA 4Y52H 1W2BA 2UUCL 4OWXB 1HQMC 1VQJA 4X62Q 4B8TA 1CKNB 1HPCA 1VQPA 1B9MA 1Q46A 3S17H 4P73A 1FYCA 1ASZA 2WFWA 5M3FH 4A93G 1A63A 4IJHA 2K5NA 2E5LL 3CC4A 4PV1C 3PCOB 4GN3B 2AMCB 4GLAC 1E2ZA 4DV1L 4TKOB 3AEVA 1Q81C 2PI2E 3GTPH 4XIGS 2YTXA 2CW0C 2LXKA 2A69D 2R7ZG 1PYSB 2I5LX 4DV5Q 1XMQL 2D62A 2QGQA 2D0PA 3G6EA 1I3QH 2NZOA 2R7DA 1CKMA 2EIFA 4QQBX 4R4IA 1J5EL 3U4ZA 1LTLA 1WCMH 4OXPA 3I4OA 1E22A 1XNRQ 3TQYA 2LSSA 4DR7L 4IFDH 3J81c 1IBKQ 1P16A 4DV0L 3LNNA 4AQYL 1E1OA 4YCUA 4A3EH 4GOPA 4YCVA 3D31A 1NJIC 4LNQA 2UXBQ 1DT4A 1HZ9A 2JA8H 4IJLA 2Q2UA 4KHPQ 2IHFA 2EJGC 3P20A 3M3YH 4KMUC 2E2IH 3PO3G 3KDFA 2LXJA 1TWGH 5FJ8H 4LK1C 1YVCA 1I94L 4PZ8A 2JA7H 3H0GG 4OO1G 4C3HH 1GKHA 3FP9A 1TWCH 3MEFA 3GTOH 4KN7C 1E2WA 1UE1A 4LWCA 3PUXA 1FGUA 3HOXH 2VNUD 5M5WH 3W5OA 3VR3A 5EAYA 1G291 3KYHC 4DR1L 2AUJD 3B6YA 4X64Q 4HJAA 3HOVH 2JEAI 3NE5B 1WJJA 1U0LA 3TEHB 4L5SA 3CCMA 4AM3A 4UP9A 3TREA 1HNWQ 2UU9L 5BN4A 4O0AA 4BY1H 4DR2L 4DR5Q 2K14A 1VQIA 4JBMA 5C3EH 3ND9A 2CTFA 2NVTH 4HIOA 3OTOL 3NELA 3HOYH 4ME3A 3AEVB 2CFMA 2I5MX 2VZAA 5GQOA 1M90C 3M9BA 1N32L 5IYBH 3CF5A 1AH9A 1EWHA 5LMUQ 2FXQA 4BY7H 1HR0Q 4X65L 3F2DA 4IFDG 1TUAA 1TU2B 4LF5L 3H15A 4DV3L 1WFQA 3H3VI 3M7NA 3BZCA 3HOUH 4LF4Q 4PG3A 1X3EA 4ALPA 2E8GA 5GROA 2Q2HA 4JI1L 1K8OA 3G71A 1TXYA 2NN6I 3I4NH 2B8FA 1HZCA 1HNXL 4LF7Q 4GOPB 2JXMB 1JB7A 3I4MG 1XNQQ 4DR6Q 4HR7B 5K36G 5FJ8G 3PUYA 1HH2P 1JT8A 4GKJL 3VR6A 4MTNA 2VQEL 2P2RA 1UE5A 4QMFB 2KCTA 1YBYA 3KDFB 1Z7TA 5IT9c 3J81j 4KKSA 1WOCA 1EYGA 2YV5A 3RNUA 4JI5L 3K7UC 4AIMA 1N34Q 2VUMH 2RF4A 4JYAL 3STBD 2E76C 1MJCA 3STBC 4L5RC 1VQ6A 1SMXA 2ES2A 4BY1G 2HIXA 2NZHA 2HH2A 4QGUA 1GVPA 3KFUA 3RLFA 1Q12A 2EJFC 1Q1EA 3RZDH 4LF8Q 5FLXc 1VQEA 1A8VA 2UUAL 4O2DA 2A6HD 1VQLA 4IPHA 1YHBA 1HNZL 2F4VQ 1PV4A 2B3GA 3CCRA 4JVHA 2BH2A 1HJPA 4A3BG 1PH1A 2CWAA 4X66L 3IKJA 1ASYA 4NXMQ 2O5JC 4JVYA 3CW2C 2DNCA 1E1TA 3I72A 3SGIA 3TS0A 1Z9FA 1KL9A 2HHHQ 4DK1A 1Y1WG 4LFCL 4JI0L 2D2CC 2AKWB 1VQGA 3UDFA 3ULPA 3J80c 4H02A 4DPGA 2DNEA 4DK6C 3CRKC 2EXDA 4NBQA 1GM5A 4DV6Q 4JBKA 3MXNB 4KI0A 1LYLA 2JQOA 4DR3Q 3LWUA 4YWKA 1EIYB 1QUQA 1K3RA 3M4QA 4LW1A 2BA1A 5IYDG 3I7FA 1GUNA 3CQZH 1QVCA 1BBUA 5JJKA 1EOVA 4DV7L 2OPVA 4DNIA 4A93H 4JI4L 3M85A 4C3IH 2CTJA 4PZ6A 2ZJQA 1O78A 4IFDI 1GUTA 4C2MH 1VQ8A 4OWWB 1N33Q 4A3LH 3JC66 1N36Q 2DN8A 4DKAC 4YHHL 1KRSA 2OPUA 3A7AB 1BDOA 4HIDA 1H9SB 1GHJA 3IRBA 1SN8A 2R7ZH 4L5QA 1V8QA 1X55A 2R93G 2UUCQ 1IYVA 5IYCH 4FDBA 3S2DH 2ZTDA 2F1MA 2A6ED 4LF6L 2A6EC 2E5LQ 5GAHC 1MJEA 1PH2A 1IZ6A 1UE6A 1TWHH 1KRTA 1M1KC 1KC8C 4JI3L 3ULJA 2QF7A 1KQSA 2LMCB 1YJNA 1N8RC 3BZKA 1CI3M 1SMYC 3A7LA 1B70B 1K8AC 3LGJA 4HJ9A 1IBLQ 4DAMA 1VQKA 4OWTB 3S15H 1BBWA 3CCSA 1Q1BA 5M5YH 3HFZB 3AFPA 4A3IG 3PGZA 5C4JH 2F3IA 3A5ZB 3JAMc 1C9OA 2VY3A 3FHWA 3PF4A 2KA7A 3J7A5 1J5EQ 1RL2A 1GJXA 2CKZB 4B3SL 3AB9A 1YNJC 3KOJA 4DR7Q 3KLRA 3PO3H 3D4RA 1SR3A 5LMNQ 1X6OA 4AQYQ 2MO0A 1J5KA 3MXUA 3H0GH 4OO1H 3KF6A 1QZHA 1KAWA 5AJ3L 2PQAA 2K7VA 3UE1A 4WALA 2JA5G 5GAGC 3S1RH 2K50A 2E74C 2JVZA 1QUQB 3GTMH 4DUYL 3PUVA 1A0IA 2Y0SG 4KKTA 1GUOA 4JBWA 1NBWA 4A3LG 4A3GG 1Y14B 5A35A 2DUDA 4LIJA 4AYBE 3CC7A 1JJCB 1ZZKA 3T1YL 1YITA 2I0QA 1QVGA 5M5XH 3TS2A 1K83H 5IYCG 2JZXA 1MIUA 3VKEA 4DR1Q 3L7ZC 3GDEA 4RCNA 3S1QH 2ZM6Q 4UP7A 2HH3A 3FKIG 4I7ZC 4QIWE 5IY0A 1PH5A 2K5VA 2UU9Q 1VQDA 3RLOA 1YJWA 4DR2Q 1H9KA 1W3SA 2A8VA 4A3JG 4JI6Q 1CSPA 4BBSH 2YQRA 1BVSA 4MZ9A 3S1MH 1N32Q 4BXXH 5IWAQ 4H44C 2VW9A 4IOAA 3I4MH 4LUOA 4X62L 3ERSX 2PY9A 4X65Q 2UXCQ 1DD2A 5K36H 4LF5Q 4DV3Q 2NVYH 1Z6HA 1KD1C 3HGBA 1TWFH 4UY8C 2JA6G 3U9SA 1GD7A 4IPGA 3D0FA 1VQOA 1EUJA 4JI1Q 2Z0SA 3AFQA 3J7ZC 4DNTB 3SE0A 3L2PA 1H9JA 4NXNL 3OPOA 1HNXQ 2IY5B 3KLWA 1VQFA 1QJOA 3GO5A 1NE3A 4JI2L 3E9HA 2MJHA 2EDGA 1DGSA 1SROA 3A5UA 1EQRA 4GKJQ 5GAEC 2KHIA 3ICEA 2VQEQ 4HJ5A 1PFSA 1KIXA 4JI7Q 3PO2G 1ZZIA 2F52A 2CPQA 3T51B 2YTVA 3KF8B 4LF9L 2ANNA 3NBHB 3WDNA 2QEXA 4R4TA 2PNRC 1C7YA 4GNXA 1JJGA 1PMRA 1K8MA 4JYAQ 4POGA 3OOCA 3BU2A 5H1SE 1IL2A 1X4NA 2UXBL 5M3MG 4A3BH 1R9TH 3V69A 4K0KL 1HZAA 1Q86C 2WAQG 1SLJA 1HZBA 1UWVA 1IW7D 2PMZE 2IT1A 1IW7C 3QJYA 4BBSG 2UUAQ 4OX9L 1Y1WH 4QY7A 4BXXG 5LMNW 3CCLA 2JE6I 4A3CG 1EIFA 1XMOL 3GTGH 3DXJC 1HTPA 4X66Q 3OW2A 3ULLA 2K75A 2CQOA 1OXXK 3UE0A 2NVQH 4DV2L 3U50C 1TWAH 2BE5D 2K5HA 2BE5C 4PZ7A 3CCJA 4OONA 1C0AA 3RN5A 3F8TA 2OWOA 4JV5Q 5IP9H 1E24A 4BBRH 4G7ZC 2V4DA 5C0XJ 4LFCQ 4IQZA 5IYDH 2PQUA 2WAQE 2DGRA 1CUKA 4DAYB 2N8NA 3U58A 4YCWA 1YHQA 2Q8IB 2RHQB 3Q8DA 1J4WA 1Y8OB 1FL0A 1PA6A 2EVBA 1X3FA 2KBNA 4WANA 4JC0A 2HIVA 2ZJRA 2R6GA 4A3DG 3FMCA 2A1AA 2ALYB 4YY3Q 3AQQA 1JMCA 3U1KA
chains in the Genus database with same CATH superfamily
4XT3B 1XMQH 4B9WA 2R93H 1YZ6A 1RIPA 1O7IA 3GABA 4GNXC 1EFID 3CCQA 2DY7A 4DV7Q 2XNAC 2WB1G 3RZOH 5C44B 4JI4Q 1NMGA 1LUZA 1L0WA 4YWLA 4OL7A 1B7YB 4OGQC 3I91A 1RHPA 4Y7NH 5C44H 5CV6A 4DR7H 1UE7A 4LF7L 4IO9A 4C1NI 5F2DA 2F0LA 1IKLA 4OO1I 4DV0H 1OXSC 1PZID 1JJ2A 4DR6L 3S14B 3UDGA 3HKZG 4UPAA 1FJGL 4G08A 1ZYRD 1I4GA 1K0RA 1ZYRC 1XPOA 2AWOA 4K5WA 3CPFA 1TY0A 4G57A 3P75A 1A3UA 3AMUA 3GP7A 1VIHA 2MFIA 4RHRA 4A3IH 4G7OC 4LFAQ 4LF6Q 4POFA 4GZYC 4B3RL 2HQLA 2Q2IA 3EVQA 4L63B 1VIGA 1U4MA 3DUZA 1XTDA 2E2HB 2F0KA 1XPUA 3QO2A 3HRZC 3J81i 5KYLA 2B63B 5KNCA 4LMQD 4XTCS 3S24A 3J81L 1TIID 5IGFA 3GTQB 1V8CA 4JI3Q 3DEOA 1NY4A 2QNDA 3SVMA 4DGZA 1I94H 3PUZA 5FK9C 5IP9G 1FD7D 3TRZA 4H7BA 3V05A 5E4WC 4BBRG 4DXFA 3S1NB 1Q8KA 2ICEC 2AQ3B 2WB1E 1V9NA 1SNQA 4L8JA 1KXLA 1D5XC 1LM0A 3HOZG 1B53A 1FNUA 4KY5A 1CTMA 3EZJA 3JAMW 1G6PA 1TQOA 3PIPA 3S2HB 4DR1H 1L2FA 2JA5H 3WWVA 2UXDL 5ELDA 4NXNH 2CQAA 1JWUD 3QWNA 4LJZC 3BDOA 5C5MA 3HKZE 2D0OA 2OCEA 4GN4B 5J22A 1I4PA 3DWAA 4LFBL 5C4XG 2UU9H 2CCZA 1SBBB 3CD6A 4B3SQ 1KLUD 1Y1VB 1VDZA 4A3KG 3NQTA 4A3GH 2E75C 1Y8PB 4P72A 2JN4A 4FVMA 1X32A 3T1HL 3EBEA 3PQIA 3VR5A 2PT7G 3VYRA 1ESRA 2CWHA 1ZTGA 4DR4L 1OXVA 1HR0W 3OTOH 5ELFA 3KJPA 2G9DA 3EIVA 4BA1I 1ZZJA 3BG3A 1AE3A 1NTGA 1VS0A 4LF9H 3M4OH 3ER0A 1BCPD 3MTSA 5E7NA 1BCPC 5CR3A 5G3LD 4JBJA 5CV9A 3NENA 3D4WA 5CBAE 3J7AF 2JA9A 4K14A 2HHHL 5FLMG 1PDQA 4DUYQ 4JK1C 4JG2A 5C44G 3CPWA 3BZDB 4A3FB 2OQ0A 2GN5A 3EN2A 3FKIH 4X65H 1VQ4A 5JVH3 1S5ED 4LF5H 2MO1A 4DV1Q 4P71A 4UAIA 4K0KH 2N3SA 4JI8L 5IE8A 4S3SA 1A3TA 4FF1A 3T16A 3GTLB 2K28A 2XWJB 5D65A 3NTHA 2X6LA 4EQ5A 5DAUA 4APVA 4GKKL 5IODA 4P74A 4GLXA 1ENFA 3FRPB 4A3JH 3A8JE 1I4QA 1VMPA 1HRJA 2N78A 1WVLA 1XMQQ 4OX9H 1X56A 1SYBA 2IX1A 1D1IA 2BA0A 3NP8A 1QG7A 3DWPA 1PH9A 2KECA 4ZAIA 2CTEA 4NPSA 4DA2A 1XMOH 1LTAD 3CCEA 4A4IA 1B1ZA 5ELOA 2EY2A 2O5IC 4DUZL 1SE8A 4EQNA 2IHEA 1Y8NB 2FMRA 1YJ9A 2B63G 2MP1A 3CC2A 4DV2H 1OXTA 4C3JH 1H9MA 3KJOA 3R2IA 3M4YA 1S5DD 3X3MA 2XSCA 2NVXB 2VQEH 3EQLC 4IPCA 4DV0Q 4XYOA 4FNFA 4HMJA 2ASBA 2LTMA 2JA6H 3T56B 1LTID 1JOQA 3K80C 1SXTA 1HQRD 1ET9A 4A3MB 2B29A 1N36L 1EYDA 2LS01 4JI5H 5FLXE 2FHTA 1WTQA 3MXGA 3OW7A 1EEFD 3SXHA 1VQ9A 1Y69U 1I6HH 3CCVA 1QZGA 2RDHA 2AWNA 1K9MC 3S17B 1HHVA 2OTJA 3DM1A 5M3FB 1PYBA 1S5CD 2NN6G 1G91A 2ZXPA 5JEAJ 3E0EA 3W1BA 1WVNA 1OTCA 5CV5A 1Y1VG 1IYJB 3PO2B 1I94Q 4DAVA 5BR8L 1SNDA 2GVBA 1X0AA 4HJ7A 2EOTA 3RLNA 1E2VA 3K0XA 3PO2H 4JOIA 3E0JA 5IT9L 2VQFL 3C1EA 5KNDA 1L1OA 1NMFA 3MAQA 5JEAG 2UUAH 4MN3A 3GTPB 1STBA 2C9OA 1A3VA 2RDGA 3X3NA 3S9WA 1JE5A 1B8AA 3HP3A 1HNZH 1EQVA 2UUBL 1GO3E 2B2UA 2VS1A 3C46A 4B3ML 2E2JH 4K8JA 4NXNQ 1VQCA 2FMMA 1IBLL 1N9WA 2ANRA 2A69C 1K1GA 5KNBA 4RGOS 2B2VA 1IL8A 1DOMA 2JSOA 4EQPA 3PF5A 5M3MH 4A3FG 1QE6A 2A68D 3BYYB 4OIKA 4JI2Q 1VQNA 2A68C 1DXMA 2DGYA 4IUNA 3J80E 5K5PA 1U4LA 2ZXOA 3S16H 4HSPA 1WCMB 1QCBD 2KCMA 4B3TL 1LACA 2DJGC 4TQUS 3SHLA 3OTOQ 3GTJB 1IBML 2IJ0A 2BOSA 2Y0SE 3E5SA 2AUKA 1UEBA 1CQVA 3PIOA 4LF9Q 4JI0H 4GLVB 3W2DA 3GTJH 4C1NK 5J3BA 5LMNL 4DV4L 4A3EB 2XRQD 3A8IE 1PFBA 1U4RA 2YYZA 2JA8B 1TKWB 4A3CH 4MNOA 4HIKA 1DTJA 5EPKA 2EZVA 1U5KA 2F0GA 1H95A 3M4PA 1KDAA 1PRTB 1YNXA 4EGVA 3NWSA 3EFXD 3GD7A 3H94A 3C3LA 1LLRD 2MNAA 2L4NA 4JW0A 5GADC 5G3LF 1AE2A 4F87A 4K0KQ 1X54A 1SAPA 3M3YB 3BYTB 2R92G 3A8KE 3T53B 2EJMA 2F0FA 1X9ZA 1D8LA 5HGTA 1EEID 1SRUA 1LTSD 2H4OA 2ZTCA 1TWGB 5J39A 1PH4A 4JCVE 3K0YA 1EC6A 3AYHB 2JA7B 3J80i 2IX0A 1PTOB 1TWCB 2X69A 4DK0A 1VQAA 4DNRB 4OX9Q 3RF2A 4EX5A 2E3UA 2F0DA 2F3VA 2F4IA 3G48A 5BN5A 4A3MG 3HOXB 5M5WB 3CRLC 1KHMA 1PTOH 2XTIA 4RGMA 3U4VA 1XMOQ 2A19A 1SNOA 3KF6B 2PCFB 1L0YB 2UXDH 2VB3X 4DV7H 5HY6A 2PQAB 4TVAB 1H9RA 3HOVB 2I5HA 2L5TA 3K7AB 2BL5A 1SFOH 2HDMA 1EZ8A 2RVLA 4DV5L 1BKBA 5C0XH 4LFBH 1EYCA 4RA8A 5M3FG 4DV2Q 3BVMA 5IGCA 2I07B 3K7AH 2PZTA 1C4QA 4X3UA 4ZK9B 1WTXA 1JCKB 1A6XA 1Z47A 3PV0A 2P5ZX 2J7ZA 3PSIA 4ZQ3A 4YHHH 2ZM6L 5A2QW 1JORA 2K32A 2HD3A 2JK8A 2Z4HA 4JOIC 1IXRA 4UHVA 2Z6KA 5E1FA 4EVOA 1MD2D 3PMFA 1Q7YC 1V9PA 1XNRL 4A3DH 1L1OC 4DR4H 3HOWB 2CWPA 1F2YA 2F0WA 3TP6A 5C3EB 3VA7A 2EYHA 4KHZA 3DLLA 1BR9A 3R2TA 1PZKD 2M2LA 1IBKL 1VQ7A 2NVTB 1F9SA 3HOWH 2NYZD 4CJ2C 4JI5Q 4K6DA 1EWCA 4HJ8A 1KNAA 3HOYB 2RQXA 2N49A 2B2UC 4JPBW 4KV6A 1L1OB 1ET6A 2ZTEA 4JI6L 4Q0FA 3NBIA 4KTAA 1PHJA 2VXWA 1S5BD 2B2VC 1V1OA 3F2BA 2RA4A 1A15A 2L1BA 4IFDJ 5E4XA 3GV6A 4NZRM 4KHPL 4DFAA 1B9NA 2KEEA 5LL6X 4BY7B 4CKBA 3JAME 2SOBA 3EROA 4V190 4JI3H 2PW7A 5IWAL 2NUCA 1CSQA 2EPBA 4JI8H 4X3SA 1HA5A 1WCMG 1ZEQX 4HCEA 5CBEE 5JOBA 2B2TA 3NK9A 1EWIA 2VL6A 2UXCL 3QG1A 3HOUB 4GKKH 1X3GA 5EKLA 1GUSA 1F9PA 2LFNA 3T13A 3N6RA 4AH6A 3F1ZA 1HNZQ 1ML0D 4OD6A 3L0OA 5ELEA 4A3EG 3UDXA 2PI2A 4J15A 4JVZA 2FFKB 2PNHA 3GQBA 1K73C 1STGA 2XGTA 2QW7A 3KLSX 3KLSA 1DM0B 1YHAA 2JA8G 4I65A 4GOPC 2RHSB 3K5NA 3I4NB 4RMFA 5CV4A 1KABA 2WIIB 1YNND 4H13C 4FO2A 4DUZH 1GUGA 1YNNC 3OYYA 2HQEA 3P1HA 4XXEA 1PH6A 4X64L 3NWTA 5C3WA 4NB3A 3MFYA 4KKUA 1EZ6A 2KENA 5I9OA 4CHTB 2Z9HA 2KCCA 4IPDA 1XJVA 3NEMA 2NWGA 3I55A 2YU9H 3A0JA 2ID0A 1F2LA 4LUZA 1HNWL 2Z4IA 3UDIA 4P75A 5IGBA 1MI2A 4FJUA 5JJIA 1FJGQ 2KEDA 1I50H 4DR5L 3BDCA 4JI0Q 2C35B 1FVIA 2WV6D 3JAMi 1FR3A 2R7FA 2JA7G 1CKOA 3RUZA 4CDDC 4JI7L 4BS9A 2MPMA 3JAML 3HOZH 3RMHA 2HDLA 1S3OA 1AEXA 1YEZA 5IP7H 3D8GA 2BDOA 3HOXG 5JPMC 4DK3C 4OELB 4B3RQ 3QD7X 4KN4C 3CP0A 2FMCA 2XRSD 3I73A 1EQQA 3CAMA 2GVAA 5T1GA 5C0XG 4QMGA 1QNKA 1NXUA 1DOLA 4NZTM 3K5LA 2R3ZA 3HOVG 2LTLA 5C5LA 5LL6S 2VUMB 4QUCA 1P8LA 2CTLA 5C4XH 1EY0A 1VQ5A 3L9AX 3GTKB 5EPLA 5LMUL 4A3KH 1HCZA 4UDUC 5BR8H 1T5EA 3T1YH 5C4ZA 3GTKH 4WJ3M 2J0TD 1HR0L 3OSOA 2Z6KC 4U68A 2VQFH 1H9SA 1CQFA 3OMCA 4CJ1B 3RZDB 3HOWG 2PPBC 4CKCA 4RG1A 3J81E 1WI5A 5C3EG 4R4OA 3TZDA 3VR4A 2WP8J 4LF4L 3BJUA 4ODGA 5JJZA 1MKHA 2UUBH 3HOYG 2UXDQ 4KLKA 4HN7A 4CDFC 4B3MH 1VF5C 4UP8A 2K1HA 1X3QA 2QILA 4YWMA 5BN3A 3I3CA 5FLMH 1A2TA 2QDBA 2LRRA 2A6HC 1EU4A 1LTGD 3QOLA 3ZJYC 4LFBQ 1B3QA 5ELBA 1LABA 4GNXB 5FO9B 5IYBG 2QA4A 4B08A 2L15A 1EFWA 4ID6A 4BY7G 4YHHQ 1KLGD 5COYA 3T1HQ 1PH3A 1XNQL 1ONLA 1V1QA 3I56A 1SNCA 2OTLA 4WJ4A 1I6VC 3LX0A 4B3TH 5KEEA 3QIAA 4DR4Q 1VF7A 2B2TC 2Q2TA 3S14H 1V1PA 1IBMH 2OT2A 4K5VA 1SE4A 1JC7A 1PVOA 2CTKA 3HOUG 1EY6A 3K57A 2BH8A 1EY7A 4DV4H 1X3PA 1EOTA 1JWMD 1I5FA 3IFTA 2K4KA 2K1BA 1VQHA 2NTTA 4ILWA 3VR2A 4JV5L 5CC4A 1IYUA 4A76A 3NTKA 2AQ1B 4IOCA 3I4NG 4H0LC 5EGTA 3ND8A 4AYBB 2ATWA 4X62H 1B44D 1SJED 2TMPA 2QDLA 2E2HH 1N34L 2B63H 4JI8Q 1Q82C 2AXYA 2KVMA 3W3AA 2DY8A 3GTQH 1YI2A 2ZT9C 1BOSA 2B2WC 2F0HA 2EYMA 3SEBA 2HT1A 1J6QA 4CBVA 1E7ZA 1S4ZA 4HCSA 4GKKQ 1G2SA 3S1NH 1XXGA 2QEJC 1CZWA 1IKMA 2XVSA 1PH7A 5T1IA 2F0IA 5ELNA 5IP7G 1IHZA 1DCZA 2CTMA 1CKNA 1Q8IA 2WINB 1X4MA 3H3VH 2EQSA 3N52A 4LF8L 3KDKA 1ODHA 4M8AA 1NSNS 1F77A 1PYWD 3TZUA 3S2HH 5JJLA 1I4XA 4IUTA 4YY3L 3CQZB 4DUZQ 3WOEA 4CDEC 1KHIA 1XPRA 3RR5A 3DM3A 2F4VL 4DV5H 4JI2H 2VUMG 4A93B 3VYUA 1QVFA 5DLQE 1MSZA 1STNA 4RAUC 3MVVA 3E9IA 2NN6H 4C3IB 1SYCA 2V1CC 1ZKOA 1WD0A 2D5DA 1Y1VH 4IZ8A 2K52A 2LY7A 3TP5A 2PW5A 4C2MB 5IIFA 1G6ZA 1CT1D 3J7YW 2AHOB 4NXML 4GN5A 3F2CA 1K8GA 2KJXA 4V0BA 3RN2A 1XNRH 1X65A 1G51A 4XQJA 5AJ3Q 1VQMA 3CMEA 3IL8A 3H09A 4ZLTF 5JEAH 1G2TA 5JPNC 1IBKH 3K8AA 1JE4A 4N8FA 1Q90A 2VB2X 2R7ZB 1XRHA 2EYFA 1UUPA 1PH8A 4GS3A 2OEOA 2CVRA 2UXBH 3CCUA 1EY5A 4PMWA 2H5XA 3R8BA 3W1GA 1BCPB 2A73B 3CHBD 2L11A 2C5CA 4J6HA 4QL5A 4PMCA 3LWEA 2FFMA 5IGDA 1YIJA 1D7QA 2KHJA 4A75A 4A3FH 2JJQA 1TWHB 4LFAL 5BR8Q 3G4SA 3T1YQ 1GUWA 1V43A 3I4LA 2EY1A 2OQKA 5ELCA 2VQFQ 1DZ1A 2AQ2B 4DV6L 3GR5A 1PQXA 4R4CA 3GTLH 3HKSA 4IURA 3I0PA 4DR3L 3NTIA 1BQQT 1WYDA 2F0SA 4R4QA 2JEBI 1WTHA 4K6LA 2UUBQ 4I7AA 3VDYA 1CFMA 3S15B 3I2ZA 4PNYA 4R1JA 5EKIA 1OXUA 1V1PB 4L5TA 3BVZA 1X9NA 4B3MQ 5M5YB 3CXCA 5IT9E 1VQBA 1TS5A 5C4JB 4XQQA 5C0XI 3PUWA 3CMAA 1T9HA 3QB3A 2YTYA 4FYDA 5FO8B 4AYBG 2K33A 1A62A 2R92B 4X64H 1U9RA 2RKSA 3OSSD 4KK7A 3FPPA 1D6EC 4QJFA 4FXKC 1RKNA 1S40A 1EIHA 4WFN3 4BA2I 2R92H 5EBCA 1QOHA 1VCIA 3TP7A 1LTTD 2NVXH 4B3TQ 3A74A 1FNWA 1D5ZC 2RCNA 3SDZA 1HNWH 4XDXA 3PO3B 4G7HC 1E3PA 1IBMQ 4HIMA 1N33L 1S72A 2CPMA 2MQHA 3K5MA 1BNZA 3VA5A 2ZJPA 3K81C 3H0GB 1EIGA 2B8GA 1AN8A 2Z8LA 1WE8A 4RH6A 4DV4Q 2B2YA 4X6AH 4LUVA 1KAAA 3TN2A 3OIQA 1O7LA 4A3MH 5HGQA 1GHKA 4Y52H 2RSOA 1W2BA 3S1RB 4NP5A 3I8ZA 4OWXB 4X62Q 1HQMC 1VQJA 2UUCL 4B8TA 1CKNB 1HPCA 1VQPA 1B9MA 4RFBA 3GTMB 1Q46A 2F0OA 3S17H 1HFGA 4P73A 1FYCA 1ASZA 2WFWA 5M3FH 4A93G 1A63A 1TS2A 4IJHA 1QWYA 2K5NA 4C3IG 2E5LL 3CC4A 3TMEA 2FINB 5A2QL 1DONA 5LMUH 1R4QB 3SB1A 2RBMA 2K6AA 3DMUA 4PV1C 3PCOB 4GN3B 1HR0H 2N55A 2AMCB 4GLAC 4J8QA 1E2ZA 4M1UB 4DV1L 2X06A 4TKOB 4RKLA 4E6IA 5M5XB 3SK5A 1Q81C 3AEVA 1CK1A 1F9RA 3Q23A 2CW0D 2PI2E 3GTPH 1K83B 4KD4A 4XIGS 4LF4H 2YTXA 2CW0C 3NHHA 2LXKA 2EY5A 1F2ZA 2A69D 2R7ZG 1PZJD 3D4DA 1ICWA 3NQIA 1PYSB 4DF7A 2I5LX 1D2BA 2F03A 4FF2A 4R8IA 4DV5Q 1XMQL 2D62A 2K05A 1I3QB 2QGQA 3S1QB 4FJSA 2D0PA 1A2UA 4LF7H 3G6EA 1GXDC 1I3QH 2NZOA 2R7DA 1CKMA 2EIFA 2K5QA 1SE2A 4DR6H 4QQBX 4R4IA 1J5EL 2QCPX 3U4ZA 1LTLA 1WCMH 4OXPA 3I4OA 1E22A 1XNRQ 3TQYA 1FJGH 2LSSA 3TBIB 4DR7L 3FEWX 4IFDH 2K5WA 3J81c 1IBKQ 1P16A 4PQXA 4DV0L 3LNNA 4AQYL 1E1OA 1ZXTA 4J1MA 5JAVA 4YCUA 2R61A 3MC0B 4A3EH 2J4XA 4GOPA 2LKVA 4YCVA 4B3RH 1EY9A 3D31A 1NJIC 4LNQA 4EC5A 2EE1A 2UXBQ 1DT4A 1HZ9A 2JA8H 2A1SA 4IJLA 2Q2UA 4MHEA 5I6WA 3F2UA 4KHPQ 4IUPA 1CHQD 1N34H 5DM73 2IHFA 3I4MB 1SJHD 2EJGC 3MXPA 3P20A 5C4HA 2E2IB 3M3YH 1TS4A 2LF0A 2E2DC 4N9PA 4KMUC 2NVYB 3K58A 1FNVA 2E2IH 3PO3G 1XTCD 2WKCA 3KDFA 2LXJA 1TWGH 5FJ8H 3ONAB 4LK1C 4C3HB 1YVCA 1I94L 4PZ8A 3GTOB 2JA7H 5AFWA 3H0GG 2B2YC 4OO1G 4C3HH 1GKHA 3FP9A 1TWCH 4ZYSA 4LF8H 3MEFA 3GTOH 4KN7C 1PFNA 1E2WA 1UE1A 4LWCA 1FGUA 3PUXA 4KJNA 3HOXH 2VNUD 5I2XA 5M5WH 3W5OA 4IUUA 2O2LD 4X3TA 5DM63 1EU3A 3VR3A 1U4PA 5EAYA 1G291 3KYHC 4DR1L 5TSSA 2AUJD 3B6YA 4X64Q 4HJAA 3HOVH 1PFMA 2F4VH 3BVGA 2JEAI 3NE5B 1WJJA 3ZYYX 1U0LA 3TEHB 4L5SA 1NNXA 3T1HH 3CCMA 4BY1B 4UP9A 2MJ8A 4AM3A 1BBXC 3TREA 1HNWQ 2UU9L 5BN4A 4NXMH 4O0AA 3O13A 5I2YA 2SNSA 1WTVA 4BY1H 4DR2L 4DR5Q 2WKDA 2EXZA 2K14A 1VQIA 4B9XA 5KIXA 1C48A 5C6AA 1QILA 4JBMA 5C3EH 1JR0D 3ND9A 4R9WA 2CTFA 2PO4A 2NVTH 4HIOA 1NR4A 4NKLA 3OTOL 3NELA 3HOYH 2HHHH 4ME3A 1Z2IA 3D6WA 1NAPA 3AEVB 2CFMA 2O4CA 2I5MX 2VZAA 5GQOA 1BF4A 3IAYA 1M90C 3M9BA 1N32L 4O42A 5IYBH 3CF5A 4A3BB 1AH9A 2K5DA 1EWHA 4QB4A 5LMUQ 2FXQA 1R9TB 4BY7H 3Q0AA 2I46A 1LT4D 1HR0Q 4X65L 5ISRA 3F2DA 5FO7B 4IFDG 1TUAA 1TU2B 4DV6H 4LF5L 1TY2A 3H15A 4DV3L 1WFQA 3H3VI 2IW3A 3M7NA 5FKAC 4DR3H 4F8MA 5JVG3 3BZCA 3HG9A 5CORA 3HOUH 4LF4Q 5FLXW 4PG3A 1X3EA 4ALPA 4CJ0B 3DWQA 2E8GA 5GROA 2NZ1D 1Y1WB 2Q2HA 4JI1L 1AW7A 1K8OA 3G71A 1TXYA 2NN6I 4KY6A 3MA2B 1NUCA 3GTGB 3I4NH 1CA6A 3MXNA 4P2CB 2B8FA 1AFPA 1HZCA 1AP0A 1HNXL 4LF7Q 1DOKA 2JXMB 4GOPB 3ITPA 3C2PA 1JB7A 2NVQB 3I4MG 1I4RA 1XNQQ 4DR6Q 4HR7B 2B2WA 4NDXA 1TWAB 2F0UA 1SDFA 1ILQA 5FJ8G 5K36G 3PUYA 1HH2P 1JT8A 3HEJA 4GKJL 2EYJA 3L3OC 1WTJA 1N33H 3VR6A 4MTNA 4C3HG 2VQEL 2P2RA 4PMBA 1N36H 2F0VA 2XWBB 4IALA 1UE5A 1E0BA 4QMFB 1HXYD 1I6UA 2M9VA 2KCNA 3RD4A 2KCTA 2RCFA 1YBYA 3KDFB 1Z7TA 4KY7A 5IT9c 3J81j 4FP5D 4KKSA 4DN4M 3P7JA 1S5FD 5DT9A 1WOCA 1EYGA 2YV5A 4KD3A 2UUCH 3RNUA 4JI5L 1LTBD 3K7UC 3J80W 4AIMA 1EYAA 1N34Q 1HFNA 3ERQA 2VUMH 3MZ5A 1O80A 2RF4A 4JYAL 3STBD 2RSNA 4ZKBB 2E5LH 1MJCA 2E76C 3STBC 4L5RC 1VQ6A 1SMXA 2G8YA 2ES2A 4BY1G 2HIXA 2EYLA 4L6TB 2NZHA 2HH2A 2G9HD 1GVPA 1PRTF 4QGUA 1EY8A 3KFUA 3RLFA 1Q12A 3DHQA 2EJFC 1Q1EA 1RDPD 3RZDH 4N9TA 4LF8Q 5FLXc 1VQEA 1A8VA 1LTRD 5CMDA 4XQNA 4R8NA 2EYPA 1IBLH 2UUAL 4O2DA 2R93B 2A6HD 2K03A 4F7XA 1VQLA 4FXDA 4MIUA 4IPHA 1YHBA 1HNZL 1S03G 4X3KA 1PTOF 2F4VQ 1PV4A 3Q24A 2B3GA 3RZOB 3CCRA 4JVHA 2HCCA 2BH2A 1HJPA 5J1ZA 4A3BG 1PH1A 2CWAA 4X66L 3K6OA 3IKJA 3MHBA 4Y7NB 1ASYA 4NXMQ 1RJTA 4DAPA 2O5JC 1J5EH 4JVYA 3CW2C 1G8ZD 2DNCA 1E1TA 3I72A 3SGIA 2IWHA 1F2MA 3CU7A 5LMNH 2F0JA 4AQYH 3TS0A 1EL0A 1Z9FA 1KL9A 3VYSA 2HHHQ 4DK1A 4ME5A 1CHPD 4K8IA 5E3FA 1HA6A 1KTKA 1RD9D 1Y1WG 4LFCL 4JI0L 2D2CC 2AKWB 4A3IB 4OCHA 1MGSA 1VQGA 3FVQA 3UDFA 3ULPA 2BCOA 2NBFA 2NTSA 3J80c 1PLFA 4H02A 3J7AK 1SYFA 4DPGA 2DNEA 4DK6C 2Q8RE 3CRKC 2EXDA 1QNUA 1SEBD 4NBQA 4K5XA 3NSWA 1WD1A 1GM5A 3G6JB 4DV6Q 3MXNB 4JBKA 1HUNA 4KI0A 1JICA 4TRDA 1VBIA 4KJOA 1LYLA 4C56C 2JQOA 4DR3Q 4O1NA 1XWEA 3H3VC 5EBDA 1RF2D 4OIJA 1SSOA 4QIWB 3LWUA 4HMIA 3OWEB 4YWKA 4U673 1EIYB 1QUQA 1JOOA 1K3RA 3M4QA 4LW1A 2BA1A 3WOFA 2JA5B 5IYDG 3I7FA 3IFDA 1GUNA 3CQZH 2G5DA 4KHVA 1QVCA 5LHY1 1BBUA 5JJKA 1CM9A 1EOVA 4DV7L 3Q22A 2OPVA 2Y0SB 4DNIA 4A93H 4JI4L 3M85A 2ZM6H 4ZKCB 4C3IH 1B3AA 1K0SA 2CTJA 3OETA 4A3GB 4PZ6A 3OIPA 1EY4A 2ZJQA 1O78A 4IFDI 1GUTA 4RHSA 5D14A 4C2MH 1VQ8A 4ZCKA 4OWWB 3SK4A 1N33Q 1L0XB 4DR2H 2SNMA 4A3LH 1DJRD 3JC66 1N36Q 2DN8A 4DKAC 4YHHL 1KRSA 1F0XA 2OPUA 3A7AB 1BDOA 3NPPA 4HTHA 4BWGB 4IN3A 4HIDA 2L12A 1LT6D 1H9SB 1I4HA 1WTPA 1GHJA 3FAUA 4E9JA 3M4OB 2N88A 3IRBA 4JI6H 1SN8A 4H8AA 3AU7A 3S2DB 2R7ZH 1UEAB 4L5QA 1V8QA 1X55A 2SDFA 4QCLA 2R93G 2UUCQ 1IYVA 3OHXC 2F0QA 5IYCH 4FDBA 3S2DH 1AZQA 4KHPH 2ZTDA 2F1MA 2A6ED 2K04A 4FXGC 4LF6L 1N32H 2A6EC 1K3BC 5IWAH 1XYIA 2E5LQ 3FKIB 5GAHC 1MJEA 1KDBA 2ENBA 4HAEA 1PH2A 1IZ6A 1UE6A 1RTOA 1TWHH 2JP1A 2M00A 4RCOA 1KRTA 1SNPA 2WACA 3R3OA 4DXGA 1M1KC 1HTLD 2UXCH 2VKCA 1KC8C 4JI3L 1VMCA 3DEPA 4DV3H 1WTWA 3ULJA 1ENAA 4Q5VA 2QF7A 4QUFA 1KQSA 2F0NA 2LMCB 1SMYD 1YJNA 4A3JB 1N8RC 3BZKA 1W6KA 1CI3M 1SMYC 3A7LA 1B70B 4DU9A 5A2QE 1K8AC 4NW2A 3LGJA 4CKEA 4HJ9A 1IBLQ 4DAMA 1VQKA 4OWTB 3S15H 1BBWA 1O7ZA 1MSGA 4HSVA 3CCSA 2FPHX 1KDCA 3KUPA 4JI1H 1Q1BA 2JYOA 5M5YH 3HFZB 1BUVT 3H6MA 1NCVA 3TSSA 3AFPA 4A3IG 3PGZA 5C4JH 2IL8A 3NCVA 3GKUA 2ZXRA 2F3IA 3A5ZB 3JAMc 1C9OA 2VY3A 1HNXH 4ZUIA 2D9IA 3FHWA 3PF4A 2KA7A 3J7A5 1M8AA 1WHRA 1J5EQ 3E6ZX 4C3JB 2KHSA 1RL2A 3I70A 1GJXA 2CKZB 4B3SL 1YNJD 1TS3A 3AB9A 3K5OA 4DR5H 1YNJC 3KOJA 4DR7Q 3J81W 4YIJA 5IOCA 2KQ3A 3KLRA 3PO3H 4GKJH 3D4RA 1SR3A 5LMNQ 1LV9A 4JI7H 1X6OA 2JA6B 4WORA 4AQYQ 4TSSA 2MO0A 1K28A 5CV7A 3KBXA 2HUGA 1J5KA 3MXUA 3H0GH 4OO1H 5FOBB 3KF6A 1QZHA 1KAWA 5AJ3L 2IX3A 2PQAA 2K7VA 3UE1A 4WALA 1BXTA 1TR5A 1I6HB 2JA5G 4HEDA 5GAGC 1SE3A 3S1RH 5KGUA 3PIP3 2K50A 2PMZB 1CA5A 1SEIA 1TVXA 2DJFC 2E74C 2JVZA 1QUQB 3GTMH 4DUYL 3PUVA 1A0IA 4JYAH 1Q3LA 5C3XA 4ZUJA 2Y0SG 5HURA 2D9UA 4KKTA 1PXUA 1STYA 1GUOA 4JBWA 1NBWA 4A3LG 4A3GG 1MHWC 2B39A 5CV8A 1Y14B 5A35A 1GOZA 2DUDA 2CHBD 3KBGA 3KF8A 4LIJA 4AYBE 3CC7A 3NBHA 1M4VA 1JJCB 1ZZKA 3T1YL 2TSSA 1YITA 2I0QA 1QVGA 5M5XH 2KUMA 2M8WA 3C1FA 1UAPA 3TS2A 1K83H 2CH4A 3FPUB 2OXPA 2L9HA 5IYCG 2JZXA 1MIUA 5D3IB 4EQOA 2E2JB 1II3A 3VKEA 1SYGA 4DR1Q 3J7AV 3L7ZC 3GDEA 4RCNA 3V2TA 3S1QH 1R4PB 2L0CA 2ZM6Q 5M3MB 4UP7A 2HH3A 1XNQH 3FKIG 4I7ZC 4QIWE 2PZUA 4X66H 5IY0A 1PH5A 2K5VA 2UU9Q 1VQDA 2CH4W 3S16B 2BDNA 2MGSA 3OWFA 3RLOA 1JQYD 1YJWA 2MUYA 1RTNA 1O7YA 4DR2Q 1H9KA 2WAQB 2XN9C 1BO0A 3M7GA 4LAAA 5I6YA 5FLXL 1W3SA 2A8VA 2F3WA 4RGNA 1SNMA 3EJIA 4A3JG 4BBSB 4JV5H 4JI6Q 2H1EA 1CSPA 2GA4B 3S1MB 4RGTA 1JB3A 5CGKA 4LFCH 1PRTD 4BBSH 2YQRA 4F88A 3BDLA 1PRTC 1BVSA 4MZ9A 2Z1CA 3S1MH 1DYQA 4OHJA 4WRDA 3QOJA 1N32Q 4BXXH 5IWAQ 2CWFA 1ENCA 4H44C 2VW9A 3UOEA 4IOAA 2F0EA 1AZPA 3I4MH 4LUOA 1EQTA 4X62L 1MBYA 3ERSX 2PY9A 4ABNA 4CDCC 4X65Q 3Q6SA 4C3JG 2UXCQ 1DD2A 4Z9CB 1BCPF 5K36H 4LF5Q 1TWFB 4DV3Q 2NVYH 1J8IA 1PTOD 3KDGA 1Z6HA 1PTOC 3NXWA 1KD1C 1RODA 3HGBA 1TWFH 4UY8C 2JA6G 1ILPA 3U9SA 4K2LA 1GD7A 4IPGA 3D0FA 2MHVA 1B2TA 1VQOA 1JOKA 4DAYA 2HCIA 5KYIA 1EUJA 4JI1Q 4YY3H 2Z0SA 3AFQA 3J7ZC 4DNTB 3J80L 5EJWA 3MEHA 3SE0A 1AN7A 3L2PA 1STHA 1H9JA 2OF1A 3D3RA 4NXNL 3HS0C 3OPOA 1HNXQ 5D3DA 5IGEA 1SFOB 4MTKA 3GV3A 2IY5B 3CKIB 1SYDA 3KLWA 5EPJA 4JI4H 2NB0A 1VQFA 1QJOA 5CYUA 3GO5A 1NE3A 5I9PA 4JI2L 3E9HA 2EY6A 1DGSA 2EDGA 5I4DA 2MJHA 1SROA 3A5UA 1EQRA 2K01A 4GKJQ 2Y3MA 5GAEC 2KHIA 3ICEA 2VQEQ 4HJ5A 1PFSA 1KIXA 4JI7Q 3PO2G 4A3DB 1ZZIA 1WTRA 3SK8A 3EA6A 4ZRZA 2PZWA 2F0PA 5IT9W 4CGYB 3URYA 2F52A 2CPQA 2YTVA 3T51B 3KF8B 4LF9L 2ANNA 2ICIA 3NBHB 4WJWA 1J9OA 3WDNA 1UNSA 2QEXA 4R4TA 2PNRC 3A54A 1C7YA 4GNXA 1JJGA 4RKBA 1PMRA 5EQ0A 1K8MA 3K59A 3SK6A 2WB1B 2RDFA 2F0TA 4LF6H 4LFAH 4JYAQ 4POGA 3TP8A 3OOCA 3BU2A 5H1SE 3FDTA 1IL2A 2UXBL 1X4NA 1FKAH 1UG8A 4PDBA 5M3MG 4A3BH 4FF3A 3H91A 1R9TH 3V69A 2A5HA 4K0KL 1STEA 1ESFA 3OMGA 1HZAA 3BS1A 1Q86C 2WAQG 2XIWA 3R93A 2EYOA 1SLJA 1HZBA 1UWVA 1HUMA 3HKZB 1IW7D 2PMZE 2IT1A 3MWYW 1JWSD 3E3XA 1IW7C 3QJYA 2A74C 1LT3D 4BBSG 2O4XA 2QKIC 3VYTA 1OO9B 1W6JA 1B4OA 2UUAQ 3PIO3 1LO5D 2F0MA 4OX9L 4G4KA 1Y1WH 3A55A 4QY7A 4BXXG 3UI2A 5LMNW 2X6GA 3CCLA 2JE6I 1CZGA 5L37A 1EIFA 4A3CG 5KRUA 1B50A 1XMOL 1TT2A 3GTGH 3DXJC 2SEBD 3SR1A 5IGGA 1HTPA 2ZQEA 1T5XD 4X66Q 3NUCA 3ULLA 3OW2A 5LL6b 4OEMB 2K75A 2CQOA 1OXXK 3UE0A 1S20A 2NVQH 2FJ2A 4DV2L 1QB5D 2PYKA 4K2KA 3U50C 1TWAH 4B3SH 2BE5D 2YU9B 2K5HA 2BE5C 4PZ7A 4RWSC 3CCJA 2L55A 4OONA 1C0AA 1SYEA 1XX8A 3D6CA 3RN5A 3F8TA 4BBRB 3TDQA 2OWOA 1I50B 3KK7A 4XYQA 5EKKA 4JV5Q 5DNFA 3I90A 1E24A 5IP9H 4IUQA 1D1KA 4BBRH 4NMZA 4G7ZC 3T4AC 3HOZB 2V4DA 4FF4A 5C0XJ 4LFCQ 2Q8TA 1WTOA 3A56A 3HZXA 1NR2A 5NUCA 4IQZA 1FGBD 2KOLA 4QF4A 4IUVA 1RCVD 4XT1B 5M9OA 1KNEA 5IYDH 1STAA 4B8CD 2PQUA 2WAQE 2DGRA 4N8X1 1CUKA 4DAYB 2N8NA 1C8CA 2IPKD 4DUYH 3U58A 4YCWA 2PQEA 5C4XB 1YHQA 2Z6BA 4ULLA 3QR8A 3G7LA 2Q8IB 2RHQB 1D5MC 3Q8DA 1J4WA 1Y8OB 4A3KB 1FL0A 1F9QA 1PA6A 2EVBA 1X3FA 2KBNA 4WANA 4DV1H 4JC0A 1ICFB 3U9OA 2HIVA 2ZJRA 1LT5D 2R6GA 4A3DG 3FMCA 2M6QA 3V96A 2A1AA 2ALYB 4YY3Q 3AQQA 3MFGA 1JMCA 1MSHA 5DEHA 3U1KA
chains in the Genus database with same CATH topology
4XT3B 4B9WA 2R93H 1YZ6A 1RIPA 1O7IA 4GNXC 1EFID 3CCQA 2DY7A 4DV7Q 2XNAC 2WB1G 3RZOH 5C44B 4JI4Q 1NMGA 1LUZA 1L0WA 4YWLA 4OL7A 1B7YB 4OGQC 3I91A 1RHPA 4Y7NH 5C44H 5CV6A 1UE7A 4LF7L 4IO9A 4C1NI 5F2DA 2F0LA 1IKLA 4OO1I 1OXSC 1PZID 3S14B 1JJ2A 4DR6L 3UDGA 3HKZG 4UPAA 1FJGL 1ZYRD 1I4GA 1K0RA 1ZYRC 1XPOA 2AWOA 4K5WA 3CPFA 1TY0A 4G57A 3P75A 1A3UA 3AMUA 3GP7A 1VIHA 2MFIA 4RHRA 4A3IH 4G7OC 4LFAQ 4LF6Q 4GZYC 4POFA 4B3RL 2HQLA 2Q2IA 3EVQA 4L63B 1VIGA 1U4MA 3DUZA 1XTDA 2E2HB 2F0KA 1XPUA 3QO2A 3HRZC 3J81i 5KYLA 2B63B 5KNCA 4LMQD 4XTCS 3S24A 3J81L 1TIID 5IGFA 3GTQB 4JI3Q 3DEOA 1NY4A 2QNDA 3SVMA 4DGZA 3PUZA 5FK9C 5IP9G 1FD7D 3TRZA 4H7BA 3V05A 5E4WC 4DXFA 4BBRG 3S1NB 1Q8KA 2ICEC 2AQ3B 2WB1E 1SNQA 4L8JA 1KXLA 1D5XC 1LM0A 3HOZG 1B53A 1FNUA 4KY5A 1CTMA 1G6PA 1TQOA 3S2HB 3PIPA 1L2FA 2JA5H 3WWVA 2UXDL 5ELDA 2CQAA 1JWUD 3QWNA 4LJZC 3BDOA 5C5MA 3HKZE 2D0OA 2OCEA 5J22A 4GN4B 1I4PA 3DWAA 4LFBL 5C4XG 2CCZA 1SBBB 3CD6A 4B3SQ 1KLUD 1Y1VB 1VDZA 4A3KG 3NQTA 4A3GH 2E75C 1Y8PB 4P72A 4FVMA 1X32A 3T1HL 3EBEA 3VR5A 3VYRA 1ESRA 1ZTGA 4DR4L 1OXVA 1HR0W 5ELFA 3KJPA 2G9DA 4BA1I 3EIVA 1ZZJA 3BG3A 1AE3A 1NTGA 1VS0A 3M4OH 3ER0A 1BCPD 3MTSA 5E7NA 1BCPC 5CR3A 5G3LD 4JBJA 5CV9A 3NENA 3D4WA 5CBAE 3J7AF 4K14A 2JA9A 2HHHL 5FLMG 1PDQA 4DUYQ 4JK1C 4JG2A 5C44G 3CPWA 3BZDB 4A3FB 2OQ0A 2GN5A 3EN2A 3FKIH 1VQ4A 5JVH3 1S5ED 2MO1A 4DV1Q 4P71A 4UAIA 2N3SA 4JI8L 5IE8A 4S3SA 1A3TA 4FF1A 3T16A 3GTLB 2K28A 2XWJB 5D65A 3NTHA 2X6LA 4EQ5A 5DAUA 4APVA 4GKKL 5IODA 4P74A 4GLXA 1ENFA 3FRPB 4A3JH 3A8JE 1I4QA 1VMPA 1HRJA 2N78A 1WVLA 1XMQQ 1X56A 1SYBA 2IX1A 1D1IA 2BA0A 3NP8A 1QG7A 3DWPA 1PH9A 2KECA 4ZAIA 2CTEA 4DA2A 4NPSA 1LTAD 3CCEA 4A4IA 1B1ZA 5ELOA 2EY2A 2O5IC 4DUZL 1SE8A 4EQNA 2IHEA 1Y8NB 2FMRA 1YJ9A 2B63G 2MP1A 3CC2A 1OXTA 4C3JH 1H9MA 2NVXB 3R2IA 3M4YA 1S5DD 3X3MA 2XSCA 3KJOA 3EQLC 4IPCA 4DV0Q 4XYOA 4FNFA 4HMJA 2ASBA 2JA6H 3T56B 1LTID 1JOQA 3K80C 1SXTA 1HQRD 1ET9A 4A3MB 2B29A 1N36L 1EYDA 2LS01 5FLXE 2FHTA 1WTQA 3MXGA 3OW7A 1EEFD 3SXHA 1VQ9A 1Y69U 1I6HH 3CCVA 1QZGA 2RDHA 2AWNA 3S17B 1K9MC 1HHVA 2OTJA 3DM1A 5M3FB 1PYBA 1S5CD 2NN6G 1G91A 2ZXPA 5JEAJ 3E0EA 3W1BA 1WVNA 1OTCA 5CV5A 3PO2B 1IYJB 1Y1VG 1I94Q 4DAVA 5BR8L 1SNDA 2GVBA 4HJ7A 2EOTA 3RLNA 1E2VA 3K0XA 3PO2H 4JOIA 3E0JA 5IT9L 2VQFL 3C1EA 5KNDA 1L1OA 1NMFA 3MAQA 5JEAG 4MN3A 3GTPB 1STBA 2C9OA 1A3VA 2RDGA 3X3NA 3S9WA 1JE5A 1B8AA 3HP3A 1EQVA 2UUBL 1GO3E 2B2UA 2VS1A 3C46A 4B3ML 2E2JH 4K8JA 4NXNQ 1VQCA 2FMMA 1IBLL 1N9WA 2ANRA 2A69C 1K1GA 5KNBA 4RGOS 2B2VA 1IL8A 1DOMA 2JSOA 4EQPA 3PF5A 5M3MH 4A3FG 1QE6A 2A68D 3BYYB 4OIKA 4JI2Q 1VQNA 2A68C 1DXMA 4IUNA 2DGYA 3J80E 5K5PA 1U4LA 2ZXOA 3S16H 4HSPA 1WCMB 1QCBD 2KCMA 4B3TL 1LACA 4TQUS 3SHLA 3GTJB 3OTOQ 1IBML 2IJ0A 2BOSA 2Y0SE 3E5SA 2AUKA 1UEBA 1CQVA 3PIOA 4LF9Q 4GLVB 3W2DA 3GTJH 4C1NK 5J3BA 5LMNL 4A3EB 4DV4L 2XRQD 3A8IE 1PFBA 1U4RA 2YYZA 2JA8B 1TKWB 4A3CH 4MNOA 4HIKA 1DTJA 5EPKA 2EZVA 2F0GA 1U5KA 1H95A 3M4PA 1KDAA 1PRTB 1YNXA 4EGVA 3NWSA 3EFXD 3GD7A 3H94A 3C3LA 1LLRD 2MNAA 2L4NA 5GADC 5G3LF 1AE2A 4F87A 4K0KQ 1X54A 1SAPA 3M3YB 3BYTB 2R92G 3A8KE 3T53B 2EJMA 2F0FA 1D8LA 5HGTA 1EEID 1SRUA 1LTSD 2H4OA 2ZTCA 1TWGB 5J39A 1PH4A 4JCVE 3K0YA 1EC6A 3AYHB 2JA7B 3J80i 2IX0A 1PTOB 1TWCB 2X69A 4DK0A 1VQAA 4DNRB 4OX9Q 4EX5A 2E3UA 2F0DA 2F3VA 2F4IA 5BN5A 3G48A 4A3MG 3HOXB 5M5WB 3CRLC 1KHMA 1PTOH 4RGMA 2XTIA 3U4VA 1XMOQ 2A19A 1SNOA 3KF6B 2PCFB 1L0YB 2VB3X 5HY6A 2PQAB 4TVAB 1H9RA 3HOVB 2L5TA 3K7AB 2I5HA 2BL5A 1SFOH 2HDMA 1EZ8A 2RVLA 4DV5L 1BKBA 5C0XH 1EYCA 4RA8A 5M3FG 4DV2Q 3BVMA 5IGCA 2I07B 3K7AH 2PZTA 1C4QA 4X3UA 4ZK9B 1WTXA 1JCKB 1A6XA 1Z47A 3PV0A 2J7ZA 4ZQ3A 3PSIA 2ZM6L 1JORA 2K32A 2Z4HA 2JK8A 4JOIC 1IXRA 4EVOA 5E1FA 2Z6KA 1MD2D 3PMFA 1Q7YC 1V9PA 1XNRL 4A3DH 1L1OC 3HOWB 2CWPA 1F2YA 2F0WA 3TP6A 5C3EB 3VA7A 2EYHA 4KHZA 3DLLA 1BR9A 1PZKD 2M2LA 3R2TA 2NVTB 1IBKL 1VQ7A 1F9SA 3HOWH 2NYZD 4CJ2C 4JI5Q 4K6DA 1EWCA 3HOYB 1KNAA 4HJ8A 2RQXA 2N49A 2B2UC 4KV6A 1ET6A 1L1OB 2ZTEA 4JI6L 4Q0FA 3NBIA 4KTAA 1PHJA 2VXWA 1S5BD 2B2VC 1V1OA 3F2BA 2RA4A 1A15A 2L1BA 4IFDJ 5E4XA 3GV6A 4KHPL 4DFAA 1B9NA 2KEEA 5LL6X 4BY7B 4CKBA 3JAME 2SOBA 3EROA 4V190 2PW7A 5IWAL 2NUCA 1CSQA 2EPBA 4X3SA 1HA5A 1ZEQX 1WCMG 4HCEA 5CBEE 5JOBA 2B2TA 3NK9A 1EWIA 2VL6A 2UXCL 3QG1A 3HOUB 1X3GA 5EKLA 1GUSA 1F9PA 2LFNA 3T13A 3N6RA 4AH6A 3F1ZA 1HNZQ 1ML0D 3L0OA 5ELEA 4A3EG 3UDXA 2PI2A 4J15A 2FFKB 3GQBA 2PNHA 1K73C 1STGA 2XGTA 3KLSX 3KLSA 1DM0B 1YHAA 2JA8G 4I65A 4GOPC 2RHSB 3K5NA 3I4NB 4RMFA 5CV4A 1KABA 2WIIB 1YNND 4H13C 4FO2A 1GUGA 1YNNC 3OYYA 2HQEA 3P1HA 4XXEA 1PH6A 4X64L 3NWTA 5C3WA 4NB3A 3MFYA 4KKUA 1EZ6A 2KENA 5I9OA 4CHTB 2KCCA 4IPDA 1XJVA 3NEMA 2NWGA 3I55A 2YU9H 3A0JA 2ID0A 1F2LA 4LUZA 1HNWL 2Z4IA 3UDIA 4P75A 5IGBA 1MI2A 5JJIA 1FJGQ 2KEDA 1I50H 4DR5L 3BDCA 4JI0Q 2C35B 2WV6D 1FVIA 3JAMi 1FR3A 2R7FA 2JA7G 3RUZA 1CKOA 4JI7L 4BS9A 2MPMA 3JAML 3HOZH 3RMHA 2HDLA 1S3OA 1AEXA 1YEZA 5IP7H 3D8GA 2BDOA 3HOXG 5JPMC 4DK3C 4B3RQ 4KN4C 3CP0A 2FMCA 2XRSD 3I73A 1EQQA 5T1GA 5C0XG 2GVAA 3CAMA 4QMGA 1QNKA 1DOLA 3K5LA 2R3ZA 3HOVG 5C5LA 5LL6S 2VUMB 4QUCA 1P8LA 2CTLA 5C4XH 1EY0A 1VQ5A 3L9AX 3GTKB 5EPLA 5LMUL 4A3KH 1HCZA 4UDUC 1T5EA 5C4ZA 3GTKH 4WJ3M 2J0TD 1HR0L 3OSOA 2Z6KC 4U68A 1H9SA 1CQFA 3OMCA 4CJ1B 3RZDB 3HOWG 2PPBC 4CKCA 3J81E 4RG1A 1WI5A 5C3EG 4R4OA 3TZDA 3VR4A 2WP8J 4LF4L 4ODGA 3BJUA 5JJZA 1MKHA 3HOYG 2UXDQ 4KLKA 4HN7A 1VF5C 4UP8A 1X3QA 2QILA 5BN3A 4YWMA 3I3CA 5FLMH 1A2TA 2QDBA 2A6HC 1EU4A 1LTGD 3QOLA 3ZJYC 4LFBQ 5ELBA 1LABA 4GNXB 5FO9B 5IYBG 2QA4A 4B08A 2L15A 1EFWA 4ID6A 4BY7G 4YHHQ 1KLGD 5COYA 3T1HQ 1PH3A 1XNQL 1ONLA 1V1QA 3I56A 1SNCA 2OTLA 4WJ4A 1I6VC 3LX0A 5KEEA 3QIAA 4DR4Q 1VF7A 2B2TC 2Q2TA 3S14H 1V1PA 2OT2A 4K5VA 1SE4A 1JC7A 1PVOA 2CTKA 3HOUG 1EY6A 3K57A 2BH8A 1EY7A 1X3PA 1EOTA 1JWMD 3IFTA 1I5FA 2K4KA 2K1BA 2NTTA 4ILWA 3VR2A 1VQHA 4JV5L 5CC4A 1IYUA 4A76A 3NTKA 2AQ1B 4IOCA 3I4NG 4H0LC 5EGTA 3ND8A 4AYBB 2ATWA 1B44D 1SJED 2TMPA 2E2HH 1N34L 2B63H 4JI8Q 1Q82C 2AXYA 2KVMA 3W3AA 2DY8A 3GTQH 1YI2A 2ZT9C 1BOSA 2B2WC 2F0HA 2EYMA 3SEBA 2HT1A 4CBVA 1J6QA 1S4ZA 1E7ZA 4HCSA 4GKKQ 1G2SA 3S1NH 1XXGA 2QEJC 1CZWA 1IKMA 2XVSA 1PH7A 5T1IA 2F0IA 5ELNA 5IP7G 1IHZA 1DCZA 2CTMA 1Q8IA 2WINB 1CKNA 1X4MA 3H3VH 2EQSA 3N52A 4LF8L 4M8AA 1NSNS 1F77A 1PYWD 3TZUA 3S2HH 5JJLA 1I4XA 4IUTA 4YY3L 3CQZB 4DUZQ 3WOEA 1KHIA 1XPRA 3RR5A 3DM3A 2F4VL 2VUMG 4A93B 3VYUA 1QVFA 5DLQE 1STNA 4RAUC 3MVVA 2NN6H 4C3IB 3E9IA 1SYCA 2V1CC 1ZKOA 1WD0A 2D5DA 1Y1VH 4IZ8A 2K52A 2LY7A 3TP5A 2PW5A 4C2MB 5IIFA 1G6ZA 1CT1D 3J7YW 2AHOB 4NXML 4GN5A 3F2CA 1K8GA 2KJXA 4V0BA 3RN2A 1X65A 1G51A 4XQJA 5AJ3Q 1VQMA 3CMEA 3IL8A 3H09A 4ZLTF 5JEAH 1G2TA 5JPNC 3K8AA 1JE4A 1Q90A 2VB2X 2R7ZB 2EYFA 1UUPA 1PH8A 4GS3A 2OEOA 2CVRA 3CCUA 1EY5A 4PMWA 3R8BA 2H5XA 3W1GA 1BCPB 2A73B 3CHBD 2L11A 2C5CA 4J6HA 4QL5A 4PMCA 3LWEA 5IGDA 1YIJA 1D7QA 2KHJA 4A75A 4A3FH 2JJQA 1TWHB 4LFAL 5BR8Q 3G4SA 3T1YQ 1GUWA 1V43A 3I4LA 2EY1A 2OQKA 5ELCA 1DZ1A 2VQFQ 2AQ2B 4DV6L 4R4CA 3GTLH 3HKSA 4IURA 4DR3L 1BQQT 3NTIA 1WYDA 2F0SA 4R4QA 2JEBI 4K6LA 2UUBQ 3VDYA 1CFMA 3S15B 3I2ZA 4PNYA 4R1JA 5EKIA 1OXUA 1V1PB 4L5TA 3BVZA 5M5YB 1X9NA 4B3MQ 3CXCA 5IT9E 1VQBA 1TS5A 5C4JB 4XQQA 5C0XI 3PUWA 3CMAA 1T9HA 3QB3A 2YTYA 4FYDA 5FO8B 4AYBG 2K33A 1A62A 2R92B 1U9RA 2RKSA 4KK7A 3FPPA 1D6EC 4QJFA 4FXKC 1RKNA 1S40A 1EIHA 4WFN3 4BA2I 2R92H 5EBCA 1QOHA 1VCIA 3TP7A 1LTTD 2NVXH 4B3TQ 3A74A 1FNWA 1D5ZC 2RCNA 3SDZA 4XDXA 3PO3B 4G7HC 1E3PA 1IBMQ 4HIMA 1N33L 1S72A 3K5MA 1BNZA 2MQHA 3VA5A 2ZJPA 3K81C 3H0GB 1EIGA 2B8GA 1AN8A 2Z8LA 1WE8A 4RH6A 4DV4Q 2B2YA 4X6AH 4LUVA 1KAAA 3TN2A 3OIQA 1O7LA 4A3MH 5HGQA 1GHKA 4Y52H 2RSOA 1W2BA 3S1RB 4NP5A 3I8ZA 4OWXB 4X62Q 1HQMC 1VQJA 2UUCL 4B8TA 1CKNB 1HPCA 1VQPA 1B9MA 4RFBA 3GTMB 1Q46A 2F0OA 3S17H 1HFGA 4P73A 1FYCA 1ASZA 2WFWA 5M3FH 4A93G 1A63A 1TS2A 4IJHA 1QWYA 4C3IG 2K5NA 2E5LL 3CC4A 3TMEA 2FINB 5A2QL 1DONA 1R4QB 2RBMA 2K6AA 3DMUA 4PV1C 3PCOB 4GN3B 2N55A 2AMCB 4GLAC 4J8QA 1E2ZA 4M1UB 4DV1L 4TKOB 4RKLA 4E6IA 5M5XB 3SK5A 1Q81C 3AEVA 1CK1A 1F9RA 3Q23A 2CW0D 2PI2E 3GTPH 1K83B 4KD4A 4XIGS 2YTXA 2CW0C 3NHHA 2LXKA 2EY5A 1F2ZA 2A69D 2R7ZG 1PZJD 3D4DA 1ICWA 3NQIA 4DF7A 1PYSB 2I5LX 1D2BA 2F03A 4FF2A 4R8IA 4DV5Q 1XMQL 2D62A 2K05A 1I3QB 2QGQA 3S1QB 2D0PA 1A2UA 3G6EA 1GXDC 1I3QH 2NZOA 2R7DA 2K5QA 1CKMA 2EIFA 1SE2A 4QQBX 4R4IA 1J5EL 2QCPX 3U4ZA 1LTLA 1WCMH 4OXPA 3I4OA 1E22A 1XNRQ 3TQYA 3TBIB 2LSSA 4DR7L 3FEWX 4IFDH 2K5WA 3J81c 1IBKQ 4PQXA 1P16A 4DV0L 3LNNA 4AQYL 1E1OA 1ZXTA 4J1MA 5JAVA 4YCUA 2R61A 3MC0B 4A3EH 2J4XA 4GOPA 2LKVA 4YCVA 1EY9A 3D31A 1NJIC 4LNQA 2EE1A 2UXBQ 1DT4A 1HZ9A 2JA8H 4IJLA 2Q2UA 4MHEA 5I6WA 3F2UA 4KHPQ 4IUPA 1CHQD 5DM73 3I4MB 2IHFA 1SJHD 2EJGC 3MXPA 3P20A 5C4HA 2E2IB 3M3YH 1TS4A 2E2DC 4N9PA 4KMUC 2NVYB 3K58A 1FNVA 2E2IH 3PO3G 1XTCD 2WKCA 3KDFA 2LXJA 1TWGH 4C3HB 3ONAB 4LK1C 5FJ8H 1YVCA 3GTOB 4PZ8A 1I94L 2JA7H 5AFWA 3H0GG 2B2YC 4OO1G 4C3HH 1GKHA 3FP9A 1TWCH 4ZYSA 3MEFA 3GTOH 4KN7C 1PFNA 1E2WA 1UE1A 4LWCA 3PUXA 1FGUA 4KJNA 2VNUD 3HOXH 5I2XA 5M5WH 3W5OA 4IUUA 2O2LD 4X3TA 5DM63 1EU3A 3VR3A 1U4PA 5EAYA 1G291 3KYHC 4DR1L 5TSSA 2AUJD 3B6YA 4X64Q 4HJAA 3HOVH 1PFMA 3BVGA 2JEAI 3NE5B 1WJJA 3ZYYX 1U0LA 3TEHB 4L5SA 3CCMA 4BY1B 4UP9A 2MJ8A 4AM3A 1BBXC 3TREA 1HNWQ 2UU9L 5BN4A 4O0AA 3O13A 5I2YA 2SNSA 1WTVA 4BY1H 4DR2L 4DR5Q 2WKDA 2EXZA 2K14A 4B9XA 1VQIA 5KIXA 1C48A 5C6AA 1QILA 4JBMA 5C3EH 1JR0D 3ND9A 4R9WA 2CTFA 2PO4A 2NVTH 4HIOA 1NR4A 4NKLA 3OTOL 3NELA 3HOYH 4ME3A 3D6WA 1NAPA 3AEVB 2CFMA 2I5MX 2VZAA 5GQOA 1BF4A 3IAYA 1M90C 3M9BA 1N32L 4O42A 5IYBH 3CF5A 4A3BB 1AH9A 2K5DA 1EWHA 4QB4A 5LMUQ 2FXQA 1R9TB 4BY7H 3Q0AA 2I46A 1LT4D 1HR0Q 4X65L 5ISRA 3F2DA 5FO7B 4IFDG 1TUAA 1TU2B 4LF5L 1TY2A 3H15A 4DV3L 1WFQA 3H3VI 2IW3A 3M7NA 5FKAC 4F8MA 5JVG3 3BZCA 3HG9A 5CORA 3HOUH 4LF4Q 4PG3A 1X3EA 4ALPA 4CJ0B 3DWQA 2E8GA 5GROA 2NZ1D 1Y1WB 2Q2HA 4JI1L 1AW7A 1K8OA 3G71A 1TXYA 2NN6I 4KY6A 3MA2B 1NUCA 3GTGB 3I4NH 1CA6A 3MXNA 4P2CB 2B8FA 1AFPA 1AP0A 1HZCA 1HNXL 4LF7Q 1DOKA 2JXMB 4GOPB 3ITPA 3C2PA 1JB7A 2NVQB 3I4MG 1I4RA 1XNQQ 4DR6Q 4HR7B 2B2WA 4NDXA 1TWAB 2F0UA 1SDFA 1ILQA 5K36G 5FJ8G 3PUYA 1HH2P 1JT8A 3HEJA 4GKJL 2EYJA 3L3OC 3VR6A 4MTNA 4C3HG 2VQEL 2P2RA 4PMBA 2F0VA 2XWBB 4IALA 1UE5A 1E0BA 4QMFB 1HXYD 2M9VA 2KCNA 3RD4A 2KCTA 1YBYA 3KDFB 1Z7TA 4KY7A 5IT9c 3J81j 4FP5D 4KKSA 4DN4M 3P7JA 1S5FD 1WOCA 1EYGA 2YV5A 4KD3A 3RNUA 4JI5L 1LTBD 3K7UC 4AIMA 1EYAA 1N34Q 1HFNA 3ERQA 2VUMH 3MZ5A 1O80A 2RF4A 4JYAL 3STBD 2RSNA 4ZKBB 2E76C 1MJCA 3STBC 4L5RC 1VQ6A 1SMXA 2ES2A 4BY1G 2HIXA 2EYLA 4L6TB 2NZHA 2HH2A 2G9HD 1PRTF 1GVPA 4QGUA 1EY8A 3KFUA 3RLFA 1Q12A 3DHQA 2EJFC 1Q1EA 1RDPD 3RZDH 4N9TA 4LF8Q 5FLXc 1VQEA 1A8VA 1LTRD 5CMDA 4XQNA 4R8NA 2EYPA 2UUAL 4O2DA 2R93B 2A6HD 2K03A 4F7XA 1VQLA 4FXDA 4MIUA 4IPHA 1YHBA 1HNZL 4X3KA 1PTOF 2F4VQ 1PV4A 3Q24A 3RZOB 2B3GA 3CCRA 4JVHA 2HCCA 2BH2A 1HJPA 5J1ZA 4A3BG 1PH1A 2CWAA 4X66L 3K6OA 3IKJA 3MHBA 4Y7NB 1ASYA 4NXMQ 1RJTA 4DAPA 2O5JC 4JVYA 3CW2C 1G8ZD 2DNCA 1E1TA 3I72A 3SGIA 2IWHA 1F2MA 3CU7A 2F0JA 3TS0A 1EL0A 3VYSA 1KL9A 1Z9FA 2HHHQ 4DK1A 4ME5A 1CHPD 4K8IA 5E3FA 1HA6A 1KTKA 1RD9D 1Y1WG 4LFCL 4JI0L 2D2CC 2AKWB 4A3IB 1MGSA 1VQGA 3FVQA 3UDFA 3ULPA 2BCOA 2NBFA 2NTSA 3J80c 1PLFA 4H02A 1SYFA 4DPGA 2DNEA 4DK6C 2Q8RE 3CRKC 2EXDA 1QNUA 1SEBD 4NBQA 4K5XA 3NSWA 1WD1A 1GM5A 3G6JB 4DV6Q 3MXNB 1HUNA 4JBKA 4KI0A 1JICA 4TRDA 4KJOA 4C56C 1LYLA 2JQOA 4DR3Q 4O1NA 1XWEA 3H3VC 5EBDA 1RF2D 4OIJA 4QIWB 1SSOA 3LWUA 4HMIA 3OWEB 4YWKA 4U673 1EIYB 1QUQA 1JOOA 1K3RA 3M4QA 4LW1A 2BA1A 3WOFA 2JA5B 5IYDG 3I7FA 3IFDA 1GUNA 3CQZH 4KHVA 5LHY1 1QVCA 1BBUA 5JJKA 1CM9A 1EOVA 4DV7L 3Q22A 2OPVA 2Y0SB 4DNIA 4A93H 4JI4L 3M85A 4ZKCB 4C3IH 1B3AA 2CTJA 4A3GB 4PZ6A 3OIPA 1EY4A 2ZJQA 1O78A 4IFDI 1GUTA 4RHSA 5D14A 4C2MH 1VQ8A 4OWWB 3SK4A 1N33Q 1L0XB 2SNMA 4A3LH 1DJRD 3JC66 1N36Q 2DN8A 4DKAC 4YHHL 1KRSA 2OPUA 3A7AB 1BDOA 4BWGB 3NPPA 4HTHA 4IN3A 4HIDA 2L12A 1LT6D 1H9SB 1I4HA 1WTPA 1GHJA 3M4OB 2N88A 3IRBA 1SN8A 3AU7A 3S2DB 2R7ZH 1UEAB 4L5QA 1V8QA 1X55A 2SDFA 4QCLA 2R93G 2UUCQ 1IYVA 3OHXC 2F0QA 5IYCH 4FDBA 3S2DH 1AZQA 2ZTDA 2F1MA 2A6ED 2K04A 4FXGC 4LF6L 2A6EC 1XYIA 2E5LQ 3FKIB 5GAHC 1MJEA 1KDBA 2ENBA 4HAEA 1PH2A 1IZ6A 1UE6A 1RTOA 2JP1A 1TWHH 2M00A 4RCOA 1KRTA 1SNPA 2WACA 3R3OA 4DXGA 1M1KC 1HTLD 1KC8C 4JI3L 1VMCA 3DEPA 1WTWA 3ULJA 1ENAA 4Q5VA 2QF7A 4QUFA 1KQSA 2F0NA 2LMCB 1SMYD 1YJNA 4A3JB 1N8RC 4DU9A 1W6KA 1CI3M 1SMYC 3A7LA 5A2QE 1B70B 3BZKA 1K8AC 4NW2A 3LGJA 4CKEA 4HJ9A 1IBLQ 4DAMA 1VQKA 4OWTB 3S15H 1BBWA 1O7ZA 1MSGA 4HSVA 3CCSA 1KDCA 3KUPA 1Q1BA 2JYOA 5M5YH 3HFZB 1BUVT 3H6MA 1NCVA 3TSSA 3AFPA 4A3IG 3PGZA 5C4JH 2IL8A 2ZXRA 2F3IA 3A5ZB 3JAMc 1C9OA 2VY3A 4ZUIA 3FHWA 3PF4A 2KA7A 3J7A5 1M8AA 1J5EQ 3E6ZX 4C3JB 2KHSA 3I70A 1RL2A 1GJXA 2CKZB 4B3SL 1YNJD 1TS3A 3AB9A 3K5OA 1YNJC 3KOJA 4DR7Q 4YIJA 5IOCA 2KQ3A 3KLRA 3PO3H 3D4RA 1SR3A 5LMNQ 1LV9A 1X6OA 2JA6B 4WORA 4AQYQ 4TSSA 2MO0A 5CV7A 3KBXA 2HUGA 1J5KA 3MXUA 3H0GH 4OO1H 5FOBB 3KF6A 1QZHA 1KAWA 5AJ3L 2IX3A 2PQAA 2K7VA 3UE1A 4WALA 1BXTA 1TR5A 1I6HB 2JA5G 4HEDA 5GAGC 1SE3A 3S1RH 5KGUA 3PIP3 2K50A 2PMZB 1CA5A 1TVXA 2E74C 2JVZA 1QUQB 3GTMH 4DUYL 3PUVA 1A0IA 1Q3LA 5C3XA 4ZUJA 5HURA 2Y0SG 2D9UA 4KKTA 1PXUA 1STYA 1GUOA 4JBWA 1NBWA 4A3LG 4A3GG 2B39A 5CV8A 1Y14B 5A35A 1GOZA 2DUDA 2CHBD 3KBGA 3KF8A 4LIJA 4AYBE 3CC7A 3NBHA 1M4VA 1JJCB 1ZZKA 3T1YL 2TSSA 1YITA 2I0QA 1QVGA 5M5XH 2KUMA 3C1FA 1UAPA 3TS2A 1K83H 3FPUB 2OXPA 2L9HA 5IYCG 2JZXA 1MIUA 5D3IB 4EQOA 2E2JB 1II3A 3VKEA 1SYGA 4DR1Q 3J7AV 3L7ZC 3GDEA 4RCNA 3V2TA 3S1QH 1R4PB 2L0CA 2ZM6Q 5M3MB 4UP7A 2HH3A 3FKIG 4I7ZC 4QIWE 2PZUA 5IY0A 1PH5A 2K5VA 2UU9Q 1VQDA 3S16B 2BDNA 2MGSA 3OWFA 3RLOA 1JQYD 1YJWA 2MUYA 1RTNA 1O7YA 4DR2Q 1H9KA 2WAQB 2XN9C 1BO0A 3M7GA 4LAAA 5I6YA 5FLXL 1W3SA 2A8VA 2F3WA 4RGNA 1SNMA 3EJIA 4BBSB 4A3JG 4JI6Q 2H1EA 1CSPA 2GA4B 3S1MB 4RGTA 1JB3A 5CGKA 1PRTD 4BBSH 2YQRA 4F88A 3BDLA 1PRTC 1BVSA 4MZ9A 2Z1CA 3S1MH 1DYQA 4OHJA 4WRDA 3QOJA 1N32Q 4BXXH 5IWAQ 1ENCA 4H44C 2VW9A 4IOAA 2F0EA 1AZPA 3I4MH 4LUOA 1EQTA 4X62L 1MBYA 3ERSX 2PY9A 4ABNA 4X65Q 3Q6SA 4C3JG 2UXCQ 1DD2A 4Z9CB 1BCPF 5K36H 4LF5Q 1TWFB 4DV3Q 2NVYH 1J8IA 1PTOD 1Z6HA 1PTOC 3NXWA 1KD1C 1RODA 3HGBA 1TWFH 4UY8C 2JA6G 1ILPA 3U9SA 4K2LA 1GD7A 4IPGA 3D0FA 2MHVA 1B2TA 1VQOA 1JOKA 4DAYA 2HCIA 5KYIA 1EUJA 4JI1Q 2Z0SA 3AFQA 3J7ZC 4DNTB 3J80L 5EJWA 3MEHA 3SE0A 3L2PA 1STHA 1H9JA 2OF1A 3D3RA