4IFDG

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
236
structure length
236
Chain Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKSGVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 50
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ifdG01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ifdG02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4ifdG03
3J7ZC 2F4VQ 1V9PA 4PV1C 1H9RA 2AUKA 2K7VA 1X3EA 2I5MX 3FKIH 5ELNA 3A5UA 1PH3A 1EC6A 3KOJA 1WFQA 4YY3Q 1CKMA 3CD6A 2A6ED 2NZOA 3A0JA 1VDZA 5LMUL 1LABA 1VQMA 4JI0L 1FJGL 3HOUH 3GTKH 3M4OH 4WJ4A 3RN2A 3PUYA 1X3GA 4DNRB 1YHAA 4TVAB 2K5HA 2HIVA 2RF4A 1GD7A 4R4TA 4C3HH 4DKAC 4A76A 3N6RA 2R7FA 1SROA 5IWAQ 4A3KH 2OTLA 1SR3A 1X65A 4DR1Q 1ASZA 2NN6G 3I7FA 3H15A 4X64L 1PYSB 3KF6A 3A74A 1G6PA 2EJGC 4ALPA 3ULPA 1RIPA 3IFTA 3KLRA 4IFDG 1XNQQ 4JI1L 4DV2L 1KRSA 4NXNQ 3VA7A 4A3IG 3CCLA 5C0XG 2P2RA 2WAQE 2E74C 4KKUA 3J81c 2AWNA 3I56A 3PF5A 3OW7A 1VQIA 4JCVE 4HJ9A 2B29A 3E9IA 4EQ5A 5EAYA 2ES2A 4GKJL 3PUWA 4DV5Q 4A93H 4R4OA 1FJGQ 3PSIA 3GTOH 1S40A 4A93G 1PFSA 5C4XG 5HGQA 1ZZKA 4X62Q 4JV5L 2N78A 4IFDI 3CAMA 2AHOB 5C3EH 5GAHC 1EQQA 2E2JH 3OW2A 3GTGH 1YVCA 3M4YA 3M4QA 4R4CA 5JJIA 4OO1H 2K4KA 1PH1A 1IW7D 5HY6A 4IOAA 1KHMA 1MJEA 5M5XH 2VUMH 3GQBA 1MJCA 3F2DA 1Y1VH 2ASBA 5A35A 3HOYH 2OTJA 1Z47A 3G6EA 4JOIA 1L1OA 2F3IA 2UUBQ 3TRZA 4MNOA 2E75C 4YCWA 4JI1Q 4BBRH 4DAMA 4A3EH 1BBUA 2MJHA 5J3BA 4H13C 4JBMA 1DGSA 2A8VA 2AUJD 4DUZQ 3TQYA 3NELA 3BDOA 3A8KE 2OQ0A 4DR7L 2BL5A 3BZKA 5C0XH 2AMCB 1OXTA 1PH2A 4HJ5A 2NVXH 1J5EL 2IY5B 1A8VA 2HQLA 2CWAA 3I4LA 4QQBX 2AKWB 1KIXA 2LMCB 4A3JH 3E0EA 3RNUA 2UUCL 1HZCA 5C4XH 4GN5A 4JI5Q 3PO2G 4JI3L 1Q82C 1PH5A 4LF9Q 3CCEA 2L15A 2PNRC 4LF7Q 1RL2A 4OO1G 2C35B 4WALA 2UXDQ 3NBHB 3RZOH 2Q8IB 1B7YB 3CCRA 4DV6Q 1VQEA 1VCIA 1SE8A 1Y1VG 1OXVA 2ALYB 4HIMA 2UUAQ 4B8TA 4BY1H 3S2HH 1YHBA 1CTMA 2CTLA 4PZ8A 4LFAQ 2R7ZG 4P72A 3FKIG 1Y1WG 4LFBQ 1L1OB 4JBWA 1LUZA 2RHQB 2VY3A 5FJ8G 3G48A 2VQEL 4DV3L 4LF5Q 3OOCA 1Q7YC 2A68D 2F1MA 4GS3A 1VIGA 2NN6I 1KHIA 4LF6Q 1XPUA 2QA4A 4BXXG 2UU9Q 4GN3B 2QGQA 1UE7A 2A6HD 3HOUG 4JI5L 3DXJC 4DK1A 2EJMA 4KHZA 3AFQA 4H02A 3CCUA 1K8OA 2UUCQ 2E76C 3UDFA 1NBWA 1YEZA 3VR4A 1CI3M 4K0KQ 3VKEA 4QMFB 1WCMH 2CFMA 2Z6KC 4AH6A 3L0OA 2UXCQ 2DN8A 2EJFC 2KCMA 3CQZH 5AJ3Q 2A6EC 1UWVA 2JA8G 2VNUD 3EN2A 4B3RQ 1JJGA 4IFDH 5IP9G 4MTNA 2KCTA 4LUOA 2D62A 4A3LG 2GVBA 1VQJA 3TEHB 3PIPA 4LF4Q 4DV7L 5FLMH 1H95A 3D31A 1VQ4A 1WE8A 2F4VL 3W1BA 3RLFA 4JI8L 3L2PA 4PZ7A 3F2CA 2JA7H 3M3YH 3MEFA 5IT9c 1H9SA 4IPDA 3U4VA 4X65L 3S1NH 4OO1I 4YY3L 4DR3L 2PPBC 1ONLA 4C3JH 4DV0Q 5H1SE 2KBNA 3EIVA 3RR5A 4A4IA 2A1AA 1I94L 1HR0Q 2E5LQ 3GD7A 4B3SL 1ASYA 4LFCQ 2QEXA 4BXXH 4I7ZC 1UEBA 5C3EG 3STBD 3AB9A 1A63A 1H9SB 1DTJA 1QUQB 3HOZG 1K8MA 2ZJQA 3H3VH 1HJPA 2JK8A 2MQHA 1VQLA 1Z9FA 1VQOA 2I5LX 4A3FH 4KHPQ 2R93G 3HKZE 3OTOL 3B6YA 2VQFL 1X4NA 4OONA 3K7AH 4B3RL 4LF8Q 4WANA 1QUQA 3BZCA 3MXUA 2FXQA 3CXCA 4JVYA 4JOIC 4AIMA 4GOPC 2K5NA 1EIFA 3HOXH 1H9JA 5KNDA 1KRTA 1I6VC 5IP7G 2ZJPA 4A3LH 1MKHA 1AH9A 1PV4A 3ULLA 4Y7NH 3T53B 3HKZG 3PUVA 4XIGS 3IKJA 1IYJB 1IYVA 4DK6C 5KNBA 2DUDA 4DPGA 4X65Q 3CCVA 4X66L 4JG2A 5M3MH 1TU2B 4A3JG 4QY7A 1I94Q 4OWTB 3RZDH 3J80i 3CMEA 1H9MA 1UE1A 1K8AC 1L0WA 3JAMc 3W3AA 1W3SA 2LXKA 4X62L 1GUTA 5BN5A 3M9BA 3ER0A 4J15A 4JI2Q 2R92H 4DR2Q 1FR3A 1VQKA 1SFOH 1XMOQ 4LFBL 1CSPA 5IYCH 1VS0A 1I5FA 3CC4A 3KJPA 2PQUA 1PHJA 4AQYQ 3CRKC 1IYUA 1N32Q 1GM5A 1LYLA 3Q8DA 3CRLC 4PG3A 4GKKQ 2CCZA 1AE2A 1N34L 3I2ZA 3GTMH 5JJKA 4DV4L 2YYZA 2R7ZH 1D8LA 2VS1A 3KF6B 4DUZL 1M1KC 2JA5H 1QVFA 2HIXA 3GTLH 1IW7C 2CTEA 2V4DA 2VW9A 2B63H 1A6XA 1PH6A 3ICEA 1OXSC 1B70B 1PVOA 3TS0A 2YTYA 3LWUA 4IQZA 1Q8KA 2NZHA 4IJLA 2FMRA 4NXMQ 1YNJC 3NEMA 4OWXB 4B3MQ 3VDYA 1PH7A 4DR5Q 1HNZL 2CTJA 1IBLQ 3VR6A 4KKSA 1M90C 4GKKL 2KENA 2OWOA 2D2CC 2L5TA 4OWWB 1QJOA 2ZTDA 2IHFA 2ZJRA 1GUSA 3CCSA 4L5RC 4LF7L 1A0IA 4X6AH 2JA6H 2D5DA 4FDBA 3K8AA 3I72A 2JA8H 1ZTGA 3W5OA 5LMNQ 2V1CC 4JI4L 4BY7H 3FPPA 5M3FH 2UXBQ 3ZJYC 1XNQL 4POFA 3A7LA 1L1OC 4DUYQ 2I0QA 3HOYG 3JC66 2DNCA 3VR2A 2OCEA 2BDOA 2MFIA 2O5IC 3KF8B 2AXYA 4EX5A 2EXDA 4JI6L 2EVBA 1J4WA 2N3SA 1IBKL 3H3VI 4HIDA 2XGTA 3KYHC 4XTCS 1PMRA 3SGIA 1T9HA 4OX9L 3J7A5 3KFUA 1W2BA 4IOCA 3ND9A 1WJJA 3S16H 4H44C 4GLAC 1YIJA 1SMXA 1K73C 2JZXA 3OPOA 1HNZQ 4ME3A 1NJIC 3HOZH 3K7UC 1O7IA 3UDGA 2OPUA 2OPVA 3S14H 2NVYH 4IPGA 1V43A 2UXCL 4IJHA 1GUOA 1UE6A 3KDFB 3T1YQ 1CKNA 4LJZC 2A69C 2A19A 1Q1EA 2B8GA 2RHSB 1K83H 1Y69U 2Y0SE 4YWKA 4DR1L 1QZGA 4B3TQ 3HOVG 1X4MA 3M85A 4PZ6A 4LF4L 2XTIA 1J6QA 1XNRQ 2K5VA 4QIWE 3RLOA 1GUNA 2KHJA 2Q2UA 4JI6Q 1ZZJA 4TKOB 4RG1A 1MIUA 2JVZA 1UE5A 2BH8A 2YQRA 4JI7L 4L5TA 3VR5A 1VQPA 4IPHA 3CMAA 3AEVA 3F8TA 1EIYB 5FJ8H 1NE3A 1X56A 1K1GA 1E3PA 4APVA 1I6HH 3HOWH 1XJVA 3UDXA 4DV1Q 3UE0A 1K9MC 1JB7A 5GAEC 4LF9L 3LNNA 3PUZA 3T56B 4DV5L 3WDNA 2D0PA 2UXBL 1H9KA 5IYDH 5LMNW 1DXMA 3AEVB 1TWCH 4BY1G 2JEBI 1V1QA 3CW2C 2PNHA 1VQGA 2PI2E 3PO3H 4G7OC 1YBYA 1BBWA 4JV5Q 3D4RA 1Q12A 1Y8OB 2Z6KA 3TZUA 3JAMi 1P16A 2BE5D 4B3TL 1PH9A 2IX0A 1N9WA 3U58A 4RCNA 4AYBE 1VF5C 2PMZE 4O0AA 3CPWA 3T1HQ 3G4SA 2CQOA 5JJLA 1C7YA 1PH4A 1CKNB 1IXRA 1EQRA 4DV3Q 3PO2H 2K75A 3AFPA 1LTLA 2AWOA 2VQEQ 2UUBL 2PI2A 4GN4B 4JC0A 4R4QA 1YI2A 1CFMA 4LF5L 1VQ6A 2HH2A 1S72A 5GAGC 1N8RC 2YU9H 1YJWA 1E1OA 1VQHA 1X3FA 3A8JE 5IYBH 1Q86C 1K8GA 4DR7Q 1Q1BA 3L7ZC 3MFYA 1TWAH 4PMWA 1CSQA 3H0GH 1HNXQ 1YJNA 1IBMQ 3PGZA 1GJXA 1TXYA 1JE5A 4DR4Q 4AYBG 4KKTA 5IWAL 4O2DA 4DR6L 2IT1A 2MNAA 4YWMA 3S24A 2ZM6Q 1PH8A 2KCCA 1V8QA 4DK0A 2KA7A 4P75A 5C0XI 5AJ3L 1N32L 4UP8A 3STBC 2BA0A 3BG3A 4KMUC 4HJAA 5BR8L 1IZ6A 4LUZA 1JT8A 4A3FG 1QZHA 4G7HC 1J5KA 1Q46A 3CP0A 1VQBA 4NXNL 4OXPA 5JEAH 1BKBA 4JI8Q 1GHKA 4GLXA 4BBSH 1HCZA 3HOXG 2E3UA 5IP7H 1OXXK 2H5XA 1HR0W 5C4JH 4H0LC 4GKJQ 4A3IH 2E5LL 4LFCL 1A62A 1Y8NB 1HZBA 4B3ML 4NXML 3GO5A 1HNXL 1IBML 1Z6HA 3J80c 1HQMC 1XTDA 4DR4L 4HJ7A 2BH2A 4A3GG 4LIJA 1NMGA 1IBLL 3GDEA 2JXMB 3I4NG 4KI0A 5GQOA 4DR6Q 2OQKA 1XPOA 1BDOA 2ZM6L 1FVIA 1KC8C 1N33L 3UE1A 4LUVA 4A3BG 2PQAA 1SMYC 1X6OA 4HIKA 1YJ9A 1JMCA 4GOPB 1I3QH 3I4MH 3HOVH 1VQDA 2B63G 2A6HC 1NMFA 2GVAA 1Q90A 2RCNA 3HKSA 4LWCA 4R4IA 3D0FA 4R1JA 3K0XA 3F1ZA 4QJFA 4X64Q 2A68C 1LM0A 2N8NA 3PIOA 2MO0A 2HH3A 1SRUA 1TWFH 2K14A 2ANRA 3NE5B 4BA2I 5K36G 5JEAG 3SDZA 1YNXA 1K0RA 3T51B 1S3OA 1E24A 1WI5A 2K50A 3LGJA 3K80C 4DV2Q 2JA5G 2CW0C 4DNTB 2N49A 4QGUA 3CC7A 4L5SA 1HZ9A 1BVSA 2JEAI 2HHHQ 2K33A 1VQ7A 2WFWA 2BE5C 3CCJA 4DR3Q 1YITA 3KDFA 1XMOL 4DV0L 1N36Q 4YHHQ 3CPFA 2E2HH 2PCFB 4JK1C 4B3SQ 4P73A 1TWGH 5C44H 1C9OA 2YTVA 1VQFA 4C2MH 3G71A 1NY4A 1VQCA 2Q2IA 4IPCA 3AYHB 2R93H 4A75A 1X9NA 3IRBA 4NB3A 2ZTCA 3T1YL 1XMQL 4A3DG 1GO3E 3P20A 1OTCA 4UY8C 1HNWL 4P71A 1HZAA 2JE6I 5BN3A 3PCOB 1KQSA 4DV4Q 1TKWB 3I4MG 4A3CH 4DK3C 2VQFQ 4JYAL 1YZ6A 1VF7A 1XNRL 1R9TH 4GOPA 5M3FG 1Y8PB 4LFAL 4HIOA 4LNQA 2CTMA 1QVCA 2ANNA 2Q2TA 3SE0A 4JI7Q 2B3GA 4NPSA 2B8FA 1GVPA 5IYBG 3ND8A 4LF6L 5M3MG 3FP9A 4JBKA 5M5YH 2VL6A 3A5ZB 1VQ8A 4BA1I 2HHHL 3RLNA 4WJ3M 1PA6A 4UPAA 3I73A 1N36L 2UU9L 5IY0A 5C0XJ 3QJYA 4YHHL 2ATWA 3S2DH 2QNDA 5ELOA 5FLXc 3CF5A 1AE3A 5IYCG 1D7QA 2IHEA 5KNCA 4DNIA 3CCQA 2EIFA 1EYGA 4JI4Q 5GADC 1O78A 2ZTEA 3DLLA 3V69A 2Z0SA 2VUMG 1VQNA 1WCMG 3U1KA 4OGQC 3HFZB 4JYAQ 3H94A 3TREA 1KXLA 3T1HL 4BBRG 4UP9A 4A3EG 2MO1A 4A3CG 4BBSG 1Q81C 3QG1A 1P8LA 1VQ5A 5M5WH 3S1MH 4OX9Q 2JA6G 5BN4A 4UP7A 2UUAL 3TS2A 1WYDA 2K52A 1YNNC 5FLMG 3KLWA 2CPQA 2DGRA 2E8GA 3J81j 2BA1A 2JA9A 1LACA 1G291 2CKZB 1XPRA 1PYBA 1NTGA 3U4ZA 4A3GH 1Y14B 3U50C 2PY9A 2JJQA 1JJ2A 3I4NH 3I55A 4POGA 4L8JA 3HOWG 3GTPH 1U0LA 1ZKOA 3MXNB 2JQOA 3PF4A 2ID0A 4JI3Q 3ERSX 4KHPL 3OTOQ 1EWIA 1ZYRC 5GROA 2O5JC 1CUKA 3CCMA 4DR5L 3PO3G 1EWHA 1IL2A 4Y52H 3U9SA 3A7AB 2DGYA 4K0KL 2LSSA 1Y1WH 3QIAA 2ZT9C 2EDGA 1B9NA 1JJCB 4DAYB 4IO9A 4LK1C 2CWPA 1KL9A 5LMNL 1X55A 2NVQH 4JBJA 2EQSA 1EOVA 5K36H 1HTPA 3CC2A 3E9HA 1FYCA 4KN7C 1L2FA 4YCUA 1ZZIA 1YHQA 4JVHA 4DV7Q 2WB1E 4DV1L 1GUGA 1GKHA 1IBKQ 2YTXA 4KLKA 1J5EQ 3DM3A 2D0OA 4QL5A 4JI2L 1WOCA 4DR2L 1E7ZA 2Y0SG 1SLJA 5C44G 1HH2P 4TQUS 1U5KA 3H0GG 2VZAA 5DLQE 3PV0A 4GNXC 1I50H 4A3MH 1VQ9A 4AQYL 2DNEA 2IX1A 1Z7TA 3FMCA 2WB1G 2E2IH 2R92G 1EUJA 3M4PA 3W1GA 4A3DH 2K32A 4P74A 4IFDJ 2KHIA 3S15H 2WP8J 1X54A 1T5EA 3EBEA 1FGUA 2QF7A 5IP9H 2F52A 1TWHH 3BJUA 3BU2A 3S1RH 1CKOA 2UXDL 3UDIA 1TUAA 4DV6L 4AM3A 4LF8L 4YWLA 4MZ9A 3FHWA 1QVGA 3K81C 3AQQA 2JA7G 4GZYC 1DCZA 1C0AA 1GHJA 4GNXB 4KN4C 2NVTH 1KD1C 3HGBA 1DT4A 2R6GA 4HR7B 4LW1A 3KJOA 3S1QH 3OYYA 3VR3A 1SN8A 5IYDG 4X66Q 1XMQQ 4YCVA 3A8IE 4GNXA 5LMUQ 1B9MA 4JI0Q 1VQAA 1E1TA 1E22A 3WWVA 2Q2HA 4C3IH 4A3KG 5BR8Q 2LXJA 2GN5A 4A3MG 2NN6H 4RMFA 2CTFA 3GTQH 1O7LA 2R7DA 3J81i 4A3BH 5JEAJ 1N33Q 1HNWQ 2CTKA 2WAQG 1FL0A 3S17H 4DUYL 1K3RA 3I4OA 4L5QA 1B8AA 1KAWA 1E2VA 2I5HA 2PQAB 1OXUA 5E7NA 3ULJA 4HJ8A 1HPCA 4G7ZC 4GLVB 1HR0L 2HT1A 3GTJH 4BY7G 1WVNA 1EFWA 2YV5A 3EQLC 1DD2A 4NBQA 1E2ZA 2A69D 3M7NA 3PUXA 3RN5A 1G51A 3NENA 1N34Q 1E2WA 1VIHA 3F2BA 5IE8A
chains in the Genus database with same CATH superfamily
3J7ZC 1NAPA 2F4VQ 3FKIH 4G08A 1H9RA 2I5MX 1PH3A 5TSSA 4AQYH 1VQMA 4JI0L 4FF1A 3RN2A 3PUYA 1X3GA 4TVAB 5CYUA 3F2BA 2RF4A 1SYFA 4CGYB 4C3HH 2F4IA 2NYZD 4JPBW 3J7AF 4O42A 2SEBD 2OTLA 2NN6G 2K6AA 2F0UA 1SJHD 3HOXB 4DU9A 2XRQD 3ULPA 3IFTA 1XNQQ 4AYBB 2XN9C 4DXFA 2XWBB 1KRSA 3KUPA 4XT3B 4NDXA 2GA4B 3SK8A 4KKUA 1IKLA 3I56A 3PF5A 3R2IA 4MTKA 4FF2A 5EAYA 4GKJL 3NTHA 4BWGB 1FJGQ 3M3YB 2HUGA 2IL8A 5HGQA 4Z9CB 1X3QA 2E2JH 1U9RA 3OW2A 3GTGH 1YVCA 3M4YA 1M4VA 4K5XA 5HY6A 5IT9E 3KF8A 1MJEA 1EY6A 3MXGA 1E0BA 1Y1VH 1I4XA 5A35A 1NUCA 4DAVA 3G6EA 1L1OA 4IUUA 4BBRH 4JI1Q 2F0MA 1BBUA 1LT5D 4JI3H 4H13C 1D5ZC 4DUZQ 4XQNA 4NP5A 1XTCD 2VXWA 3NELA 4YY3H 2BL5A 3BZKA 2QEJC 2MUYA 1A8VA 1I4QA 1II3A 4WRDA 3CU7A 2AKWB 1KIXA 2LMCB 2EY1A 3E0EA 2UUCL 3J7AV 4DV6H 2CVRA 1V9NA 4LF7Q 3P7JA 1RL2A 4LF6H 1ILPA 3H6MA 2UXDQ 4B9XA 1B7YB 5BR8H 4DV6Q 4HIMA 4B8TA 3I90A 5CORA 4PZ8A 2R7ZG 4JBWA 1LUZA 2VQEL 4LF5Q 2F1MA 2NN6I 4BXXG 2A6HD 4LF9H 2D9IA 1LLRD 1J9OA 3Q6SA 1JC7A 3VR4A 1CI3M 3MTSA 4E6IA 4K0KQ 4UAIA 2Z4HA 3L0OA 4XT1B 4C2MB 1A3VA 2CH4A 2X69A 4IFDH 5IP9G 2GVBA 1VQJA 4LF4Q 5FLMH 2XRSD 1VQ4A 5LMUH 3Q22A 3RLFA 4JI8L 4PZ7A 3SK6A 2X6LA 3GTMB 4OO1I 4PDBA 4DR3L 1I94L 3GD7A 3NWSA 1UEBA 5C4JB 1XNQH 3AB9A 1H9SB 3HOZG 2ZJQA 1VQLA 1Z9FA 3FPUB 4ZLTF 3J80W 1QCBD 3K7AB 2FINB 4A3FH 3OTOL 4RHRA 4OONA 2SOBA 2EXZA 3DHQA 3MXUA 2ZXPA 1MSHA 4P2CB 1SSOA 4NXNH 2ZJPA 3BYTB 1HFNA 5CC4A 3A54A 5JPNC 3HKZG 3T53B 2FFMA 1IYJB 4XIGS 4X65Q 1C8CA 2DUDA 1ODHA 1BOSA 5M3MH 1RODA 3KK7A 1EQVA 1K8AC 1FD7D 2FJ2A 2WKCA 2L0CA 5FLXL 4J15A 4JI2Q 3ER0A 3GTGB 1VQKA 2CWHA 2PQUA 5JJZA 2MGSA 2BDNA 1ML0D 3CRKC 1MSGA 3NQTA 1LYLA 2Z1CA 4GKKQ 1AE2A 1N34L 3GTMH 2L12A 2FMCA 1U4MA 4OIKA 2R7ZH 2WINB 1M1KC 5E4WC 2KJXA 2VW9A 4BBSB 5EPKA 1MD2D 4X64H 1B70B 1SNDA 1SEBD 2YTYA 3TS0A 1Q8KA 5IODA 5M9OA 4IN3A 5I2YA 1YNJC 1ICWA 4DR5Q 1KLGD 1M8AA 4KKSA 1M90C 3NTKA 2D2CC 2OWOA 1STEA 4L5RC 4DV5H 1S03G 1A0IA 4ZK9B 1DONA 2D5DA 4KHVA 3K8AA 2JA8H 1ZTGA 5LMNQ 4POFA 3A7LA 1KDAA 3JC66 3VR2A 2OCEA 4EX5A 2EVBA 5JOBA 1J4WA 2N3SA 1KNAA 4HIDA 2ZXRA 3H3VI 3SGIA 1PMRA 3UI2A 1SMYD 5KEEA 3DM1A 4DR1H 2G5DA 4IOCA 3ND9A 3URYA 4C1NI 1WVLA 2F03A 5DEHA 4FO2A 3QD7X 3K7UC 4JI7H 2BCOA 3S17B 1CQFA 2ENBA 2UXCL 5KRUA 4XQJA 1CKNA 2UXBL 2A69C 1Y69U 2R92B 3M85A 1XNRQ 2K5VA 1WTOA 2JVZA 2RDGA 3SB1A 1UE5A 4HMJA 2BH8A 4QIWB 3VR5A 1GOZA 1RTOA 1EIYB 1NE3A 1E3PA 4WORA 4APVA 3K0YA 3HOWH 5EGTA 1K9MC 3GTLB 1XYIA 4B9WA 5GAEC 3LNNA 3T56B 3AEVB 1G2TA 1LT3D 4BY1G 3BYYB 2F0VA 3T4AC 4G7OC 1A15A 2Z6KA 3D4RA 1B4OA 1TWFB 3E3XA 1P16A 1N9WA 2B39A 4RCNA 1VF5C 1L0XB 1PLFA 2L1BA 4G4KA 4DV3Q 2UUBL 2PI2A 1CFMA 2HH2A 1VQ6A 3NK9A 5KGUA 1F2YA 1S72A 1KDBA 2KEDA 5GAGC 1EY8A 2ICIA 1VQHA 1Q86C 3A8JE 1K8GA 1NXUA 1UG8A 4PMWA 3SXHA 2K05A 1IBMQ 3PGZA 3C3LA 2G8YA 4DR6L 2MNAA 3S24A 1N33Q 2KCCA 4P75A 5AJ3L 2BA0A 5BR8L 1IZ6A 2F0GA 4A3FG 1QZHA 4IUNA 4G7HC 5EQ0A 3PMFA 1AZPA 1T5XD 5JEAH 4BBSH 5ELFA 5IP7H 1OXXK 1F9QA 4LFCL 4NXML 1Y8NB 5I4DA 1SE4A 1C48A 1I50B 1HQMC 4DR4L 2BH2A 1NMGA 5GQOA 3MC0B 5JVG3 3HOVH 2A6HC 4R4IA 4JVZA 3D0FA 1F2ZA 1STHA 3Q23A 2HH3A 4DR2H 1SRUA 4LFAH 5K36G 1WI5A 1D2BA 2CW0C 2N49A 4FYDA 1HZ9A 1BVSA 2JEAI 3VA5A 1VQ7A 4N9TA 5EPLA 3CCJA 4DR3Q 3KDFA 4BY1H 4DV0L 4JI3Q 1PZKD 1TWGH 3G71A 2Q2IA 4IPCA 2R93H 1SYDA 3IRBA 4NB3A 3T1YL 1GO3E 3P20A 2JE6I 3PCOB 1D1KA 4JYAL 1CZWA 4LFAL 2ANNA 2A5HA 1Y1VB 4LF6L 3FP9A 5ELEA 5IGBA 5E1FA 1D6EC 3I73A 1XXGA 4TRDA 2QNDA 3CF5A 4FNFA 4B08A 2IHEA 4S3SA 2EIFA 2LS01 4K2LA 3HOUB 3V69A 3U1KA 1AFPA 4OGQC 2F0JA 4IUPA 3TREA 2UXCH 3T1HL 2AQ1B 3NBIA 4BBSG 4A3CG 4FJUA 4RHSA 5DT9A 4UP7A 4MIUA 3J80E 2UUAL 3TS2A 5T1GA 1CT1D 1U4PA 5CV6A 3EVQA 4QB4A 3J81j 2JA9A 1G291 2CKZB 1XPRA 1Y14B 3U50C 1JCKB 1X32A 3I4NH 3I55A 4POGA 2FHTA 3GTPH 3V05A 3HOWG 1QNUA 4KHPL 3CCMA 4DR5L 2O5JC 4B3TH 3OMCA 5G3LD 3PO3G 1JWSD 3QIAA 2Z8LA 4IO9A 5LMNL 1KL9A 4QUCA 1WTXA 1PRTB 2WIIB 1HTPA 3J81L 3CC2A 4KN7C 4JVHA 3MAQA 3RD4A 4RGMA 5FOBB 1IBKQ 1F77A 4DR2L 1O80A 4GNXC 3PV0A 1SNPA 1B50A 4A3JB 1CA6A 1Z7TA 2IX1A 5KYIA 2R92G 3M4PA 2UXBH 1PFNA 1I4RA 1NCVA 3QB3A 1X54A 2QF7A 5D14A 5C6AA 2UXDL 1O7ZA 4GKJH 5IGCA 3S1RB 2JYOA 2CWFA 1C0AA 1DCZA 1IHZA 4KN4C 3S16B 2KVMA 1DT4A 4BY1B 4HR7B 1SN8A 5IYDG 2PZWA 1LTAD 2PO4A 3LX0A 3NUCA 1QNKA 5CGKA 4GNXA 1E22A 4U68A 3FEWX 2LXJA 4I65A 2NN6H 4MN3A 4B8CD 1O7LA 3J81i 1IBMH 2CTKA 2WAQG 3S17H 4DUYL 1PTOB 4LF7H 3TDQA 1KAWA 1E2VA 5E7NA 1OXUA 3MWYW 4IURA 4G7ZC 3CQZB 4Q0FA 2YV5A 4NBQA 3NENA 3WOFA 5C0XJ 3K5LA 3HP3A 4PV1C 2AUKA 2K7VA 1SYBA 5ELNA 3KOJA 1WFQA 4YY3Q 1CKMA 3CD6A 1LABA 2ICEC 3HOUH 4WJ4A 2NBFA 3K57A 4DNRB 2CHBD 1GXDC 1GD7A 2HIVA 4XYQA 1SDFA 4A76A 3N6RA 4A3KH 1B53A 1SR3A 1X65A 3DEPA 4DR1Q 3D6CA 1TVXA 2EJGC 2KCNA 3RMHA 3KDGA 4A3IG 2P2RA 1HNZH 4NW2A 2WAQE 3OW7A 1VQIA 4JCVE 4HJ9A 4EQ5A 3I4NB 1PYWD 4DV5Q 1HUNA 3PSIA 1S40A 1PFSA 3D4DA 4X62Q 2RSNA 4IFDI 2AHOB 3S9WA 1W6KA 3TBIB 3S1QB 5JJIA 2K4KA 1PH1A 1IW7D 2LTMA 2VUMH 1MJCA 3F2DA 2OTJA 2ASBA 1WTJA 1V1OA 4F7XA 2F3IA 1DOKA 1I4PA 4YCWA 5J3BA 2AUJD 2F0OA 5IE8A 2F0PA 4ZKCB 3BDOA 4DR7L 2NVXB 2AMCB 3PIP3 1OXTA 1PTOD 3OTOH 4A3JH 3RNUA 4JI5Q 2M9VA 4HAEA 3R3OA 1Q82C 4FP5D 1PH5A 3CCEA 2L15A 2PNRC 4F87A 4HEDA 1IKMA 3UOEA 2KOLA 2C9OA 1N32H 2NUCA 2ATWA 3S2HB 2JSOA 1VQEA 1VCIA 1Y1VG 2ALYB 5M3MB 1CTMA 5CV9A 2JZXA 5EKIA 3OOCA 2A68D 1KHIA 4XYOA 2QA4A 2QGQA 2B2TA 4DK1A 3CCUA 2EJMA 2VUMB 3GR5A 1N34H 4OX9H 1AP0A 4O1NA 1EU4A 4X3KA 1WCMH 2CFMA 2Z6KC 4ZUIA 2UXCQ 2DN8A 2F0HA 2EJFC 1W6JA 2M2LA 2K01A 3CQZH 3GV3A 5AJ3Q 1JJGA 4B3RQ 1SAPA 3FDTA 1STBA 1EU3A 3TEHB 4JI0H 4K8IA 3F2CA 1STYA 5IT9c 3TP5A 2Z6BA 2PPBC 5IIFA 3R93A 1JOKA 4FXGC 3RR5A 5KIXA 2A1AA 5H1SE 1HR0Q 2E5LQ 4B3SL 1JT8A 4I7ZC 3STBD 2UU9H 1XRHA 1QUQB 1K8MA 2JK8A 2MQHA 1WTPA 3VYSA 1JORA 2I5LX 4LAAA 1YNND 2F0EA 5LMNH 4LF8Q 3CXCA 4JOIC 4A3DB 4JI6H 1KDCA 3HOXH 4M8AA 3VYTA 1SNCA 1JE4A 1AH9A 3VYUA 3IKJA 1IYVA 5KNBA 4M1UB 4XQQA 3H0GB 4JG2A 1TU2B 4A3JG 3GTQB 4H7BA 1RJTA 3CMEA 3PO2H 1FKAH 1L0WA 1GUTA 5IGFA 2R92H 4DR2Q 1FR3A 4LFBL 5IYCH 1I5FA 3KJPA 1IYUA 2E2JB 5FLXW 2NVQB 3Q8DA 1J8IA 3I70A 1NR4A 1TWGB 3HEJA 2KEEA 4KJOA 2FPHX 5KYLA 4DV4L 4OD6A 3GTLH 1EQTA 1IW7C 4BBRB 2CTEA 3SR1A 1PH6A 1S5FD 4K14A 2F0KA 1K3BC 4OWXB 4B3MQ 1KNEA 2MPMA 3CKIB 4OWWB 2ZJRA 1VIGA 4LF7L 1I4HA 5AFWA 1I4GA 2V1CC 4JI4L 5JPMC 3FPPA 1I3QB 2K04A 3BVMA 4DUYQ 3EROA 2I0QA 4KY7A 3HOYG 2AXYA 2F0IA 3WOEA 4DR5H 2EXDA 2XGTA 3KYHC 3KFUA 1W2BA 4DR7H 2QW7A 3ITPA 3S16H 2H4OA 4H44C 4R9WA 1LTID 4IPGA 1BCPD 2Y0SB 1V43A 5T1IA 1B2TA 3T1YQ 2JA6G 1S5ED 2RHSB 2WB1B 2VB3X 1X3PA 4N9PA 4JV5H 4PZ6A 2Q2UA 2KHJA 1CQVA 4TKOB 1MIUA 1SYGA 2YQRA 5F2DA 4IUTA 4L5TA 1MSZA 5IOCA 1VQPA 3OWFA 4IPHA 3AEVA 3F8TA 5FJ8H 3D6WA 3UDXA 4DV1Q 5EBDA 4XXEA 1JB7A 3S15B 3PUZA 5A2QL 1TQOA 4DV5L 2O4CA 5C4HA 1DXMA 1TWCH 4OEMB 2EYMA 3I91A 3CW2C 2PNHA 1VQGA 2B2VC 2PI2E 1YBYA 1Y8OB 3JAMi 2OEOA 1LT4D 4U673 3D3RA 3EA6A 4B3TL 4A3KB 2J0TD 3U58A 4O0AA 1DZ1A 1G6ZA 3QO2A 4CDFC 2VQEQ 1LTLA 4R4QA 4BY7B 5E3FA 2WKDA 3OIPA 2B2WA 1X3FA 5IYBH 4KV6A 3PO2B 1F9RA 2LF0A 3TZDA 2DJGC 1TXYA 1GJXA 5L37A 2IX3A 4DV3H 2NTTA 2PW5A 4O2DA 2IT1A 2B2VA 4DK0A 2KA7A 3EJIA 1N32L 4UP8A 3STBC 3BG3A 4KMUC 1EZ6A 1DOMA 3LWEA 1Q46A 1VQBA 2OF1A 4ODGA 4JI8Q 2RDHA 4GKKH 3HOXG 2E3UA 4H0LC 1PFBA 3KDKA 1BO0A 1O7YA 1HZBA 5C4ZA 1HNXL 5I6WA 1Z6HA 3J80c 2A1SA 1XTDA 2B2TC 4A3GG 1G2SA 1F2LA 2OQKA 1N33L 4LUVA 1I6HB 1X6OA 1TWHB 4GOPB 3P1HA 1MGSA 1I3QH 1TY2A 1VQDA 2B63G 1U4LA 4LWCA 2GVAA 1BCPB 3QR8A 4X64Q 3OMGA 2A68C 3J80L 2MO0A 2K14A 3MA2B 3LGJA 1S3OA 5DM73 1E24A 2R61A 4C56C 3K5NA 5ELCA 1YITA 2BE5C 1YNJD 2UU9Q 1XMOL 2EYOA 4YHHQ 3CPFA 3DEOA 4ZAIA 1HR0L 1C9OA 1VQFA 1NY4A 3X3NA 2X06A 4A75A 1QG7A 4A3DG 1PDQA 1VF7A 5G3LF 4JI4H 4HIOA 4LNQA 3N52A 2B2UA 4FF3A 3SE0A 4ILWA 4DF7A 4ABNA 2B3GA 4NXMH 1GVPA 5IYBG 1SEIA 4JBKA 2R7ZB 1VQ8A 1PA6A 3GKUA 5ELOA 3E6ZX 1AE3A 2EY5A 5KNCA 1EYGA 3A55A 5E4XA 1O78A 2Z0SA 1KAAA 2I07B 4IUQA 4JYAQ 1BUVT 1G8ZD 3H94A 3NSWA 4IALA 4A3EG 2MO1A 2L9HA 2F0WA 1RDPD 1VBIA 5BN4A 2JA8B 3DUZA 2AQ2B 2DGRA 4A3GH 1PTOF 2JJQA 1JJ2A 5IWAH 1U0LA 3MXNB 5C5LA 3ERSX 3OTOQ 1EWIA 5J39A 1FNVA 3HOYB 4Y52H 4JYAH 1JOOA 2ZT9C 3DWQA 1B9NA 1JJCB 1QE6A 3MXPA 4LK1C 1EY7A 1AZQA 2NVQH 1EOVA 1L2FA 4DV7Q 2WB1E 4CBVA 1FNWA 1GUGA 2UXDH 2YTXA 3ERQA 4ZQ3A 1F0XA 3ONAB 1E7ZA 1SE3A 1SLJA 2Y0SG 5CMDA 4TQUS 2CTJA 2VZAA 1I50H 1VQ9A 2EYLA 2DNEA 2JA6B 3G7LA 2IPKD 1EUJA 1KABA 2MJ8A 2F0DA 4DN4M 2KHIA 2WP8J 1FGUA 1JWUD 3BU2A 3EZJA 1JWMD 4AM3A 4YWLA 4MZ9A 3H3VC 5A2QW 4GNXB 2NVTH 1KD1C 3HGBA 2R6GA 4LW1A 3S1QH 5LHY1 3VR3A 3FAUA 1DYQA 4X66Q 4YCVA 1X0AA 3A8IE 3WWVA 2Q2HA 2RKSA 4A3KG 4UHVA 5BR8Q 2GN5A 4A3MG 2LTLA 4RMFA 2CTFA 3GTQH 4B3MH 2R7DA 4A3BH 4B3RH 1HNWQ 4JVYA 4LFBQ 1FL0A 2RA4A 5DNFA 2HCCA 2I5HA 1DJRD 3ULJA 2JP1A 1Z2IA 5HGTA 4BY7G 5LL6b 1RCVD 1PZJD 1DD2A 2A69D 3PUXA 5J22A 4QJFA 1UNSA 1PRTC 1V9PA 1X3EA 1EC6A 2B2WC 3A5UA 3TMEA 2NZOA 2ZQEA 4DAPA 1VDZA 2CQAA 4OL7A 4B3ML 5IT9W 2EYFA 4DKAC 2R3ZA 1HTLD 5IWAQ 2LRRA 1CZGA 1ASZA 4R8IA 4RKLA 4KTAA 1PYSB 3KF6A 3MFGA 1VMPA 3VYRA 4ALPA 1EY5A 2B2YC 3KLRA 4IFDG 4DV2L 1V1PB 4NXNQ 1FJGH 3CCLA 3HOVB 4DV4H 2TMPA 2E74C 3J81c 2AWNA 5K5PA 3E9IA 3HRZC 3PUWA 4A93H 1JR0D 2PW7A 1TIID 4R4OA 3GTOH 5C4XG 1ZZKA 2QILA 2N78A 3CAMA 3NHHA 1EQQA 4DUYH 2K5WA 1KHMA 5M5XH 3KBGA 1Z47A 3HZXA 2X6GA 1WTWA 2UUBQ 2NB0A 4MNOA 4A3EH 3TRZA 2MJHA 3C2PA 1PTOC 4ZCKA 2A8VA 4JBMA 4NZRM 3TQYA 5FKAC 3A8KE 4NZTM 5C0XH 3T13A 2QDBA 3R2TA 1PH2A 4HJ5A 1J5EL 1XMOH 4QQBX 2HD3A 5HURA 3GV6A 1HZCA 4GN5A 2RDFA 3C1EA 3NTIA 3C1FA 5M3FB 4RAUC 5CV7A 1C4QA 1OO9B 4OO1G 2C35B 4WALA 3RZOH 1EYAA 3HG9A 2Q8IB 2O2LD 2UUAQ 2CW0D 1CA5A 1YHBA 2CTLA 2HDLA 4KJNA 4P72A 3FKIG 4EGVA 5JJKA 1L1OB 2RHQB 2VY3A 4PMBA 1KTKA 2DY8A 4LMQD 1MI2A 2RCFA 4JI5L 3DXJC 5M5XB 1K8OA 4C3HG 2E76C 3UDFA 1NBWA 2BOSA 4IZ8A 3VKEA 2SNMA 4QMFB 4AH6A 1UAPA 3SHLA 4CDCC 2A6EC 2JA8G 4QF4A 1SFOB 1KLUD 2KCTA 4A3LG 2F0LA 3PIPA 4DR4H 1WE8A 1LTGD 4WJWA 4EC5A 3L2PA 4FXKC 1TY0A 2JA7H 3MEFA 4YY3L 4EQOA 2E2IB 4DV0Q 3EIVA 2PYKA 2J4XA 1ASYA 1A63A 3RZOB 5I6YA 3H3VH 4X62H 3E0JA 4C3IG 1VQOA 3MHBA 2R93G 3OSSD 3HKZE 2VQFL 2JN4A 3B6YA 3K5OA 1X4NA 2F4VH 1QILA 1VMCA 3K7AH 4B3RL 1QUQA 3BZCA 2F0QA 2FXQA 1CHQD 1H9JA 1KRTA 5KNDA 5IP7G 1MKHA 1PV4A 1SNMA 2N55A 3PUVA 4DK6C 4A93B 4DPGA 5C44B 1HRJA 4OWTB 3RZDH 1UE1A 1LV9A 4X62L 4H8AA 3M9BA 4F88A 1SFOH 1XMOQ 1CSPA 5EJWA 3CC4A 1B1ZA 1PHJA 1N32Q 1JQYD 4K5WA 4PG3A 3I2ZA 1B44D 5D3IB 1D8LA 1F2MA 1PTOH 2V4DA 3ICEA 1OXSC 1EOTA 3LWUA 4IQZA 4CJ1B 4IJLA 2FMRA 1XMQH 4DFAA 3NEMA 1BBXC 5EPJA 2F3VA 1HNZL 2NTSA 1RTNA 3VR6A 1RD9D 5C3WA 2L5TA 1QJOA 2ZTDA 4ME5A 1GUSA 4CDDC 4X6AH 2JA6H 3I72A 5CBAE 4BY7H 3ZJYC 4K0KH 3P75A 2F0SA 3PO3B 3TN2A 2DNCA 4PQXA 2BDOA 2MFIA 2WACA 4KD4A 4DGZA 2XNAC 1IBKL 3X3MA 4XTCS 4OX9L 1T9HA 3J7A5 3FRPB 1DOLA 1YIJA 1SMXA 2E2DC 1EIGA 4Y7NB 5FO9B 4ME3A 1NJIC 3HOZH 3UDGA 1U4RA 4MHEA 3KLSX 1STGA 2YU9B 2NVYH 2EY6A 1PRTD 4IJHA 1GUOA 3KDFB 1XMQQ 2A19A 4AYBG 4RCOA 1QZGA 4YWKA 4B3TQ 2I46A 2KQ3A 3NWTA 4ID6A 3HOVG 4L6TB 1J6QA 2B2YA 2EPBA 1AEXA 4JI6Q 3SK4A 4TSSA 1V8CA 3CMAA 4WFN3 1X56A 1I6HH 3BDLA 2FMMA 3GTKB 3UE0A 1BXTA 4DUZH 2D0PA 2A74C 5J1ZA 1H9KA 3WDNA 5LMNW 5IYDH 3V2TA 1V1QA 3PO3H 2CPMA 1B3AA 1BBWA 1Q12A 1ET6A 1PH9A 5DAUA 4AYBE 1CM9A 1ZXTA 2PMZE 3CPWA 3G4SA 5JJLA 1UUPA 3T16A 2WAQB 1CKNB 1IXRA 3NXWA 3C46A 2K75A 3AFPA 2AWOA 1YI2A 4UDUC 2ZXOA 3DWPA 1N8RC 2YU9H 4ULLA 1E1OA 3RZDB 1YJWA 1Q1BA 3L7ZC 2K5QA 3MFYA 3H0GH 1Q3LA 1HNXQ 1YJNA 1PRTF 1JE5A 2TSSA 4FJSA 3GTJB 1NR2A 1LO5D 1V8QA 2VB2X 4HJAA 4LUZA 2E2HB 3MEHA 3K58A 3S14B 5DM63 1J5KA 2QCPX 1A3UA 1G91A 1N33H 1S5BD 4GLXA 1QOHA 4J8QA 2H5XA 3AU7A 1HR0W 2LY7A 4A3IH 1ZYRD 1A3TA 5CR3A 2E5LL 1A62A 1BR9A 3BVGA 2Z9HA 3NP8A 2EY2A 2KHSA 4N8FA 4HJ7A 1IBLL 3GDEA 3I4NG 2ZM6L 5IGGA 1FVIA 1ESRA 2OXPA 3UE1A 2PQAA 1JMCA 4HIKA 4DR3H 3NPPA 5ELBA 1LTSD 1NMFA 1Q8IA 1Q90A 2XSCA 4F8MA 4R1JA 1WHRA 2N88A 3PIOA 2AQ3B 4QMGA 2ANRA 4RWSC 3SVMA 3M3YH 1K0RA 3T51B 2Y3MA 4DV2Q 3K80C 2F0FA 3CC7A 4L5SA 5IT9L 2WFWA 4C3IB 2E2HH 2Z4IA 1WTQA 4P73A 4LF9L 3S2DH 2YTVA 3AYHB 1X9NA 2ZTCA 1S4ZA 4K2KA 3GTOB 1OTCA 4UY8C 1HNWL 4P71A 1HZAA 2DJFC 5BN3A 3JAMW 4DV4Q 2EE1A 3I4MG 5FK9C 2VQFQ 3RF2A 1YZ6A 2B63H 1R9TH 2CTMA 1Y8PB 3I8ZA 2Q2TA 4JI7Q 5M3MG 5FO8B 1IBKH 2P5ZX 2VL6A 3A5ZB 1Y1WB 4BA1I 2HHHL 5JVH3 4UPAA 2UU9L 1N36L 5IY0A 3QJYA 4YHHL 4FVMA 5EBCA 4DNIA 4HSPA 4ZKBB 5NUCA 4JI4Q 5GADC 3M4OB 3DLLA 2ZTEA 3GABA 2VUMG 1VQNA 1WCMG 1PQXA 3HFZB 3J81W 4K8JA 3SEBA 4UP9A 4Q5VA 1VQ5A 1P8LA 5M5WH 2RSOA 3S1MH 4OCHA 3TP8A 5IGEA 1YNNC 2UUCH 2K1HA 1EWCA 2O4XA 3T1HH 1PYBA 1NTGA 3U4ZA 2PY9A 2MP1A 1FNUA 4L8JA 2M00A 3GTPB 3CHBD 1R9TB 1CUKA 2J7ZA 4YIJA 5C3EB 3U9SA 3A7AB 4K0KL 3MXNA 2LSSA 2EDGA 4DAYB 2CWPA 4LF5H 2EQSA 3OHXC 5K36H 1FYCA 1A2UA 4DV1L 3PIO3 1PXUA 1IL8A 4KLKA 1J5EQ 3DM3A 2D0OA 4QL5A 1WOCA 1EIHA 1HH2P 3H0GG 2PQEA 4A3MH 4AQYL 3FMCA 2E2IH 2K32A 5M5WB 3S1MB 4P74A 4IFDJ 3S15H 1FGBD 3EBEA 3S1RH 1TWHH 1TWCB 1CKOA 2D9UA 3UDIA 2EOTA 1TUAA 4DV6L 5D3DA 1JOQA 3E5SA 1QB5D 3FHWA 1QVGA 3AQQA 4BS9A 3QOLA 1HR0H 3QWNA 5D65A 4RGTA 5EKKA 4V0BA 3OYYA 4JI0Q 4CKEA 2L11A 2VQEH 3K59A 1SE2A 1IBLH 5JEAJ 1HNXH 2NVYB 3I4OA 1K3RA 4HJ8A 1HPCA 4DR6H 4K6LA 3EQLC 5I2XA 1E2ZA 1N34Q 1D1IA 3RN5A 1VIHA 1Y1WH 1BCPC 2VNUD 3IL8A 2EYPA 2A6ED 3S1NB 4DV2H 3A0JA 5LMUL 1FJGL 3GTKH 3M7GA 3M4OH 1YHAA 3V96A 4A3FB 2K5HA 4R4TA 4CHTB 1EY9A 1WTHA 1SROA 1STNA 2R7FA 3J7AK 2H1EA 3PQIA 3I7FA 1I94H 3H15A 4X64L 4J6HA 3A74A 2PZTA 1RKNA 4ZYSA 4EQPA 1RIPA 2F0TA 4CKCA 4JI1L 3K6OA 2F3WA 4JI5H 3VA7A 3I3CA 5C0XG 2E5LH 4RGOS 2SNSA 3BS1A 2B29A 2ES2A 1NSNS 3O13A 1V1PA 3OIQA 4KHPH 4C3JG 4JV5L 1HFGA 5ELDA 4V190 5C3EH 5GAHC 3M4QA 4R4CA 4OO1H 1CK1A 4IOAA 3GQBA 3HOYH 1HQRD 4JOIA 4GKKL 1LTRD 2E75C 3NQIA 4DAMA 4CKBA 1DGSA 2OQ0A 4CJ2C 1EY0A 3HS0C 3OETA 2NVXH 2IY5B 2HQLA 2CWAA 5LL6S 3I4LA 3IAYA 3R8BA 3PO2G 5C4XH 1XNRH 2K28A 4JI3L 3I4MB 1ICFB 4L63B 4LF9Q 2K1BA 3NBHB 1HHVA 1UEAB 4E9JA 3TSSA 3CCRA 1SE8A 1OXVA 2C5CA 3S2HH 1XX8A 2F0NA 4LFAQ 2HCIA 1Y1WG 1D7QA 4DV3L 4RGNA 3G48A 4DXGA 5FJ8G 3MVVA 1Q7YC 4GS3A 1HA6A 4LF6Q 1XPUA 4GN3B 4X65H 4KY5A 1UE7A 3HOUG 1EL0A 2UUCQ 2K5DA 3AFQA 4H02A 4KHZA 2L55A 4FXDA 1EEFD 1WCMB 3JAME 1LTBD 1YEZA 5CV5A 4DV0H 2RVLA 2K03A 4A3GB 4JW0A 1LTTD 3DWAA 2QKIC 2KCMA 1UWVA 4A3BB 1EYCA 3EN2A 5COYA 4MTNA 2CH4W 4LUOA 2D62A 4DV7L 2B63B 5FO7B 4HN7A 3D31A 1AN7A 2F4VL 3W1BA 1J5EH 5EKLA 1QWYA 4HSVA 4QUFA 3Q0AA 3HOWB 1H9SA 4IPDA 3U4VA 4X65L 3S1NH 1ONLA 4C3JH 2JA5B 2KBNA 4A4IA 4LFCQ 1RF2D 4BXXH 2QEXA 2XVSA 5C3EG 1DTJA 1WD1A 1D5XC 1S20A 4X3SA 5FLXE 4LF4H 1HJPA 1MBYA 3Q24A 4IUVA 4KHPQ 1SNQA 4WANA 4AIMA 4GOPC 2K5NA 1EIFA 4JI2H 1I6VC 4A3LH 2PT7G 3ULLA 4Y7NH 4DV1H 4K6DA 3CCVA 2EZVA 2KECA 4X66L 1I94Q 4QY7A 3J80i 3GP7A 1H9MA 3JAMc 3W3AA 1W3SA 2LXKA 5BN5A 1SYEA 1VS0A 1R4PB 4AQYQ 2FFKB 2NZ1D 2HHHH 1GM5A 2WV6D 3CRLC 3S2DB 2CCZA 2IW3A 2RQXA 2YYZA 4ZRZA 2VS1A 3KF6B 4DUZL 2JA5H 1QVFA 2HIXA 4A3EB 1SJED 1XWEA 1A6XA 1EZ8A 1PVOA 4X3UA 2NZHA 2VKCA 4NXMQ 4FF4A 3T1YH 1EEID 3VDYA 1PH7A 1IBLQ 4JI8H 3U9OA 3NBHA 4KD3A 2VQFH 3CCSA 2IHFA 1GUWA 3K5MA 4FDBA 3W5OA 2UXBQ 5M3FH 4R8NA 1XNQL 1L1OC 3KF8B 2O5IC 4RA8A 4JI6L 2XWJB 2L4NA 4RFBA 2HDMA 1K0SA 2UUBH 1HUMA 2EYJA 2M8WA 1WJJA 4EVOA 1R4QB 4GLAC 5IGDA 1K73C 3OPOA 3JAML 3OSOA 1HNZQ 1O7IA 2OPUA 5ISRA 2OPVA 1SXTA 3S14H 5A2QE 2QDLA 1UE6A 4LJZC 1H95A 1Q1EA 2B8GA 2Y0SE 1K83H 4DR1L 4A3IB 1X4MA 3TP7A 4LF4L 2XTIA 1ZZJA 4QIWE 3RLOA 1GUNA 4OIJA 4RG1A 4LF8H 4JI7L 3AMUA 4C3JB 1S5DD 1K1GA 2JA7B 1XJVA 5CV4A 5M5YB 1JICA 3BVZA 4OELB 2OT2A 4DA2A 1WTVA 1F9PA 2DY7A 1ENAA 2JEBI 1WD0A 2IWHA 4JV5Q 1TT2A 3I0PA 3TZUA 3D4WA 2BE5D 2IX0A 1I6UA 4A3MB 1AN8A 3T1HQ 2CQOA 1C7YA 1PH4A 1EQRA 1BQQT 2B2UC 4LF5L 4JC0A 4GN4B 1JB3A 1EY4A 4EQNA 4CDEC 4DR7Q 1K28A 3H09A 1TWAH 1CSQA 1HNWH 4NMZA 2LKVA 4DR4Q 3MZ5A 1BCPF 4KKTA 5IWAL 1PH8A 4YWMA 2ZM6Q 4NKLA 5C0XI 1F9SA 1SNOA 2Q8TA 1EYDA 1X9ZA 1S5CD 3CP0A 4NXNL 2ZM6H 4OXPA 1BKBA 4K5VA 1GHKA 1N36H 1HCZA 4HCSA 1HA5A 5C4JH 4XDXA 4GKJQ 4ZUJA 3GO5A 1IBML 4LIJA 3DMUA 2JXMB 4KI0A 2PMZB 4DR6Q 4J1MA 1XPOA 1B3QA 1BDOA 1KC8C 4A3BG 1YJ9A 1SMYC 5C4XB 4X3TA 4PMCA 3ZYYX 4I7AA 5I9PA 1ENFA 3W2DA 3I4MH 1LT6D 2RCNA 2MHVA 3HKSA 3K0XA 3F1ZA 1LM0A 2N8NA 3KLSA 1TWAB 1TWFH 2KENA 3NE5B 4BA2I 2K50A 3SDZA 1YNXA 5JEAG 2JA5G 3F2UA 2RBMA 3QOJA 4DNTB 4QGUA 4OHJA 1WTRA 1MHWC 1ET9A 3L9AX 1D5MC 2K33A 2HHHQ 3NCVA 1N36Q 2PZUA 4B3SQ 2PCFB 4JK1C 1G6PA 5C44H 4C2MH 5C3XA 1VQCA 4PNYA 4N8X1 2Q8RE 5I9OA 1K83B 1XMQL 1TS2A 3G6JB 1KQSA 4A3CH 1TKWB 4DK3C 1XNRL 4GOPA 5M3FG 1A2TA 1QVCA 3BZDB 1PFMA 4NPSA 4JI1H 4X66H 2B8FA 3ND8A 5M5YH 2G9DA 3FKIB 5LL6X 3RLNA 4WJ3M 5FLXc 5IYCG 1ILQA 3CCQA 2SDFA 1ENCA 2XIWA 4C3HB 2G9HD 4CJ0B 1KXLA 4BBRG 4KK7A 1AW7A 1NNXA 1TR5A 3QG1A 1Q81C 5JAVA 4OX9Q 1WYDA 2K52A 3KBXA 5FLMG 3KLWA 1BF4A 2CPQA 1ZEQX 2E8GA 2BA1A 1LACA 4DV7H 5CV8A 5C5MA 1RHPA 1ZKOA 3L3OC 3FVQA 2JQOA 1EFID 3OWEB 1DM0B 3PF4A 2ID0A 4DAYA 5GROA 1ZYRC 2UUAH 3H91A 1EWHA 4KY6A 1IL2A 2DGYA 4LFBH 3HOZB 1ESFA 1STAA 2R93B 1X55A 4JBJA 3IFDA 5CBEE 1TS4A 1BNZA 3E9HA 1L0YB 1ZZIA 4YCUA 1YHQA 2M6QA 1GKHA 4G57A 4HMIA 1SYCA 4JI2L 3HKZB 2A73B 4A93G 3BDCA 5C44G 1U5KA 5DLQE 1TS5A 4HCEA 2WB1G 4A3DH 3W1GA 2EYHA 1PZID 4RKBA 1T5EA 5IP9H 1TS3A 2F52A 3BJUA 4HTHA 3TP6A 3J81E 2LFNA 4LF8L 2KUMA 4B3SH 4RH6A 3K81C 2JA7G 4GZYC 4LFCH 4QCLA 1GHJA 3EFXD 3KJOA 3D8GA 2NVTB 1CHPD 5LMUQ 1B9MA 1VQAA 1E1TA 2NWGA 4C3IH 4C1NK 1HXYD 4L5QA 3RUZA 1B8AA 2PQAB 2HQEA 4GLVB 2HT1A 1WVNA 3GTJH 2IJ0A 1EFWA 3M7NA 4YHHH 1G51A 1SBBB 1E2WA 3J7YW 3SK5A 3A56A
chains in the Genus database with same CATH topology
3J7ZC 1NAPA 2F4VQ 3FKIH 1H9RA 2I5MX 1PH3A 5TSSA 1VQMA 4JI0L 4FF1A 3RN2A 3PUYA 1X3GA 5CYUA 4TVAB 3F2BA 2RF4A 1SYFA 3J7AF 4CGYB 2F4IA 2NYZD 4C3HH 4O42A 2SEBD 2OTLA 2NN6G 2K6AA 2F0UA 1SJHD 3HOXB 4DU9A 2XRQD 3ULPA 3IFTA 1XNQQ 4AYBB 2XN9C 4DXFA 2XWBB 3KUPA 1KRSA 4XT3B 4NDXA 2GA4B 3SK8A 4KKUA 1IKLA 3I56A 3PF5A 3R2IA 4FF2A 5EAYA 4GKJL 3NTHA 4BWGB 1FJGQ 3M3YB 2HUGA 2IL8A 5HGQA 4Z9CB 1X3QA 2E2JH 1U9RA 3OW2A 3GTGH 1YVCA 3M4YA 1M4VA 4K5XA 5IT9E 5HY6A 3KF8A 1MJEA 1EY6A 3MXGA 1E0BA 1Y1VH 1I4XA 5A35A 1NUCA 4DAVA 3G6EA 1L1OA 4IUUA 4BBRH 4JI1Q 2F0MA 1BBUA 1LT5D 4H13C 1D5ZC 4DUZQ 4XQNA 4NP5A 1XTCD 2VXWA 3NELA 2BL5A 3BZKA 2QEJC 2MUYA 1I4QA 1A8VA 1II3A 4WRDA 3CU7A 2AKWB 1KIXA 2LMCB 2EY1A 3E0EA 2UUCL 3J7AV 2CVRA 4LF7Q 3P7JA 1RL2A 1ILPA 3H6MA 2UXDQ 4B9XA 1B7YB 4DV6Q 4HIMA 4B8TA 3I90A 5CORA 4PZ8A 2R7ZG 4JBWA 1LUZA 2VQEL 4LF5Q 2F1MA 2NN6I 4BXXG 2A6HD 1LLRD 1J9OA 3Q6SA 1JC7A 3VR4A 1CI3M 3MTSA 4E6IA 4K0KQ 4UAIA 2Z4HA 4XT1B 4C2MB 3L0OA 1A3VA 2X69A 4IFDH 5IP9G 2GVBA 1VQJA 4LF4Q 5FLMH 2XRSD 1VQ4A 3Q22A 3RLFA 4JI8L 3SK6A 4PZ7A 2X6LA 3GTMB 4OO1I 4DR3L 1I94L 3GD7A 3NWSA 5C4JB 1UEBA 3AB9A 1H9SB 3HOZG 2ZJQA 1VQLA 3FPUB 1Z9FA 4ZLTF 1QCBD 3K7AB 2FINB 4A3FH 3OTOL 4RHRA 4OONA 2SOBA 2EXZA 3DHQA 3MXUA 2ZXPA 1MSHA 4P2CB 1SSOA 2ZJPA 3BYTB 1HFNA 5CC4A 3A54A 5JPNC 3T53B 3HKZG 4XIGS 1IYJB 4X65Q 1C8CA 2DUDA 1BOSA 5M3MH 1RODA 3KK7A 1EQVA 1K8AC 1FD7D 2FJ2A 2WKCA 2L0CA 5FLXL 4J15A 4JI2Q 3ER0A 3GTGB 1VQKA 2PQUA 5JJZA 2MGSA 2BDNA 1ML0D 3CRKC 1MSGA 3NQTA 1LYLA 2Z1CA 4GKKQ 1AE2A 1N34L 3GTMH 2L12A 2FMCA 1U4MA 4OIKA 2R7ZH 2WINB 1M1KC 5E4WC 2KJXA 2VW9A 4BBSB 5EPKA 1MD2D 1B70B 1SNDA 1SEBD 2YTYA 3TS0A 1Q8KA 5IODA 5M9OA 4IN3A 5I2YA 1YNJC 1ICWA 4DR5Q 1KLGD 1M8AA 4KKSA 1M90C 3NTKA 2D2CC 2OWOA 1STEA 4L5RC 4ZK9B 1A0IA 1DONA 2D5DA 4KHVA 3K8AA 2JA8H 1ZTGA 5LMNQ 4POFA 3A7LA 1KDAA 3JC66 3VR2A 2OCEA 4EX5A 2EVBA 5JOBA 1J4WA 2N3SA 1KNAA 4HIDA 2ZXRA 3H3VI 3SGIA 1PMRA 3UI2A 1SMYD 5KEEA 3DM1A 4IOCA 3ND9A 3URYA 4C1NI 1WVLA 2F03A 5DEHA 4FO2A 3K7UC 2BCOA 3S17B 1CQFA 2ENBA 2UXCL 5KRUA 4XQJA 1CKNA 2UXBL 2A69C 1Y69U 2R92B 3M85A 1XNRQ 1WTOA 2K5VA 2JVZA 2RDGA 1UE5A 4HMJA 2BH8A 4QIWB 3VR5A 1GOZA 1RTOA 1EIYB 1NE3A 4WORA 1E3PA 4APVA 3K0YA 3HOWH 3GTLB 5EGTA 1K9MC 1XYIA 4B9WA 5GAEC 3LNNA 3T56B 3AEVB 1G2TA 1LT3D 4BY1G 3BYYB 2F0VA 3T4AC 4G7OC 1A15A 3D4RA 2Z6KA 1B4OA 1TWFB 1P16A 1N9WA 2B39A 4RCNA 1VF5C 1L0XB 1PLFA 2L1BA 4G4KA 4DV3Q 2UUBL 2PI2A 1CFMA 2HH2A 1VQ6A 3NK9A 5KGUA 1F2YA 1S72A 1KDBA 2KEDA 5GAGC 1EY8A 2ICIA 1VQHA 1Q86C 3A8JE 1K8GA 4PMWA 3SXHA 2K05A 1IBMQ 3PGZA 3C3LA 4DR6L 2MNAA 3S24A 1N33Q 2KCCA 4P75A 5AJ3L 2BA0A 5BR8L 1IZ6A 2F0GA 4A3FG 1QZHA 4IUNA 4G7HC 5EQ0A 3PMFA 1AZPA 1T5XD 5JEAH 4BBSH 5ELFA 5IP7H 1OXXK 1F9QA 4LFCL 4NXML 1Y8NB 5I4DA 1SE4A 1C48A 1I50B 1HQMC 4DR4L 2BH2A 1NMGA 5GQOA 3MC0B 5JVG3 3HOVH 2A6HC 4R4IA 3D0FA 1F2ZA 1STHA 3Q23A 2HH3A 1SRUA 5K36G 1WI5A 1D2BA 2CW0C 2N49A 4FYDA 1HZ9A 1BVSA 2JEAI 3VA5A 1VQ7A 4N9TA 5EPLA 3CCJA 4DR3Q 3KDFA 4BY1H 4DV0L 4JI3Q 1PZKD 1TWGH 3G71A 2Q2IA 4IPCA 2R93H 1SYDA 3IRBA 4NB3A 3T1YL 1GO3E 3P20A 2JE6I 3PCOB 1D1KA 4JYAL 1CZWA 4LFAL 2ANNA 2A5HA 1Y1VB 4LF6L 3FP9A 5ELEA 5IGBA 5E1FA 1D6EC 3I73A 1XXGA 4TRDA 2QNDA 3CF5A 4FNFA 4B08A 2IHEA 4S3SA 2EIFA 2LS01 4K2LA 3HOUB 3V69A 3U1KA 1AFPA 4OGQC 2F0JA 4IUPA 3TREA 3T1HL 2AQ1B 3NBIA 4BBSG 4A3CG 4RHSA 4UP7A 4MIUA 3J80E 2UUAL 3TS2A 5T1GA 1CT1D 1U4PA 5CV6A 3EVQA 4QB4A 3J81j 2JA9A 1G291 2CKZB 1XPRA 1Y14B 3U50C 1JCKB 1X32A 3I4NH 3I55A 4POGA 2FHTA 3GTPH 3V05A 3HOWG 1QNUA 4KHPL 3CCMA 2O5JC 4DR5L 3OMCA 5G3LD 3PO3G 1JWSD 3QIAA 2Z8LA 4IO9A 1WTXA 1KL9A 4QUCA 5LMNL 1PRTB 2WIIB 1HTPA 3J81L 3CC2A 4KN7C 4JVHA 3MAQA 3RD4A 4RGMA 5FOBB 1IBKQ 1F77A 4DR2L 1O80A 4GNXC 3PV0A 1SNPA 1B50A 4A3JB 1CA6A 1Z7TA 2IX1A 5KYIA 2R92G 3M4PA 1PFNA 1I4RA 1NCVA 3QB3A 1X54A 2QF7A 5D14A 5C6AA 2UXDL 1O7ZA 5IGCA 3S1RB 2JYOA 1C0AA 1DCZA 1IHZA 4KN4C 3S16B 2KVMA 1DT4A 4BY1B 4HR7B 1SN8A 5IYDG 2PZWA 1LTAD 2PO4A 3LX0A 3NUCA 1QNKA 5CGKA 4GNXA 1E22A 4U68A 3FEWX 2LXJA 4I65A 2NN6H 4MN3A 1O7LA 3J81i 2CTKA 2WAQG 3S17H 4DUYL 1PTOB 3TDQA 1KAWA 1E2VA 5E7NA 1OXUA 3MWYW 4IURA 4G7ZC 3CQZB 4Q0FA 2YV5A 4NBQA 3NENA 3WOFA 5C0XJ 3K5LA 3HP3A 4PV1C 2AUKA 2K7VA 1SYBA 5ELNA 3KOJA 1WFQA 4YY3Q 1CKMA 3CD6A 1LABA 2ICEC 3HOUH 4WJ4A 2NBFA 3K57A 4DNRB 2CHBD 1GXDC 1GD7A 4XYQA 2HIVA 1SDFA 4A76A 3N6RA 4A3KH 1B53A 3DEPA 1SR3A 1X65A 4DR1Q 3D6CA 1TVXA 2EJGC 2KCNA 3RMHA 4A3IG 2P2RA 4NW2A 2WAQE 3OW7A 1VQIA 3I4NB 4JCVE 4EQ5A 4HJ9A 1PYWD 4DV5Q 1HUNA 3PSIA 1S40A 1PFSA 3D4DA 4X62Q 2RSNA 4IFDI 2AHOB 3S9WA 1W6KA 3TBIB 3S1QB 5JJIA 2K4KA 1PH1A 1IW7D 2VUMH 1MJCA 3F2DA 2OTJA 2ASBA 1V1OA 4F7XA 2F3IA 1DOKA 1I4PA 4YCWA 5J3BA 2AUJD 2F0OA 5IE8A 2F0PA 4ZKCB 3BDOA 2NVXB 4DR7L 2AMCB 3PIP3 1OXTA 1PTOD 4A3JH 3RNUA 4JI5Q 2M9VA 4HAEA 3R3OA 1Q82C 4FP5D 1PH5A 3CCEA 4F87A 2PNRC 2L15A 4HEDA 1IKMA 2KOLA 2C9OA 2NUCA 3S2HB 2ATWA 2JSOA 1VQEA 1VCIA 1Y1VG 2ALYB 5M3MB 1CTMA 5CV9A 2JZXA 5EKIA 3OOCA 2A68D 1KHIA 4XYOA 2QA4A 2QGQA 2B2TA 4DK1A 3CCUA 2EJMA 2VUMB 1AP0A 4O1NA 1EU4A 4X3KA 1WCMH 2CFMA 2Z6KC 4ZUIA 2UXCQ 2DN8A 2F0HA 2EJFC 1W6JA 2M2LA 2K01A 3CQZH 3GV3A 5AJ3Q 1JJGA 4B3RQ 1SAPA 3FDTA 1STBA 1EU3A 3TEHB 4K8IA 3F2CA 1STYA 5IT9c 3TP5A 2PPBC 5IIFA 3R93A 1JOKA 4FXGC 3RR5A 5KIXA 2A1AA 5H1SE 1HR0Q 2E5LQ 4B3SL 1JT8A 4I7ZC 3STBD 1QUQB 1K8MA 2JK8A 2MQHA 1WTPA 3VYSA 1JORA 2I5LX 4LAAA 1YNND 2F0EA 4LF8Q 3CXCA 4JOIC 4A3DB 1KDCA 3HOXH 4M8AA 3VYTA 1SNCA 1JE4A 1AH9A 3VYUA 3IKJA 1IYVA 5KNBA 4M1UB 4XQQA 3H0GB 4JG2A 1TU2B 4A3JG 3GTQB 4H7BA 1RJTA 3CMEA 3PO2H 1L0WA 1GUTA 5IGFA 2R92H 4DR2Q 1FR3A 4LFBL 5IYCH 1I5FA 3KJPA 1IYUA 2E2JB 2NVQB 1J8IA 3Q8DA 3I70A 1NR4A 1TWGB 3HEJA 2KEEA 4KJOA 5KYLA 4DV4L 3GTLH 1EQTA 1IW7C 4BBRB 2CTEA 3SR1A 1PH6A 1S5FD 4K14A 2F0KA 4OWXB 4B3MQ 1KNEA 2MPMA 3CKIB 4OWWB 2ZJRA 1VIGA 4LF7L 1I4HA 5AFWA 1I4GA 2V1CC 4JI4L 5JPMC 3FPPA 1I3QB 2K04A 3BVMA 4DUYQ 3EROA 2I0QA 4KY7A 3HOYG 2AXYA 2F0IA 3WOEA 2EXDA 2XGTA 3KYHC 3KFUA 1W2BA 3ITPA 3S16H 2H4OA 4H44C 4R9WA 1LTID 4IPGA 1BCPD 2Y0SB 1V43A 5T1IA 1B2TA 3T1YQ 2JA6G 1S5ED 2RHSB 2WB1B 2VB3X 1X3PA 4N9PA 4PZ6A 2Q2UA 2KHJA 1CQVA 4TKOB 1MIUA 1SYGA 2YQRA 5F2DA 4IUTA 4L5TA 5IOCA 1VQPA 3OWFA 4IPHA 3AEVA 3F8TA 5FJ8H 3D6WA 3UDXA 4DV1Q 5EBDA 4XXEA 1JB7A 3S15B 5A2QL 3PUZA 1TQOA 4DV5L 5C4HA 1DXMA 1TWCH 2EYMA 3I91A 3CW2C 2PNHA 1VQGA 2B2VC 2PI2E 1YBYA 1Y8OB 3JAMi 2OEOA 1LT4D 4U673 3D3RA 3EA6A 4B3TL 4A3KB 2J0TD 3U58A 1DZ1A 4O0AA 1G6ZA 3QO2A 2VQEQ 1LTLA 4R4QA 4BY7B 5E3FA 2WKDA 3OIPA 2B2WA 1X3FA 3PO2B 4KV6A 5IYBH 1F9RA 3TZDA 1GJXA 1TXYA 2IX3A 2NTTA 2PW5A 4O2DA 2IT1A 2B2VA 4DK0A 2KA7A 3EJIA 1N32L 4UP8A 3STBC 3BG3A 4KMUC 1EZ6A 1DOMA 3LWEA 1Q46A 1VQBA 2OF1A 4ODGA 4JI8Q 2RDHA 3HOXG 2E3UA 4H0LC 1PFBA 1BO0A 1O7YA 1HZBA 5C4ZA 1HNXL 5I6WA 1Z6HA 3J80c 1XTDA 2B2TC 4A3GG 1G2SA 1F2LA 2OQKA 1N33L 1I6HB 4LUVA 1X6OA 1TWHB 4GOPB 3P1HA 1MGSA 1I3QH 1TY2A 1VQDA 2B63G 1U4LA 2GVAA 4LWCA 1BCPB 4X64Q 3OMGA 2A68C 3J80L 2MO0A 2K14A 3MA2B 5DM73 1S3OA 3LGJA 1E24A 2R61A 4C56C 3K5NA 5ELCA 1YITA 2BE5C 1YNJD 2UU9Q 1XMOL 2EYOA 4YHHQ 3CPFA 3DEOA 4ZAIA 1HR0L 1C9OA 1VQFA 1NY4A 3X3NA 4A75A 1QG7A 4A3DG 1PDQA 1VF7A 5G3LF 4HIOA 4LNQA 3N52A 2B2UA 4FF3A 3SE0A 4ILWA 4DF7A 4ABNA 2B3GA 1GVPA 5IYBG 4JBKA 2R7ZB 1VQ8A 1PA6A 5ELOA 3E6ZX 1AE3A 2EY5A 5KNCA 1EYGA 3A55A 5E4XA 1O78A 2Z0SA 1KAAA 2I07B 4IUQA 4JYAQ 1BUVT 1G8ZD 3H94A 3NSWA 4IALA 4A3EG 2MO1A 2L9HA 2F0WA 1RDPD 5BN4A 2JA8B 3DUZA 2AQ2B 2DGRA 4A3GH 1PTOF 2JJQA 1JJ2A 1U0LA 3MXNB 5C5LA 3ERSX 3OTOQ 1EWIA 5J39A 1FNVA 3HOYB 4Y52H 1JOOA 2ZT9C 3DWQA 1B9NA 1QE6A 3MXPA 1JJCB 4LK1C 1EY7A 1AZQA 2NVQH 1EOVA 1L2FA 4DV7Q 4CBVA 2WB1E 1FNWA 1GUGA 2YTXA 3ERQA 4ZQ3A 3ONAB 1SE3A 5CMDA 1E7ZA 1SLJA 2Y0SG 4TQUS 2CTJA 2VZAA 1I50H 1VQ9A 2EYLA 2DNEA 2JA6B 3G7LA 2IPKD 1KABA 2MJ8A 1EUJA 2F0DA 4DN4M 2KHIA 2WP8J 1FGUA 1JWUD 3BU2A 1JWMD 4AM3A 4YWLA 4MZ9A 3H3VC 4GNXB 2NVTH 1KD1C 3HGBA 2R6GA 4LW1A 3S1QH 5LHY1 3VR3A 1DYQA 4X66Q 4YCVA 3A8IE 3WWVA 2Q2HA 2RKSA 4A3KG 5BR8Q 2GN5A 4A3MG 4RMFA 2CTFA 3GTQH 2R7DA 4A3BH 4JVYA 1HNWQ 4LFBQ 1FL0A 2RA4A 5DNFA 2HCCA 2I5HA 1DJRD 3ULJA 2JP1A 5HGTA 4BY7G 1RCVD 1PZJD 1DD2A 2A69D 3PUXA 5J22A 4QJFA 1UNSA 1PRTC 1V9PA 1X3EA 1EC6A 2B2WC 3A5UA 3TMEA 2NZOA 4DAPA 1VDZA 2CQAA 4OL7A 4B3ML 2EYFA 4DKAC 2R3ZA 1HTLD 5IWAQ 1CZGA 1ASZA 4R8IA 4RKLA 4KTAA 1PYSB 3KF6A 3MFGA 1VMPA 3VYRA 4ALPA 1EY5A 2B2YC 3KLRA 4IFDG 4DV2L 1V1PB 4NXNQ 3HOVB 3CCLA 2TMPA 2E74C 3J81c 2AWNA 5K5PA 3E9IA 3HRZC 3PUWA 4A93H 1JR0D 2PW7A 1TIID 4R4OA 3GTOH 5C4XG 1ZZKA 2QILA 2N78A 3CAMA 3NHHA 1EQQA 2K5WA 1KHMA 5M5XH 3KBGA 1Z47A 3HZXA 2X6GA 1WTWA 2UUBQ 2NB0A 4MNOA 4A3EH 3TRZA 2MJHA 3C2PA 1PTOC 2A8VA 4JBMA 3TQYA 5FKAC 3A8KE 5C0XH 3T13A 2QDBA 3R2TA 1PH2A 4HJ5A 1J5EL 4QQBX 5HURA 3GV6A 1HZCA 4GN5A 2RDFA 3C1EA 3NTIA 3C1FA 5M3FB 4RAUC 5CV7A 1C4QA 1OO9B 4OO1G 2C35B 4WALA 3RZOH 1EYAA 3HG9A 2Q8IB 2O2LD 2UUAQ 2CW0D 1CA5A 1YHBA 2CTLA 2HDLA 4KJNA 4EGVA 3FKIG 4P72A 5JJKA 1L1OB 2RHQB 2VY3A 4PMBA 1KTKA 2DY8A 4LMQD 1MI2A 4JI5L 3DXJC 5M5XB 1K8OA 4C3HG 2E76C 3UDFA 2BOSA 4IZ8A 1NBWA 3VKEA 2SNMA 4QMFB 4AH6A 1UAPA 3SHLA 2A6EC 2JA8G 4QF4A 1SFOB 1KLUD 2KCTA 4A3LG 2F0LA 3PIPA 1WE8A 1LTGD 4WJWA 3L2PA 4FXKC 1TY0A 2JA7H 3MEFA 4YY3L 4EQOA 2E2IB 4DV0Q 3EIVA 2PYKA 2J4XA 1ASYA 1A63A 3RZOB 5I6YA 3H3VH 3E0JA 4C3IG 1VQOA 3MHBA 2R93G 3HKZE 2VQFL 3B6YA 1X4NA 3K5OA 1QILA 1VMCA 3K7AH 4B3RL 1QUQA 3BZCA 2F0QA 2FXQA 1CHQD 1H9JA 5KNDA 1KRTA 5IP7G 1MKHA 1PV4A 1SNMA 2N55A 3PUVA 4A93B 4DK6C 5C44B 4DPGA 1HRJA 4OWTB 3RZDH 1UE1A 1LV9A 4X62L 3M9BA 4F88A 1SFOH 1XMOQ 5EJWA 1CSPA 3CC4A 1B1ZA 1PHJA 1N32Q 1JQYD 4K5WA 4PG3A 3I2ZA 1B44D 5D3IB 1D8LA 1F2MA 1PTOH 2V4DA 3ICEA 1OXSC 1EOTA 3LWUA 4IQZA 4CJ1B 4IJLA 2FMRA 4DFAA 3NEMA 1BBXC 5EPJA 2F3VA 1HNZL 2NTSA 1RTNA 3VR6A 1RD9D 5C3WA 2L5TA 1QJOA 4ME5A 2ZTDA 1GUSA 4X6AH 2JA6H 3I72A 5CBAE 4BY7H 3ZJYC 3P75A 2F0SA 3PO3B 3TN2A 2DNCA 4PQXA 2BDOA 2WACA 2MFIA 4KD4A 4DGZA 2XNAC 1IBKL 3X3MA 4XTCS 4OX9L 1T9HA 3J7A5 3FRPB 1DOLA 1YIJA 1SMXA 2E2DC 1EIGA 4Y7NB 5FO9B 4ME3A 1NJIC 3HOZH 3UDGA 1U4RA 4MHEA 3KLSX 1STGA 2YU9B 2NVYH 2EY6A 1PRTD 4IJHA 1GUOA 3KDFB 1XMQQ 2A19A 4AYBG 4RCOA 1QZGA 4YWKA 4B3TQ 2I46A 2KQ3A 3NWTA 4ID6A 3HOVG 4L6TB 1J6QA 2B2YA 2EPBA 1AEXA 4JI6Q 3SK4A 4TSSA 3CMAA 4WFN3 1X56A 1I6HH 3BDLA 2FMMA 3GTKB 3UE0A 1BXTA 3WDNA 2A74C 5J1ZA 1H9KA 2D0PA 5LMNW 5IYDH 3V2TA 1V1QA 3PO3H 1B3AA 1BBWA 1Q12A 1ET6A 1PH9A 5DAUA 4AYBE 1CM9A 1ZXTA 2PMZE 3CPWA 3G4SA 5JJLA 1UUPA 3T16A 2WAQB 3NXWA 3C46A 1IXRA 1CKNB 2K75A 3AFPA 2AWOA 1YI2A 4UDUC 2ZXOA 3DWPA 1N8RC 2YU9H 4ULLA 3RZDB 1E1OA 1YJWA 1Q1BA 3L7ZC 2K5QA 3MFYA 3H0GH 1Q3LA 1HNXQ 1YJNA 1PRTF 2TSSA 1JE5A 3GTJB 1NR2A 1LO5D 1V8QA 2VB2X 4HJAA 4LUZA 2E2HB 3MEHA 3K58A 3S14B 5DM63 1J5KA 2QCPX 1A3UA 1G91A 1S5BD 4GLXA 1QOHA 4J8QA 2H5XA 3AU7A 1HR0W 2LY7A 4A3IH 1ZYRD 1A3TA 5CR3A 2E5LL 1A62A 1BR9A 3BVGA 3NP8A 2EY2A 2KHSA 4HJ7A 1IBLL 3GDEA 3I4NG 2ZM6L 5IGGA 2OXPA 1ESRA 1FVIA 3UE1A 2PQAA 1JMCA 4HIKA 3NPPA 5ELBA 1LTSD 1NMFA 1Q8IA 1Q90A 2XSCA 4F8MA 4R1JA 2N88A 3PIOA 2AQ3B 4QMGA 2ANRA 4RWSC 3SVMA 3M3YH 1K0RA 3T51B 4DV2Q 3K80C 2F0FA 3CC7A 4L5SA 5IT9L 2WFWA 4C3IB 2E2HH 2Z4IA 1WTQA 4P73A 4LF9L 3S2DH 2YTVA 3AYHB 1X9NA 2ZTCA 1S4ZA 4K2KA 3GTOB 1OTCA 4UY8C 1HNWL 4P71A 1HZAA 5BN3A 4DV4Q 2EE1A 3I4MG 5FK9C 2VQFQ 1YZ6A 2B63H 1R9TH 2CTMA 1Y8PB 3I8ZA 2Q2TA 4JI7Q 5M3MG 5FO8B 2VL6A 1Y1WB 3A5ZB 4BA1I 2HHHL 5JVH3 4UPAA 2UU9L 1N36L 5IY0A 3QJYA 4YHHL 4FVMA 5EBCA 4DNIA 4HSPA 4ZKBB 5NUCA 3M4OB 5GADC 4JI4Q 3DLLA 2ZTEA 2VUMG 1VQNA 1WCMG 3HFZB 4K8JA 3SEBA 4UP9A 4Q5VA 1VQ5A 1P8LA 5M5WH 2RSOA 3S1MH 3TP8A 5IGEA 1YNNC 1EWCA 2O4XA 1PYBA 1NTGA 3U4ZA 2PY9A 2MP1A 1FNUA 4L8JA 2M00A 3GTPB 3CHBD 1R9TB 1CUKA 2J7ZA 4YIJA 5C3EB 3U9SA 3A7AB 4K0KL 3MXNA 2LSSA 2EDGA 4DAYB 2CWPA 2EQSA 3OHXC 5K36H 1FYCA 1A2UA 4DV1L 3PIO3 1PXUA 1IL8A 4KLKA 1J5EQ 3DM3A 2D0OA 4QL5A 1WOCA 1EIHA 1HH2P 3H0GG 2PQEA 4A3MH 4AQYL 3FMCA 2E2IH 2K32A 5M5WB 3S1MB 4P74A 4IFDJ 3S15H 1FGBD 3EBEA 3S1RH 1TWHH 1TWCB 2D9UA 1CKOA 3UDIA 2EOTA 1TUAA 4DV6L 5D3DA 1JOQA 3E5SA 1QB5D 3FHWA 1QVGA 3AQQA 4BS9A 3QOLA 3QWNA 5D65A 4RGTA 5EKKA 4V0BA 3OYYA 4JI0Q 4CKEA 2L11A 3K59A 1SE2A 5JEAJ 2NVYB 1K3RA 3I4OA 4HJ8A 1HPCA 4K6LA 3EQLC 5I2XA 1E2ZA 1N34Q 1D1IA 3RN5A 1VIHA 1Y1WH 1BCPC 2VNUD 3IL8A 2EYPA 2A6ED 3S1NB 3A0JA 5LMUL 1FJGL 3GTKH 3M7GA 3M4OH 3V96A 4A3FB 1YHAA 2K5HA 4R4TA 4CHTB 1EY9A 2R7FA 1STNA 1SROA 2H1EA 3I7FA 3H15A 4X64L 4J6HA 3A74A 2PZTA 1RKNA 4ZYSA 4EQPA 1RIPA 2F0TA 4CKCA 4JI1L 3K6OA 2F3WA 3VA7A 3I3CA 5C0XG 4RGOS 2SNSA 3BS1A 2B29A 2ES2A 1NSNS 3O13A 1V1PA 3OIQA 4C3JG 4JV5L 1HFGA 5ELDA 4V190 5C3EH 5GAHC 3M4QA 4R4CA 4OO1H 1CK1A 4IOAA 3GQBA 3HOYH 1HQRD 4JOIA 4GKKL 1LTRD 2E75C 3NQIA 4DAMA 4CKBA 1DGSA 4CJ2C 2OQ0A 1EY0A 3HS0C 2NVXH 2IY5B 2HQLA 2CWAA 5LL6S 3I4LA 3IAYA 3R8BA 3PO2G 5C4XH 2K28A 3I4MB 4JI3L 4L63B 4LF9Q 2K1BA 1HHVA 3NBHB 1UEAB 3TSSA 3CCRA 1SE8A 1OXVA 2C5CA 3S2HH 1XX8A 2F0NA 4LFAQ 2HCIA 1Y1WG 1D7QA 4DV3L 4RGNA 4DXGA 3G48A 5FJ8G 3MVVA 1Q7YC 4GS3A 1HA6A 4LF6Q 1XPUA 4GN3B 4KY5A 1UE7A 3HOUG 1EL0A 2UUCQ 2K5DA 4FXDA 3AFQA 4KHZA 2L55A 4H02A 1EEFD 1WCMB 3JAME 1LTBD 5CV5A 1YEZA 2RVLA 2K03A 4A3GB 1LTTD 3DWAA 2QKIC 2KCMA 4A3BB 1UWVA 1EYCA 3EN2A 5COYA 4MTNA 4LUOA 2D62A 2B63B 4DV7L 5FO7B 4HN7A 3D31A 2F4VL 3W1BA 5EKLA 1QWYA 4HSVA 4QUFA 3Q0AA 3HOWB 1H9SA 4IPDA 3U4VA 4X65L 3S1NH 1ONLA 4C3JH 2JA5B 2KBNA 4A4IA 4LFCQ 1RF2D 4BXXH 2QEXA 2XVSA 5C3EG 1DTJA 1WD1A 1D5XC 4X3SA 5FLXE 1MBYA 1HJPA 3Q24A 4IUVA 4KHPQ 1SNQA 4WANA 4AIMA 4GOPC 2K5NA 1EIFA 1I6VC 4A3LH 3ULLA 4Y7NH 4K6DA 3CCVA 2EZVA 2KECA 4X66L 1I94Q 4QY7A 3J80i 3GP7A 1H9MA 3JAMc 3W3AA 1W3SA 2LXKA 5BN5A 1SYEA 1VS0A 1R4PB 4AQYQ 2FFKB 2NZ1D 1GM5A 2WV6D 3CRLC 3S2DB 2CCZA 2IW3A 2RQXA 2YYZA 4ZRZA 2VS1A 3KF6B 4DUZL 2JA5H 1QVFA 2HIXA 4A3EB 1SJED 1XWEA 1A6XA 1EZ8A 1PVOA 4X3UA 2NZHA 4FF4A 4NXMQ 1EEID 3VDYA 1PH7A 1IBLQ 3U9OA 3NBHA 4KD3A 3CCSA 2IHFA 1GUWA 3K5MA 4FDBA 3W5OA 2UXBQ 5M3FH 4R8NA 1XNQL 1L1OC 3KF8B 2O5IC 4RA8A 4JI6L 2XWJB 2L4NA 4RFBA 2HDMA 1HUMA 2EYJA 1WJJA 4EVOA 1R4QB 4GLAC 5IGDA 1K73C 3OPOA 3JAML 3OSOA 1HNZQ 1O7IA 2OPUA 5ISRA 2OPVA 1SXTA 3S14H 5A2QE 1UE6A 4LJZC 1H95A 1Q1EA 2B8GA 2Y0SE 1K83H 4DR1L 4A3IB 1X4MA 3TP7A 4LF4L 2XTIA 1ZZJA 4QIWE 3RLOA 1GUNA 4OIJA 4RG1A 4JI7L 3AMUA 4C3JB 1S5DD 1K1GA 2JA7B 1XJVA 5CV4A 5M5YB 1JICA 3BVZA 4DA2A 2OT2A 1WTVA 1F9PA 2DY7A 1ENAA 2JEBI 1WD0A 2IWHA 4JV5Q 1TT2A 3TZUA