1ZZIA

Crystal structure analysis of the third kh domain of hnrnp k in complex with ssdna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
GAMGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*TP*CP*CP*CP*C)-3'
publication title X-Ray Crystallographic and NMR Studies of the Third KH Domain of hnRNP K in Complex with Single-Stranded Nucleic Acids
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 20
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1zziA00
2JVZA 2JE6I 1K1GA 4B8TA 5C0XG 1WVNA 2CTMA 2E3UA 1X4MA 4JVHA 4QMFB 1DT4A 3U1KA 2HH2A 4JVYA 4AIMA 4BA1I 2ANNA 1WE8A 2CTLA 2CTFA 2JEBI 4NBQA 1J4WA 4LIJA 2MJHA 1EC6A 2DGRA 2JZXA 2PQUA 1VIGA 2CTJA 2Z0SA 5K36G 2QNDA 1DTJA 4IFDG 1TUAA 2FMRA 1VIHA 3VKEA 3L7ZC 5JEAG 2OPVA 3V69A 4AM3A 2JEAI 1KHMA 4WANA 2HH3A 2NN6G 4BA2I 1J5KA 2CPQA 2CTEA 1ZZKA 2PY9A 1ZZJA 1ZZIA 2BL5A 3AEVB 2AXYA 1ZTGA 2CTKA 4WALA 2YQRA 4OO1G 2BA0A 2JA9A 1X4NA 2OPUA 2ANRA 2P2RA
chains in the Genus database with same CATH superfamily
1K1GA 5C0XG 2Y3MA 1WVNA 1F0XA 4JI2H 2CTMA 1X4MA 4JI1H 1NXUA 4JVHA 2F4VH 1XRHA 3U1KA 2HH2A 4BA1I 2ANNA 2VQFH 1WHRA 2VKCA 2ZQEA 4DV1H 4X65H 1N32H 1EC6A 2D9IA 1IBLH 1N34H 2PQUA 5K36G 1DTJA 1N36H 4DR6H 4DR7H 1XMOH 1V9NA 4DR4H 2JEAI 2LTLA 2UXBH 2CWFA 1HR0H 4FJUA 1J5KA 1SEIA 1FKAH 4JI3H 2K1HA 3AEVB 5BR8H 2AXYA 1I94H 4OX9H 3EZJA 1FJGH 1VBIA 2FFMA 3KDGA 4JI5H 4OCHA 1MSZA 4LF8H 4B8CD 4DV5H 5DT9A 4B3RH 4JI0H 2G8YA 2CTLA 2X06A 2CTFA 4LIJA 2UUBH 5LMNH 2PT7G 2HHHH 2UXCH 4IFDG 3OSSD 5IWAH 1V8CA 4AM3A 1KHMA 3RF2A 3JAMW 4WANA 4X64H 2PY9A 3J80W 4K0KH 2UXDH 2M6QA 4DR2H 4DR5H 1HNZH 3T1YH 4B3SH 2BA0A 2JA9A 2CPMA 1I6UA 3L7ZC 2ANRA 2JVZA 1HNWH 4JI4H 4DV7H 1Z2IA 3T1HH 3OETA 5LMUH 2LRRA 2ZM6H 1XNRH 1N33H 5IT9W 3SB1A 4DV0H 2E5LH 4DR3H 1WTJA 2LTMA 4JVYA 3GR5A 3J81W 4LF6H 3J7AK 4DUZH 2MJHA 1J4WA 2JEBI 3KDKA 4NBQA 5FLXW 2CTJA 2LF0A 1PQXA 2UU9H 1VIHA 3VKEA 4EC5A 2OPVA 3QD7X 1XMQH 1HNXH 4LFBH 4FJSA 4AQYH 1IBMH 3OTOH 2NN6G 4JI6H 2UUAH 2CTEA 4LF9H 2CWHA 4LF7H 1ZZIA 2BL5A 4DV6H 3FAUA 2M8WA 2YQRA 4NXNH 2VQEH 4PDBA 4JV5H 3UOEA 2OPUA 1X9ZA 1AN7A 4DUYH 2P2RA 4GKJH 2JE6I 5LL6b 4B8TA 4DV3H 1UG8A 4YY3H 3NCVA 4DR1H 4OD6A 4GKKH 4JYAH 2E3UA 4H8AA 4QMFB 4DV4H 1J5EH 1DT4A 4JI7H 5A2QW 1S03G 1WE8A 4E9JA 4LF5H 4G08A 4B3MH 4LFCH 2DGRA 2JZXA 4NZTM 1VIGA 2Z0SA 1IBKH 4LF4H 2QNDA 4NXMH 4NZRM 1TUAA 2FMRA 4X66H 3GABA 5JEAG 4B3TH 3V69A 1X0AA 2O4CA 4X62H 4YHHH 4DV2H 2FPHX 2HH3A 4LFAH 4BA2I 3GKUA 2CPQA 1ZZKA 1ZZJA 2A1SA 1S20A 1ZTGA 2CTKA 4WALA 3I0PA 4JI8H 4OO1G 1XNQH 1ODHA 1X4NA 2UUCH 4KHPH 4AIMA
chains in the Genus database with same CATH topology
2JVZA 2JE6I 1K1GA 4B8TA 5C0XG 1WVNA 2CTMA 2E3UA 1X4MA 4JVHA 4QMFB 1DT4A 3U1KA 2HH2A 4JVYA 4AIMA 4BA1I 2ANNA 1WE8A 2CTLA 2CTFA 2JEBI 4NBQA 1J4WA 4LIJA 2MJHA 1EC6A 2DGRA 2JZXA 2PQUA 1VIGA 2CTJA 2Z0SA 5K36G 2QNDA 1DTJA 4IFDG 1TUAA 2FMRA 1VIHA 3VKEA 3L7ZC 5JEAG 2OPVA 3V69A 4AM3A 2JEAI 1KHMA 4WANA 2HH3A 2NN6G 4BA2I 1J5KA 2CPQA 2CTEA 1ZZKA 2PY9A 1ZZJA 1ZZIA 2BL5A 3AEVB 2AXYA 1ZTGA 2CTKA 4WALA 2YQRA 4OO1G 2BA0A 2JA9A 1X4NA 2OPUA 2ANRA 2P2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JVZ A;  2JE6 I;  1K1G A;  4B8T A;  5C0X G;  1WVN A;  2CTM A;  2E3U A;  1X4M A;  4JVH A;  4QMF B;  1DT4 A;  3U1K A;  2HH2 A;  4JVY A;  4AIM A;  4BA1 I;  2ANN A;  1WE8 A;  2CTL A;  2CTF A;  2JEB I;  4NBQ A;  1J4W A;  4LIJ A;  2MJH A;  1EC6 A;  2DGR A;  2JZX A;  2PQU A;  1VIG A;  2CTJ A;  2Z0S A;  5K36 G;  2QND A;  1DTJ A;  4IFD G;  1TUA A;  2FMR A;  1VIH A;  3VKE A;  3L7Z C;  5JEA G;  2OPV A;  3V69 A;  4AM3 A;  2JEA I;  1KHM A;  4WAN A;  2HH3 A;  2NN6 G;  4BA2 I;  1J5K A;  2CPQ A;  2CTE A;  1ZZK A;  2PY9 A;  1ZZJ A;  1ZZI A;  2BL5 A;  3AEV B;  2AXY A;  1ZTG A;  2CTK A;  4WAL A;  2YQR A;  4OO1 G;  2BA0 A;  2JA9 A;  1X4N A;  2OPU A;  2ANR A;  2P2R A; 
#chains in the Genus database with same CATH topology
 1K1G A;  5C0X G;  2Y3M A;  1WVN A;  1F0X A;  4JI2 H;  2CTM A;  1X4M A;  4JI1 H;  1NXU A;  4JVH A;  2F4V H;  1XRH A;  3U1K A;  2HH2 A;  4BA1 I;  2ANN A;  2VQF H;  1WHR A;  2VKC A;  2ZQE A;  4DV1 H;  4X65 H;  1N32 H;  1EC6 A;  2D9I A;  1IBL H;  1N34 H;  2PQU A;  5K36 G;  1DTJ A;  1N36 H;  4DR6 H;  4DR7 H;  1XMO H;  1V9N A;  4DR4 H;  2JEA I;  2LTL A;  2UXB H;  2CWF A;  1HR0 H;  4FJU A;  1J5K A;  1SEI A;  1FKA H;  4JI3 H;  2K1H A;  3AEV B;  5BR8 H;  2AXY A;  1I94 H;  4OX9 H;  3EZJ A;  1FJG H;  1VBI A;  2FFM A;  3KDG A;  4JI5 H;  4OCH A;  1MSZ A;  4LF8 H;  4B8C D;  4DV5 H;  5DT9 A;  4B3R H;  4JI0 H;  2G8Y A;  2CTL A;  2X06 A;  2CTF A;  4LIJ A;  2UUB H;  5LMN H;  2PT7 G;  2HHH H;  2UXC H;  4IFD G;  3OSS D;  5IWA H;  1V8C A;  4AM3 A;  1KHM A;  3RF2 A;  3JAM W;  4WAN A;  4X64 H;  2PY9 A;  3J80 W;  4K0K H;  2UXD H;  2M6Q A;  4DR2 H;  4DR5 H;  1HNZ H;  3T1Y H;  4B3S H;  2BA0 A;  2JA9 A;  2CPM A;  1I6U A;  3L7Z C;  2ANR A;  2JVZ A;  1HNW H;  4JI4 H;  4DV7 H;  1Z2I A;  3T1H H;  3OET A;  5LMU H;  2LRR A;  2ZM6 H;  1XNR H;  1N33 H;  5IT9 W;  3SB1 A;  4DV0 H;  2E5L H;  4DR3 H;  1WTJ A;  2LTM A;  4JVY A;  3GR5 A;  3J81 W;  4LF6 H;  3J7A K;  4DUZ H;  2MJH A;  1J4W A;  2JEB I;  3KDK A;  4NBQ A;  5FLX W;  2CTJ A;  2LF0 A;  1PQX A;  2UU9 H;  1VIH A;  3VKE A;  4EC5 A;  2OPV A;  3QD7 X;  1XMQ H;  1HNX H;  4LFB H;  4FJS A;  4AQY H;  1IBM H;  3OTO H;  2NN6 G;  4JI6 H;  2UUA H;  2CTE A;  4LF9 H;  2CWH A;  4LF7 H;  1ZZI A;  2BL5 A;  4DV6 H;  3FAU A;  2M8W A;  2YQR A;  4NXN H;  2VQE H;  4PDB A;  4JV5 H;  3UOE A;  2OPU A;  1X9Z A;  1AN7 A;  4DUY H;  2P2R A;  4GKJ H;  2JE6 I;  5LL6 b;  4B8T A;  4DV3 H;  1UG8 A;  4YY3 H;  3NCV A;  4DR1 H;  4OD6 A;  4GKK H;  4JYA H;  2E3U A;  4H8A A;  4QMF B;  4DV4 H;  1J5E H;  1DT4 A;  4JI7 H;  5A2Q W;  1S03 G;  1WE8 A;  4E9J A;  4LF5 H;  4G08 A;  4B3M H;  4LFC H;  2DGR A;  2JZX A;  4NZT M;  1VIG A;  2Z0S A;  1IBK H;  4LF4 H;  2QND A;  4NXM H;  4NZR M;  1TUA A;  2FMR A;  4X66 H;  3GAB A;  5JEA G;  4B3T H;  3V69 A;  1X0A A;  2O4C A;  4X62 H;  4YHH H;  4DV2 H;  2FPH X;  2HH3 A;  4LFA H;  4BA2 I;  3GKU A;  2CPQ A;  1ZZK A;  1ZZJ A;  2A1S A;  1S20 A;  1ZTG A;  2CTK A;  4WAL A;  3I0P A;  4JI8 H;  4OO1 G;  1XNQ H;  1ODH A;  1X4N A;  2UUC H;  4KHP H;  4AIM A; 
#chains in the Genus database with same CATH homology
 2JVZ A;  2JE6 I;  1K1G A;  4B8T A;  5C0X G;  1WVN A;  2CTM A;  2E3U A;  1X4M A;  4JVH A;  4QMF B;  1DT4 A;  3U1K A;  2HH2 A;  4JVY A;  4AIM A;  4BA1 I;  2ANN A;  1WE8 A;  2CTL A;  2CTF A;  2JEB I;  4NBQ A;  1J4W A;  4LIJ A;  2MJH A;  1EC6 A;  2DGR A;  2JZX A;  2PQU A;  1VIG A;  2CTJ A;  2Z0S A;  5K36 G;  2QND A;  1DTJ A;  4IFD G;  1TUA A;  2FMR A;  1VIH A;  3VKE A;  3L7Z C;  5JEA G;  2OPV A;  3V69 A;  4AM3 A;  2JEA I;  1KHM A;  4WAN A;  2HH3 A;  2NN6 G;  4BA2 I;  1J5K A;  2CPQ A;  2CTE A;  1ZZK A;  2PY9 A;  1ZZJ A;  1ZZI A;  2BL5 A;  3AEV B;  2AXY A;  1ZTG A;  2CTK A;  4WAL A;  2YQR A;  4OO1 G;  2BA0 A;  2JA9 A;  1X4N A;  2OPU A;  2ANR A;  2P2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...