1ZZIA

Crystal structure analysis of the third kh domain of hnrnp k in complex with ssdna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
GAMGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 5'-D(*CP*TP*CP*CP*CP*C)-3'
publication title X-Ray Crystallographic and NMR Studies of the Third KH Domain of hnRNP K in Complex with Single-Stranded Nucleic Acids
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1zziA00
4IFDG 2JEAI 2HH3A 2MJHA 4B8TA 4LIJA 2YQRA 2CTEA 2JEBI 4AM3A 5C0XG 4OO1G 1WE8A 2FMRA 4JVHA 5K36G 2OPUA 3VKEA 4AIMA 3L7ZC 2JE6I 2OPVA 1ZTGA 1X4NA 4BA2I 2E3UA 4NBQA 3AEVB 4WANA 1ZZJA 4QMFB 4JVYA 4BA1I 1TUAA 2DGRA 2PY9A 1ZZKA 2NN6G 5JEAG 4WALA 2P2RA 1KHMA 1WVNA 2BL5A 2PQUA 2CTMA 2AXYA 1DT4A 2CPQA 1VIGA 3U1KA 3V69A 2CTLA 1ZZIA 2JA9A 2JVZA 1J5KA 2ANRA 1J4WA 2ANNA 1DTJA 1X4MA 2CTJA 1K1GA 1EC6A 2CTFA 2CTKA 2JZXA 2HH2A 2BA0A 2QNDA 2Z0SA 1VIHA
chains in the Genus database with same CATH superfamily
1I6UA 4JI5H 4NXMH 4FJUA 2HH3A 5BR8H 2CPMA 2VQEH 1XMOH 4B3MH 4LF9H 4JI4H 1FJGH 2JEBI 4OO1G 4DR7H 1UG8A 1WE8A 3SB1A 4EC5A 4DV2H 4NZRM 2UUAH 2HHHH 2CWHA 2UUBH 1WHRA 1HNWH 1VBIA 2JE6I 3L7ZC 1X4NA 2PT7G 1AN7A 3AEVB 4WANA 4LF8H 4DR2H 4FJSA 1TUAA 2DGRA 4BA1I 2PY9A 4OCHA 4WALA 1S03G 2F4VH 1ODHA 2AXYA 3T1YH 4X66H 1N32H 5DT9A 3V69A 2ANNA 2JVZA 2ZQEA 4LF6H 2X06A 3GR5A 1DTJA 1V9NA 2CWFA 1Z2IA 1HR0H 3FAUA 2LF0A 3GABA 4DUYH 1WTJA 4PDBA 4NXNH 2JEAI 2UXCH 4B8TA 4X64H 2YQRA 1HNZH 2D9IA 1XNRH 5LMNH 4JI2H 2OPUA 2OPVA 4LF7H 4BA2I 2K1HA 1PQXA 4JI6H 2M6QA 3KDGA 1V8CA 4X65H 4DV1H 1IBMH 4QMFB 4JYAH 2NN6G 4JI0H 2VQFH 4JI1H 4K0KH 1HNXH 4AQYH 1IBKH 1KHMA 5A2QW 1DT4A 1VIGA 1XRHA 3U1KA 4E9JA 5LMUH 1MSZA 2JA9A 1ZZIA 1J5KA 2ANRA 1J4WA 1S20A 4DR6H 1X4MA 4B3RH 3OSSD 3UOEA 2CTFA 2CTKA 2JZXA 3GKUA 4DUZH 1XMQH 4DV7H 2MJHA 2UXDH 4LIJA 3OETA 4OD6A 4GKJH 4AM3A 1IBLH 1I94H 5K36G 4DV6H 3RF2A 4AIMA 2O4CA 3J81W 4DV0H 1NXUA 3VKEA 5FLXW 1ZTGA 2E3UA 4NBQA 3J80W 4JI3H 4YY3H 4LFAH 4DR4H 2VKCA 1N33H 1ZZKA 3JAMW 4B8CD 5JEAG 2ZM6H 1N34H 1FKAH 4DR3H 3QD7X 2LTMA 4DR5H 4YHHH 2CPQA 2CTLA 4LFBH 4H8AA 1J5EH 3I0PA 2UUCH 1EC6A 1SEIA 2QNDA 2HH2A 2BA0A 2Z0SA 1VIHA 4DV3H 4IFDG 2G8YA 2A1SA 5LL6b 4JI7H 4DV5H 2CTEA 4JI8H 1XNQH 5C0XG 3J7AK 5IT9W 2FMRA 2M8WA 4DV4H 4JVHA 2UXBH 2E5LH 4DR1H 4B3TH 4LF5H 4X62H 3T1HH 2FFMA 4G08A 1N36H 4JVYA 4JV5H 2UU9H 2P2RA 2LTLA 1WVNA 3EZJA 2BL5A 4GKKH 5IWAH 1F0XA 2CTMA 2PQUA 4LF4H 4OX9H 1X0AA 4KHPH 2CTJA 3NCVA 4B3SH 1K1GA 2Y3MA 4NZTM 4LFCH 3OTOH 1X9ZA 2LRRA 3KDKA 2FPHX 1ZZJA
chains in the Genus database with same CATH topology
4IFDG 2JEAI 2HH3A 2MJHA 4B8TA 4LIJA 2YQRA 2CTEA 2JEBI 4AM3A 5C0XG 4OO1G 1WE8A 2FMRA 4JVHA 5K36G 2OPUA 3VKEA 4AIMA 3L7ZC 2JE6I 2OPVA 1ZTGA 1X4NA 4BA2I 2E3UA 4NBQA 3AEVB 4WANA 1ZZJA 4QMFB 4JVYA 4BA1I 1TUAA 2DGRA 2PY9A 1ZZKA 2NN6G 5JEAG 4WALA 2P2RA 1KHMA 1WVNA 2BL5A 2PQUA 2CTMA 2AXYA 1DT4A 2CPQA 1VIGA 3U1KA 3V69A 2CTLA 1ZZIA 2JA9A 2JVZA 1J5KA 2ANRA 1J4WA 2ANNA 1DTJA 1X4MA 2CTJA 1K1GA 1EC6A 2CTFA 2CTKA 2JZXA 2HH2A 2BA0A 2QNDA 2Z0SA 1VIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD G;  2JEA I;  2HH3 A;  2MJH A;  4B8T A;  4LIJ A;  2YQR A;  2CTE A;  2JEB I;  4AM3 A;  5C0X G;  4OO1 G;  1WE8 A;  2FMR A;  4JVH A;  5K36 G;  2OPU A;  3VKE A;  4AIM A;  3L7Z C;  2JE6 I;  2OPV A;  1ZTG A;  1X4N A;  4BA2 I;  2E3U A;  4NBQ A;  3AEV B;  4WAN A;  1ZZJ A;  4QMF B;  4JVY A;  4BA1 I;  1TUA A;  2DGR A;  2PY9 A;  1ZZK A;  2NN6 G;  5JEA G;  4WAL A;  2P2R A;  1KHM A;  1WVN A;  2BL5 A;  2PQU A;  2CTM A;  2AXY A;  1DT4 A;  2CPQ A;  1VIG A;  3U1K A;  3V69 A;  2CTL A;  1ZZI A;  2JA9 A;  2JVZ A;  1J5K A;  2ANR A;  1J4W A;  2ANN A;  1DTJ A;  1X4M A;  2CTJ A;  1K1G A;  1EC6 A;  2CTF A;  2CTK A;  2JZX A;  2HH2 A;  2BA0 A;  2QND A;  2Z0S A;  1VIH A; 
#chains in the Genus database with same CATH topology
 1I6U A;  4JI5 H;  4NXM H;  4FJU A;  2HH3 A;  5BR8 H;  2CPM A;  2VQE H;  1XMO H;  4B3M H;  4LF9 H;  4JI4 H;  1FJG H;  2JEB I;  4OO1 G;  4DR7 H;  1UG8 A;  1WE8 A;  3SB1 A;  4EC5 A;  4DV2 H;  4NZR M;  2UUA H;  2HHH H;  2CWH A;  2UUB H;  1WHR A;  1HNW H;  1VBI A;  2JE6 I;  3L7Z C;  1X4N A;  2PT7 G;  1AN7 A;  3AEV B;  4WAN A;  4LF8 H;  4DR2 H;  4FJS A;  1TUA A;  2DGR A;  4BA1 I;  2PY9 A;  4OCH A;  4WAL A;  1S03 G;  2F4V H;  1ODH A;  2AXY A;  3T1Y H;  4X66 H;  1N32 H;  5DT9 A;  3V69 A;  2ANN A;  2JVZ A;  2ZQE A;  4LF6 H;  2X06 A;  3GR5 A;  1DTJ A;  1V9N A;  2CWF A;  1Z2I A;  1HR0 H;  3FAU A;  2LF0 A;  3GAB A;  4DUY H;  1WTJ A;  4PDB A;  4NXN H;  2JEA I;  2UXC H;  4B8T A;  4X64 H;  2YQR A;  1HNZ H;  2D9I A;  1XNR H;  5LMN H;  4JI2 H;  2OPU A;  2OPV A;  4LF7 H;  4BA2 I;  2K1H A;  1PQX A;  4JI6 H;  2M6Q A;  3KDG A;  1V8C A;  4X65 H;  4DV1 H;  1IBM H;  4QMF B;  4JYA H;  2NN6 G;  4JI0 H;  2VQF H;  4JI1 H;  4K0K H;  1HNX H;  4AQY H;  1IBK H;  1KHM A;  5A2Q W;  1DT4 A;  1VIG A;  1XRH A;  3U1K A;  4E9J A;  5LMU H;  1MSZ A;  2JA9 A;  1ZZI A;  1J5K A;  2ANR A;  1J4W A;  1S20 A;  4DR6 H;  1X4M A;  4B3R H;  3OSS D;  3UOE A;  2CTF A;  2CTK A;  2JZX A;  3GKU A;  4DUZ H;  1XMQ H;  4DV7 H;  2MJH A;  2UXD H;  4LIJ A;  3OET A;  4OD6 A;  4GKJ H;  4AM3 A;  1IBL H;  1I94 H;  5K36 G;  4DV6 H;  3RF2 A;  4AIM A;  2O4C A;  3J81 W;  4DV0 H;  1NXU A;  3VKE A;  5FLX W;  1ZTG A;  2E3U A;  4NBQ A;  3J80 W;  4JI3 H;  4YY3 H;  4LFA H;  4DR4 H;  2VKC A;  1N33 H;  1ZZK A;  3JAM W;  4B8C D;  5JEA G;  2ZM6 H;  1N34 H;  1FKA H;  4DR3 H;  3QD7 X;  2LTM A;  4DR5 H;  4YHH H;  2CPQ A;  2CTL A;  4LFB H;  4H8A A;  1J5E H;  3I0P A;  2UUC H;  1EC6 A;  1SEI A;  2QND A;  2HH2 A;  2BA0 A;  2Z0S A;  1VIH A;  4DV3 H;  4IFD G;  2G8Y A;  2A1S A;  5LL6 b;  4JI7 H;  4DV5 H;  2CTE A;  4JI8 H;  1XNQ H;  5C0X G;  3J7A K;  5IT9 W;  2FMR A;  2M8W A;  4DV4 H;  4JVH A;  2UXB H;  2E5L H;  4DR1 H;  4B3T H;  4LF5 H;  4X62 H;  3T1H H;  2FFM A;  4G08 A;  1N36 H;  4JVY A;  4JV5 H;  2UU9 H;  2P2R A;  2LTL A;  1WVN A;  3EZJ A;  2BL5 A;  4GKK H;  5IWA H;  1F0X A;  2CTM A;  2PQU A;  4LF4 H;  4OX9 H;  1X0A A;  4KHP H;  2CTJ A;  3NCV A;  4B3S H;  1K1G A;  2Y3M A;  4NZT M;  4LFC H;  3OTO H;  1X9Z A;  2LRR A;  3KDK A;  2FPH X;  1ZZJ A; 
#chains in the Genus database with same CATH homology
 4IFD G;  2JEA I;  2HH3 A;  2MJH A;  4B8T A;  4LIJ A;  2YQR A;  2CTE A;  2JEB I;  4AM3 A;  5C0X G;  4OO1 G;  1WE8 A;  2FMR A;  4JVH A;  5K36 G;  2OPU A;  3VKE A;  4AIM A;  3L7Z C;  2JE6 I;  2OPV A;  1ZTG A;  1X4N A;  4BA2 I;  2E3U A;  4NBQ A;  3AEV B;  4WAN A;  1ZZJ A;  4QMF B;  4JVY A;  4BA1 I;  1TUA A;  2DGR A;  2PY9 A;  1ZZK A;  2NN6 G;  5JEA G;  4WAL A;  2P2R A;  1KHM A;  1WVN A;  2BL5 A;  2PQU A;  2CTM A;  2AXY A;  1DT4 A;  2CPQ A;  1VIG A;  3U1K A;  3V69 A;  2CTL A;  1ZZI A;  2JA9 A;  2JVZ A;  1J5K A;  2ANR A;  1J4W A;  2ANN A;  1DTJ A;  1X4M A;  2CTJ A;  1K1G A;  1EC6 A;  2CTF A;  2CTK A;  2JZX A;  2HH2 A;  2BA0 A;  2QND A;  2Z0S A;  1VIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...