1ZZIA

Crystal structure analysis of the third kh domain of hnrnp k in complex with ssdna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
GAMGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*TP*CP*CP*CP*C)-3'
publication title X-Ray Crystallographic and NMR Studies of the Third KH Domain of hnRNP K in Complex with Single-Stranded Nucleic Acids
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 20
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1zziA00
2CTKA 2JEBI 2JVZA 2OPUA 3AEVB 1J4WA 1TUAA 2CTJA 1DT4A 2QNDA 4IFDG 2JEAI 2DGRA 2BL5A 1VIHA 2HH3A 1ZZKA 2JA9A 2NN6G 4NBQA 4LIJA 4B8TA 2JE6I 1ZZJA 4AM3A 3V69A 4AIMA 4WALA 2HH2A 1WVNA 4OO1G 2JZXA 4WANA 1EC6A 2BA0A 2P2RA 2FMRA 1J5KA 1X4MA 2CTEA 1ZZIA 2CTFA 4QMFB 2ANRA 1VIGA 2MJHA 5K36G 1X4NA 5C0XG 2CPQA 4BA1I 1K1GA 4JVHA 1ZTGA 3L7ZC 2AXYA 3U1KA 1DTJA 4BA2I 1KHMA 2CTLA 2PY9A 2E3UA 1WE8A 2OPVA 2Z0SA 2CTMA 2PQUA 2ANNA 2YQRA 4JVYA 3VKEA 5JEAG
chains in the Genus database with same CATH superfamily
1HNXH 5IWAH 2JEBI 2HHHH 1ODHA 4DR1H 5LMNH 2CTJA 4EC5A 4YY3H 3NCVA 4IFDG 2JEAI 4G08A 4NBQA 2VQFH 4AM3A 1UG8A 4LFCH 1Z2IA 2JE6I 2FPHX 3I0PA 4DV1H 1FJGH 2ZQEA 2HH2A 4GKKH 2G8YA 1EC6A 2P2RA 1X9ZA 5LMUH 1VIGA 2CPQA 4BA1I 1K1GA 4FJUA 4X65H 4OCHA 5FLXW 4DV6H 2UU9H 2PT7G 1N34H 3T1HH 1KHMA 4E9JA 4JI4H 2E3UA 4DV7H 1WE8A 2Z0SA 2CTMA 1NXUA 3QD7X 2YQRA 4FJSA 2CTKA 3J7AK 2UXDH 4JI2H 5A2QW 3J81W 1J4WA 4DUYH 1S03G 4K0KH 4DR2H 2QNDA 1XNQH 1N33H 4X64H 2JA9A 1ZZJA 1IBLH 4JI6H 3EZJA 4DR7H 3V69A 1N36H 5DT9A 2JZXA 2VKCA 4H8AA 1WTJA 4WANA 4DV4H 2F4VH 1V8CA 4X66H 1X4MA 1WHRA 2CTEA 2CTFA 1FKAH 2ANRA 4JI7H 5K36G 3GKUA 5BR8H 1X4NA 4KHPH 4DR6H 3GABA 4YHHH 2UUAH 4JYAH 4DV3H 4DR3H 3SB1A 1DTJA 3JAMW 3UOEA 4DUZH 3T1YH 1HNZH 4DR5H 1I94H 2LTMA 4DV2H 4DR4H 4PDBA 1I6UA 4JVYA 2M8WA 4B3RH 5JEAG 1XRHA 4LFAH 4LF4H 1HNWH 1TUAA 1IBKH 1PQXA 4JI5H 2DGRA 2BL5A 2CWHA 2HH3A 3FAUA 2NN6G 2UXCH 5IT9W 1J5EH 4JI3H 4GKJH 1HR0H 4OO1G 1SEIA 1MSZA 4NXNH 2FMRA 4AQYH 1XMOH 1F0XA 2Y3MA 4QMFB 2MJHA 4LF7H 4B3SH 2UUBH 4OX9H 2VQEH 1X0AA 1ZTGA 3L7ZC 1XMQH 2AXYA 3U1KA 5LL6b 4DV0H 1XNRH 4NZTM 4BA2I 2CTLA 2PY9A 2OPVA 3KDGA 4LF6H 2ANNA 2M6QA 2CPMA 2D9IA 2JVZA 3OSSD 2OPUA 2E5LH 3OTOH 3GR5A 4JI1H 4JI8H 3AEVB 2K1HA 1DT4A 2FFMA 2LTLA 1VIHA 4B8TA 1IBMH 1S20A 1ZZKA 3OETA 4JI0H 4LIJA 2LRRA 4AIMA 4WALA 4LFBH 1WVNA 2LF0A 3RF2A 4B3MH 2BA0A 4DV5H 1V9NA 1J5KA 1AN7A 4JV5H 5C0XG 4X62H 4LF8H 3J80W 4JVHA 2A1SA 4NXMH 4OD6A 2UUCH 4B3TH 4NZRM 2X06A 1N32H 4LF9H 1VBIA 3KDKA 2CWFA 4B8CD 2O4CA 2PQUA 2UXBH 2ZM6H 4LF5H 3VKEA 1ZZIA
chains in the Genus database with same CATH topology
2CTKA 2JEBI 2JVZA 2OPUA 3AEVB 1J4WA 1TUAA 2CTJA 1DT4A 2QNDA 4IFDG 2JEAI 2DGRA 2BL5A 1VIHA 2HH3A 1ZZKA 2JA9A 2NN6G 4NBQA 4LIJA 4B8TA 2JE6I 1ZZJA 4AM3A 3V69A 4AIMA 4WALA 2HH2A 1WVNA 4OO1G 2JZXA 4WANA 1EC6A 2BA0A 2P2RA 2FMRA 1J5KA 1X4MA 2CTEA 1ZZIA 2CTFA 4QMFB 2ANRA 1VIGA 2MJHA 5K36G 1X4NA 5C0XG 2CPQA 4BA1I 1K1GA 4JVHA 1ZTGA 3L7ZC 2AXYA 3U1KA 1DTJA 4BA2I 1KHMA 2CTLA 2PY9A 2E3UA 1WE8A 2OPVA 2Z0SA 2CTMA 2PQUA 2ANNA 2YQRA 4JVYA 3VKEA 5JEAG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTK A;  2JEB I;  2JVZ A;  2OPU A;  3AEV B;  1J4W A;  1TUA A;  2CTJ A;  1DT4 A;  2QND A;  4IFD G;  2JEA I;  2DGR A;  2BL5 A;  1VIH A;  2HH3 A;  1ZZK A;  2JA9 A;  2NN6 G;  4NBQ A;  4LIJ A;  4B8T A;  2JE6 I;  1ZZJ A;  4AM3 A;  3V69 A;  4AIM A;  4WAL A;  2HH2 A;  1WVN A;  4OO1 G;  2JZX A;  4WAN A;  1EC6 A;  2BA0 A;  2P2R A;  2FMR A;  1J5K A;  1X4M A;  2CTE A;  1ZZI A;  2CTF A;  4QMF B;  2ANR A;  1VIG A;  2MJH A;  5K36 G;  1X4N A;  5C0X G;  2CPQ A;  4BA1 I;  1K1G A;  4JVH A;  1ZTG A;  3L7Z C;  2AXY A;  3U1K A;  1DTJ A;  4BA2 I;  1KHM A;  2CTL A;  2PY9 A;  2E3U A;  1WE8 A;  2OPV A;  2Z0S A;  2CTM A;  2PQU A;  2ANN A;  2YQR A;  4JVY A;  3VKE A;  5JEA G; 
#chains in the Genus database with same CATH topology
 1HNX H;  5IWA H;  2JEB I;  2HHH H;  1ODH A;  4DR1 H;  5LMN H;  2CTJ A;  4EC5 A;  4YY3 H;  3NCV A;  4IFD G;  2JEA I;  4G08 A;  4NBQ A;  2VQF H;  4AM3 A;  1UG8 A;  4LFC H;  1Z2I A;  2JE6 I;  2FPH X;  3I0P A;  4DV1 H;  1FJG H;  2ZQE A;  2HH2 A;  4GKK H;  2G8Y A;  1EC6 A;  2P2R A;  1X9Z A;  5LMU H;  1VIG A;  2CPQ A;  4BA1 I;  1K1G A;  4FJU A;  4X65 H;  4OCH A;  5FLX W;  4DV6 H;  2UU9 H;  2PT7 G;  1N34 H;  3T1H H;  1KHM A;  4E9J A;  4JI4 H;  2E3U A;  4DV7 H;  1WE8 A;  2Z0S A;  2CTM A;  1NXU A;  3QD7 X;  2YQR A;  4FJS A;  2CTK A;  3J7A K;  2UXD H;  4JI2 H;  5A2Q W;  3J81 W;  1J4W A;  4DUY H;  1S03 G;  4K0K H;  4DR2 H;  2QND A;  1XNQ H;  1N33 H;  4X64 H;  2JA9 A;  1ZZJ A;  1IBL H;  4JI6 H;  3EZJ A;  4DR7 H;  3V69 A;  1N36 H;  5DT9 A;  2JZX A;  2VKC A;  4H8A A;  1WTJ A;  4WAN A;  4DV4 H;  2F4V H;  1V8C A;  4X66 H;  1X4M A;  1WHR A;  2CTE A;  2CTF A;  1FKA H;  2ANR A;  4JI7 H;  5K36 G;  3GKU A;  5BR8 H;  1X4N A;  4KHP H;  4DR6 H;  3GAB A;  4YHH H;  2UUA H;  4JYA H;  4DV3 H;  4DR3 H;  3SB1 A;  1DTJ A;  3JAM W;  3UOE A;  4DUZ H;  3T1Y H;  1HNZ H;  4DR5 H;  1I94 H;  2LTM A;  4DV2 H;  4DR4 H;  4PDB A;  1I6U A;  4JVY A;  2M8W A;  4B3R H;  5JEA G;  1XRH A;  4LFA H;  4LF4 H;  1HNW H;  1TUA A;  1IBK H;  1PQX A;  4JI5 H;  2DGR A;  2BL5 A;  2CWH A;  2HH3 A;  3FAU A;  2NN6 G;  2UXC H;  5IT9 W;  1J5E H;  4JI3 H;  4GKJ H;  1HR0 H;  4OO1 G;  1SEI A;  1MSZ A;  4NXN H;  2FMR A;  4AQY H;  1XMO H;  1F0X A;  2Y3M A;  4QMF B;  2MJH A;  4LF7 H;  4B3S H;  2UUB H;  4OX9 H;  2VQE H;  1X0A A;  1ZTG A;  3L7Z C;  1XMQ H;  2AXY A;  3U1K A;  5LL6 b;  4DV0 H;  1XNR H;  4NZT M;  4BA2 I;  2CTL A;  2PY9 A;  2OPV A;  3KDG A;  4LF6 H;  2ANN A;  2M6Q A;  2CPM A;  2D9I A;  2JVZ A;  3OSS D;  2OPU A;  2E5L H;  3OTO H;  3GR5 A;  4JI1 H;  4JI8 H;  3AEV B;  2K1H A;  1DT4 A;  2FFM A;  2LTL A;  1VIH A;  4B8T A;  1IBM H;  1S20 A;  1ZZK A;  3OET A;  4JI0 H;  4LIJ A;  2LRR A;  4AIM A;  4WAL A;  4LFB H;  1WVN A;  2LF0 A;  3RF2 A;  4B3M H;  2BA0 A;  4DV5 H;  1V9N A;  1J5K A;  1AN7 A;  4JV5 H;  5C0X G;  4X62 H;  4LF8 H;  3J80 W;  4JVH A;  2A1S A;  4NXM H;  4OD6 A;  2UUC H;  4B3T H;  4NZR M;  2X06 A;  1N32 H;  4LF9 H;  1VBI A;  3KDK A;  2CWF A;  4B8C D;  2O4C A;  2PQU A;  2UXB H;  2ZM6 H;  4LF5 H;  3VKE A;  1ZZI A; 
#chains in the Genus database with same CATH homology
 2CTK A;  2JEB I;  2JVZ A;  2OPU A;  3AEV B;  1J4W A;  1TUA A;  2CTJ A;  1DT4 A;  2QND A;  4IFD G;  2JEA I;  2DGR A;  2BL5 A;  1VIH A;  2HH3 A;  1ZZK A;  2JA9 A;  2NN6 G;  4NBQ A;  4LIJ A;  4B8T A;  2JE6 I;  1ZZJ A;  4AM3 A;  3V69 A;  4AIM A;  4WAL A;  2HH2 A;  1WVN A;  4OO1 G;  2JZX A;  4WAN A;  1EC6 A;  2BA0 A;  2P2R A;  2FMR A;  1J5K A;  1X4M A;  2CTE A;  1ZZI A;  2CTF A;  4QMF B;  2ANR A;  1VIG A;  2MJH A;  5K36 G;  1X4N A;  5C0X G;  2CPQ A;  4BA1 I;  1K1G A;  4JVH A;  1ZTG A;  3L7Z C;  2AXY A;  3U1K A;  1DTJ A;  4BA2 I;  1KHM A;  2CTL A;  2PY9 A;  2E3U A;  1WE8 A;  2OPV A;  2Z0S A;  2CTM A;  2PQU A;  2ANN A;  2YQR A;  4JVY A;  3VKE A;  5JEA G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...