1ZZIA

Crystal structure analysis of the third kh domain of hnrnp k in complex with ssdna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
b'GAMGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*TP*CP*CP*CP*C)-3'
molecule tags Structural protein/dna
source organism Homo sapiens
publication title X-Ray Crystallographic and NMR Studies of the Third KH Domain of hnRNP K in Complex with Single-Stranded Nucleic Acids
pubmed doi rcsb
total genus 20
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1zziA00
2JE6I 4BA2I 2BA0A 2HH3A 1X4NA 2JZXA 1ZZIA 3VKEA 1K1GA 1DT4A 1DTJA 2CTJA 1WVNA 2ANRA 2OPVA 2CTKA 4BA1I 2JEBI 4AM3A 2P2RA 2JEAI 1ZZJA 2E3UA 1VIHA 1ZTGA 4OO1G 1X4MA 4JVYA 4JVHA 4IFDG 3L7ZC 3AEVB 2JVZA 2Z0SA 5JEAG 1J4WA 1TUAA 1ZZKA 1KHMA 4WANA 2YQRA 4AIMA 3V69A 1J5KA 2AXYA 2DGRA 2BL5A 4WALA 2CTFA 4LIJA 2CTLA 2FMRA 2OPUA 2QNDA 2ANNA 5K36G 1EC6A 2JA9A 3U1KA 2CTMA 2NN6G 4NBQA 2PQUA 2MJHA 1WE8A 5C0XG 4B8TA 1VIGA 2CPQA 4QMFB 2HH2A 2CTEA 2PY9A
chains in the Genus database with same CATH superfamily
4JYAH 1IBLH 1XMQH 4OX9H 2VQFH 4DR2H 1DT4A 1DTJA 2CTJA 1WVNA 4JI6H 4BA1I 2FPHX 3OTOH 2JEAI 1ZZJA 4GKJH 4DV7H 4X62H 4JVYA 4B3RH 2PT7G 4NZRM 4G08A 1X0AA 1KHMA 4WANA 2LRRA 4AIMA 4DV2H 3T1HH 3V69A 2VKCA 1I6UA 2LTLA 4DR6H 4PDBA 2UUCH 2FMRA 2QNDA 5FLXW 4FJUA 4B3SH 4NZTM 3U1KA 1WHRA 5DT9A 2CTMA 1WTJA 4DV6H 2MJHA 4JI3H 5C0XG 2LTMA 4DV5H 4DR5H 1HR0H 1X9ZA 4IFDG 1I94H 1S03G 2A1SA 2JE6I 5LL6b 4LF5H 1PQXA 4JV5H 2UXDH 1X4NA 2JZXA 1XNQH 1AN7A 4H8AA 1ZZIA 1K1GA 2O4CA 4X64H 2M6QA 3I0PA 2OPVA 2CTKA 3T1YH 2P2RA 2E3UA 3L7ZC 3AEVB 1NXUA 2D9IA 2FFMA 2JVZA 3NCVA 1J4WA 1TUAA 1ZZKA 4DV1H 4LF8H 4LFAH 1F0XA 1HNZH 4GKKH 4YY3H 1IBMH 4JI0H 3GR5A 2DGRA 4AQYH 1XMOH 4WALA 2ANNA 2CTLA 3GKUA 5K36G 5LMUH 4DR3H 4LFCH 4DR7H 4NBQA 3OETA 5A2QW 4KHPH 1FKAH 3KDGA 1VIGA 2M8WA 1VBIA 1N34H 1HNXH 5IWAH 3UOEA 3OSSD 2PY9A 4DUYH 4LFBH 4OCHA 4B3MH 2ANRA 4JI4H 2Y3MA 3J80W 4AM3A 2JEBI 3J81W 1IBKH 4DR4H 1ZTGA 4JI1H 1FJGH 1X4MA 1MSZA 2Z0SA 5JEAG 2UXBH 2CWHA 1Z2IA 1HNWH 2CWFA 4NXMH 2ZQEA 4LF6H 2AXYA 4E9JA 4LIJA 2VQEH 2E5LH 2OPUA 4EC5A 4DV3H 4JI5H 1N33H 4X65H 1S20A 4B3TH 2JA9A 3KDKA 4DUZH 4LF7H 3J7AK 4OD6A 4K0KH 4B8TA 4LF4H 2CPQA 5LMNH 4QMFB 2HH2A 3RF2A 1XNRH 2F4VH 4BA2I 2BA0A 1V8CA 2HH3A 2K1HA 3EZJA 3VKEA 4NXNH 1XRHA 2HHHH 2UUBH 3QD7X 4FJSA 1J5EH 1V9NA 3SB1A 5BR8H 2X06A 4OO1G 1VIHA 4JI7H 4JI2H 4DR1H 4X66H 4JVHA 2CPMA 1ODHA 2UXCH 4LF9H 1N32H 2LF0A 2YQRA 1J5KA 1N36H 2BL5A 4YHHH 4DV0H 2CTFA 5IT9W 1EC6A 4B8CD 1SEIA 3GABA 2NN6G 2PQUA 2UU9H 1WE8A 2ZM6H 4DV4H 2UUAH 3FAUA 3JAMW 1UG8A 2G8YA 2CTEA 4JI8H
chains in the Genus database with same CATH topology
2JE6I 4BA2I 2BA0A 2HH3A 1X4NA 2JZXA 1ZZIA 3VKEA 1K1GA 1DT4A 1DTJA 2CTJA 1WVNA 2ANRA 2OPVA 2CTKA 4BA1I 2JEBI 4AM3A 2P2RA 2JEAI 1ZZJA 2E3UA 1VIHA 1ZTGA 4OO1G 1X4MA 4JVYA 4JVHA 4IFDG 3L7ZC 3AEVB 2JVZA 2Z0SA 5JEAG 1J4WA 1TUAA 1ZZKA 1KHMA 4WANA 2YQRA 4AIMA 3V69A 1J5KA 2AXYA 2DGRA 2BL5A 4WALA 2CTFA 4LIJA 2CTLA 2FMRA 2OPUA 2QNDA 2ANNA 5K36G 1EC6A 2JA9A 3U1KA 2CTMA 2NN6G 4NBQA 2PQUA 2MJHA 1WE8A 5C0XG 4B8TA 1VIGA 2CPQA 4QMFB 2HH2A 2CTEA 2PY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JE6 I;  4BA2 I;  2BA0 A;  2HH3 A;  1X4N A;  2JZX A;  1ZZI A;  3VKE A;  1K1G A;  1DT4 A;  1DTJ A;  2CTJ A;  1WVN A;  2ANR A;  2OPV A;  2CTK A;  4BA1 I;  2JEB I;  4AM3 A;  2P2R A;  2JEA I;  1ZZJ A;  2E3U A;  1VIH A;  1ZTG A;  4OO1 G;  1X4M A;  4JVY A;  4JVH A;  4IFD G;  3L7Z C;  3AEV B;  2JVZ A;  2Z0S A;  5JEA G;  1J4W A;  1TUA A;  1ZZK A;  1KHM A;  4WAN A;  2YQR A;  4AIM A;  3V69 A;  1J5K A;  2AXY A;  2DGR A;  2BL5 A;  4WAL A;  2CTF A;  4LIJ A;  2CTL A;  2FMR A;  2OPU A;  2QND A;  2ANN A;  5K36 G;  1EC6 A;  2JA9 A;  3U1K A;  2CTM A;  2NN6 G;  4NBQ A;  2PQU A;  2MJH A;  1WE8 A;  5C0X G;  4B8T A;  1VIG A;  2CPQ A;  4QMF B;  2HH2 A;  2CTE A;  2PY9 A; 
#chains in the Genus database with same CATH topology
 4JYA H;  1IBL H;  1XMQ H;  4OX9 H;  2VQF H;  4DR2 H;  1DT4 A;  1DTJ A;  2CTJ A;  1WVN A;  4JI6 H;  4BA1 I;  2FPH X;  3OTO H;  2JEA I;  1ZZJ A;  4GKJ H;  4DV7 H;  4X62 H;  4JVY A;  4B3R H;  2PT7 G;  4NZR M;  4G08 A;  1X0A A;  1KHM A;  4WAN A;  2LRR A;  4AIM A;  4DV2 H;  3T1H H;  3V69 A;  2VKC A;  1I6U A;  2LTL A;  4DR6 H;  4PDB A;  2UUC H;  2FMR A;  2QND A;  5FLX W;  4FJU A;  4B3S H;  4NZT M;  3U1K A;  1WHR A;  5DT9 A;  2CTM A;  1WTJ A;  4DV6 H;  2MJH A;  4JI3 H;  5C0X G;  2LTM A;  4DV5 H;  4DR5 H;  1HR0 H;  1X9Z A;  4IFD G;  1I94 H;  1S03 G;  2A1S A;  2JE6 I;  5LL6 b;  4LF5 H;  1PQX A;  4JV5 H;  2UXD H;  1X4N A;  2JZX A;  1XNQ H;  1AN7 A;  4H8A A;  1ZZI A;  1K1G A;  2O4C A;  4X64 H;  2M6Q A;  3I0P A;  2OPV A;  2CTK A;  3T1Y H;  2P2R A;  2E3U A;  3L7Z C;  3AEV B;  1NXU A;  2D9I A;  2FFM A;  2JVZ A;  3NCV A;  1J4W A;  1TUA A;  1ZZK A;  4DV1 H;  4LF8 H;  4LFA H;  1F0X A;  1HNZ H;  4GKK H;  4YY3 H;  1IBM H;  4JI0 H;  3GR5 A;  2DGR A;  4AQY H;  1XMO H;  4WAL A;  2ANN A;  2CTL A;  3GKU A;  5K36 G;  5LMU H;  4DR3 H;  4LFC H;  4DR7 H;  4NBQ A;  3OET A;  5A2Q W;  4KHP H;  1FKA H;  3KDG A;  1VIG A;  2M8W A;  1VBI A;  1N34 H;  1HNX H;  5IWA H;  3UOE A;  3OSS D;  2PY9 A;  4DUY H;  4LFB H;  4OCH A;  4B3M H;  2ANR A;  4JI4 H;  2Y3M A;  3J80 W;  4AM3 A;  2JEB I;  3J81 W;  1IBK H;  4DR4 H;  1ZTG A;  4JI1 H;  1FJG H;  1X4M A;  1MSZ A;  2Z0S A;  5JEA G;  2UXB H;  2CWH A;  1Z2I A;  1HNW H;  2CWF A;  4NXM H;  2ZQE A;  4LF6 H;  2AXY A;  4E9J A;  4LIJ A;  2VQE H;  2E5L H;  2OPU A;  4EC5 A;  4DV3 H;  4JI5 H;  1N33 H;  4X65 H;  1S20 A;  4B3T H;  2JA9 A;  3KDK A;  4DUZ H;  4LF7 H;  3J7A K;  4OD6 A;  4K0K H;  4B8T A;  4LF4 H;  2CPQ A;  5LMN H;  4QMF B;  2HH2 A;  3RF2 A;  1XNR H;  2F4V H;  4BA2 I;  2BA0 A;  1V8C A;  2HH3 A;  2K1H A;  3EZJ A;  3VKE A;  4NXN H;  1XRH A;  2HHH H;  2UUB H;  3QD7 X;  4FJS A;  1J5E H;  1V9N A;  3SB1 A;  5BR8 H;  2X06 A;  4OO1 G;  1VIH A;  4JI7 H;  4JI2 H;  4DR1 H;  4X66 H;  4JVH A;  2CPM A;  1ODH A;  2UXC H;  4LF9 H;  1N32 H;  2LF0 A;  2YQR A;  1J5K A;  1N36 H;  2BL5 A;  4YHH H;  4DV0 H;  2CTF A;  5IT9 W;  1EC6 A;  4B8C D;  1SEI A;  3GAB A;  2NN6 G;  2PQU A;  2UU9 H;  1WE8 A;  2ZM6 H;  4DV4 H;  2UUA H;  3FAU A;  3JAM W;  1UG8 A;  2G8Y A;  2CTE A;  4JI8 H; 
#chains in the Genus database with same CATH homology
 2JE6 I;  4BA2 I;  2BA0 A;  2HH3 A;  1X4N A;  2JZX A;  1ZZI A;  3VKE A;  1K1G A;  1DT4 A;  1DTJ A;  2CTJ A;  1WVN A;  2ANR A;  2OPV A;  2CTK A;  4BA1 I;  2JEB I;  4AM3 A;  2P2R A;  2JEA I;  1ZZJ A;  2E3U A;  1VIH A;  1ZTG A;  4OO1 G;  1X4M A;  4JVY A;  4JVH A;  4IFD G;  3L7Z C;  3AEV B;  2JVZ A;  2Z0S A;  5JEA G;  1J4W A;  1TUA A;  1ZZK A;  1KHM A;  4WAN A;  2YQR A;  4AIM A;  3V69 A;  1J5K A;  2AXY A;  2DGR A;  2BL5 A;  4WAL A;  2CTF A;  4LIJ A;  2CTL A;  2FMR A;  2OPU A;  2QND A;  2ANN A;  5K36 G;  1EC6 A;  2JA9 A;  3U1K A;  2CTM A;  2NN6 G;  4NBQ A;  2PQU A;  2MJH A;  1WE8 A;  5C0X G;  4B8T A;  1VIG A;  2CPQ A;  4QMF B;  2HH2 A;  2CTE A;  2PY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...