4JVHA

Structure of the star domain of quaking protein in complex with rna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
193
structure length
176
Chain Sequence
KPTPDYLMQLMNDKKLMSNHLERLLDEEISRVRKDMYNDTSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein quaking
publication title Structure-function studies of STAR family Quaking proteins bound to their in vivo RNA target sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 40
structure length 176
sequence length 193
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF16544 STAR_dimer Homodimerisation region of STAR domain protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4jvhA00
4OO1G 4LIJA 3AEVB 2BL5A 4WALA 2CTLA 3U1KA 1ZTGA 4JVYA 1J4WA 2HH2A 2MJHA 2FMRA 1X4NA 2CTJA 1J5KA 2DGRA 2OPUA 1VIHA 2HH3A 2JZXA 3L7ZC 2E3UA 2YQRA 5C0XG 2ANNA 2NN6G 5JEAG 4JVHA 2P2RA 5K36G 1EC6A 4NBQA 2AXYA 1WE8A 1ZZKA 2CTMA 2JEBI 4AIMA 1WVNA 1TUAA 3VKEA 3V69A 2PY9A 1KHMA 2JE6I 2ANRA 2JEAI 1X4MA 1ZZIA 2QNDA 4BA2I 2CTEA 1VIGA 1K1GA 2CTFA 1DTJA 2BA0A 2JVZA 1ZZJA 4BA1I 2PQUA 1DT4A 2CPQA 4B8TA 4WANA 2Z0SA 4AM3A 2CTKA 4IFDG 2JA9A 4QMFB 2OPVA
chains in the Genus database with same CATH superfamily
2LTLA 3GKUA 4DR4H 2K1HA 2LRRA 4LFCH 1XRHA 2Y3MA 1IBKH 1HNXH 2FPHX 4X62H 3OTOH 5C0XG 1ODHA 4JVHA 1KHMA 2CWHA 4NZTM 5JEAG 2P2RA 4DR7H 5IT9W 1EC6A 4LF7H 4JI4H 4GKKH 1N33H 1XMQH 1ZZKA 1WVNA 2UUBH 4BA2I 4DV1H 4DUYH 2UUAH 1K1GA 1Z2IA 2PQUA 5DT9A 1HNZH 2CTKA 2A1SA 4NZRM 4QMFB 2E5LH 1X0AA 4NXNH 1UG8A 4GKJH 4E9JA 4LIJA 3AEVB 2BL5A 4DV0H 4JYAH 3SB1A 1WTJA 4NXMH 1J4WA 4JI2H 5IWAH 2VQEH 3NCVA 1J5KA 1V9NA 2DGRA 2HH3A 2JZXA 4YHHH 2E3UA 2ZQEA 5LMNH 4DV6H 4AQYH 1J5EH 4DR2H 4LF8H 1FKAH 1AN7A 2M6QA 2AXYA 1WE8A 4LF9H 2CTMA 1N36H 4YY3H 4LF4H 1PQXA 4OD6A 3V69A 4KHPH 1X4MA 4JI5H 1VIGA 1SEIA 1DTJA 2CTFA 2X06A 3EZJA 1IBLH 2D9IA 4B3RH 1I94H 1DT4A 2CPQA 4DR1H 4K0KH 2Z0SA 3RF2A 4JI6H 1IBMH 2HHHH 1X9ZA 4JI0H 2UXCH 3KDKA 2F4VH 4OCHA 2JA9A 1S03G 4OO1G 4DV5H 3OSSD 4DR3H 4B3SH 2UU9H 4DV3H 4JV5H 3KDGA 3U1KA 3T1HH 3J81W 1FJGH 1N32H 2MJHA 2FMRA 3GR5A 4X64H 5LMUH 2G8YA 2OPUA 4LF6H 2UUCH 1XNQH 4X65H 2ANNA 5FLXW 2UXDH 4DV2H 2VKCA 2CWFA 4LFBH 4JI1H 2FFMA 2JEBI 4AIMA 2PY9A 3VKEA 2QNDA 1N34H 2JVZA 3OETA 1MSZA 5BR8H 4WANA 5LL6b 4AM3A 4IFDG 3QD7X 3I0PA 4B8TA 1S20A 2OPVA 3UOEA 4JI3H 2VQFH 4LFAH 2ZM6H 4DR6H 4DV4H 4WALA 2CTLA 2LF0A 1ZTGA 4JVYA 2HH2A 4X66H 1X4NA 2CTJA 1F0XA 4OX9H 1VIHA 1HNWH 1XNRH 3L7ZC 2YQRA 2NN6G 1WHRA 1I6UA 5K36G 4DV7H 4LF5H 5A2QW 4NBQA 3J80W 4B8CD 4G08A 1XMOH 4JI8H 2PT7G 1V8CA 1HR0H 2CPMA 1TUAA 2LTMA 2ANRA 1VBIA 2JEAI 1ZZIA 3J7AK 2CTEA 4FJUA 4FJSA 3T1YH 2M8WA 2BA0A 4DUZH 1ZZJA 4BA1I 4B3MH 4B3TH 4JI7H 3GABA 4H8AA 2O4CA 4EC5A 2UXBH 4DR5H 3JAMW 3FAUA 2JE6I 1NXUA 4PDBA
chains in the Genus database with same CATH topology
4OO1G 4LIJA 3AEVB 2BL5A 4WALA 2CTLA 3U1KA 1ZTGA 4JVYA 1J4WA 2HH2A 2MJHA 2FMRA 1X4NA 2CTJA 1J5KA 2DGRA 2OPUA 1VIHA 2HH3A 2JZXA 3L7ZC 2E3UA 2YQRA 5C0XG 2ANNA 2NN6G 5JEAG 4JVHA 2P2RA 5K36G 1EC6A 4NBQA 2AXYA 1WE8A 1ZZKA 2CTMA 2JEBI 4AIMA 1WVNA 1TUAA 3VKEA 3V69A 2PY9A 1KHMA 2JE6I 2ANRA 2JEAI 1X4MA 1ZZIA 2QNDA 4BA2I 2CTEA 1VIGA 1K1GA 2CTFA 1DTJA 2BA0A 2JVZA 1ZZJA 4BA1I 2PQUA 1DT4A 2CPQA 4B8TA 4WANA 2Z0SA 4AM3A 2CTKA 4IFDG 2JA9A 4QMFB 2OPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 G;  4LIJ A;  3AEV B;  2BL5 A;  4WAL A;  2CTL A;  3U1K A;  1ZTG A;  4JVY A;  1J4W A;  2HH2 A;  2MJH A;  2FMR A;  1X4N A;  2CTJ A;  1J5K A;  2DGR A;  2OPU A;  1VIH A;  2HH3 A;  2JZX A;  3L7Z C;  2E3U A;  2YQR A;  5C0X G;  2ANN A;  2NN6 G;  5JEA G;  4JVH A;  2P2R A;  5K36 G;  1EC6 A;  4NBQ A;  2AXY A;  1WE8 A;  1ZZK A;  2CTM A;  2JEB I;  4AIM A;  1WVN A;  1TUA A;  3VKE A;  3V69 A;  2PY9 A;  1KHM A;  2JE6 I;  2ANR A;  2JEA I;  1X4M A;  1ZZI A;  2QND A;  4BA2 I;  2CTE A;  1VIG A;  1K1G A;  2CTF A;  1DTJ A;  2BA0 A;  2JVZ A;  1ZZJ A;  4BA1 I;  2PQU A;  1DT4 A;  2CPQ A;  4B8T A;  4WAN A;  2Z0S A;  4AM3 A;  2CTK A;  4IFD G;  2JA9 A;  4QMF B;  2OPV A; 
#chains in the Genus database with same CATH topology
 2LTL A;  3GKU A;  4DR4 H;  2K1H A;  2LRR A;  4LFC H;  1XRH A;  2Y3M A;  1IBK H;  1HNX H;  2FPH X;  4X62 H;  3OTO H;  5C0X G;  1ODH A;  4JVH A;  1KHM A;  2CWH A;  4NZT M;  5JEA G;  2P2R A;  4DR7 H;  5IT9 W;  1EC6 A;  4LF7 H;  4JI4 H;  4GKK H;  1N33 H;  1XMQ H;  1ZZK A;  1WVN A;  2UUB H;  4BA2 I;  4DV1 H;  4DUY H;  2UUA H;  1K1G A;  1Z2I A;  2PQU A;  5DT9 A;  1HNZ H;  2CTK A;  2A1S A;  4NZR M;  4QMF B;  2E5L H;  1X0A A;  4NXN H;  1UG8 A;  4GKJ H;  4E9J A;  4LIJ A;  3AEV B;  2BL5 A;  4DV0 H;  4JYA H;  3SB1 A;  1WTJ A;  4NXM H;  1J4W A;  4JI2 H;  5IWA H;  2VQE H;  3NCV A;  1J5K A;  1V9N A;  2DGR A;  2HH3 A;  2JZX A;  4YHH H;  2E3U A;  2ZQE A;  5LMN H;  4DV6 H;  4AQY H;  1J5E H;  4DR2 H;  4LF8 H;  1FKA H;  1AN7 A;  2M6Q A;  2AXY A;  1WE8 A;  4LF9 H;  2CTM A;  1N36 H;  4YY3 H;  4LF4 H;  1PQX A;  4OD6 A;  3V69 A;  4KHP H;  1X4M A;  4JI5 H;  1VIG A;  1SEI A;  1DTJ A;  2CTF A;  2X06 A;  3EZJ A;  1IBL H;  2D9I A;  4B3R H;  1I94 H;  1DT4 A;  2CPQ A;  4DR1 H;  4K0K H;  2Z0S A;  3RF2 A;  4JI6 H;  1IBM H;  2HHH H;  1X9Z A;  4JI0 H;  2UXC H;  3KDK A;  2F4V H;  4OCH A;  2JA9 A;  1S03 G;  4OO1 G;  4DV5 H;  3OSS D;  4DR3 H;  4B3S H;  2UU9 H;  4DV3 H;  4JV5 H;  3KDG A;  3U1K A;  3T1H H;  3J81 W;  1FJG H;  1N32 H;  2MJH A;  2FMR A;  3GR5 A;  4X64 H;  5LMU H;  2G8Y A;  2OPU A;  4LF6 H;  2UUC H;  1XNQ H;  4X65 H;  2ANN A;  5FLX W;  2UXD H;  4DV2 H;  2VKC A;  2CWF A;  4LFB H;  4JI1 H;  2FFM A;  2JEB I;  4AIM A;  2PY9 A;  3VKE A;  2QND A;  1N34 H;  2JVZ A;  3OET A;  1MSZ A;  5BR8 H;  4WAN A;  5LL6 b;  4AM3 A;  4IFD G;  3QD7 X;  3I0P A;  4B8T A;  1S20 A;  2OPV A;  3UOE A;  4JI3 H;  2VQF H;  4LFA H;  2ZM6 H;  4DR6 H;  4DV4 H;  4WAL A;  2CTL A;  2LF0 A;  1ZTG A;  4JVY A;  2HH2 A;  4X66 H;  1X4N A;  2CTJ A;  1F0X A;  4OX9 H;  1VIH A;  1HNW H;  1XNR H;  3L7Z C;  2YQR A;  2NN6 G;  1WHR A;  1I6U A;  5K36 G;  4DV7 H;  4LF5 H;  5A2Q W;  4NBQ A;  3J80 W;  4B8C D;  4G08 A;  1XMO H;  4JI8 H;  2PT7 G;  1V8C A;  1HR0 H;  2CPM A;  1TUA A;  2LTM A;  2ANR A;  1VBI A;  2JEA I;  1ZZI A;  3J7A K;  2CTE A;  4FJU A;  4FJS A;  3T1Y H;  2M8W A;  2BA0 A;  4DUZ H;  1ZZJ A;  4BA1 I;  4B3M H;  4B3T H;  4JI7 H;  3GAB A;  4H8A A;  2O4C A;  4EC5 A;  2UXB H;  4DR5 H;  3JAM W;  3FAU A;  2JE6 I;  1NXU A;  4PDB A; 
#chains in the Genus database with same CATH homology
 4OO1 G;  4LIJ A;  3AEV B;  2BL5 A;  4WAL A;  2CTL A;  3U1K A;  1ZTG A;  4JVY A;  1J4W A;  2HH2 A;  2MJH A;  2FMR A;  1X4N A;  2CTJ A;  1J5K A;  2DGR A;  2OPU A;  1VIH A;  2HH3 A;  2JZX A;  3L7Z C;  2E3U A;  2YQR A;  5C0X G;  2ANN A;  2NN6 G;  5JEA G;  4JVH A;  2P2R A;  5K36 G;  1EC6 A;  4NBQ A;  2AXY A;  1WE8 A;  1ZZK A;  2CTM A;  2JEB I;  4AIM A;  1WVN A;  1TUA A;  3VKE A;  3V69 A;  2PY9 A;  1KHM A;  2JE6 I;  2ANR A;  2JEA I;  1X4M A;  1ZZI A;  2QND A;  4BA2 I;  2CTE A;  1VIG A;  1K1G A;  2CTF A;  1DTJ A;  2BA0 A;  2JVZ A;  1ZZJ A;  4BA1 I;  2PQU A;  1DT4 A;  2CPQ A;  4B8T A;  4WAN A;  2Z0S A;  4AM3 A;  2CTK A;  4IFD G;  2JA9 A;  4QMF B;  2OPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...