4JVHA

Structure of the star domain of quaking protein in complex with rna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
193
structure length
176
Chain Sequence
KPTPDYLMQLMNDKKLMSNHLERLLDEEISRVRKDMYNDTSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Protein quaking
publication title Structure-function studies of STAR family Quaking proteins bound to their in vivo RNA target sites.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 176
sequence length 193
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF16544 STAR_dimer Homodimerisation region of STAR domain protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4jvhA00
2OPVA 2PQUA 2CTJA 1J5KA 1KHMA 2DGRA 2CTFA 2PY9A 1J4WA 3VKEA 1X4MA 1K1GA 3AEVB 4AIMA 1DTJA 2P2RA 2FMRA 2BL5A 5JEAG 2ANNA 1EC6A 2CTKA 4WANA 2HH3A 4JVYA 1ZZJA 2JA9A 4OO1G 2CTLA 2E3UA 2JEBI 3U1KA 2JE6I 2MJHA 5C0XG 2CPQA 1ZZKA 2CTMA 4BA1I 2CTEA 1VIGA 2HH2A 2AXYA 4LIJA 4QMFB 2JZXA 2NN6G 4BA2I 1VIHA 1DT4A 1ZTGA 4AM3A 5K36G 3L7ZC 4JVHA 2ANRA 1X4NA 1WE8A 2YQRA 1WVNA 2JVZA 2QNDA 4NBQA 4WALA 4B8TA 1ZZIA 2BA0A 1TUAA 2Z0SA 4IFDG 3V69A 2JEAI 2OPUA
chains in the Genus database with same CATH superfamily
4JI7H 5A2QW 4EC5A 1J5KA 1IBMH 2CWFA 3OTOH 2DGRA 3UOEA 1S03G 4NXNH 4LF7H 2HHHH 1DTJA 2ANNA 1VBIA 4DV0H 4WANA 4K0KH 1N36H 4DR4H 1XNRH 3U1KA 2JEBI 2JE6I 4E9JA 1AN7A 1V9NA 4QMFB 4B3RH 2JZXA 4X64H 2FPHX 5DT9A 3GABA 1XMQH 2D9IA 3J81W 4BA2I 2VQFH 1I94H 2ANRA 4X66H 1FJGH 1WE8A 2JVZA 3GKUA 4B3SH 2BA0A 1TUAA 2JEAI 2OPUA 1X0AA 4DV4H 4GKJH 2OPVA 2PT7G 4NXMH 2PQUA 4GKKH 2CTJA 2VQEH 1N34H 4LF8H 3J80W 2PY9A 1XRHA 3VKEA 1X4MA 1K1GA 2UXCH 2BL5A 2LTMA 2O4CA 2X06A 1EC6A 2CTKA 4FJUA 2E5LH 3J7AK 2Y3MA 4B3TH 5FLXW 4LFAH 2MJHA 5C0XG 2VKCA 3EZJA 4FJSA 4DV3H 5IT9W 2AXYA 4LIJA 1HR0H 1HNZH 1F0XA 3OSSD 2F4VH 4PDBA 1VIHA 5LMNH 2CWHA 4LF9H 1XNQH 1X4NA 1I6UA 4NBQA 2YQRA 5LL6b 2G8YA 4WALA 2M8WA 2Z0SA 3T1YH 2UXBH 3OETA 4YHHH 4G08A 1ODHA 3KDKA 4JI2H 2UUAH 1KHMA 4JYAH 2UU9H 2CTFA 1WTJA 3AEVB 1MSZA 1X9ZA 4AIMA 4YY3H 2P2RA 5BR8H 4X62H 3GR5A 2LF0A 2HH3A 4DV7H 4NZRM 1WHRA 4DUYH 1IBKH 4JVYA 4LF5H 2CTLA 2CPQA 2CTEA 5IWAH 2HH2A 4B8CD 4AQYH 4JI3H 4LFCH 4DR6H 1NXUA 1PQXA 3KDGA 4KHPH 3I0PA 4DV2H 4JI5H 1N32H 2NN6G 4DR5H 1DT4A 1J5EH 4OX9H 4LF4H 4JVHA 4H8AA 3FAUA 4B8TA 2QNDA 4NZTM 1XMOH 2LTLA 2UXDH 4IFDG 3V69A 4JI8H 4B3MH 4LFBH 3JAMW 2UUCH 1HNXH 2CPMA 1Z2IA 3T1HH 1J4WA 1FKAH 2FFMA 4JI0H 4DR7H 2FMRA 5JEAG 4JI4H 3QD7X 1SEIA 4OCHA 1V8CA 4X65H 1IBLH 2K1HA 1ZZJA 2JA9A 4OO1G 2M6QA 2E3UA 4DR2H 2A1SA 4JV5H 2UUBH 4OD6A 1N33H 1ZZKA 2CTMA 4BA1I 4JI6H 4DV6H 1VIGA 4DR3H 3RF2A 4DV5H 2ZM6H 4DUZH 3SB1A 4LF6H 1ZTGA 4AM3A 5K36G 3L7ZC 2ZQEA 1ZZIA 1WVNA 1S20A 1UG8A 5LMUH 4DR1H 1HNWH 4JI1H 3NCVA 4DV1H 2LRRA
chains in the Genus database with same CATH topology
2OPVA 2PQUA 2CTJA 1J5KA 1KHMA 2DGRA 2CTFA 2PY9A 1J4WA 3VKEA 1X4MA 1K1GA 3AEVB 4AIMA 1DTJA 2P2RA 2FMRA 2BL5A 5JEAG 2ANNA 1EC6A 2CTKA 4WANA 2HH3A 4JVYA 1ZZJA 2JA9A 4OO1G 2CTLA 2E3UA 2JEBI 3U1KA 2JE6I 2MJHA 5C0XG 2CPQA 1ZZKA 2CTMA 4BA1I 2CTEA 1VIGA 2HH2A 2AXYA 4LIJA 4QMFB 2JZXA 2NN6G 4BA2I 1VIHA 1DT4A 1ZTGA 4AM3A 5K36G 3L7ZC 4JVHA 2ANRA 1X4NA 1WE8A 2YQRA 1WVNA 2JVZA 2QNDA 4NBQA 4WALA 4B8TA 1ZZIA 2BA0A 1TUAA 2Z0SA 4IFDG 3V69A 2JEAI 2OPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPV A;  2PQU A;  2CTJ A;  1J5K A;  1KHM A;  2DGR A;  2CTF A;  2PY9 A;  1J4W A;  3VKE A;  1X4M A;  1K1G A;  3AEV B;  4AIM A;  1DTJ A;  2P2R A;  2FMR A;  2BL5 A;  5JEA G;  2ANN A;  1EC6 A;  2CTK A;  4WAN A;  2HH3 A;  4JVY A;  1ZZJ A;  2JA9 A;  4OO1 G;  2CTL A;  2E3U A;  2JEB I;  3U1K A;  2JE6 I;  2MJH A;  5C0X G;  2CPQ A;  1ZZK A;  2CTM A;  4BA1 I;  2CTE A;  1VIG A;  2HH2 A;  2AXY A;  4LIJ A;  4QMF B;  2JZX A;  2NN6 G;  4BA2 I;  1VIH A;  1DT4 A;  1ZTG A;  4AM3 A;  5K36 G;  3L7Z C;  4JVH A;  2ANR A;  1X4N A;  1WE8 A;  2YQR A;  1WVN A;  2JVZ A;  2QND A;  4NBQ A;  4WAL A;  4B8T A;  1ZZI A;  2BA0 A;  1TUA A;  2Z0S A;  4IFD G;  3V69 A;  2JEA I;  2OPU A; 
#chains in the Genus database with same CATH topology
 4JI7 H;  5A2Q W;  4EC5 A;  1J5K A;  1IBM H;  2CWF A;  3OTO H;  2DGR A;  3UOE A;  1S03 G;  4NXN H;  4LF7 H;  2HHH H;  1DTJ A;  2ANN A;  1VBI A;  4DV0 H;  4WAN A;  4K0K H;  1N36 H;  4DR4 H;  1XNR H;  3U1K A;  2JEB I;  2JE6 I;  4E9J A;  1AN7 A;  1V9N A;  4QMF B;  4B3R H;  2JZX A;  4X64 H;  2FPH X;  5DT9 A;  3GAB A;  1XMQ H;  2D9I A;  3J81 W;  4BA2 I;  2VQF H;  1I94 H;  2ANR A;  4X66 H;  1FJG H;  1WE8 A;  2JVZ A;  3GKU A;  4B3S H;  2BA0 A;  1TUA A;  2JEA I;  2OPU A;  1X0A A;  4DV4 H;  4GKJ H;  2OPV A;  2PT7 G;  4NXM H;  2PQU A;  4GKK H;  2CTJ A;  2VQE H;  1N34 H;  4LF8 H;  3J80 W;  2PY9 A;  1XRH A;  3VKE A;  1X4M A;  1K1G A;  2UXC H;  2BL5 A;  2LTM A;  2O4C A;  2X06 A;  1EC6 A;  2CTK A;  4FJU A;  2E5L H;  3J7A K;  2Y3M A;  4B3T H;  5FLX W;  4LFA H;  2MJH A;  5C0X G;  2VKC A;  3EZJ A;  4FJS A;  4DV3 H;  5IT9 W;  2AXY A;  4LIJ A;  1HR0 H;  1HNZ H;  1F0X A;  3OSS D;  2F4V H;  4PDB A;  1VIH A;  5LMN H;  2CWH A;  4LF9 H;  1XNQ H;  1X4N A;  1I6U A;  4NBQ A;  2YQR A;  5LL6 b;  2G8Y A;  4WAL A;  2M8W A;  2Z0S A;  3T1Y H;  2UXB H;  3OET A;  4YHH H;  4G08 A;  1ODH A;  3KDK A;  4JI2 H;  2UUA H;  1KHM A;  4JYA H;  2UU9 H;  2CTF A;  1WTJ A;  3AEV B;  1MSZ A;  1X9Z A;  4AIM A;  4YY3 H;  2P2R A;  5BR8 H;  4X62 H;  3GR5 A;  2LF0 A;  2HH3 A;  4DV7 H;  4NZR M;  1WHR A;  4DUY H;  1IBK H;  4JVY A;  4LF5 H;  2CTL A;  2CPQ A;  2CTE A;  5IWA H;  2HH2 A;  4B8C D;  4AQY H;  4JI3 H;  4LFC H;  4DR6 H;  1NXU A;  1PQX A;  3KDG A;  4KHP H;  3I0P A;  4DV2 H;  4JI5 H;  1N32 H;  2NN6 G;  4DR5 H;  1DT4 A;  1J5E H;  4OX9 H;  4LF4 H;  4JVH A;  4H8A A;  3FAU A;  4B8T A;  2QND A;  4NZT M;  1XMO H;  2LTL A;  2UXD H;  4IFD G;  3V69 A;  4JI8 H;  4B3M H;  4LFB H;  3JAM W;  2UUC H;  1HNX H;  2CPM A;  1Z2I A;  3T1H H;  1J4W A;  1FKA H;  2FFM A;  4JI0 H;  4DR7 H;  2FMR A;  5JEA G;  4JI4 H;  3QD7 X;  1SEI A;  4OCH A;  1V8C A;  4X65 H;  1IBL H;  2K1H A;  1ZZJ A;  2JA9 A;  4OO1 G;  2M6Q A;  2E3U A;  4DR2 H;  2A1S A;  4JV5 H;  2UUB H;  4OD6 A;  1N33 H;  1ZZK A;  2CTM A;  4BA1 I;  4JI6 H;  4DV6 H;  1VIG A;  4DR3 H;  3RF2 A;  4DV5 H;  2ZM6 H;  4DUZ H;  3SB1 A;  4LF6 H;  1ZTG A;  4AM3 A;  5K36 G;  3L7Z C;  2ZQE A;  1ZZI A;  1WVN A;  1S20 A;  1UG8 A;  5LMU H;  4DR1 H;  1HNW H;  4JI1 H;  3NCV A;  4DV1 H;  2LRR A; 
#chains in the Genus database with same CATH homology
 2OPV A;  2PQU A;  2CTJ A;  1J5K A;  1KHM A;  2DGR A;  2CTF A;  2PY9 A;  1J4W A;  3VKE A;  1X4M A;  1K1G A;  3AEV B;  4AIM A;  1DTJ A;  2P2R A;  2FMR A;  2BL5 A;  5JEA G;  2ANN A;  1EC6 A;  2CTK A;  4WAN A;  2HH3 A;  4JVY A;  1ZZJ A;  2JA9 A;  4OO1 G;  2CTL A;  2E3U A;  2JEB I;  3U1K A;  2JE6 I;  2MJH A;  5C0X G;  2CPQ A;  1ZZK A;  2CTM A;  4BA1 I;  2CTE A;  1VIG A;  2HH2 A;  2AXY A;  4LIJ A;  4QMF B;  2JZX A;  2NN6 G;  4BA2 I;  1VIH A;  1DT4 A;  1ZTG A;  4AM3 A;  5K36 G;  3L7Z C;  4JVH A;  2ANR A;  1X4N A;  1WE8 A;  2YQR A;  1WVN A;  2JVZ A;  2QND A;  4NBQ A;  4WAL A;  4B8T A;  1ZZI A;  2BA0 A;  1TUA A;  2Z0S A;  4IFD G;  3V69 A;  2JEA I;  2OPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...