4JVHA

Structure of the star domain of quaking protein in complex with rna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
193
structure length
176
Chain Sequence
b'KPTPDYLMQLMNDKKLMSNHLERLLDEEISRVRKDMYNDTSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein quaking
publication title Structure-function studies of STAR family Quaking proteins bound to their in vivo RNA target sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 40
structure length 176
sequence length 193
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF16544 STAR_dimer Homodimerisation region of STAR domain protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4jvhA00
2CTLA 1VIHA 1ZZKA 4LIJA 3VKEA 2PY9A 4IFDG 1EC6A 2CPQA 2OPVA 4BA1I 4B8TA 2CTKA 1J4WA 1DT4A 2ANRA 4JVYA 4WANA 3L7ZC 2JEAI 2BL5A 3AEVB 2CTMA 2FMRA 2JVZA 1ZZIA 2Z0SA 3V69A 1ZZJA 2CTFA 1J5KA 2JA9A 4QMFB 2HH3A 5JEAG 4BA2I 2E3UA 1K1GA 1ZTGA 2JZXA 1KHMA 2JEBI 1X4NA 2JE6I 3U1KA 1WVNA 2CTJA 2OPUA 2AXYA 2QNDA 2MJHA 5C0XG 2BA0A 2YQRA 2P2RA 4JVHA 4OO1G 2NN6G 4AM3A 1X4MA 2ANNA 2PQUA 4WALA 2CTEA 4AIMA 1DTJA 1TUAA 1VIGA 4NBQA 2HH2A 1WE8A 2DGRA 5K36G
chains in the Genus database with same CATH superfamily
1F0XA 2PY9A 1I6UA 2E5LH 4B3MH 4G08A 4DV4H 1N34H 4LF8H 3J7AK 4NZTM 4JVYA 2UUAH 2JEAI 2FMRA 2LTLA 5LL6b 3NCVA 1MSZA 4DR3H 1XNRH 4LF5H 3GR5A 3V69A 4OX9H 5FLXW 2CTFA 2FFMA 4AQYH 1J5KA 5JEAG 5LMUH 4DUYH 3I0PA 4LFCH 1HNWH 5IWAH 4YHHH 3GABA 1XNQH 4FJUA 1X9ZA 2OPUA 2AXYA 2QNDA 3GKUA 2NN6G 1XMOH 4LF9H 5DT9A 4B3SH 4X65H 1AN7A 1S20A 4X62H 4JI2H 2FPHX 1XRHA 2K1HA 5K36G 4LIJA 1VBIA 1N36H 1FJGH 4H8AA 4FJSA 4JI4H 2CPQA 3KDGA 2M8WA 3RF2A 4BA1I 1WHRA 1DT4A 1IBLH 4WANA 2CWFA 1IBKH 4LFAH 1ZZIA 2JVZA 2UXBH 4X66H 4JI7H 4JI0H 4X64H 2PT7G 4PDBA 2JA9A 4JI5H 1K1GA 5LMNH 2JEBI 4DV5H 1HNZH 2A1SA 1WVNA 2CTJA 2MJHA 4JVHA 5C0XG 2BA0A 2X06A 1X4MA 1HNXH 2ANNA 4WALA 4AIMA 2HH2A 3JAMW 5BR8H 4DR5H 3T1YH 3OETA 3VKEA 2O4CA 1J5EH 4B8CD 4NZRM 2LTMA 4EC5A 4B8TA 4OD6A 1IBMH 2CTKA 4K0KH 5IT9W 3J81W 2BL5A 2UU9H 2VQEH 3OTOH 3AEVB 3UOEA 4LF6H 3EZJA 5A2QW 1ZZJA 2HH3A 4BA2I 2CPMA 2E3UA 4YY3H 1ODHA 4DUZH 2UUBH 2LF0A 3SB1A 4LF4H 1ZTGA 2F4VH 4DR4H 1KHMA 1HR0H 3FAUA 1X4NA 4B3RH 1Z2IA 4DR2H 2M6QA 2P2RA 4DR6H 1N33H 4GKJH 4OO1G 1NXUA 1XMQH 2CTEA 4DV0H 2VQFH 1I94H 3U1KA 4GKKH 4JI3H 1WE8A 2JZXA 1UG8A 2CTLA 1VIHA 1ZZKA 4IFDG 1N32H 3J80W 2HHHH 4NXNH 3QD7X 4DV6H 4JI6H 4JI8H 1EC6A 4JYAH 2Y3MA 2OPVA 4OCHA 4E9JA 1J4WA 2ANRA 2UUCH 3L7ZC 2CTMA 2D9IA 3OSSD 2ZM6H 2Z0SA 4DV3H 1X0AA 1PQXA 2VKCA 4B3TH 4DR7H 3KDKA 4JI1H 1WTJA 2CWHA 4DV7H 3T1HH 4LFBH 4DR1H 2G8YA 2JE6I 1SEIA 4DV1H 4NXMH 2YQRA 2UXCH 4LF7H 4KHPH 2UXDH 4AM3A 1FKAH 2PQUA 4DV2H 1DTJA 1V8CA 1TUAA 1VIGA 4NBQA 4QMFB 4JV5H 1S03G 2DGRA 1V9NA 2ZQEA 2LRRA
chains in the Genus database with same CATH topology
2CTLA 1VIHA 1ZZKA 4LIJA 3VKEA 2PY9A 4IFDG 1EC6A 2CPQA 2OPVA 4BA1I 4B8TA 2CTKA 1J4WA 1DT4A 2ANRA 4JVYA 4WANA 3L7ZC 2JEAI 2BL5A 3AEVB 2CTMA 2FMRA 2JVZA 1ZZIA 2Z0SA 3V69A 1ZZJA 2CTFA 1J5KA 2JA9A 4QMFB 2HH3A 5JEAG 4BA2I 2E3UA 1K1GA 1ZTGA 2JZXA 1KHMA 2JEBI 1X4NA 2JE6I 3U1KA 1WVNA 2CTJA 2OPUA 2AXYA 2QNDA 2MJHA 5C0XG 2BA0A 2YQRA 2P2RA 4JVHA 4OO1G 2NN6G 4AM3A 1X4MA 2ANNA 2PQUA 4WALA 2CTEA 4AIMA 1DTJA 1TUAA 1VIGA 4NBQA 2HH2A 1WE8A 2DGRA 5K36G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTL A;  1VIH A;  1ZZK A;  4LIJ A;  3VKE A;  2PY9 A;  4IFD G;  1EC6 A;  2CPQ A;  2OPV A;  4BA1 I;  4B8T A;  2CTK A;  1J4W A;  1DT4 A;  2ANR A;  4JVY A;  4WAN A;  3L7Z C;  2JEA I;  2BL5 A;  3AEV B;  2CTM A;  2FMR A;  2JVZ A;  1ZZI A;  2Z0S A;  3V69 A;  1ZZJ A;  2CTF A;  1J5K A;  2JA9 A;  4QMF B;  2HH3 A;  5JEA G;  4BA2 I;  2E3U A;  1K1G A;  1ZTG A;  2JZX A;  1KHM A;  2JEB I;  1X4N A;  2JE6 I;  3U1K A;  1WVN A;  2CTJ A;  2OPU A;  2AXY A;  2QND A;  2MJH A;  5C0X G;  2BA0 A;  2YQR A;  2P2R A;  4JVH A;  4OO1 G;  2NN6 G;  4AM3 A;  1X4M A;  2ANN A;  2PQU A;  4WAL A;  2CTE A;  4AIM A;  1DTJ A;  1TUA A;  1VIG A;  4NBQ A;  2HH2 A;  1WE8 A;  2DGR A;  5K36 G; 
#chains in the Genus database with same CATH topology
 1F0X A;  2PY9 A;  1I6U A;  2E5L H;  4B3M H;  4G08 A;  4DV4 H;  1N34 H;  4LF8 H;  3J7A K;  4NZT M;  4JVY A;  2UUA H;  2JEA I;  2FMR A;  2LTL A;  5LL6 b;  3NCV A;  1MSZ A;  4DR3 H;  1XNR H;  4LF5 H;  3GR5 A;  3V69 A;  4OX9 H;  5FLX W;  2CTF A;  2FFM A;  4AQY H;  1J5K A;  5JEA G;  5LMU H;  4DUY H;  3I0P A;  4LFC H;  1HNW H;  5IWA H;  4YHH H;  3GAB A;  1XNQ H;  4FJU A;  1X9Z A;  2OPU A;  2AXY A;  2QND A;  3GKU A;  2NN6 G;  1XMO H;  4LF9 H;  5DT9 A;  4B3S H;  4X65 H;  1AN7 A;  1S20 A;  4X62 H;  4JI2 H;  2FPH X;  1XRH A;  2K1H A;  5K36 G;  4LIJ A;  1VBI A;  1N36 H;  1FJG H;  4H8A A;  4FJS A;  4JI4 H;  2CPQ A;  3KDG A;  2M8W A;  3RF2 A;  4BA1 I;  1WHR A;  1DT4 A;  1IBL H;  4WAN A;  2CWF A;  1IBK H;  4LFA H;  1ZZI A;  2JVZ A;  2UXB H;  4X66 H;  4JI7 H;  4JI0 H;  4X64 H;  2PT7 G;  4PDB A;  2JA9 A;  4JI5 H;  1K1G A;  5LMN H;  2JEB I;  4DV5 H;  1HNZ H;  2A1S A;  1WVN A;  2CTJ A;  2MJH A;  4JVH A;  5C0X G;  2BA0 A;  2X06 A;  1X4M A;  1HNX H;  2ANN A;  4WAL A;  4AIM A;  2HH2 A;  3JAM W;  5BR8 H;  4DR5 H;  3T1Y H;  3OET A;  3VKE A;  2O4C A;  1J5E H;  4B8C D;  4NZR M;  2LTM A;  4EC5 A;  4B8T A;  4OD6 A;  1IBM H;  2CTK A;  4K0K H;  5IT9 W;  3J81 W;  2BL5 A;  2UU9 H;  2VQE H;  3OTO H;  3AEV B;  3UOE A;  4LF6 H;  3EZJ A;  5A2Q W;  1ZZJ A;  2HH3 A;  4BA2 I;  2CPM A;  2E3U A;  4YY3 H;  1ODH A;  4DUZ H;  2UUB H;  2LF0 A;  3SB1 A;  4LF4 H;  1ZTG A;  2F4V H;  4DR4 H;  1KHM A;  1HR0 H;  3FAU A;  1X4N A;  4B3R H;  1Z2I A;  4DR2 H;  2M6Q A;  2P2R A;  4DR6 H;  1N33 H;  4GKJ H;  4OO1 G;  1NXU A;  1XMQ H;  2CTE A;  4DV0 H;  2VQF H;  1I94 H;  3U1K A;  4GKK H;  4JI3 H;  1WE8 A;  2JZX A;  1UG8 A;  2CTL A;  1VIH A;  1ZZK A;  4IFD G;  1N32 H;  3J80 W;  2HHH H;  4NXN H;  3QD7 X;  4DV6 H;  4JI6 H;  4JI8 H;  1EC6 A;  4JYA H;  2Y3M A;  2OPV A;  4OCH A;  4E9J A;  1J4W A;  2ANR A;  2UUC H;  3L7Z C;  2CTM A;  2D9I A;  3OSS D;  2ZM6 H;  2Z0S A;  4DV3 H;  1X0A A;  1PQX A;  2VKC A;  4B3T H;  4DR7 H;  3KDK A;  4JI1 H;  1WTJ A;  2CWH A;  4DV7 H;  3T1H H;  4LFB H;  4DR1 H;  2G8Y A;  2JE6 I;  1SEI A;  4DV1 H;  4NXM H;  2YQR A;  2UXC H;  4LF7 H;  4KHP H;  2UXD H;  4AM3 A;  1FKA H;  2PQU A;  4DV2 H;  1DTJ A;  1V8C A;  1TUA A;  1VIG A;  4NBQ A;  4QMF B;  4JV5 H;  1S03 G;  2DGR A;  1V9N A;  2ZQE A;  2LRR A; 
#chains in the Genus database with same CATH homology
 2CTL A;  1VIH A;  1ZZK A;  4LIJ A;  3VKE A;  2PY9 A;  4IFD G;  1EC6 A;  2CPQ A;  2OPV A;  4BA1 I;  4B8T A;  2CTK A;  1J4W A;  1DT4 A;  2ANR A;  4JVY A;  4WAN A;  3L7Z C;  2JEA I;  2BL5 A;  3AEV B;  2CTM A;  2FMR A;  2JVZ A;  1ZZI A;  2Z0S A;  3V69 A;  1ZZJ A;  2CTF A;  1J5K A;  2JA9 A;  4QMF B;  2HH3 A;  5JEA G;  4BA2 I;  2E3U A;  1K1G A;  1ZTG A;  2JZX A;  1KHM A;  2JEB I;  1X4N A;  2JE6 I;  3U1K A;  1WVN A;  2CTJ A;  2OPU A;  2AXY A;  2QND A;  2MJH A;  5C0X G;  2BA0 A;  2YQR A;  2P2R A;  4JVH A;  4OO1 G;  2NN6 G;  4AM3 A;  1X4M A;  2ANN A;  2PQU A;  4WAL A;  2CTE A;  4AIM A;  1DTJ A;  1TUA A;  1VIG A;  4NBQ A;  2HH2 A;  1WE8 A;  2DGR A;  5K36 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...