3V69A

Filia-n crystal structure
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
ASLKRFQTLVPLDHKQGTLFEIIGEPKLPKWFHVECLEDPKRLYVEPRLLEIMFGKDGEHIPHLESMLHTLIHVNVWGPERRAEIWIFGPPPFRRDVDRMLTDLAHYCRMKLMEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Filia
publication title The N-terminus of FILIA Forms an Atypical KH Domain with a Unique Extension Involved in Interaction with RNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 27
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16005 MOEP19 KH-like RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 3v69A00
2JEBI 2FMRA 1ZZJA 2AXYA 1WVNA 2JA9A 1J4WA 2JZXA 2PQUA 4JVYA 2CPQA 1DT4A 2PY9A 2QNDA 3V69A 5JEAG 4WALA 2JEAI 4NBQA 2HH2A 3U1KA 2CTFA 2ANRA 1KHMA 1DTJA 2YQRA 5C0XG 1WE8A 4JVHA 2Z0SA 2DGRA 1X4NA 4AM3A 4BA1I 2CTLA 1J5KA 1ZTGA 4LIJA 2CTEA 4QMFB 1X4MA 4B8TA 3VKEA 2ANNA 3L7ZC 4IFDG 2MJHA 4OO1G 1VIHA 2CTKA 3AEVB 2BA0A 1K1GA 1VIGA 2CTJA 4BA2I 2NN6G 4AIMA 2OPVA 2CTMA 2E3UA 1ZZKA 1ZZIA 2JVZA 5K36G 2HH3A 2P2RA 2BL5A 4WANA 2OPUA 2JE6I 1TUAA 1EC6A
chains in the Genus database with same CATH superfamily
2AXYA 2PQUA 1J4WA 4JVYA 2CPQA 1N32H 2PY9A 4JI0H 2JEAI 5FLXW 5DT9A 5C0XG 1WE8A 2LRRA 4DUZH 2DGRA 4X65H 4KHPH 4JI1H 2CTLA 1J5KA 5IWAH 2CTEA 1WTJA 4JI2H 1PQXA 3VKEA 4LF8H 3L7ZC 4JI4H 2UXDH 2BA0A 3EZJA 2VKCA 4B8CD 3GR5A 2Y3MA 4LF4H 3QD7X 2OPVA 4FJSA 4K0KH 1ZZIA 2K1HA 4YY3H 4G08A 4DUYH 1N34H 3UOEA 3GKUA 4DV6H 4DR6H 4WANA 4DR5H 1I94H 4NXMH 3OETA 3JAMW 1X0AA 2FMRA 3RF2A 2JA9A 1HNXH 2M8WA 4DV5H 3V69A 5JEAG 4WALA 4LFAH 5LL6b 2X06A 2HH2A 3U1KA 2CTFA 4DR2H 1XNRH 1SEIA 1DTJA 4DR3H 4JVHA 4FJUA 3J7AK 1X4NA 4AM3A 4BA1I 1ZTGA 2VQEH 1XRHA 4LIJA 3J80W 2FPHX 1VBIA 1X4MA 1MSZA 2ZQEA 4NZRM 4LFBH 5A2QW 2MJHA 1VIHA 4NZTM 2PT7G 5LMNH 1VIGA 1S20A 3KDGA 2O4CA 4BA2I 4AIMA 3SB1A 4LF7H 2CTMA 4DR7H 2E3UA 2UXBH 5K36G 2P2RA 2BL5A 2A1SA 3T1HH 2F4VH 2JE6I 1N36H 2D9IA 4JI3H 4B3SH 4B3TH 4DV7H 3GABA 2JZXA 1J5EH 3NCVA 1FKAH 2UUAH 2QNDA 4LF9H 4JI7H 4LFCH 1S03G 4DR1H 2UXCH 2YQRA 4JV5H 4X64H 4DV3H 1XMOH 1X9ZA 4YHHH 1IBMH 4QMFB 4DV1H 4NXNH 1XMQH 1WHRA 2VQFH 2HHHH 1V8CA 2UUCH 4OX9H 1HNWH 4GKKH 4JYAH 4X66H 4JI5H 4OD6A 3FAUA 4OCHA 1ODHA 2NN6G 4DV4H 2E5LH 2HH3A 4EC5A 3T1YH 1N33H 2OPUA 1V9NA 1Z2IA 2CWHA 5BR8H 4GKJH 2M6QA 2JEBI 4LF6H 4H8AA 4X62H 1ZZJA 4AQYH 1WVNA 4JI8H 2FFMA 5IT9W 4DR4H 4B3MH 1DT4A 1F0XA 1HNZH 1IBLH 3KDKA 4NBQA 1I6UA 2ANRA 4DV0H 1KHMA 4LF5H 2Z0SA 1UG8A 4JI6H 2CWFA 4DV2H 4B3RH 1AN7A 2G8YA 3I0PA 4B8TA 2ANNA 2LF0A 4IFDG 4OO1G 4E9JA 3AEVB 2CTKA 1FJGH 3J81W 2CPMA 1K1GA 1HR0H 1IBKH 4PDBA 5LMUH 2UUBH 3OTOH 2CTJA 2LTMA 2ZM6H 1ZZKA 2JVZA 2UU9H 1XNQH 2LTLA 1NXUA 3OSSD 1TUAA 1EC6A
chains in the Genus database with same CATH topology
2JEBI 2FMRA 1ZZJA 2AXYA 1WVNA 2JA9A 1J4WA 2JZXA 2PQUA 4JVYA 2CPQA 1DT4A 2PY9A 2QNDA 3V69A 5JEAG 4WALA 2JEAI 4NBQA 2HH2A 3U1KA 2CTFA 2ANRA 1KHMA 1DTJA 2YQRA 5C0XG 1WE8A 4JVHA 2Z0SA 2DGRA 1X4NA 4AM3A 4BA1I 2CTLA 1J5KA 1ZTGA 4LIJA 2CTEA 4QMFB 1X4MA 4B8TA 3VKEA 2ANNA 3L7ZC 4IFDG 2MJHA 4OO1G 1VIHA 2CTKA 3AEVB 2BA0A 1K1GA 1VIGA 2CTJA 4BA2I 2NN6G 4AIMA 2OPVA 2CTMA 2E3UA 1ZZKA 1ZZIA 2JVZA 5K36G 2HH3A 2P2RA 2BL5A 4WANA 2OPUA 2JE6I 1TUAA 1EC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEB I;  2FMR A;  1ZZJ A;  2AXY A;  1WVN A;  2JA9 A;  1J4W A;  2JZX A;  2PQU A;  4JVY A;  2CPQ A;  1DT4 A;  2PY9 A;  2QND A;  3V69 A;  5JEA G;  4WAL A;  2JEA I;  4NBQ A;  2HH2 A;  3U1K A;  2CTF A;  2ANR A;  1KHM A;  1DTJ A;  2YQR A;  5C0X G;  1WE8 A;  4JVH A;  2Z0S A;  2DGR A;  1X4N A;  4AM3 A;  4BA1 I;  2CTL A;  1J5K A;  1ZTG A;  4LIJ A;  2CTE A;  4QMF B;  1X4M A;  4B8T A;  3VKE A;  2ANN A;  3L7Z C;  4IFD G;  2MJH A;  4OO1 G;  1VIH A;  2CTK A;  3AEV B;  2BA0 A;  1K1G A;  1VIG A;  2CTJ A;  4BA2 I;  2NN6 G;  4AIM A;  2OPV A;  2CTM A;  2E3U A;  1ZZK A;  1ZZI A;  2JVZ A;  5K36 G;  2HH3 A;  2P2R A;  2BL5 A;  4WAN A;  2OPU A;  2JE6 I;  1TUA A;  1EC6 A; 
#chains in the Genus database with same CATH topology
 2AXY A;  2PQU A;  1J4W A;  4JVY A;  2CPQ A;  1N32 H;  2PY9 A;  4JI0 H;  2JEA I;  5FLX W;  5DT9 A;  5C0X G;  1WE8 A;  2LRR A;  4DUZ H;  2DGR A;  4X65 H;  4KHP H;  4JI1 H;  2CTL A;  1J5K A;  5IWA H;  2CTE A;  1WTJ A;  4JI2 H;  1PQX A;  3VKE A;  4LF8 H;  3L7Z C;  4JI4 H;  2UXD H;  2BA0 A;  3EZJ A;  2VKC A;  4B8C D;  3GR5 A;  2Y3M A;  4LF4 H;  3QD7 X;  2OPV A;  4FJS A;  4K0K H;  1ZZI A;  2K1H A;  4YY3 H;  4G08 A;  4DUY H;  1N34 H;  3UOE A;  3GKU A;  4DV6 H;  4DR6 H;  4WAN A;  4DR5 H;  1I94 H;  4NXM H;  3OET A;  3JAM W;  1X0A A;  2FMR A;  3RF2 A;  2JA9 A;  1HNX H;  2M8W A;  4DV5 H;  3V69 A;  5JEA G;  4WAL A;  4LFA H;  5LL6 b;  2X06 A;  2HH2 A;  3U1K A;  2CTF A;  4DR2 H;  1XNR H;  1SEI A;  1DTJ A;  4DR3 H;  4JVH A;  4FJU A;  3J7A K;  1X4N A;  4AM3 A;  4BA1 I;  1ZTG A;  2VQE H;  1XRH A;  4LIJ A;  3J80 W;  2FPH X;  1VBI A;  1X4M A;  1MSZ A;  2ZQE A;  4NZR M;  4LFB H;  5A2Q W;  2MJH A;  1VIH A;  4NZT M;  2PT7 G;  5LMN H;  1VIG A;  1S20 A;  3KDG A;  2O4C A;  4BA2 I;  4AIM A;  3SB1 A;  4LF7 H;  2CTM A;  4DR7 H;  2E3U A;  2UXB H;  5K36 G;  2P2R A;  2BL5 A;  2A1S A;  3T1H H;  2F4V H;  2JE6 I;  1N36 H;  2D9I A;  4JI3 H;  4B3S H;  4B3T H;  4DV7 H;  3GAB A;  2JZX A;  1J5E H;  3NCV A;  1FKA H;  2UUA H;  2QND A;  4LF9 H;  4JI7 H;  4LFC H;  1S03 G;  4DR1 H;  2UXC H;  2YQR A;  4JV5 H;  4X64 H;  4DV3 H;  1XMO H;  1X9Z A;  4YHH H;  1IBM H;  4QMF B;  4DV1 H;  4NXN H;  1XMQ H;  1WHR A;  2VQF H;  2HHH H;  1V8C A;  2UUC H;  4OX9 H;  1HNW H;  4GKK H;  4JYA H;  4X66 H;  4JI5 H;  4OD6 A;  3FAU A;  4OCH A;  1ODH A;  2NN6 G;  4DV4 H;  2E5L H;  2HH3 A;  4EC5 A;  3T1Y H;  1N33 H;  2OPU A;  1V9N A;  1Z2I A;  2CWH A;  5BR8 H;  4GKJ H;  2M6Q A;  2JEB I;  4LF6 H;  4H8A A;  4X62 H;  1ZZJ A;  4AQY H;  1WVN A;  4JI8 H;  2FFM A;  5IT9 W;  4DR4 H;  4B3M H;  1DT4 A;  1F0X A;  1HNZ H;  1IBL H;  3KDK A;  4NBQ A;  1I6U A;  2ANR A;  4DV0 H;  1KHM A;  4LF5 H;  2Z0S A;  1UG8 A;  4JI6 H;  2CWF A;  4DV2 H;  4B3R H;  1AN7 A;  2G8Y A;  3I0P A;  4B8T A;  2ANN A;  2LF0 A;  4IFD G;  4OO1 G;  4E9J A;  3AEV B;  2CTK A;  1FJG H;  3J81 W;  2CPM A;  1K1G A;  1HR0 H;  1IBK H;  4PDB A;  5LMU H;  2UUB H;  3OTO H;  2CTJ A;  2LTM A;  2ZM6 H;  1ZZK A;  2JVZ A;  2UU9 H;  1XNQ H;  2LTL A;  1NXU A;  3OSS D;  1TUA A;  1EC6 A; 
#chains in the Genus database with same CATH homology
 2JEB I;  2FMR A;  1ZZJ A;  2AXY A;  1WVN A;  2JA9 A;  1J4W A;  2JZX A;  2PQU A;  4JVY A;  2CPQ A;  1DT4 A;  2PY9 A;  2QND A;  3V69 A;  5JEA G;  4WAL A;  2JEA I;  4NBQ A;  2HH2 A;  3U1K A;  2CTF A;  2ANR A;  1KHM A;  1DTJ A;  2YQR A;  5C0X G;  1WE8 A;  4JVH A;  2Z0S A;  2DGR A;  1X4N A;  4AM3 A;  4BA1 I;  2CTL A;  1J5K A;  1ZTG A;  4LIJ A;  2CTE A;  4QMF B;  1X4M A;  4B8T A;  3VKE A;  2ANN A;  3L7Z C;  4IFD G;  2MJH A;  4OO1 G;  1VIH A;  2CTK A;  3AEV B;  2BA0 A;  1K1G A;  1VIG A;  2CTJ A;  4BA2 I;  2NN6 G;  4AIM A;  2OPV A;  2CTM A;  2E3U A;  1ZZK A;  1ZZI A;  2JVZ A;  5K36 G;  2HH3 A;  2P2R A;  2BL5 A;  4WAN A;  2OPU A;  2JE6 I;  1TUA A;  1EC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...