4OD6A

Structure of smr domain of muts2 from deinococcus radiodurans, mn2+ soaked
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
82
structure length
82
Chain Sequence
RFDNELQLRGLSVEAAVEELRAAIAEARALKETPLRVVHGKGMGVLRRTLRDYLKTDKNVESFHDAEANQGGHGVTIVNVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Endonuclease MutS2
publication title Structural and functional studies of MutS2 from Deinococcus radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 29
structure length 82
sequence length 82
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4od6A00
2D9IA 2VKCA 4OCHA 3QD7X 3FAUA 2ZQEA 4OD6A
chains in the Genus database with same CATH superfamily
4JYAH 3JAMW 2VQEH 1XMQH 4JV5H 4NZRM 5BR8H 4JI2H 2P2RA 1Z2IA 4FJUA 4OCHA 3OSSD 2LTLA 4JI3H 2LTMA 1X0AA 2O4CA 4DV4H 3KDGA 4AM3A 1N33H 4JVHA 1WE8A 2E5LH 2VKCA 2JZXA 2PQUA 4JVYA 3NCVA 4JI1H 2OPUA 2AXYA 1I6UA 4JI0H 4LF6H 2CTKA 2UU9H 5IWAH 1SEIA 5LL6b 2JVZA 1J5KA 1ZZJA 2JE6I 4IFDG 1IBMH 2CWFA 5DT9A 2UXBH 2FFMA 5IT9W 3EZJA 1WTJA 4DR3H 2NN6G 4NBQA 1XNRH 2UXCH 2CTEA 3OETA 1IBLH 1X9ZA 3J80W 4DR7H 2HHHH 2VQFH 1DT4A 5K36G 4QMFB 4JI8H 2LRRA 3T1HH 3T1YH 1DTJA 1HNZH 4LF7H 2ZM6H 1J5EH 4B8TA 2HH3A 2PT7G 2UUBH 4PDBA 2CTMA 4B3SH 1X4NA 2M8WA 3QD7X 4DV7H 3SB1A 1VBIA 4DUYH 1ODHA 2CTLA 1KHMA 2K1HA 2M6QA 2ANNA 4KHPH 2BA0A 1MSZA 5FLXW 2A1SA 1XMOH 2JEAI 2CWHA 1AN7A 2X06A 2ZQEA 5A2QW 4DR5H 1NXUA 4OX9H 1FJGH 4GKKH 3RF2A 1V9NA 2FPHX 3GKUA 4DV5H 1N32H 1HNWH 4NZTM 5JEAG 1V8CA 1VIGA 4G08A 2Z0SA 4E9JA 2DGRA 2OPVA 2CPQA 1ZTGA 1S03G 3L7ZC 3GABA 4X62H 2FMRA 4B3MH 1HNXH 2G8YA 4K0KH 2LF0A 4OD6A 5C0XG 2F4VH 4DR4H 4X64H 4DR6H 2D9IA 4LFCH 3J7AK 4DV3H 4H8AA 3VKEA 2CPMA 2QNDA 2E3UA 1ZZKA 2UUAH 4NXMH 4OO1G 2Y3MA 4WANA 4LF9H 1VIHA 3V69A 1XRHA 2CTJA 5LMNH 4DR2H 2BL5A 1EC6A 1F0XA 2JA9A 4DV6H 4B3TH 4DUZH 2UUCH 4DV2H 1WHRA 4YHHH 3GR5A 4NXNH 1WVNA 4DR1H 1ZZIA 4FJSA 4WALA 1UG8A 4JI4H 4JI7H 1X4MA 4EC5A 1S20A 2CTFA 4LFBH 4AIMA 3AEVB 1IBKH 2YQRA 3I0PA 1N34H 3OTOH 2HH2A 4AQYH 4LFAH 4LF8H 4BA2I 4JI6H 4DV0H 1N36H 2PY9A 1HR0H 4BA1I 1J4WA 1I94H 1K1GA 4YY3H 2MJHA 4GKJH 2JEBI 4X66H 3KDKA 4B8CD 4JI5H 4LIJA 1PQXA 4LF5H 2UXDH 4LF4H 4X65H 3J81W 5LMUH 3UOEA 1FKAH 1XNQH 3FAUA 1TUAA 4B3RH 4DV1H 2ANRA 3U1KA
chains in the Genus database with same CATH topology
4JYAH 3JAMW 2VQEH 1XMQH 4JV5H 4NZRM 5BR8H 4JI2H 4OCHA 3OSSD 4JI3H 2O4CA 4DV4H 3KDGA 1N33H 2E5LH 2VKCA 3NCVA 4JI1H 1I6UA 4JI0H 4LF6H 2UU9H 5IWAH 1SEIA 5LL6b 1IBMH 5DT9A 2UXBH 5IT9W 3EZJA 4DR3H 1XNRH 2UXCH 3OETA 1IBLH 1X9ZA 3J80W 4DR7H 2HHHH 2VQFH 4JI8H 3T1HH 3T1YH 1HNZH 4LF7H 2ZM6H 1J5EH 2PT7G 2UUBH 4PDBA 4B3SH 3QD7X 4DV7H 3SB1A 4DUYH 1ODHA 4KHPH 5FLXW 1XMOH 2ZQEA 1AN7A 4DR5H 5A2QW 4OX9H 1FJGH 4GKKH 3RF2A 2FPHX 4DV5H 1N32H 1HNWH 4NZTM 4G08A 4E9JA 1S03G 3GABA 4X62H 4B3MH 1HNXH 4K0KH 2LF0A 4OD6A 2F4VH 4DR4H 4X64H 4DR6H 2D9IA 4LFCH 3J7AK 4DV3H 2UUAH 4NXMH 2Y3MA 4LF9H 5LMNH 4DR2H 1F0XA 4DV6H 4B3TH 4DUZH 2UUCH 4DV2H 4YHHH 3GR5A 4NXNH 4DR1H 4JI4H 4JI7H 4EC5A 4LFBH 1IBKH 1N34H 3OTOH 4AQYH 4LFAH 4LF8H 4JI6H 4DV0H 1N36H 1HR0H 1I94H 4YY3H 4GKJH 4X66H 3KDKA 4B8CD 4JI5H 4LF5H 2UXDH 4LF4H 4X65H 3J81W 5LMUH 1FKAH 1XNQH 3FAUA 4B3RH 4DV1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9I A;  2VKC A;  4OCH A;  3QD7 X;  3FAU A;  2ZQE A;  4OD6 A; 
#chains in the Genus database with same CATH topology
 4JYA H;  3JAM W;  2VQE H;  1XMQ H;  4JV5 H;  4NZR M;  5BR8 H;  4JI2 H;  2P2R A;  1Z2I A;  4FJU A;  4OCH A;  3OSS D;  2LTL A;  4JI3 H;  2LTM A;  1X0A A;  2O4C A;  4DV4 H;  3KDG A;  4AM3 A;  1N33 H;  4JVH A;  1WE8 A;  2E5L H;  2VKC A;  2JZX A;  2PQU A;  4JVY A;  3NCV A;  4JI1 H;  2OPU A;  2AXY A;  1I6U A;  4JI0 H;  4LF6 H;  2CTK A;  2UU9 H;  5IWA H;  1SEI A;  5LL6 b;  2JVZ A;  1J5K A;  1ZZJ A;  2JE6 I;  4IFD G;  1IBM H;  2CWF A;  5DT9 A;  2UXB H;  2FFM A;  5IT9 W;  3EZJ A;  1WTJ A;  4DR3 H;  2NN6 G;  4NBQ A;  1XNR H;  2UXC H;  2CTE A;  3OET A;  1IBL H;  1X9Z A;  3J80 W;  4DR7 H;  2HHH H;  2VQF H;  1DT4 A;  5K36 G;  4QMF B;  4JI8 H;  2LRR A;  3T1H H;  3T1Y H;  1DTJ A;  1HNZ H;  4LF7 H;  2ZM6 H;  1J5E H;  4B8T A;  2HH3 A;  2PT7 G;  2UUB H;  4PDB A;  2CTM A;  4B3S H;  1X4N A;  2M8W A;  3QD7 X;  4DV7 H;  3SB1 A;  1VBI A;  4DUY H;  1ODH A;  2CTL A;  1KHM A;  2K1H A;  2M6Q A;  2ANN A;  4KHP H;  2BA0 A;  1MSZ A;  5FLX W;  2A1S A;  1XMO H;  2JEA I;  2CWH A;  1AN7 A;  2X06 A;  2ZQE A;  5A2Q W;  4DR5 H;  1NXU A;  4OX9 H;  1FJG H;  4GKK H;  3RF2 A;  1V9N A;  2FPH X;  3GKU A;  4DV5 H;  1N32 H;  1HNW H;  4NZT M;  5JEA G;  1V8C A;  1VIG A;  4G08 A;  2Z0S A;  4E9J A;  2DGR A;  2OPV A;  2CPQ A;  1ZTG A;  1S03 G;  3L7Z C;  3GAB A;  4X62 H;  2FMR A;  4B3M H;  1HNX H;  2G8Y A;  4K0K H;  2LF0 A;  4OD6 A;  5C0X G;  2F4V H;  4DR4 H;  4X64 H;  4DR6 H;  2D9I A;  4LFC H;  3J7A K;  4DV3 H;  4H8A A;  3VKE A;  2CPM A;  2QND A;  2E3U A;  1ZZK A;  2UUA H;  4NXM H;  4OO1 G;  2Y3M A;  4WAN A;  4LF9 H;  1VIH A;  3V69 A;  1XRH A;  2CTJ A;  5LMN H;  4DR2 H;  2BL5 A;  1EC6 A;  1F0X A;  2JA9 A;  4DV6 H;  4B3T H;  4DUZ H;  2UUC H;  4DV2 H;  1WHR A;  4YHH H;  3GR5 A;  4NXN H;  1WVN A;  4DR1 H;  1ZZI A;  4FJS A;  4WAL A;  1UG8 A;  4JI4 H;  4JI7 H;  1X4M A;  4EC5 A;  1S20 A;  2CTF A;  4LFB H;  4AIM A;  3AEV B;  1IBK H;  2YQR A;  3I0P A;  1N34 H;  3OTO H;  2HH2 A;  4AQY H;  4LFA H;  4LF8 H;  4BA2 I;  4JI6 H;  4DV0 H;  1N36 H;  2PY9 A;  1HR0 H;  4BA1 I;  1J4W A;  1I94 H;  1K1G A;  4YY3 H;  2MJH A;  4GKJ H;  2JEB I;  4X66 H;  3KDK A;  4B8C D;  4JI5 H;  4LIJ A;  1PQX A;  4LF5 H;  2UXD H;  4LF4 H;  4X65 H;  3J81 W;  5LMU H;  3UOE A;  1FKA H;  1XNQ H;  3FAU A;  1TUA A;  4B3R H;  4DV1 H;  2ANR A;  3U1K A; 
#chains in the Genus database with same CATH homology
 4JYA H;  3JAM W;  2VQE H;  1XMQ H;  4JV5 H;  4NZR M;  5BR8 H;  4JI2 H;  4OCH A;  3OSS D;  4JI3 H;  2O4C A;  4DV4 H;  3KDG A;  1N33 H;  2E5L H;  2VKC A;  3NCV A;  4JI1 H;  1I6U A;  4JI0 H;  4LF6 H;  2UU9 H;  5IWA H;  1SEI A;  5LL6 b;  1IBM H;  5DT9 A;  2UXB H;  5IT9 W;  3EZJ A;  4DR3 H;  1XNR H;  2UXC H;  3OET A;  1IBL H;  1X9Z A;  3J80 W;  4DR7 H;  2HHH H;  2VQF H;  4JI8 H;  3T1H H;  3T1Y H;  1HNZ H;  4LF7 H;  2ZM6 H;  1J5E H;  2PT7 G;  2UUB H;  4PDB A;  4B3S H;  3QD7 X;  4DV7 H;  3SB1 A;  4DUY H;  1ODH A;  4KHP H;  5FLX W;  1XMO H;  2ZQE A;  1AN7 A;  4DR5 H;  5A2Q W;  4OX9 H;  1FJG H;  4GKK H;  3RF2 A;  2FPH X;  4DV5 H;  1N32 H;  1HNW H;  4NZT M;  4G08 A;  4E9J A;  1S03 G;  3GAB A;  4X62 H;  4B3M H;  1HNX H;  4K0K H;  2LF0 A;  4OD6 A;  2F4V H;  4DR4 H;  4X64 H;  4DR6 H;  2D9I A;  4LFC H;  3J7A K;  4DV3 H;  2UUA H;  4NXM H;  2Y3M A;  4LF9 H;  5LMN H;  4DR2 H;  1F0X A;  4DV6 H;  4B3T H;  4DUZ H;  2UUC H;  4DV2 H;  4YHH H;  3GR5 A;  4NXN H;  4DR1 H;  4JI4 H;  4JI7 H;  4EC5 A;  4LFB H;  1IBK H;  1N34 H;  3OTO H;  4AQY H;  4LFA H;  4LF8 H;  4JI6 H;  4DV0 H;  1N36 H;  1HR0 H;  1I94 H;  4YY3 H;  4GKJ H;  4X66 H;  3KDK A;  4B8C D;  4JI5 H;  4LF5 H;  2UXD H;  4LF4 H;  4X65 H;  3J81 W;  5LMU H;  1FKA H;  1XNQ H;  3FAU A;  4B3R H;  4DV1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...