4OD6A

Structure of smr domain of muts2 from deinococcus radiodurans, mn2+ soaked
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
82
structure length
82
Chain Sequence
b'RFDNELQLRGLSVEAAVEELRAAIAEARALKETPLRVVHGKGMGVLRRTLRDYLKTDKNVESFHDAEANQGGHGVTIVNVKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endonuclease MutS2
molecule tags Hydrolase
source organism Deinococcus radiodurans
publication title Structural and functional studies of MutS2 from Deinococcus radiodurans.
pubmed doi rcsb
total genus 29
structure length 82
sequence length 82
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4od6A00
3FAUA 2ZQEA 2VKCA 2D9IA 4OCHA 4OD6A 3QD7X
chains in the Genus database with same CATH superfamily
4DR1H 1WHRA 1F0XA 2Y3MA 2X06A 3VKEA 2UUCH 4BA2I 1DT4A 3RF2A 3JAMW 1X9ZA 2CTFA 4DV3H 4DV4H 4JI7H 2CTMA 4KHPH 2LF0A 1Z2IA 2HHHH 3L7ZC 5LMUH 4E9JA 4LFBH 2UU9H 2CPMA 2JEBI 4YHHH 1KHMA 2ANNA 3QD7X 4FJSA 5K36G 4EC5A 4X65H 1J4WA 1IBMH 3SB1A 3J80W 2VKCA 4LFAH 1V8CA 1ZZIA 2QNDA 2PQUA 1X4NA 4BA1I 2F4VH 3UOEA 4B3TH 4DV6H 2D9IA 2M6QA 4LIJA 2O4CA 2E3UA 1FKAH 4GKKH 4JV5H 2K1HA 4JI8H 2ZQEA 1WE8A 1X4MA 2FPHX 4B3MH 4OCHA 5LMNH 4PDBA 2JVZA 4WANA 4JI1H 4DR5H 3T1HH 3EZJA 3T1YH 4DV0H 3GR5A 4DV7H 1S03G 3J81W 1XRHA 5FLXW 4JI6H 2LRRA 4DUZH 4DV5H 3GABA 4DR3H 4NXNH 1XNQH 3I0PA 1MSZA 5LL6b 1HNXH 2MJHA 4QMFB 2BA0A 3NCVA 1ODHA 1VIHA 2UXCH 2UUBH 2UUAH 4DV2H 1AN7A 3J7AK 2PT7G 2CWHA 4AM3A 1N33H 1J5EH 4FJUA 1WTJA 2G8YA 4H8AA 1I94H 4JI5H 1N32H 3OTOH 1ZZKA 2JE6I 2OPVA 2M8WA 4YY3H 2CTJA 2Z0SA 3OETA 1ZZJA 1WVNA 2CTLA 4LFCH 1TUAA 2HH2A 4DR4H 3AEVB 5IT9W 4NZRM 4B3RH 4LF7H 1N34H 1NXUA 4X66H 4G08A 1VIGA 4DV1H 2FFMA 4DR7H 5A2QW 1N36H 4LF4H 5DT9A 2A1SA 4JVHA 2LTMA 2OPUA 2AXYA 2PY9A 4WALA 1SEIA 1PQXA 5IWAH 2CPQA 4DUYH 2CWFA 1K1GA 4LF6H 2CTKA 2BL5A 3U1KA 4DR6H 2JA9A 2UXBH 2NN6G 2DGRA 1FJGH 4OD6A 2JZXA 1ZTGA 4X64H 2VQEH 1XMOH 2P2RA 4K0KH 3KDGA 4AIMA 1S20A 1IBKH 4B3SH 2CTEA 2HH3A 4NBQA 4GKJH 5JEAG 1I6UA 4X62H 1VBIA 1J5KA 1HNWH 1UG8A 4IFDG 1DTJA 1XMQH 4JI3H 2UXDH 4NZTM 4NXMH 3GKUA 2LTLA 5BR8H 3KDKA 4AQYH 1IBLH 4OX9H 4JYAH 1HNZH 3OSSD 5C0XG 4LF5H 2VQFH 4B8CD 4DR2H 1V9NA 4JI4H 2ANRA 1XNRH 1X0AA 4LF9H 4JI2H 4JI0H 4B8TA 2E5LH 3FAUA 4OO1G 2ZM6H 1HR0H 4LF8H 2JEAI 4JVYA 2FMRA 3V69A 2YQRA 1EC6A
chains in the Genus database with same CATH topology
4DR1H 1F0XA 2Y3MA 2UUCH 3RF2A 3JAMW 1X9ZA 4DV3H 4DV4H 4JI7H 4KHPH 2LF0A 2HHHH 5LMUH 4E9JA 4LFBH 2UU9H 4YHHH 3QD7X 4EC5A 4X65H 1IBMH 3SB1A 3J80W 2VKCA 4LFAH 2F4VH 4B3TH 4DV6H 2D9IA 2O4CA 1FKAH 4GKKH 4JV5H 4JI8H 2ZQEA 2FPHX 4B3MH 4OCHA 5LMNH 4PDBA 4JI1H 4DR5H 3EZJA 3T1YH 4DV0H 3GR5A 4DV7H 1S03G 3J81W 4JI6H 5FLXW 4DUZH 4DV5H 3GABA 4DR3H 4NXNH 1XNQH 5LL6b 1HNXH 2UXCH 3NCVA 1ODHA 2UUBH 2UUAH 4DV2H 1AN7A 3J7AK 2PT7G 1N33H 1J5EH 1I94H 4JI5H 1N32H 3OTOH 4YY3H 3OETA 4LFCH 4DR4H 5IT9W 4NZRM 4B3RH 4LF7H 1N34H 4X66H 4G08A 4DV1H 4DR7H 5A2QW 1N36H 4LF4H 5DT9A 1SEIA 5IWAH 4DUYH 4LF6H 4DR6H 2UXBH 1FJGH 4OD6A 4X64H 2VQEH 1XMOH 4K0KH 3KDGA 1IBKH 4B3SH 4GKJH 1I6UA 4X62H 1HNWH 1XMQH 4JI3H 2UXDH 4NZTM 4NXMH 5BR8H 3KDKA 4AQYH 1IBLH 4OX9H 4JYAH 1HNZH 3OSSD 4LF5H 2VQFH 4DR2H 4B8CD 4JI4H 1XNRH 4LF9H 4JI2H 4JI0H 2E5LH 3FAUA 2ZM6H 1HR0H 4LF8H 3T1HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAU A;  2ZQE A;  2VKC A;  2D9I A;  4OCH A;  4OD6 A;  3QD7 X; 
#chains in the Genus database with same CATH topology
 4DR1 H;  1WHR A;  1F0X A;  2Y3M A;  2X06 A;  3VKE A;  2UUC H;  4BA2 I;  1DT4 A;  3RF2 A;  3JAM W;  1X9Z A;  2CTF A;  4DV3 H;  4DV4 H;  4JI7 H;  2CTM A;  4KHP H;  2LF0 A;  1Z2I A;  2HHH H;  3L7Z C;  5LMU H;  4E9J A;  4LFB H;  2UU9 H;  2CPM A;  2JEB I;  4YHH H;  1KHM A;  2ANN A;  3QD7 X;  4FJS A;  5K36 G;  4EC5 A;  4X65 H;  1J4W A;  1IBM H;  3SB1 A;  3J80 W;  2VKC A;  4LFA H;  1V8C A;  1ZZI A;  2QND A;  2PQU A;  1X4N A;  4BA1 I;  2F4V H;  3UOE A;  4B3T H;  4DV6 H;  2D9I A;  2M6Q A;  4LIJ A;  2O4C A;  2E3U A;  1FKA H;  4GKK H;  4JV5 H;  2K1H A;  4JI8 H;  2ZQE A;  1WE8 A;  1X4M A;  2FPH X;  4B3M H;  4OCH A;  5LMN H;  4PDB A;  2JVZ A;  4WAN A;  4JI1 H;  4DR5 H;  3T1H H;  3EZJ A;  3T1Y H;  4DV0 H;  3GR5 A;  4DV7 H;  1S03 G;  3J81 W;  1XRH A;  5FLX W;  4JI6 H;  2LRR A;  4DUZ H;  4DV5 H;  3GAB A;  4DR3 H;  4NXN H;  1XNQ H;  3I0P A;  1MSZ A;  5LL6 b;  1HNX H;  2MJH A;  4QMF B;  2BA0 A;  3NCV A;  1ODH A;  1VIH A;  2UXC H;  2UUB H;  2UUA H;  4DV2 H;  1AN7 A;  3J7A K;  2PT7 G;  2CWH A;  4AM3 A;  1N33 H;  1J5E H;  4FJU A;  1WTJ A;  2G8Y A;  4H8A A;  1I94 H;  4JI5 H;  1N32 H;  3OTO H;  1ZZK A;  2JE6 I;  2OPV A;  2M8W A;  4YY3 H;  2CTJ A;  2Z0S A;  3OET A;  1ZZJ A;  1WVN A;  2CTL A;  4LFC H;  1TUA A;  2HH2 A;  4DR4 H;  3AEV B;  5IT9 W;  4NZR M;  4B3R H;  4LF7 H;  1N34 H;  1NXU A;  4X66 H;  4G08 A;  1VIG A;  4DV1 H;  2FFM A;  4DR7 H;  5A2Q W;  1N36 H;  4LF4 H;  5DT9 A;  2A1S A;  4JVH A;  2LTM A;  2OPU A;  2AXY A;  2PY9 A;  4WAL A;  1SEI A;  1PQX A;  5IWA H;  2CPQ A;  4DUY H;  2CWF A;  1K1G A;  4LF6 H;  2CTK A;  2BL5 A;  3U1K A;  4DR6 H;  2JA9 A;  2UXB H;  2NN6 G;  2DGR A;  1FJG H;  4OD6 A;  2JZX A;  1ZTG A;  4X64 H;  2VQE H;  1XMO H;  2P2R A;  4K0K H;  3KDG A;  4AIM A;  1S20 A;  1IBK H;  4B3S H;  2CTE A;  2HH3 A;  4NBQ A;  4GKJ H;  5JEA G;  1I6U A;  4X62 H;  1VBI A;  1J5K A;  1HNW H;  1UG8 A;  4IFD G;  1DTJ A;  1XMQ H;  4JI3 H;  2UXD H;  4NZT M;  4NXM H;  3GKU A;  2LTL A;  5BR8 H;  3KDK A;  4AQY H;  1IBL H;  4OX9 H;  4JYA H;  1HNZ H;  3OSS D;  5C0X G;  4LF5 H;  2VQF H;  4B8C D;  4DR2 H;  1V9N A;  4JI4 H;  2ANR A;  1XNR H;  1X0A A;  4LF9 H;  4JI2 H;  4JI0 H;  4B8T A;  2E5L H;  3FAU A;  4OO1 G;  2ZM6 H;  1HR0 H;  4LF8 H;  2JEA I;  4JVY A;  2FMR A;  3V69 A;  2YQR A;  1EC6 A; 
#chains in the Genus database with same CATH homology
 4DR1 H;  1F0X A;  2Y3M A;  2UUC H;  3RF2 A;  3JAM W;  1X9Z A;  4DV3 H;  4DV4 H;  4JI7 H;  4KHP H;  2LF0 A;  2HHH H;  5LMU H;  4E9J A;  4LFB H;  2UU9 H;  4YHH H;  3QD7 X;  4EC5 A;  4X65 H;  1IBM H;  3SB1 A;  3J80 W;  2VKC A;  4LFA H;  2F4V H;  4B3T H;  4DV6 H;  2D9I A;  2O4C A;  1FKA H;  4GKK H;  4JV5 H;  4JI8 H;  2ZQE A;  2FPH X;  4B3M H;  4OCH A;  5LMN H;  4PDB A;  4JI1 H;  4DR5 H;  3EZJ A;  3T1Y H;  4DV0 H;  3GR5 A;  4DV7 H;  1S03 G;  3J81 W;  4JI6 H;  5FLX W;  4DUZ H;  4DV5 H;  3GAB A;  4DR3 H;  4NXN H;  1XNQ H;  5LL6 b;  1HNX H;  2UXC H;  3NCV A;  1ODH A;  2UUB H;  2UUA H;  4DV2 H;  1AN7 A;  3J7A K;  2PT7 G;  1N33 H;  1J5E H;  1I94 H;  4JI5 H;  1N32 H;  3OTO H;  4YY3 H;  3OET A;  4LFC H;  4DR4 H;  5IT9 W;  4NZR M;  4B3R H;  4LF7 H;  1N34 H;  4X66 H;  4G08 A;  4DV1 H;  4DR7 H;  5A2Q W;  1N36 H;  4LF4 H;  5DT9 A;  1SEI A;  5IWA H;  4DUY H;  4LF6 H;  4DR6 H;  2UXB H;  1FJG H;  4OD6 A;  4X64 H;  2VQE H;  1XMO H;  4K0K H;  3KDG A;  1IBK H;  4B3S H;  4GKJ H;  1I6U A;  4X62 H;  1HNW H;  1XMQ H;  4JI3 H;  2UXD H;  4NZT M;  4NXM H;  5BR8 H;  3KDK A;  4AQY H;  1IBL H;  4OX9 H;  4JYA H;  1HNZ H;  3OSS D;  4LF5 H;  2VQF H;  4DR2 H;  4B8C D;  4JI4 H;  1XNR H;  4LF9 H;  4JI2 H;  4JI0 H;  2E5L H;  3FAU A;  2ZM6 H;  1HR0 H;  4LF8 H;  3T1H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...