4OD6A

Structure of smr domain of muts2 from deinococcus radiodurans, mn2+ soaked
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
82
structure length
82
Chain Sequence
RFDNELQLRGLSVEAAVEELRAAIAEARALKETPLRVVHGKGMGVLRRTLRDYLKTDKNVESFHDAEANQGGHGVTIVNVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endonuclease MutS2
publication title Structural and functional studies of MutS2 from Deinococcus radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 29
structure length 82
sequence length 82
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4od6A00
2VKCA 4OCHA 2ZQEA 3FAUA 2D9IA 3QD7X 4OD6A
chains in the Genus database with same CATH superfamily
3EZJA 4LF5H 2HH3A 1N34H 3V69A 4AM3A 4JI1H 4JYAH 2ANRA 2D9IA 1XMOH 3NCVA 4AQYH 2OPUA 4DR4H 4B3MH 3J7AK 4DR5H 2Z0SA 2FPHX 1F0XA 4LIJA 4B8TA 1N32H 1SEIA 2FFMA 2UUBH 4OO1G 3OETA 2BA0A 4DV1H 4X65H 3AEVB 4WALA 4JVYA 1ODHA 4X62H 1X9ZA 2A1SA 4G08A 2MJHA 1XMQH 1IBMH 1HR0H 4DV7H 4LFBH 4LF9H 4B3SH 1PQXA 2G8YA 1HNXH 1ZZJA 1TUAA 4JI3H 4NBQA 3J81W 4JI5H 4DR6H 2CTLA 4OD6A 2JE6I 3KDGA 5LMUH 1EC6A 2ANNA 4B3TH 1XNQH 4WANA 4NXNH 4DV4H 4FJSA 3OTOH 4DUZH 1X4MA 5A2QW 2ZQEA 4LF7H 4OX9H 2CTEA 1X4NA 1FKAH 1DTJA 4GKKH 1K1GA 1N33H 2CTFA 4JI7H 1WE8A 1VIGA 2LRRA 4IFDG 1DT4A 2CWHA 4DUYH 1X0AA 1V8CA 4DV3H 4NXMH 4LF4H 2UUCH 4AIMA 3KDKA 2CTKA 1J4WA 2UXBH 3GR5A 2ZM6H 2Y3MA 4DV6H 4BA1I 4JI4H 2JVZA 2AXYA 4B3RH 3GABA 4JI2H 3U1KA 1MSZA 5LL6b 2PQUA 4LF8H 2CTJA 2JZXA 4B8CD 3QD7X 2VQFH 4DR7H 3L7ZC 4YHHH 1ZTGA 2BL5A 4JI0H 4YY3H 2OPVA 2PT7G 3FAUA 5IWAH 1J5EH 2JA9A 4LFAH 2P2RA 4E9JA 2FMRA 2VQEH 2CPMA 4BA2I 2X06A 3OSSD 2HHHH 3GKUA 3T1YH 2LTMA 3T1HH 1HNWH 4H8AA 4DV2H 5C0XG 2JEBI 2K1HA 2JEAI 1KHMA 3SB1A 1S20A 4JVHA 4QMFB 2E5LH 2M8WA 1J5KA 4EC5A 2E3UA 4JV5H 4NZRM 1XNRH 4KHPH 1ZZKA 2F4VH 3J80W 4DR1H 1XRHA 4DR3H 5LMNH 2UU9H 4DV0H 4JI8H 2HH2A 1FJGH 1N36H 4K0KH 3RF2A 1AN7A 2NN6G 2LF0A 5BR8H 1V9NA 3I0PA 4JI6H 4LF6H 5DT9A 5FLXW 1NXUA 2UUAH 1HNZH 1S03G 1IBKH 4X66H 5JEAG 1I6UA 1VIHA 4FJUA 3UOEA 1WHRA 2CPQA 1Z2IA 4DR2H 4NZTM 1ZZIA 2M6QA 3VKEA 3JAMW 2CTMA 5K36G 2LTLA 4X64H 1I94H 4GKJH 2YQRA 4PDBA 1VBIA 4LFCH 2PY9A 2CWFA 2DGRA 2VKCA 4OCHA 2UXDH 1WVNA 2O4CA 2QNDA 4DV5H 1UG8A 5IT9W 1WTJA 2UXCH 1IBLH
chains in the Genus database with same CATH topology
3EZJA 4LF5H 1N34H 4JI1H 4JYAH 2D9IA 1XMOH 3NCVA 4AQYH 4DR4H 4B3MH 3J7AK 4DR5H 2FPHX 1F0XA 1N32H 1SEIA 2UUBH 3OETA 4DV1H 4X65H 1ODHA 4X62H 1X9ZA 4G08A 1XMQH 1IBMH 1HR0H 4DV7H 4LFBH 4LF9H 4B3SH 1HNXH 4JI3H 4DR6H 3J81W 4JI5H 4OD6A 3KDGA 5LMUH 4B3TH 1XNQH 4NXNH 4DV4H 4DUZH 3OTOH 5A2QW 2ZQEA 4LF7H 4OX9H 1FKAH 4GKKH 1N33H 4JI7H 4DUYH 4DV3H 4NXMH 4LF4H 2UUCH 3KDKA 2UXBH 3GR5A 2ZM6H 2Y3MA 4DV6H 4JI4H 4B3RH 3GABA 4JI2H 5LL6b 4LF8H 4B8CD 3QD7X 2VQFH 4DR7H 4YHHH 4JI0H 4YY3H 3FAUA 2PT7G 5IWAH 4LFAH 1J5EH 4E9JA 2VQEH 2HHHH 3OSSD 3T1YH 3T1HH 1HNWH 4DV2H 3SB1A 2E5LH 4EC5A 4JV5H 4NZRM 1XNRH 4KHPH 2F4VH 3J80W 4DR1H 4DR3H 2UU9H 5LMNH 4DV0H 4JI8H 1FJGH 4K0KH 1N36H 3RF2A 1AN7A 2LF0A 5BR8H 4JI6H 4LF6H 5DT9A 5FLXW 2UUAH 1S03G 1HNZH 1IBKH 4X66H 1I6UA 4DR2H 4NZTM 3JAMW 1I94H 4X64H 4GKJH 4PDBA 4LFCH 2VKCA 4OCHA 2UXDH 2O4CA 4DV5H 5IT9W 2UXCH 1IBLH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKC A;  4OCH A;  2ZQE A;  3FAU A;  2D9I A;  3QD7 X;  4OD6 A; 
#chains in the Genus database with same CATH topology
 3EZJ A;  4LF5 H;  2HH3 A;  1N34 H;  3V69 A;  4AM3 A;  4JI1 H;  4JYA H;  2ANR A;  2D9I A;  1XMO H;  3NCV A;  4AQY H;  2OPU A;  4DR4 H;  4B3M H;  3J7A K;  4DR5 H;  2Z0S A;  2FPH X;  1F0X A;  4LIJ A;  4B8T A;  1N32 H;  1SEI A;  2FFM A;  2UUB H;  4OO1 G;  3OET A;  2BA0 A;  4DV1 H;  4X65 H;  3AEV B;  4WAL A;  4JVY A;  1ODH A;  4X62 H;  1X9Z A;  2A1S A;  4G08 A;  2MJH A;  1XMQ H;  1IBM H;  1HR0 H;  4DV7 H;  4LFB H;  4LF9 H;  4B3S H;  1PQX A;  2G8Y A;  1HNX H;  1ZZJ A;  1TUA A;  4JI3 H;  4NBQ A;  3J81 W;  4JI5 H;  4DR6 H;  2CTL A;  4OD6 A;  2JE6 I;  3KDG A;  5LMU H;  1EC6 A;  2ANN A;  4B3T H;  1XNQ H;  4WAN A;  4NXN H;  4DV4 H;  4FJS A;  3OTO H;  4DUZ H;  1X4M A;  5A2Q W;  2ZQE A;  4LF7 H;  4OX9 H;  2CTE A;  1X4N A;  1FKA H;  1DTJ A;  4GKK H;  1K1G A;  1N33 H;  2CTF A;  4JI7 H;  1WE8 A;  1VIG A;  2LRR A;  4IFD G;  1DT4 A;  2CWH A;  4DUY H;  1X0A A;  1V8C A;  4DV3 H;  4NXM H;  4LF4 H;  2UUC H;  4AIM A;  3KDK A;  2CTK A;  1J4W A;  2UXB H;  3GR5 A;  2ZM6 H;  2Y3M A;  4DV6 H;  4BA1 I;  4JI4 H;  2JVZ A;  2AXY A;  4B3R H;  3GAB A;  4JI2 H;  3U1K A;  1MSZ A;  5LL6 b;  2PQU A;  4LF8 H;  2CTJ A;  2JZX A;  4B8C D;  3QD7 X;  2VQF H;  4DR7 H;  3L7Z C;  4YHH H;  1ZTG A;  2BL5 A;  4JI0 H;  4YY3 H;  2OPV A;  2PT7 G;  3FAU A;  5IWA H;  1J5E H;  2JA9 A;  4LFA H;  2P2R A;  4E9J A;  2FMR A;  2VQE H;  2CPM A;  4BA2 I;  2X06 A;  3OSS D;  2HHH H;  3GKU A;  3T1Y H;  2LTM A;  3T1H H;  1HNW H;  4H8A A;  4DV2 H;  5C0X G;  2JEB I;  2K1H A;  2JEA I;  1KHM A;  3SB1 A;  1S20 A;  4JVH A;  4QMF B;  2E5L H;  2M8W A;  1J5K A;  4EC5 A;  2E3U A;  4JV5 H;  4NZR M;  1XNR H;  4KHP H;  1ZZK A;  2F4V H;  3J80 W;  4DR1 H;  1XRH A;  4DR3 H;  5LMN H;  2UU9 H;  4DV0 H;  4JI8 H;  2HH2 A;  1FJG H;  1N36 H;  4K0K H;  3RF2 A;  1AN7 A;  2NN6 G;  2LF0 A;  5BR8 H;  1V9N A;  3I0P A;  4JI6 H;  4LF6 H;  5DT9 A;  5FLX W;  1NXU A;  2UUA H;  1HNZ H;  1S03 G;  1IBK H;  4X66 H;  5JEA G;  1I6U A;  1VIH A;  4FJU A;  3UOE A;  1WHR A;  2CPQ A;  1Z2I A;  4DR2 H;  4NZT M;  1ZZI A;  2M6Q A;  3VKE A;  3JAM W;  2CTM A;  5K36 G;  2LTL A;  4X64 H;  1I94 H;  4GKJ H;  2YQR A;  4PDB A;  1VBI A;  4LFC H;  2PY9 A;  2CWF A;  2DGR A;  2VKC A;  4OCH A;  2UXD H;  1WVN A;  2O4C A;  2QND A;  4DV5 H;  1UG8 A;  5IT9 W;  1WTJ A;  2UXC H;  1IBL H; 
#chains in the Genus database with same CATH homology
 3EZJ A;  4LF5 H;  1N34 H;  4JI1 H;  4JYA H;  2D9I A;  1XMO H;  3NCV A;  4AQY H;  4DR4 H;  4B3M H;  3J7A K;  4DR5 H;  2FPH X;  1F0X A;  1N32 H;  1SEI A;  2UUB H;  3OET A;  4DV1 H;  4X65 H;  1ODH A;  4X62 H;  1X9Z A;  4G08 A;  1XMQ H;  1IBM H;  1HR0 H;  4DV7 H;  4LFB H;  4LF9 H;  4B3S H;  1HNX H;  4JI3 H;  4DR6 H;  3J81 W;  4JI5 H;  4OD6 A;  3KDG A;  5LMU H;  4B3T H;  1XNQ H;  4NXN H;  4DV4 H;  4DUZ H;  3OTO H;  5A2Q W;  2ZQE A;  4LF7 H;  4OX9 H;  1FKA H;  4GKK H;  1N33 H;  4JI7 H;  4DUY H;  4DV3 H;  4NXM H;  4LF4 H;  2UUC H;  3KDK A;  2UXB H;  3GR5 A;  2ZM6 H;  2Y3M A;  4DV6 H;  4JI4 H;  4B3R H;  3GAB A;  4JI2 H;  5LL6 b;  4LF8 H;  4B8C D;  3QD7 X;  2VQF H;  4DR7 H;  4YHH H;  4JI0 H;  4YY3 H;  3FAU A;  2PT7 G;  5IWA H;  4LFA H;  1J5E H;  4E9J A;  2VQE H;  2HHH H;  3OSS D;  3T1Y H;  3T1H H;  1HNW H;  4DV2 H;  3SB1 A;  2E5L H;  4EC5 A;  4JV5 H;  4NZR M;  1XNR H;  4KHP H;  2F4V H;  3J80 W;  4DR1 H;  4DR3 H;  2UU9 H;  5LMN H;  4DV0 H;  4JI8 H;  1FJG H;  4K0K H;  1N36 H;  3RF2 A;  1AN7 A;  2LF0 A;  5BR8 H;  4JI6 H;  4LF6 H;  5DT9 A;  5FLX W;  2UUA H;  1S03 G;  1HNZ H;  1IBK H;  4X66 H;  1I6U A;  4DR2 H;  4NZT M;  3JAM W;  1I94 H;  4X64 H;  4GKJ H;  4PDB A;  4LFC H;  2VKC A;  4OCH A;  2UXD H;  2O4C A;  4DV5 H;  5IT9 W;  2UXC H;  1IBL H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...