4OD6A

Structure of smr domain of muts2 from deinococcus radiodurans, mn2+ soaked
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
82
structure length
82
Chain Sequence
RFDNELQLRGLSVEAAVEELRAAIAEARALKETPLRVVHGKGMGVLRRTLRDYLKTDKNVESFHDAEANQGGHGVTIVNVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endonuclease MutS2
publication title Structural and functional studies of MutS2 from Deinococcus radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 29
structure length 82
sequence length 82
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4od6A00
2D9IA 3QD7X 4OD6A 2ZQEA 3FAUA 2VKCA 4OCHA
chains in the Genus database with same CATH superfamily
3U1KA 5JEAG 4DUZH 1KHMA 1XMOH 2X06A 2NN6G 2DGRA 4DR7H 1PQXA 5A2QW 2A1SA 2D9IA 2CTJA 2CTKA 5LMUH 1DTJA 4JI8H 4LF8H 1XNRH 4FJSA 4JI1H 5BR8H 2HHHH 4OO1G 2BL5A 2HH2A 2CWHA 2ANNA 1IBKH 1I94H 4LFAH 1X0AA 1IBMH 4NXNH 4OX9H 4WANA 3JAMW 4DV1H 1UG8A 1J5KA 1FJGH 4BA2I 2JEAI 1N32H 1HNXH 4NZTM 4JYAH 1AN7A 2VQEH 5FLXW 3T1YH 4JI2H 1XMQH 1Z2IA 1ZTGA 4IFDG 4LIJA 4DV6H 1X4MA 2OPUA 2UXBH 3RF2A 4DV5H 1EC6A 2VKCA 2JVZA 2YQRA 3OETA 1K1GA 4DR5H 4AQYH 4G08A 1XRHA 2JA9A 3GABA 1ZZJA 4AM3A 1VIGA 2PT7G 4JI5H 2CWFA 2OPVA 1DT4A 4LF7H 2K1HA 2AXYA 3KDGA 4KHPH 5K36G 2LRRA 1HNZH 1ODHA 1FKAH 1SEIA 4DV3H 5IWAH 4NXMH 3KDKA 1NXUA 2FFMA 4DV7H 3J81W 4B3SH 1X9ZA 4DR6H 2CPQA 3L7ZC 4EC5A 4DR3H 1N36H 2BA0A 2ZQEA 2UUBH 4JI3H 2JEBI 2CTEA 4LF4H 2HH3A 1N34H 2UU9H 3OTOH 1S20A 2LTLA 4DUYH 2FMRA 4JI7H 1F0XA 4LF6H 2MJHA 4LFBH 4K0KH 4X66H 2JZXA 3VKEA 4JI0H 4H8AA 4JVYA 2P2RA 1VBIA 2M8WA 3QD7X 2E3UA 4B8TA 2ANRA 4DR2H 2Z0SA 4AIMA 4DV2H 3UOEA 2O4CA 3J80W 4PDBA 1N33H 3J7AK 4X64H 2CPMA 2QNDA 2LF0A 1ZZKA 5C0XG 4DR1H 2LTMA 3T1HH 3AEVB 4DR4H 4DV4H 4OD6A 1X4NA 4WALA 1S03G 2UXCH 1J5EH 1MSZA 1HNWH 5IT9W 3NCVA 1TUAA 5LMNH 2M6QA 2CTLA 2UUAH 2CTMA 4YY3H 4JV5H 1V9NA 4JVHA 3GKUA 4BA1I 2Y3MA 2G8YA 3I0PA 4GKJH 4GKKH 3FAUA 2FPHX 3GR5A 1HR0H 1I6UA 4NBQA 4OCHA 2ZM6H 4E9JA 4FJUA 2VQFH 4B3TH 4YHHH 1ZZIA 4DV0H 2JE6I 4LF9H 4B3RH 1WHRA 1WVNA 1XNQH 1VIHA 4LFCH 4QMFB 2UUCH 5DT9A 4X62H 4JI6H 2PQUA 4LF5H 4B3MH 4JI4H 2F4VH 1WE8A 4B8CD 2PY9A 2E5LH 1V8CA 1WTJA 3V69A 1J4WA 5LL6b 4NZRM 3SB1A 2UXDH 3OSSD 4X65H 2CTFA 1IBLH 3EZJA
chains in the Genus database with same CATH topology
4DUZH 1XMOH 4DR7H 5A2QW 2D9IA 5LMUH 4JI8H 1XNRH 4JI1H 5BR8H 2HHHH 1IBKH 1I94H 4LFAH 1IBMH 4NXNH 4OX9H 3JAMW 4DV1H 1FJGH 1N32H 1HNXH 4NZTM 4JYAH 1AN7A 3T1YH 5FLXW 2VQEH 4JI2H 1XMQH 4DV6H 2UXBH 3RF2A 4DV5H 2VKCA 3OETA 4AQYH 4DR5H 4G08A 3GABA 2PT7G 4JI5H 4LF7H 3KDGA 4KHPH 1HNZH 1ODHA 1FKAH 1SEIA 4DV3H 5IWAH 4NXMH 3KDKA 4DV7H 3J81W 4B3SH 1X9ZA 4DR6H 4DR3H 4EC5A 1N36H 2UUBH 4JI3H 4LF4H 2ZQEA 4LF8H 1N34H 2UU9H 3OTOH 4DUYH 4JI7H 1F0XA 4LF6H 4LFBH 4K0KH 4X66H 4JI0H 3QD7X 4DR2H 4DV2H 2O4CA 3J80W 4PDBA 1N33H 3J7AK 4X64H 2LF0A 4DR1H 3T1HH 4DR4H 4DV4H 4OD6A 1S03G 2UXCH 1J5EH 1HNWH 5IT9W 3NCVA 2UUAH 5LMNH 4JV5H 4YY3H 2Y3MA 4GKJH 4GKKH 3FAUA 2FPHX 3GR5A 1HR0H 1I6UA 4OCHA 2ZM6H 4E9JA 2VQFH 4B3TH 4YHHH 4DV0H 4LF9H 4B3RH 1XNQH 4LFCH 2UUCH 5DT9A 4X62H 4JI6H 4LF5H 4B3MH 4JI4H 2F4VH 4B8CD 2E5LH 5LL6b 4NZRM 3SB1A 2UXDH 3OSSD 4X65H 1IBLH 3EZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9I A;  3QD7 X;  4OD6 A;  2ZQE A;  3FAU A;  2VKC A;  4OCH A; 
#chains in the Genus database with same CATH topology
 3U1K A;  5JEA G;  4DUZ H;  1KHM A;  1XMO H;  2X06 A;  2NN6 G;  2DGR A;  4DR7 H;  1PQX A;  5A2Q W;  2A1S A;  2D9I A;  2CTJ A;  2CTK A;  5LMU H;  1DTJ A;  4JI8 H;  4LF8 H;  1XNR H;  4FJS A;  4JI1 H;  5BR8 H;  2HHH H;  4OO1 G;  2BL5 A;  2HH2 A;  2CWH A;  2ANN A;  1IBK H;  1I94 H;  4LFA H;  1X0A A;  1IBM H;  4NXN H;  4OX9 H;  4WAN A;  3JAM W;  4DV1 H;  1UG8 A;  1J5K A;  1FJG H;  4BA2 I;  2JEA I;  1N32 H;  1HNX H;  4NZT M;  4JYA H;  1AN7 A;  2VQE H;  5FLX W;  3T1Y H;  4JI2 H;  1XMQ H;  1Z2I A;  1ZTG A;  4IFD G;  4LIJ A;  4DV6 H;  1X4M A;  2OPU A;  2UXB H;  3RF2 A;  4DV5 H;  1EC6 A;  2VKC A;  2JVZ A;  2YQR A;  3OET A;  1K1G A;  4DR5 H;  4AQY H;  4G08 A;  1XRH A;  2JA9 A;  3GAB A;  1ZZJ A;  4AM3 A;  1VIG A;  2PT7 G;  4JI5 H;  2CWF A;  2OPV A;  1DT4 A;  4LF7 H;  2K1H A;  2AXY A;  3KDG A;  4KHP H;  5K36 G;  2LRR A;  1HNZ H;  1ODH A;  1FKA H;  1SEI A;  4DV3 H;  5IWA H;  4NXM H;  3KDK A;  1NXU A;  2FFM A;  4DV7 H;  3J81 W;  4B3S H;  1X9Z A;  4DR6 H;  2CPQ A;  3L7Z C;  4EC5 A;  4DR3 H;  1N36 H;  2BA0 A;  2ZQE A;  2UUB H;  4JI3 H;  2JEB I;  2CTE A;  4LF4 H;  2HH3 A;  1N34 H;  2UU9 H;  3OTO H;  1S20 A;  2LTL A;  4DUY H;  2FMR A;  4JI7 H;  1F0X A;  4LF6 H;  2MJH A;  4LFB H;  4K0K H;  4X66 H;  2JZX A;  3VKE A;  4JI0 H;  4H8A A;  4JVY A;  2P2R A;  1VBI A;  2M8W A;  3QD7 X;  2E3U A;  4B8T A;  2ANR A;  4DR2 H;  2Z0S A;  4AIM A;  4DV2 H;  3UOE A;  2O4C A;  3J80 W;  4PDB A;  1N33 H;  3J7A K;  4X64 H;  2CPM A;  2QND A;  2LF0 A;  1ZZK A;  5C0X G;  4DR1 H;  2LTM A;  3T1H H;  3AEV B;  4DR4 H;  4DV4 H;  4OD6 A;  1X4N A;  4WAL A;  1S03 G;  2UXC H;  1J5E H;  1MSZ A;  1HNW H;  5IT9 W;  3NCV A;  1TUA A;  5LMN H;  2M6Q A;  2CTL A;  2UUA H;  2CTM A;  4YY3 H;  4JV5 H;  1V9N A;  4JVH A;  3GKU A;  4BA1 I;  2Y3M A;  2G8Y A;  3I0P A;  4GKJ H;  4GKK H;  3FAU A;  2FPH X;  3GR5 A;  1HR0 H;  1I6U A;  4NBQ A;  4OCH A;  2ZM6 H;  4E9J A;  4FJU A;  2VQF H;  4B3T H;  4YHH H;  1ZZI A;  4DV0 H;  2JE6 I;  4LF9 H;  4B3R H;  1WHR A;  1WVN A;  1XNQ H;  1VIH A;  4LFC H;  4QMF B;  2UUC H;  5DT9 A;  4X62 H;  4JI6 H;  2PQU A;  4LF5 H;  4B3M H;  4JI4 H;  2F4V H;  1WE8 A;  4B8C D;  2PY9 A;  2E5L H;  1V8C A;  1WTJ A;  3V69 A;  1J4W A;  5LL6 b;  4NZR M;  3SB1 A;  2UXD H;  3OSS D;  4X65 H;  2CTF A;  1IBL H;  3EZJ A; 
#chains in the Genus database with same CATH homology
 4DUZ H;  1XMO H;  4DR7 H;  5A2Q W;  2D9I A;  5LMU H;  4JI8 H;  1XNR H;  4JI1 H;  5BR8 H;  2HHH H;  1IBK H;  1I94 H;  4LFA H;  1IBM H;  4NXN H;  4OX9 H;  3JAM W;  4DV1 H;  1FJG H;  1N32 H;  1HNX H;  4NZT M;  4JYA H;  1AN7 A;  3T1Y H;  5FLX W;  2VQE H;  4JI2 H;  1XMQ H;  4DV6 H;  2UXB H;  3RF2 A;  4DV5 H;  2VKC A;  3OET A;  4AQY H;  4DR5 H;  4G08 A;  3GAB A;  2PT7 G;  4JI5 H;  4LF7 H;  3KDG A;  4KHP H;  1HNZ H;  1ODH A;  1FKA H;  1SEI A;  4DV3 H;  5IWA H;  4NXM H;  3KDK A;  4DV7 H;  3J81 W;  4B3S H;  1X9Z A;  4DR6 H;  4DR3 H;  4EC5 A;  1N36 H;  2UUB H;  4JI3 H;  4LF4 H;  2ZQE A;  4LF8 H;  1N34 H;  2UU9 H;  3OTO H;  4DUY H;  4JI7 H;  1F0X A;  4LF6 H;  4LFB H;  4K0K H;  4X66 H;  4JI0 H;  3QD7 X;  4DR2 H;  4DV2 H;  2O4C A;  3J80 W;  4PDB A;  1N33 H;  3J7A K;  4X64 H;  2LF0 A;  4DR1 H;  3T1H H;  4DR4 H;  4DV4 H;  4OD6 A;  1S03 G;  2UXC H;  1J5E H;  1HNW H;  5IT9 W;  3NCV A;  2UUA H;  5LMN H;  4JV5 H;  4YY3 H;  2Y3M A;  4GKJ H;  4GKK H;  3FAU A;  2FPH X;  3GR5 A;  1HR0 H;  1I6U A;  4OCH A;  2ZM6 H;  4E9J A;  2VQF H;  4B3T H;  4YHH H;  4DV0 H;  4LF9 H;  4B3R H;  1XNQ H;  4LFC H;  2UUC H;  5DT9 A;  4X62 H;  4JI6 H;  4LF5 H;  4B3M H;  4JI4 H;  2F4V H;  4B8C D;  2E5L H;  5LL6 b;  4NZR M;  3SB1 A;  2UXD H;  3OSS D;  4X65 H;  1IBL H;  3EZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...