5K36G

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
236
structure length
232
Chain Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAGVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 45
structure length 232
sequence length 236
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5k36G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5k36G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5k36G03
4DR3Q 1VDZA 1PHJA 2E2HH 4DR6L 4AYBE 3KLRA 3T56B 4IJHA 2KA7A 3AB9A 2ZTCA 3G4SA 1TWGH 2B8GA 1AH9A 3LNNA 4DR5Q 4LFAQ 5JJKA 3I4NH 2NZOA 4DV1L 2V4DA 1SROA 2MO0A 4A3EG 4LF5L 3KLWA 1IBLQ 5C3EH 4GOPB 4DUZL 2A19A 2DUDA 3F2BA 1Y8OB 2AKWB 1Q7YC 4A3CG 2K5VA 4DR3L 2UUBQ 3U4VA 1YZ6A 4GNXA 2A6HD 2RHQB 3KF6B 1VQPA 3RLFA 3U4ZA 3VR3A 2NVTH 3HOVG 4RMFA 2BL5A 4DR5L 4LFAL 2RF4A 3J81c 4JI5L 1CKMA 1B8AA 2UXCQ 3W3AA 2JA5G 1HZAA 2I5LX 3PUZA 1S40A 5IP9H 3CC7A 3KYHC 4JI0Q 4HR7B 1X4MA 3A5UA 2Q2HA 3SGIA 3PUYA 3CRLC 2Z6KC 3A0JA 5C4XG 1XNQL 4OO1G 2R92G 3MXUA 4OO1I 4DV4L 2UUBL 1X3FA 2H5XA 3NBHB 3D0FA 2A69C 3ND9A 1X3EA 1KQSA 3I4OA 2WB1G 4AQYQ 4HJ5A 2ALYB 4LJZC 5FJ8G 2EVBA 2K7VA 2EXDA 5KNCA 2UXCL 2R93H 1SMYC 3J80i 3PF5A 1B9MA 1K9MC 1P8LA 1Z6HA 3HKZE 4JI0L 1ZYRC 1J6QA 1VQ9A 2DN8A 3BG3A 3K7AH 3G6EA 2GN5A 5BN3A 1FYCA 4OWXB 2UU9L 4DUYQ 1WI5A 1IW7C 2NN6G 2NN6I 4A3BG 2PQAB 2ATWA 4P73A 4IPGA 5K36G 1V8QA 3CC4A 1A0IA 5IP7H 1I6VC 3J80c 2UXDQ 4YWKA 3GTPH 4ALPA 4C2MH 4A3JG 3KF8B 3KJOA 5JEAJ 5GAGC 3EIVA 3NELA 4NXMQ 3RLNA 4A3KH 4JBMA 4EQ5A 1O7IA 4WJ3M 3TEHB 4PZ7A 2Q2TA 4BBRG 1E3PA 1OXUA 1IBKQ 4JV5L 1FGUA 2BE5D 2BDOA 1QUQA 1MKHA 1KXLA 2CWPA 2D0PA 1HNXQ 4DV2Q 2K50A 4BY7H 1DCZA 2B63H 2UXDL 2CWAA 1ASZA 3PUWA 3I72A 3CD6A 5FLMH 3KOJA 5M3FG 2PPBC 4YHHL 5BR8Q 4LUOA 2IY5B 1V1QA 2UUAQ 4XTCS 4NXML 4A3MH 1KRSA 1C9OA 3UE1A 3VR5A 4B3TQ 4KN7C 3QG1A 1HZBA 2LMCB 3J81j 2ZT9C 1H95A 3PGZA 1KD1C 1XPOA 4P72A 4A3LH 1IBKL 1ONLA 3N6RA 1DTJA 1YEZA 2YU9H 3GTMH 1D7QA 5EAYA 4IFDH 2PCFB 1CI3M 3NEMA 2I5HA 4A3DG 3GD7A 2JXMB 2B8FA 3GTJH 4OWTB 1HNXL 4DV2L 1I94Q 4JYAL 3M4PA 4DNRB 2AXYA 4GN4B 2HIVA 2BA1A 4BBSG 1Q86C 4P71A 3QJYA 2ANNA 1LABA 2NZHA 2UUAL 5IYCH 4DR4Q 4HJ8A 1WJJA 2JA8H 1UE6A 4DK6C 1NJIC 1HR0L 3GTGH 1L0WA 1QZGA 2VUMH 1EIYB 1VQMA 1Q8KA 3F1ZA 1M90C 4POGA 3HKZG 4IOAA 4FDBA 1E24A 1VF7A 3A74A 2OTJA 3PUXA 1YJ9A 3HGBA 4R4CA 5J3BA 1L1OA 4KLKA 4C3IH 1NE3A 3FKIG 5BN4A 4YWMA 1CKNB 1PFSA 1E2WA 2QA4A 4DR2Q 4IQZA 1CFMA 1VCIA 3M4YA 3I4NG 3K81C 1OXVA 3A8IE 1QVFA 3BDOA 1HNWL 4DR4L 4P74A 1C7YA 1DD2A 4LF8Q 1H9KA 1CSQA 5M5XH 3WDNA 1VQFA 5C3EG 1K73C 2GVBA 4OX9L 1GUTA 1HPCA 1Y8NB 1PH6A 2N49A 4DR1Q 2JA6H 2OPUA 1MIUA 3STBD 2K32A 1VQAA 5IWAQ 4DV7Q 1N9WA 3DM3A 1Z7TA 2A68D 1K1GA 5E7NA 3H94A 1Y14B 2IX1A 4Y52H 2AWOA 1I5FA 2DNEA 3CCSA 4LUVA 1UE1A 2ANRA 4C3HH 2UUCQ 4DR2L 3CCJA 3RN2A 1O78A 2R7FA 1TWAH 1JB7A 4JVHA 5GAHC 4LF8L 2NVYH 1VQOA 5IP9G 4BY1H 4MNOA 1RIPA 2JEAI 2HHHQ 5GQOA 4KI0A 2K52A 1U5KA 1SN8A 4DR1L 2HQLA 4HIKA 2E8GA 1YI2A 1VQCA 2O5JC 5IWAL 2OWOA 1XNRQ 4JI8L 4DV7L 1PH3A 1FJGQ 3ERSX 2MQHA 3RZOH 4BXXH 1A6XA 1PA6A 2AWNA 1SRUA 3OTOQ 4R4OA 2UUCL 3EBEA 1Y1WH 4QQBX 2UXBQ 2R93G 1WE8A 3MFYA 4JI3Q 2JA7H 4L5RC 1GHKA 2I0QA 1FR3A 3TREA 4GKKQ 3K7UC 2YTVA 3Q8DA 1LTLA 3UDFA 4HIOA 1Z47A 1XNRL 1FJGL 3D31A 4QMFB 3K8AA 2N8NA 1JE5A 3PCOB 2PI2E 3GDEA 3W1BA 2E76C 3RZDH 3CQZH 2L15A 1I6HH 1UE7A 3OTOL 4NXNQ 5IP7G 2UXBL 1YNJC 2N3SA 1M1KC 1GUGA 2KBNA 4DK0A 5C0XH 5IYDH 1YIJA 1IW7D 2BH2A 4DAMA 4YWLA 3A7LA 4JI3L 2R7DA 4DK1A 1X56A 4A3KG 3I7FA 4GKKL 4B8TA 1S3OA 4UP7A 3UDGA 1Q90A 4IPDA 1Q81C 2OQ0A 4AIMA 3RR5A 1XMOQ 1D8LA 3HOUH 1YITA 3FMCA 1Q46A 4IO9A 5BN5A 4H0LC 1V43A 1EWHA 4BY7G 1VQIA 3ULJA 2B63G 3QIAA 3TRZA 3F2CA 4A75A 2F52A 3RN5A 1WCMH 2D5DA 3PV0A 1EWIA 4A3MG 4LNQA 1CKOA 1IBLL 3PIPA 4X66Q 4EX5A 2V1CC 2E74C 1XPRA 2A6EC 4HJ7A 4A3LG 1K8GA 1DT4A 1SFOH 1H9RA 1HH2P 4IFDG 4IFDI 3PSIA 2MFIA 1XMOL 4YCWA 4A76A 3S1MH 4K0KQ 3UDXA 1PH2A 5A35A 4LF7Q 2IX0A 5GAEC 2D0OA 2N78A 2CTLA 4R4IA 1QVCA 5IYCG 1PMRA 4B3MQ 3AEVB 3PO3H 2VUMG 4HIMA 1VIHA 3VA7A 3T1YQ 3S2DH 3HOXG 1LACA 4TQUS 1X3GA 2K5HA 4PG3A 1ZZJA 1A62A 4K0KL 1YJWA 3CCRA 1PH8A 4AQYL 2Q8IB 4A3GH 4IFDJ 1B9NA 1GVPA 3E9IA 1TWFH 4PZ8A 1N8RC 5DLQE 2PI2A 4L5TA 1A63A 2XGTA 5HY6A 4YCUA 2JQOA 1T5EA 3K0XA 2B3GA 4DV6Q 1N32Q 3HOWH 3BZCA 4DKAC 4IOCA 2ZJRA 1Y69U 4GOPA 3T1YL 1T9HA 4TKOB 1GUNA 2JK8A 1H9SB 4GLVB 1A8VA 2YTXA 2JA6G 2OCEA 2C35B 2CTMA 4DV3Q 4X64Q 1ZZIA 3U1KA 3T51B 1E1OA 2AHOB 3I2ZA 5IYBH 4DUYL 2A6HC 4JI4Q 3KF6A 3DLLA 4JI6Q 1PH5A 3BU2A 3FHWA 4JOIA 3H0GH 4KKTA 4H44C 4XIGS 2LSSA 4DV6L 4BY1G 4IPHA 2MNAA 1N32L 1MJEA 2F3IA 2YYZA 2BH8A 3GTLH 2NVXH 4DV3L 4X64L 1OTCA 1S72A 3PO2H 3NE5B 2R6GA 2ZTDA 1VQDA 1V9PA 5H1SE 4JI4L 4JI6L 3S14H 2Q2UA 4BXXG 1VQEA 5KNDA 4LW1A 3HOZH 2JVZA 1ZZKA 3W1GA 2AMCB 1NY4A 1VQ7A 3FP9A 4DNIA 5LMNQ 1HZCA 1Y1WG 4L5QA 1YHQA 3M9BA 2R92H 5C44H 1VQ8A 2PNHA 1Y8PB 5BR8L 2LXKA 4LF4Q 4X62Q 5LMUQ 3HOYH 5JEAH 3ICEA 4B3TL 1EQRA 3MEFA 3W5OA 4GNXC 2QF7A 4GS3A 3G48A 3GTOH 5FJ8H 3CC2A 2CTJA 4A3FH 4JI2Q 3F2DA 1AE2A 3IRBA 4IJLA 3I4MH 4UP9A 3J7ZC 3LGJA 2PQAA 4LFBQ 3V69A 4QL5A 1R9TH 1I94L 1G291 5LMNL 3ND8A 3M7NA 3KJPA 1HCZA 1XJVA 1OXXK 1UE5A 3E0EA 5IYDG 5C0XG 5C0XI 2K14A 1EQQA 4LF4L 4X62L 5LMUL 2Z6KA 2BA0A 3GO5A 3CCUA 4O0AA 2IT1A 2O5IC 3VR4A 4A3IH 1VQ5A 1FVIA 1GUSA 4R4TA 3T1HQ 1O7LA 3S1RH 2JJQA 4A3JH 3PUVA 1EIFA 2BE5C 1NMFA 4B3RQ 2MJHA 1KL9A 1TUAA 3ULLA 1HR0W 1PH7A 4GN5A 3HOUG 2F4VQ 4LFBL 1J5EQ 1Q1BA 1YJNA 3J7A5 4JG2A 4G7ZC 3I73A 3GTKH 1IYJB 1SR3A 1LUZA 1ZTGA 1LM0A 5JJLA 3IFTA 3S1NH 1WCMG 2B29A 4GNXB 5IE8A 2YV5A 1JJCB 1L2FA 3GTQH 1VF5C 4O2DA 2R7ZH 5HGQA 1N34Q 3EQLC 3T1HL 2JE6I 2QNDA 2JZXA 1Q12A 5C4JH 1WYDA 3H15A 1H9JA 2PY9A 4AH6A 2F4VL 1J5EL 2GVAA 4TVAB 4B3SQ 1YHAA 1BKBA 2VS1A 4JBKA 3H3VI 2HT1A 1YHBA 4KKSA 4A3DH 4DR6Q 2OQKA 2E3UA 3OW7A 2A69D 3PO3G 1YVCA 2VQFQ 1IL2A 1BBUA 1IBMQ 2WFWA 4YY3Q 1Y1VH 2HHHL 1N34L 1E2VA 3A8JE 2ID0A 2K4KA 2VY3A 1NMGA 3A7AB 4C3JH 3AYHB 2PQUA 1GUOA 4UP8A 3BZKA 3CMEA 4LF5Q 3WWVA 5GADC 3ULPA 4LF9Q 2DNCA 4B3SL 3VKEA 3TS0A 2CW0C 1CKNA 2CPQA 4DUZQ 4A3GG 3AFQA 4BA1I 4YCVA 3B6YA 1MJCA 1H9MA 5FLXc 1HZ9A 1EC6A 1PVOA 3FKIH 3JC66 2KCMA 2K33A 2VQFL 1PV4A 2EJFC 1GO3E 2CFMA 4APVA 1IBML 1W2BA 4YY3L 3HOWG 4KHZA 1KC8C 1X4NA 1VS0A 3VR2A 2EQSA 2FMRA 4JI5Q 2YQRA 3STBC 2ZJQA 3J81i 1AE3A 2Y0SE 3S2HH 3D4RA 5GROA 5IYBG 3CF5A 1N33Q 3E9HA 3M4OH 2A68C 4LF9L 3HFZB 1X54A 2MO1A 2QGQA 4NXNL 1TWHH 3JAMi 4LF6Q 2HH2A 1IXRA 1XNQQ 2OPVA 3P20A 1WOCA 2I5MX 4DV4Q 3I4LA 1QUQB 1GHJA 3H0GG 1GD7A 5FLMG 2VQEQ 3NENA 2WAQG 1YBYA 1LYLA 3CPFA 1GJXA 1L1OC 1G6PA 4DAYB 5M3MH 1FL0A 1X6OA 1VQJA 1IYUA 1P16A 4H02A 4NBQA 3A5ZB 3GQBA 4OXPA 4LFCQ 1N33L 3PO2G 2HH3A 1VQBA 1NTGA 2ASBA 3JAMc 4RCNA 1DGSA 3HOZG 2DGYA 3SE0A 4JVYA 1VQHA 3TS2A 4LF6L 1K8OA 2PMZE 3S24A 3TZUA 3H3VH 4X6AH 3OYYA 5C44G 2UU9Q 4G7OC 2D2CC 1X65A 2VQEL 3CCQA 2A1AA 2JA8G 4DPGA 3UE0A 3HOYG 5JEAG 1GM5A 4X66L 4R1JA 2P2RA 4JI1Q 4UY8C 1E22A 4PZ6A 4POFA 4JK1C 1NBWA 1BVSA 4A3FG 4H13C 3MXNB 4UPAA 4LFCL 3I4MG 4QY7A 3AFPA 4GLAC 1EFWA 4AM3A 3L2PA 1TWCH 1PH1A 2ZTEA 1K8MA 1JMCA 4GZYC 3VR6A 3KDFB 4LF7L 5ELNA 4L5SA 4A93H 4JV5Q 3F8TA 4JBJA 4MTNA 2KCTA 4LK1C 1E2ZA 1I50H 1U0LA 4ME3A 1KHIA 1EYGA 1L1OB 4B3ML 4P75A 4A4IA 4AYBG 1PYSB 4KMUC 1PYBA 4JI1L 4A3IG 2CTFA 1VQNA 1IZ6A 1Z9FA 1X55A 1JJ2A 1PH9A 4DR7Q 1E7ZA 4YHHQ 1HTPA 2KENA 5KNBA 4A3EH 4KN4C 4G7HC 1OXTA 5IY0A 1ASYA 4GLXA 2Y0SG 1K0RA 2VNUD 1KRTA 2WP8J 1CTMA 1QZHA 5M5YH 4WALA 1IYVA 3CCVA 1WVNA 1Q82C 2EJGC 4A3CH 3BJUA 2IHEA 3S16H 1VIGA 1E1TA 3CCEA 1BBWA 2CQOA 3HOVH 3FPPA 1X9NA 4HJAA 4DK3C 4NB3A 4JYAQ 3CCLA 2R7ZG 2QEXA 3I56A 2ES2A 5JJIA 1SE8A 2KCCA 3CAMA 1VQ6A 4DR7L 1Q1EA 1TXYA 2JA5H 4I7ZC 2L5TA 2DGRA 1XMQQ 1KHMA 1HR0Q 2A8VA 2HIXA 1C0AA 1XTDA 5C4XH 4OWWB 1PH4A 1TKWB 4OO1H 3L7ZC 1VQKA 4NPSA 3S17H 1K3RA 1UWVA 3AEVA 2JA7G 1HNZQ 1I3QH 4DV0Q 2CTEA 3S15H 1DXMA 1Y1VG 4QJFA 3KFUA 3EN2A 3DXJC 1QJOA 1CSPA 4KHPQ 1HNWQ 3K80C 4PV1C 4RG1A 1XMQL 1OXSC 1GKHA 1EOVA 1VQ4A 2NVQH 2E5LQ 4R4QA 1K83H 3A8KE 4OX9Q 3KDFA 5AJ3Q 3TQYA 4Y7NH 3OW2A 3HOXH 3OPOA 4KKUA 4WANA 1UEBA 4JI7Q 2JEBI 2NN6H 4A3BH 2RHSB 3M85A 1HNZL 2CTKA 1VQGA 4DV0L 5K36H 4IPCA 3CP0A 4X65Q 1J5KA 2EDGA 1ZKOA 5ELOA 3U58A 5IT9c 3ER0A 1B70B 2KHIA 4JBWA 4QGUA 1HJPA 1SMXA 1H9SA 1HQMC 2E2JH 4KHPL 4JI2L 2VL6A 2CCZA 4GKJQ 3CRKC 3I55A 1N36Q 1KAWA 3U9SA 3SDZA 3VDYA 1K8AC 2E5LL 3HKSA 2RCNA 4HJ9A 1J4WA 5AJ3L 3S1QH 4BBRH 4GN3B 3LWUA 2EJMA 1B7YB 4WJ4A 2WAQE 4J15A 4LWCA 4JI8Q 4JI7L 2E75C 3CPWA 2PNRC 4L8JA 3M3YH 1TU2B 1RL2A 4OGQC 4X65L 3OOCA 2EIFA 5LMNW 5M3MG 2Z0SA 2AUKA 5C0XJ 4JCVE 4GKJL 5M3FH 4B3RL 4HIDA 1XPUA 1N36L 3L0OA 4DV5Q 2D62A 2K5NA 3PIOA 1KIXA 3CXCA 2F1MA 4LUZA 2VW9A 3IKJA 2A6ED 2JA9A 3T53B 1WFQA 2Q2IA 1EUJA 1YNNC 2CKZB 2XTIA 3CW2C 2ZM6Q 3AQQA 3M4QA 1VQLA 5M5WH 4GOPC 1JT8A 3RNUA 2WB1E 3G71A 2ZJPA 4QIWE 1SLJA 2VZAA 1YNXA 1QVGA 1G51A 1BDOA 4BBSH 4JC0A 3CCMA 3ZJYC 4OONA 4DV1Q 2LXJA 2FXQA 4PMWA 4DV5L 2K75A 3U50C 2OTLA 3RLOA 4JOIC 4BA2I 2KHJA 2IHFA 4DNTB 3CMAA 2AUJD 1W3SA 2ZM6L 4A93G 3UDIA 4LIJA 1CUKA 3PF4A 4MZ9A 2E2IH 1JJGA 2YTYA
chains in the Genus database with same CATH superfamily
4B3RH 4DR3Q 1VDZA 1PHJA 2E2HH 2RDFA 4DR6L 4AYBE 5HURA 3KLRA 3T56B 3BS1A 4IJHA 3QWNA 2KA7A 2ZTCA 3AB9A 4FXGC 3G4SA 5CORA 1TWGH 2B8GA 1JOQA 1STYA 4K2KA 4A3BB 1AH9A 3LNNA 4DR5Q 4LFAQ 1ICFB 3L9AX 5JJKA 3I4NH 2NZOA 4DV1L 2V4DA 5CV4A 1SROA 5CMDA 2LFNA 4IZ8A 5DEHA 3SK6A 2MO0A 4A3EG 2E2JB 3EA6A 4LF5L 3KLWA 4CJ0B 1IBLQ 1TIID 2B2TC 3CU7A 5C3EH 4HMIA 5CV7A 2LRRA 2RKSA 2J7ZA 1I4PA 3OSOA 4GOPB 1I4RA 4HAEA 4DUZL 1N34H 3VA5A 3FDTA 2A19A 2DUDA 3J7AF 3S1QB 4X3UA 3F2BA 1Y8OB 1SNPA 1ZEQX 4BBRB 1UG8A 2AKWB 3SR1A 1Q7YC 4A3CG 3OIQA 2K5VA 2PQEA 4DR3L 1F2MA 2UUBQ 3I0PA 4DV5H 1HFGA 3U4VA 1YZ6A 4GNXA 2A6HD 2RHQB 3KF6B 1VQPA 4HCEA 3RLFA 3U4ZA 3VR3A 2NVTH 2MGSA 3HOVG 5KRUA 4J1MA 3GR5A 4RMFA 2XN9C 4XYQA 2NBFA 2BL5A 3M3YB 2QILA 4DR5L 4LFAL 2RF4A 3ITPA 2G9HD 2ZM6H 1IHZA 1GXDC 1X3PA 5CR3A 3J81c 1MSGA 5ELEA 3RMHA 4JI5L 3QD7X 1AZPA 4H7BA 1KDBA 1CKMA 1B8AA 4QCLA 3W3AA 2JA5G 2UXCQ 3TP8A 1HZAA 2J0TD 2I5LX 5EKKA 1ODHA 3PUZA 1S40A 4DR6H 3JAME 5IP9H 3CC7A 5M3FB 2KUMA 3KYHC 4UHVA 4JI0Q 4HR7B 1E0BA 1X4MA 3A5UA 3DWQA 2Q2HA 3SGIA 3DM1A 3PUYA 4K8JA 4Z9CB 1C4QA 1SEBD 3CRLC 2L1BA 3KBGA 2Z6KC 3A0JA 5A2QW 5C4XG 4H8AA 1XNQL 4K5WA 1BCPD 2I07B 4OO1G 2R92G 3MXUA 4OO1I 4DV1H 3KLSA 4DV4L 4U68A 2UUBL 1X3FA 2H5XA 1WTJA 1RHPA 3NBHB 2F0OA 4KY5A 5M5WB 3D0FA 4LF5H 2A69C 3ND9A 3RZOB 1JE4A 4LF9H 2Z4HA 3DWAA 2JP1A 1X3EA 5FO9B 1KQSA 3I4OA 2WB1G 4AQYQ 4HJ5A 2ALYB 4LJZC 4DUZH 1R4QB 4DXFA 5FJ8G 1LTGD 2EVBA 2GA4B 2K7VA 2EXDA 5KNCA 2UXCL 2R93H 1SMYC 3J80i 4BBSB 3PF5A 1B9MA 4DR3H 3MXPA 3EVQA 3NXWA 1K9MC 1P8LA 3QR8A 3PQIA 1X3QA 2DY7A 1Z6HA 3HKZE 5DT9A 1LLRD 4JI0L 3E0JA 4ID6A 2L11A 1ZYRC 1J6QA 1SAPA 2K5WA 1QE6A 1VQ9A 2DN8A 2C9OA 2A1SA 2B2VA 3BG3A 3K7AH 3G6EA 2GN5A 1MGSA 1PRTC 4DR5H 4LFAH 1KTKA 4X3TA 5BN3A 4X3KA 4IUQA 1FYCA 4OWXB 1OO9B 3NQTA 4JI5H 5D3DA 1ET9A 2RSNA 2UU9L 4QB4A 3SHLA 4DUYQ 4ZKBB 4MHEA 1WI5A 1IW7C 2NN6G 2NN6I 1ET6A 4A3BG 2PQAB 2ATWA 4P73A 1B1ZA 4IPGA 5C5MA 5K36G 1V8QA 3M7GA 1SSOA 3CC4A 1A0IA 3TN2A 1WTRA 5IP7H 3RZDB 1I6VC 2RA4A 3J80c 1TWGB 2UXDQ 5IT9W 4YWKA 3GTPH 1XNQH 4ALPA 4C2MH 1EQVA 1PLFA 4A3JG 4DV4H 2F0QA 2UUBH 3KF8B 3KJOA 1J9OA 3TP6A 5JEAJ 5GAGC 1C8CA 3KDGA 3EIVA 3NELA 4NXMQ 3RLNA 2EPBA 4A3KH 4JBMA 3P1HA 4EQ5A 3FVQA 1O7IA 5ELFA 4WJ3M 3TEHB 4PZ7A 5E1FA 2Q2TA 3VYSA 4BBRG 1E3PA 1I4HA 1SJED 1S03G 1RDPD 1HUNA 1STGA 3CHBD 1OXUA 1IBKQ 4JV5L 5C3EB 2MUYA 4L6TB 3AU7A 3C2PA 1Q3LA 1FGUA 2BE5D 2UXCH 1LO5D 2BDOA 1EWCA 1QUQA 2FMCA 1MKHA 2EYJA 1KXLA 1XYIA 3OMGA 4PDBA 2CWPA 4IUNA 2D0PA 2WKDA 1HNXQ 1LT4D 4DV2Q 3FRPB 2K50A 2K6AA 4BY7H 3NHHA 4DAYA 1DCZA 1TS3A 4OELB 2B63H 2UXDL 1STHA 2F0VA 3K5OA 2CWAA 4XT1B 1ASZA 3PUWA 3I72A 4F7XA 3K5NA 5FLMH 3KOJA 3CD6A 2UU9H 5E4WC 5M3FG 2PPBC 1PTOH 4WORA 4YHHL 4RCOA 4LUOA 5BR8Q 2IY5B 1V1QA 2UUAQ 4XTCS 4NXML 4A3MH 3SEBA 1PRTB 2BCOA 1KRSA 1C9OA 1QB5D 3UE1A 3VR5A 2EYFA 4B3TQ 4KN7C 3QG1A 1HZBA 2LMCB 3J81j 2ZT9C 1H95A 1ESFA 3PGZA 4QF4A 1KD1C 2MPMA 2K5DA 1XPOA 2F0PA 4P72A 4A3LH 3K5LA 1ONLA 1IBKL 1BBXC 3N6RA 1DTJA 1YEZA 2YU9H 3GTMH 4KD4A 3NUCA 3BVMA 1SBBB 1D7QA 1TY0A 5EAYA 4IFDH 2PCFB 1CI3M 3NEMA 1RTOA 2I5HA 4A3DG 3GD7A 5IGFA 2CWHA 2JXMB 4KTAA 2B8FA 4B9WA 1AP0A 1MBYA 3GTJH 4OWTB 1HNXL 4DV2L 1I94Q 1S5BD 1SNOA 1U4RA 4JYAL 3M4PA 4DNRB 2AXYA 3FAUA 2OT2A 4GN4B 3J7AV 2G9DA 2BA1A 2HIVA 4BBSG 1FKAH 4DAVA 1Q86C 1JC7A 4JV5H 4P71A 3QJYA 3URYA 2B2YA 2ANNA 4FNFA 3MXNA 1TT2A 1LABA 2NZHA 2UUAL 1EY6A 4UAIA 5IYCH 4DR4Q 4HJ8A 1WJJA 5EPLA 4PNYA 2JA8H 1UE6A 3LWEA 4DK6C 1NJIC 1HR0L 1L0WA 3GTGH 2R93B 1QZGA 2VUMH 1VQMA 1EIYB 4FF1A 1Q8KA 3PO3B 5IGBA 3BDLA 2IJ0A 5I2XA 2PW7A 2LS01 3F1ZA 1M90C 4POGA 3HKZG 4XQJA 4IOAA 4FDBA 1PTOC 2UXDH 1E24A 1VF7A 3A74A 2OTJA 2IPKD 3PUXA 4ZLTF 5L37A 1BO0A 3K7AB 1KNEA 1SYGA 3P75A 1YJ9A 1MSHA 4FF2A 3Q22A 5K5PA 3S2DB 1B50A 3HGBA 4R4CA 4YHHH 5J3BA 4CHTB 1U4MA 1L1OA 2PZTA 4KLKA 4C3IH 5JPMC 1STBA 1NE3A 3FKIG 5BN4A 1I6UA 4YWMA 5IT9E 2F4IA 1F2LA 1CKNB 2F03A 1PFBA 1PFSA 3VYTA 3ZYYX 1E2WA 2QA4A 2RVLA 1IBKH 4DR2Q 4IQZA 1CFMA 1VCIA 3M4YA 3NWSA 4XXEA 2WIIB 3I4NG 3K81C 4A3GB 1OXVA 3A8IE 5DM73 3R93A 1QVFA 3BDOA 1EFID 1HNWL 2LTLA 4DR4L 4P74A 5C5LA 1C7YA 3TBIB 5CV6A 1RJTA 1DD2A 3OSSD 4C2MB 3U9OA 4LF8Q 4FVMA 1H9KA 5KEEA 1CSQA 5M5XH 3WDNA 1VQFA 2A5HA 4K14A 1HNXH 3K57A 5D3IB 1X0AA 4DV2H 5C3EG 1K73C 3KBXA 4UDUC 2GVBA 4OX9L 4JYAH 1GUTA 1G2TA 1HPCA 3HOWB 1Y8NB 1PH6A 1D6EC 2N49A 3C46A 1LTAD 2Z8LA 4DR1Q 2M6QA 2JA6H 2OPUA 1MIUA 3STBD 3Q0AA 2K32A 1VQAA 1MD2D 5IWAQ 1B44D 5EPKA 4WJWA 1KNAA 1IKLA 1AN8A 4DV7Q 1N9WA 3DM3A 2ZXPA 5LL6b 1Z7TA 2A68D 1K1GA 1HR0H 2F0DA 5E7NA 3HZXA 1J8IA 3HG9A 3H94A 1K0SA 1Y14B 2IX1A 4FJSA 4Y52H 2AWOA 2IL8A 1I5FA 2DNEA 3CCSA 5KYLA 1XTCD 4LUVA 1UE1A 1T5XD 2ANRA 4C3HH 2UUCQ 4IURA 4DR2L 3CCJA 4NDXA 3RN2A 1O78A 2R7FA 1TS4A 1TWAH 2EYPA 4BY7B 1JB7A 3J81W 4JVHA 2B63B 4YIJA 1NSNS 5GAHC 1ENFA 1ENAA 2F0FA 4LF8L 2NVYH 1VQOA 2SOBA 5IP9G 4BY1H 3SB1A 1PTOB 2Z1CA 4MNOA 1RIPA 2JEAI 3MFGA 2L12A 2HHHQ 5GQOA 4KI0A 1EY7A 2K52A 1U5KA 1SN8A 4DR1L 2HQLA 4HIKA 1MSZA 2C5CA 2E8GA 1YI2A 1VQCA 2O5JC 3TP7A 5IWAL 2OWOA 1XNRQ 2KECA 1A3UA 4JI8L 4DV7L 1PH3A 1ICWA 1FJGQ 1HNWH 2EYMA 4DR4H 3ERSX 2YU9B 3GTMB 3IAYA 5KGUA 2MQHA 3RZOH 2EY1A 4BXXH 3PO2B 2F0JA 4JW0A 1HRJA 1GUWA 1A6XA 1PA6A 2AWNA 1SRUA 1V9NA 3OTOQ 3HOZB 1STEA 1CQVA 4R4OA 2UUCL 4OX9H 3EBEA 3GTJB 1Y1WH 2Q8TA 4QQBX 2EYOA 1PRTF 2UXBQ 2R93G 1WE8A 2TMPA 5ELDA 1B3QA 2WKCA 3MFYA 4JI3Q 2JA7H 4L5RC 1GHKA 2I0QA 1DONA 2QDLA 1FR3A 3TREA 4FXDA 4GKKQ 1V1PB 2JA8B 3K7UC 2YTVA 3Q8DA 3GTGB 1SNCA 3HOYB 1LTLA 4X65H 2LY7A 1L0XB 2ZQEA 3UDFA 4HIOA 2VUMB 2XSCA 4EVOA 3DHQA 4DR2H 3EROA 3GKUA 1SMYD 5CBEE 5IGCA 3EZJA 3PIO3 1Z47A 1XNRL 2K5QA 1FJGL 2OF1A 3D31A 4QMFB 3K8AA 2N8NA 4GKJH 1JE5A 3PCOB 4LF8H 1N36H 2LF0A 5AFWA 2DJGC 4RH6A 1ZYRD 4RKLA 3BDCA 2PI2E 3GDEA 3W1BA 2E76C 4ZUIA 3CQZH 3RZDH 1D1KA 2L15A 2O2LD 1PRTD 1I6HH 1UE7A 5TSSA 3OTOL 5FO8B 4NXNQ 5IP7G 4C3IB 4DR1H 3J80W 4ZAIA 2UXBL 2WV6D 1YNJC 2N3SA 1M1KC 1GUGA 5IWAH 1FNWA 2KBNA 4DK0A 5C0XH 5IYDH 2FFMA 4DV7H 1YIJA 1IW7D 3CKIB 4JI8H 2BH2A 4DAMA 4YWLA 3A7LA 4JI3L 4IN3A 2R7DA 1HUMA 4DK1A 1X56A 4A3KG 3I7FA 4EQNA 4CKEA 4GKKL 2H1EA 4B8TA 2PZUA 4J6HA 5DNFA 1D5MC 3E5SA 1S3OA 2UUCH 4UP7A 5M5XB 1AN7A 3Q24A 5I6WA 4A3IB 1U4LA 1W6KA 3UDGA 1Q90A 4IPDA 1Q81C 2DJFC 1AFPA 2OQ0A 4AIMA 1U9RA 2EZVA 3S1RB 2PO4A 3NBIA 3RR5A 2F0NA 2JA6B 4HEDA 1XMOQ 5I9PA 2EY2A 1D8LA 3HOUH 1YITA 3FMCA 1Q46A 5E3FA 4HSVA 1S20A 4IO9A 4B08A 1I4GA 1S5FD 5BN5A 3G6JB 4H0LC 1V43A 1EWHA 3D4DA 3J81E 4K5XA 4BY7G 1VQIA 3ULJA 2Y0SB 1V8CA 2B63G 2N55A 3QIAA 3TRZA 3F2CA 1SEIA 4A75A 4C3HB 1EIGA 2F52A 1XNRH 3RN5A 2NYZD 1WCMH 2D5DA 1FJGH 1EYAA 3PV0A 1EWIA 1ILQA 1TWAB 5CBAE 4A3MG 4LNQA 3Q23A 1CKOA 4MIUA 1B53A 3SK4A 1IBLL 4ABNA 5DAUA 4BWGB 3PIPA 3D3RA 4DAPA 1PXUA 1S5CD 3VYRA 2NVYB 4X66Q 4EX5A 2V1CC 2E74C 1XPRA 3OTOH 4BY1B 2A6EC 4HJ7A 2EYHA 4A3LG 1K8GA 1DT4A 1SFOH 1H9RA 2B2WA 2UXBH 4RWSC 4DXGA 1CA5A 5D14A 1R4PB 2XRSD 4HCSA 3S9WA 1HH2P 2KQ3A 4EQPA 4IFDG 4CDFC 4IFDI 3PSIA 2MFIA 1XMOL 4JI3H 4YCWA 4A76A 3S1MH 3I8ZA 4K0KQ 1EY4A 2RCFA 3A56A 3UDXA 1PZJD 4EGVA 4GKKH 2L55A 1PH2A 3K0YA 5A35A 4K5VA 3HEJA 2H4OA 4LF7Q 2IX0A 5I6YA 5GAEC 1MHWC 5C6AA 1KDCA 2D0OA 3RF2A 1EY8A 2N78A 2TSSA 2CTLA 1PTOF 3TSSA 1Y1WB 4R4IA 5T1IA 1QVCA 2F0KA 5IYCG 1PMRA 4OD6A 4B3MQ 2PMZB 1BUVT 1L0YB 3AEVB 3PO3H 1HQRD 2VUMG 4R9WA 4HIMA 3MHBA 2JA7B 2MHVA 3T16A 1VIHA 2KOLA 1EL0A 3VA7A 3J7YW 3T1YQ 3HOXG 3S2DH 1LACA 4ZK9B 4TQUS 4IUPA 1X3GA 3PIP3 5CV9A 2E2DC 2K5HA 1WTWA 4PG3A 5IODA 1ZZJA 4HMJA 3NK9A 1WD0A 1A62A 4NP5A 4K0KL 3KDKA 2KJXA 4C3IG 1YJWA 3CCRA 2RDGA 1PH8A 2RQXA 1IBLH 4PMBA 2X69A 1D5ZC 4HTHA 3J80E 1EY0A 1PTOD 3CQZB 2AQ3B 4LAAA 4AQYL 2Q8IB 4A3GH 4IFDJ 1B9NA 1I6HB 1AW7A 1GVPA 1X32A 4KJNA 3E9IA 1TWFH 4PZ8A 1N8RC 5DLQE 2F0MA 2PI2A 4L5TA 1A63A 1EY5A 1BOSA 2XGTA 5HY6A 4YCUA 2JQOA 1T5EA 1HFNA 1FNVA 3K0XA 2B3GA 1BR9A 3QOLA 4R8NA 4DV6Q 1STNA 1W6JA 1S4ZA 3H3VC 1QNKA 4K6LA 2B2UA 1N32Q 3HOWH 2HUGA 3BZCA 2CH4A 5KIXA 4DKAC 4IOCA 2ZJRA 1UAPA 4K6DA 1Y69U 2Z4IA 5EBCA 4GOPA 3T1YL 2P5ZX 1T9HA 2CQAA 4TKOB 1GUNA 2JK8A 1H9SB 4GLVB 1A8VA 1SE4A 2YTXA 2OCEA 2JA6G 2C35B 2CTMA 5J39A 4DV3Q 3SXHA 4X64Q 1ZZIA 3U1KA 3T51B 1E1OA 2KEDA 1F77A 2PW5A 2AHOB 3I2ZA 5IYBH 4DUYL 4RGNA 4L63B 2M2LA 1ESRA 2F0UA 4HSPA 2A6HC 4JI4Q 3KF6A 2KHSA 3DLLA 4JI6Q 1SNQA 2OEOA 5J22A 4JI0H 1QNUA 1C48A 1PH5A 3UOEA 3HOUB 3BU2A 2MJ8A 2K28A 2Z9HA 1DJRD 3FHWA 5COYA 2AQ1B 4JOIA 3H0GH 4KKTA 4H44C 3NPPA 5E4XA 5EGTA 2EXZA 4XIGS 2F0TA 1F2ZA 1SJHD 2LSSA 4K0KH 4DV6L 3I70A 4BY1G 1WCMB 4KJOA 1CT1D 4IPHA 2MNAA 4RKBA 1N32L 4V190 1KDAA 2IX3A 5KYIA 1EZ8A 1MJEA 2F3IA 2YYZA 2BH8A 4FF3A 3GTLH 4AQYH 2NVXH 2K05A 1A2UA 2Z6BA 1AEXA 4DV3L 4S3SA 1BCPC 4X64L 1G6ZA 1OTCA 1VMCA 1SFOB 1S72A 3T4AC 2N88A 1LT6D 3PO2H 3NE5B 2R6GA 2ZTDA 5FLXL 1WD1A 1VQDA 1V9PA 5H1SE 4JI4L 4NZTM 4JI6L 3S14H 2Q2UA 4BXXG 3NBHA 1VQEA 5KNDA 1JWSD 4LW1A 3HOZH 2JVZA 1ZZKA 3W1GA 2AMCB 1NY4A 1VQ7A 4N8X1 3FP9A 4IUTA 4DNIA 3S1MB 3ERQA 4CKBA 5LMNQ 1XRHA 1HZCA 1Y1WG 1YNND 4L5QA 4XT3B 3T1YH 1YHQA 1RF2D 3M9BA 3NCVA 2R92H 2ENBA 3LX0A 5C44H 2ZXOA 1VQ8A 2PNHA 1Y8PB 5BR8L 2LXKA 4LF4Q 4ZUJA 4DUYH 4X62Q 5LMUQ 3DWPA 4WRDA 1BXTA 1XX8A 4G4KA 2VXWA 5JJZA 3HOYH 5JEAH 3ICEA 4E6IA 4B3TL 5F2DA 1EQRA 3MEHA 3MEFA 3W5OA 4GNXC 2QF7A 4GS3A 3G48A 4NMZA 4NW2A 3GTOH 5FJ8H 2EYLA 4LMQD 3CC2A 1F0XA 5NUCA 5EKLA 2CTJA 2F3VA 4A3FH 4JI2Q 3OWFA 4IALA 3F2DA 1AE2A 5IOCA 1RD9D 2DY8A 3IRBA 4IJLA 3IL8A 2A74C 1BNZA 1EOTA 3I4MH 3K5MA 3DUZA 4UP9A 3J7ZC 4DV6H 3LGJA 4NXMH 2PQAA 4LFBQ 3V69A 4QL5A 2HDLA 1N32H 1R9TH 1I94L 1G291 1TWCB 2M9VA 5LMNL 3ND8A 2HCIA 4N9PA 4OIKA 5I9OA 5JVG3 3NTKA 2FFKB 3KJPA 1WVLA 3M7NA 4DV3H 4A93B 4X64H 1HCZA 4HN7A 1A15A 1EYDA 1XJVA 1OXXK 1UE5A 3E0EA 5IYDG 5C0XG 5C0XI 2K14A 1EQQA 3KF8A 4OHJA 3G7LA 4LF4L 2PT7G 1TWFB 4X62L 1SDFA 5LMUL 4JI4H 1JR0D 4JI6H 3NWTA 1I50B 2CH4W 2Z6KA 5LL6S 2BA0A 3GO5A 4XDXA 3JAML 3CCUA 1SE3A 1BCPB 4O0AA 2IT1A 2O5IC 1F2YA 3VR4A 4A3IH 1VQ5A 1FVIA 3OHXC 2LKVA 1GUSA 4KV6A 3OIPA 4R4TA 3T1HQ 5FK9C 1O7LA 1UEAB 3S1RH 2JJQA 4A3JH 1EIFA 3PUVA 2BE5C 1NMFA 4B9XA 4B3RQ 3KUPA 3SK5A 2MJHA 4CDDC 1KL9A 5BR8H 2NZ1D 3H6MA 2UUAH 1TUAA 3ULLA 1HR0W 1PH7A 4GN5A 3HOUG 4A3EB 2F4VQ 4LFBL 1J5EQ 5HGTA 1Q1BA 3D6CA 4B3TH 2O4CA 1YJNA 3J7A5 2B39A 4JG2A 4G7ZC 3I73A 3GTKH 4DF7A 4G57A 1IYJB 1JCKB 1SR3A 1LUZA 2RSOA 1ZTGA 1LM0A 3R3OA 1CHPD 4FYDA 5JJLA 2B2VC 3IFTA 3S1NH 1WCMG 2B29A 4CDEC 4GNXB 1RKNA 1CZWA 1NCVA 5IE8A 3TZDA 5JAVA 3H0GB 2YV5A 1O7YA 1JJCB 3N52A 4IUVA 2JYOA 1L2FA 1VBIA 2WAQB 3MWYW 3GTQH 1VF5C 4O2DA 1I94H 2R7ZH 3GP7A 5HGQA 3HOVB 5LMNH 1N34Q 3EQLC 3T1HL 1ZXTA 2JE6I 3MXGA 2QNDA 3QB3A 4Q0FA 3TP5A 2K04A 2JZXA 3GTLB 2NUCA 1NR4A 1Q12A 5C4JH 2NVXB 1WYDA 5G3LF 3H15A 4LF4H 1H9JA 2JA5B 4X62H 2PY9A 5LMUH 4AH6A 5C3WA 2F4VL 1J5EL 4XQNA 2GVAA 2WINB 2Y3MA 4TVAB 4ZQ3A 3NP8A 4B3SQ 3S14B 1YHAA 1BKBA 1ML0D 3EJIA 5IGGA 1D5XC 1O7ZA 1CA6A 1DZ1A 2VS1A 2BOSA 3BVGA 1X9ZA 1UNSA 4RGMA 1STAA 4JBKA 3H3VI 1U4PA 4MN3A 1NXUA 2HT1A 4ZYSA 1YHBA 4J8QA 4KKSA 4A3DH 4DR6Q 2R92B 2OQKA 2I46A 5C44B 1TQOA 2E3UA 3OW7A 4DGZA 2A69D 3PO3G 1YVCA 2VQFQ 1IL2A 4LFBH 4ZCKA 4R8IA 1BBUA 1IBMQ 2WFWA 4YY3Q 1EY9A 1Y1VH 2HHHL 4KY6A 5LL6X 1N34L 1E2VA 2FHTA 2ID0A 2K4KA 3A8JE 5G3LD 1IL8A 2VY3A 1NMGA 1HA6A 2WB1B 3A7AB 4C3JH 3VYUA 3AYHB 4QIWB 5FOBB 1D1IA 1GUOA 3GTOB 2PQUA 1SNMA 4A3FB 4UP8A 3BZKA 3CMEA 4LF5Q 3WWVA 5JOBA 1EU3A 2F0EA 5GADC 3ULPA 3I4MB 4LF9Q 2DNCA 2LTMA 4B3SL 3VKEA 3TS0A 1TY2A 2CW0C 4KHVA 1CKNA 2CPQA 3UI2A 4DUZQ 4A3GG 1LT3D 3AFQA 1R9TB 3T1HH 4BA1I 4Y7NB 4O42A 4YCVA 5ELCA 3B6YA 1ILPA 2XVSA 2FINB 1MJCA 1H9MA 5C3XA 5FLXc 1A3VA 1HZ9A 1EC6A 1PVOA 1SYEA 4ZRZA 4CGYB 3FKIH 3FPUB 3JC66 2KCMA 2K1BA 2K33A 2VQFL 1PV4A 2EJFC 1J5EH 2F4VH 4RA8A 1GO3E 2CFMA 2EOTA 4APVA 3K58A 1IBML 5C4HA 1W2BA 1QG7A 2EY5A 4QMGA 4YY3L 2D9IA 3HOWG 1UUPA 4KHZA 1KC8C 1X4NA 2BDNA 4ZKCB 1HHVA 5IIFA 2FJ2A 1VS0A 1JOKA 4AYBB 5A2QL 3VR2A 2EQSA 2FMRA 4JI5Q 2YQRA 4EC5A 1A3TA 3STBC 1B4OA 2VB3X 2ZJQA 3J81i 3SVMA 1AE3A 2Y0SE 1GOZA 3S2HH 4A3JB 3D4RA 5GROA 5IYBG 4PQXA 4EQOA 3E9HA 3CF5A 1N33Q 2B2YC 3M4OH 1CM9A 2A68C 4LF9L 3HFZB 1X54A 2MO1A 2QGQA 3A54A 4BS9A 3E6ZX 3H91A 4ILWA 5EJWA 1G2SA 4NXNL 4FXKC 2HHHH 1TWHH 3JAMi 4LF6Q 2HH2A 1DM0B 4NZRM 1IXRA 1XNQQ 2QKIC 2OPVA 3P20A 3GTKB 1WOCA 3I91A 1RTNA 3I4LA 2I5MX 4DV4Q 1QUQB 5FKAC 1GHJA 4E9JA 3H0GG 1GD7A 1I4XA 5FLMG 2AQ2B 2VQEQ 3NENA 2WAQG 3X3MA 1QWYA 1BCPF 3S1NB 4OIJA 1YBYA 1B3AA 2M8WA 1LYLA 3CPFA 1GJXA 2G5DA 4B3SH 1L1OC 1CZGA 1G6PA 4DAYB 1EEID 5M3MH 1FL0A 1X6OA 1WTQA 3GTQB 4X3SA 1VQJA 3W2DA 1IYUA 2IW3A 1P16A 4H02A 2R7ZB 4NBQA 3V96A 4WFN3 3A5ZB 4TRDA 3GQBA 1SE2A 1LTID 3MA2B 4OXPA 4LFCQ 2X6GA 1N33L 3AMUA 3PO2G 2XWJB 2SNMA 2HH3A 1VQBA 2SEBD 5C4JB 1NTGA 2ASBA 5CGKA 2VQFH 3JAMc 3TDQA 4RCNA 1DGSA 3HOZG 2DGYA 3SE0A 3MVVA 1FGBD 1IBMH 3A55A 4YY3H 4JVYA 3D4WA 1VQHA 5CC4A 3QO2A 4LF6L 3TS2A 5CV8A 1D2BA 2PMZE 4ME5A 4QUCA 1K8OA 5IT9L 3S24A 3DMUA 3TZUA 2SNSA 3H3VH 1F9SA 3I90A 4X6AH 3OYYA 4I7AA 4M1UB 5C44G 2UU9Q 2KCNA 4KD3A 1F9QA 4G7OC 2D2CC 1X65A 2VQEL 3DEOA 3CCQA 2L4NA 2QW7A 3MC0B 2HDMA 5T1GA 2A1AA 4CDCC 1PZKD 5I4DA 4FO2A 2JA8G 4DPGA 4A3DB 3UE0A 3HOYG 5JEAG 3PMFA 1GM5A 1V1PA 2L9HA 2A73B 2R3ZA 4X66L 4R1JA 2P2RA 4JI1Q 4UY8C 4NXNH 1E22A 4CKCA 4PMCA 3MAQA 4PZ6A 4POFA 1NBWA 3GV6A 4JK1C 1BVSA 1EU4A 4CBVA 4A3FG 4H13C 1Y1VB 3HP3A 1F9PA 3MXNB 4UPAA 4LFCL 1JQYD 3I4MG 5I2YA 4QY7A 3AFPA 4GLAC 4C3JB 1EFWA 1HTLD 2WACA 4AM3A 3L2PA 1SYFA 1TWCH 1Z2IA 1XXGA 4NKLA 1KABA 1PH1A 2XWBB 2ZTEA 1K8MA 1JMCA 4GZYC 1G91A 3VR6A 3KDFB 4LF7L 5ELNA 4L5SA 4A93H 4JV5Q 2JN4A 3F8TA 4JBJA 3HS0C 1SYDA 3HKZB 1M4VA 4MTNA 2KCTA 4LK1C 1E2ZA 1ENCA 3H09A 4O1NA 1I50H 1U0LA 4ME3A 1N33H 2E2IB 1IKMA 1KHIA 1EYGA 2OXPA 1L1OB 1XMOH 1CQFA 1LT5D 4XQQA 4B3ML 2E2HB 3I3CA 4P75A 4A4IA 4AYBG 1PYSB 4KMUC 3FKIB 2QCPX 1PYBA 4JI1L 4A3IG 4LF6H 2CTFA 1VQNA 1IZ6A 1Z9FA 4N8FA 1X55A 2CHBD 1JJ2A 1PH9A 4DR7Q 4IUUA 1E7ZA 4YHHQ 3NTHA 1HTPA 1S5DD 3I4NB 2KENA 2VQEH 4TSSA 5KNBA 4A3EH 2KEEA 1EIHA 1I4QA 1BQQT 5C4ZA 3OETA 4KN4C 4G7HC 1V1OA 1FD7D 1OXTA 5IY0A 1ASYA 1II3A 4Q5VA 3S2HB 3D8GA 1KLUD 4GLXA 3M4OB 2Y0SG 2X06A 3C1FA 3IFDA 4X66H 5M9OA 1K0RA 2VNUD 1KRTA 2WP8J 1CTMA 4ODGA 4V0BA 1QZHA 4C3HG 1PFMA 5M5YH 5IGDA 4WALA 3BYTB 1BF4A 3CCVA 1IYVA 1WVNA 1Q82C 1TVXA 2EJGC 1TWHB 3BJUA 4A3CH 2IHEA 2F0IA 4LFCH 4OL7A 3SK8A 2NTSA 2CPMA 1FNUA 3O13A 3S16H 1VIGA 1E1TA 3CCEA 1BBWA 3ONAB 2CQOA 3HOVH 3FPPA 1X9NA 4HJAA 1MI2A 4DK3C 4NB3A 2NVTB 4JYAQ 2KVMA 3CCLA 2R7ZG 2QEXA 3I56A 2ES2A 5JJIA 4LF7H 1SE8A 2QDBA 2KCCA 3GV3A 2XIWA 3CAMA 1VQ6A 3L3OC 4C1NK 4DR7L 1Q1EA 1TXYA 5M3MB 4XYOA 2JA5H 4I7ZC 4FP5D 3V2TA 2L5TA 2DGRA 1XMQQ 1KHMA 1TS5A 1HR0Q 2A8VA 5ELBA 1Q8IA 4B3MH 2HIXA 5A2QE 1C0AA 1TS2A 3T13A 2NWGA 4K8IA 4RFBA 1XTDA 4JI1H 2VKCA 3KLSX 5C4XH 4DA2A 1WTOA 4FJUA 2M00A 4OWWB 1PH4A 2F0GA 2R61A 1JWMD 1LTTD 1TKWB 4OO1H 4RGOS 3L7ZC 4ULLA 1VQKA 1SYBA 4NPSA 3X3NA 2ZXRA 5FO7B 1M8AA 2K03A 3S17H 2B2TA 1K3RA 1UWVA 3AEVA 2JA7G 3HRZC 4I65A 1I3QH 1HNZQ 1QILA 1JOOA 4DV0Q 2CTEA 2CVRA 1TR5A 1CHQD 2VB2X 3S15H 2F0WA 1DXMA 1Y1VG 4QJFA 5CV5A 3KFUA 1HA5A 2RDHA 3EN2A 3DXJC 5EBDA 1K28A 4C3JG 1CSPA 1QJOA 4RAUC 4KHPQ 4QUFA 1HNWQ 4JVZA 3K80C 4PV1C 4RG1A 3RD4A 1XMQL 1OXSC 3J7AK 3K59A 1CK1A 1WTXA 3C3LA 1LV9A 2XRQD 1GKHA 1EOVA 1VQ4A 2NVQH 1WTPA 2E5LQ 1O80A 4R4QA 3NSWA 5IGEA 1K83H 4DN4M 3A8KE 4OX9Q 3KDFA 1PDQA 5AJ3Q 1JORA 3TQYA 4Y7NH 3OW2A 3HOXH 3WOFA 3OPOA 3MZ5A 4P2CB 2EE1A 3J81L 5EQ0A 4C56C 1EYCA 1DOLA 3OWEB 4DR7H 4KKUA 4WANA 1UEBA 4OCHA 2PYKA 3DEPA 2B2WC 4JI7Q 5J1ZA 5FLXW 2JEBI 2NN6H 3BZDB 3GABA 4A3BH 2RHSB 3M85A 1HNZL 2CTKA 1VQGA 4DV0L 5K36H 2PZWA 4IPCA 3CP0A 4OEMB 2CW0D 3NQIA 4X65Q 1J5KA 4DFAA 2EDGA 3RUZA 1ZKOA 5ELOA 3U58A 1SXTA 1K3BC 5IT9c 3ER0A 4KK7A 1B70B 2KHIA 4JBWA 1QOHA 1YNJD 4QGUA 1HJPA 1SMXA 1H9SA 1HQMC 1SYCA 2E2JH 5EPJA 4JI2L 4KHPL 2VL6A 3F2UA 2CCZA 3GTPB 4GKJQ 3CRKC 3I55A 1N36Q 1KAWA 3U9SA 5CYUA 4U673 3SDZA 3VDYA 1B2TA 1K8AC 2E5LL 1A2TA 2F0HA 3HKSA 2RCNA 4HJ9A 4B8CD 1J4WA 4RGTA 3OMCA 2HD3A 4A3KB 3WOEA 5AJ3L 3S1QH 4BBRH 4GN3B 3LWUA 2EJMA 4N9TA 5LHY1 1B7YB 4WJ4A 2WAQE 4J15A 2K01A 1SNDA 4LWCA 4JI8Q 3BVZA 1DYQA 4JI7L 5M5YB 1XMQH 2G8YA 2E75C 1HXYD 3CPWA 2D9UA 2PNRC 3QOJA 4L8JA 5DM63 2HQEA 4F87A 1S5ED 3R2IA 3R8BA 1TU2B 1RL2A 3EFXD 3M3YH 4OGQC 4RHSA 5ISRA 2RBMA 1PZID 4X65L 3OOCA 3S16B 2EIFA 1JB3A 1PYWD 5JVH3 5LMNW 1G8ZD 1VMPA 5M3MG 1KLGD 2FPHX 2Z0SA 1JWUD 2AUKA 3BYYB 5C0XJ 4JCVE 1NR2A 4KY7A 4GKJL 5M3FH 4B3RL 4F88A 4HIDA 1XPUA 1N36L 3L0OA 4DU9A 4FF4A 4DV5Q 2D62A 1XWEA 1LTRD 2K5NA 3PIOA 1WTVA 3KK7A 3TMEA 4F8MA 1NUCA 2X6LA 2F3WA 1KIXA 3K6OA 3CXCA 2F1MA 1HNZH 1WHRA 4DV0H 4A3MB 4JPBW 4CJ2C 3JAMW 4LUZA 2VW9A 3IKJA 2A6ED 2JA9A 4G08A 3T53B 1LTSD 1WFQA 2JSOA 2Q2IA 1EUJA 1YNNC 2CKZB 2XTIA 3J80L 3CW2C 4C1NI 1QCBD 2ZM6Q 2B2UC 2EY6A 4MTKA 2O4XA 4KHPH 3AQQA 3M4QA 4JI2H 3V05A 1VQLA 5M5WH 2XNAC 3NTIA 5C4XB 1DOKA 3FEWX 4GOPC 1JT8A 1KAAA 2NB0A 3R2TA 1JICA 3MTSA 3RNUA 4CJ1B 2WB1E 3G71A 2E5LH 2QEJC 3E3XA 2ZJPA 2CWFA 4QIWE 1SLJA 2VZAA 1YNXA 1AZQA 1QVGA 3S17B 1G51A 2K1HA 1PQXA 1EZ6A 1RODA 3Q6SA 1BDOA 1I3QB 2MP1A 4BBSH 2FMMA 2L0CA 1WTHA 2HCCA 4JC0A 2F0LA 3CCMA 3S15B 3ZJYC 4K2LA 2IWHA 4M8AA 4OONA 1DOMA 4DV1Q 2LXJA 2FXQA 3P7JA 5EKIA 4PMWA 4JI7H 4DV5L 3D6WA 1LTBD 1RCVD 2K75A 3U50C 2OTLA 1NAPA 2F0SA 2J4XA 3RLOA 4JOIC 4BA2I 2KHJA 2IHFA 1F9RA 2NVQB 4DNTB 3CMAA 1EQTA 2AUJD 2ICIA 1EEFD 1W3SA 1K83B 5D65A 1NNXA 2ZM6L 2Q8RE 4A93G 3UDIA 4LIJA 1CUKA 3PF4A 5JPNC 2ICEC 5FLXE 2SDFA 4MZ9A 1PFNA 4RHRA 2NTTA 2E2IH 3C1EA 1JJGA 3HOXB 2YTYA
chains in the Genus database with same CATH topology
4DR3Q 1VDZA 1PHJA 2E2HH 2RDFA 4DR6L 4AYBE 5HURA 3KLRA 3T56B 3BS1A 4IJHA 3QWNA 2KA7A 3AB9A 4FXGC 2ZTCA 1JOQA 5CORA 1TWGH 2B8GA 3G4SA 1STYA 4K2KA 4A3BB 1AH9A 3LNNA 4DR5Q 4LFAQ 3L9AX 5JJKA 3I4NH 2NZOA 4DV1L 2V4DA 5CV4A 5CMDA 1SROA 2LFNA 4IZ8A 5DEHA 3SK6A 2MO0A 4A3EG 2E2JB 3EA6A 4LF5L 4CJ0B 3KLWA 1IBLQ 1TIID 2B2TC 3CU7A 5C3EH 4HMIA 5CV7A 2RKSA 2J7ZA 1I4PA 3OSOA 4GOPB 1I4RA 4HAEA 4DUZL 3VA5A 3FDTA 2A19A 2DUDA 3J7AF 3S1QB 4X3UA 3F2BA 1Y8OB 1SNPA 1ZEQX 4BBRB 3SR1A 2AKWB 1Q7YC 4A3CG 3OIQA 2K5VA 2PQEA 4DR3L 1F2MA 2UUBQ 1HFGA 3U4VA 1YZ6A 4GNXA 2A6HD 2RHQB 3KF6B 1VQPA 4HCEA 3RLFA 3U4ZA 3VR3A 2NVTH 2MGSA 3HOVG 5KRUA 4J1MA 4RMFA 2XN9C 4XYQA 2NBFA 2BL5A 3M3YB 2QILA 4DR5L 4LFAL 2RF4A 3ITPA 2G9HD 1IHZA 1GXDC 1X3PA 5CR3A 3J81c 1MSGA 5ELEA 3RMHA 4JI5L 1AZPA 4H7BA 1KDBA 4QCLA 1B8AA 1CKMA 3W3AA 2JA5G 2UXCQ 3TP8A 1HZAA 2J0TD 2I5LX 5EKKA 3PUZA 1S40A 3JAME 5IP9H 3CC7A 5M3FB 2KUMA 3KYHC 4JI0Q 4HR7B 1E0BA 1X4MA 3A5UA 3DWQA 2Q2HA 3SGIA 3DM1A 3PUYA 4K8JA 4Z9CB 1C4QA 1SEBD 3CRLC 2L1BA 3KBGA 2Z6KC 3A0JA 5C4XG 1XNQL 4K5WA 1BCPD 2I07B 4OO1G 2R92G 3MXUA 4OO1I 3KLSA 4DV4L 4U68A 2UUBL 1X3FA 2H5XA 1RHPA 4KY5A 2F0OA 5M5WB 3NBHB 3D0FA 2A69C 3ND9A 3RZOB 1JE4A 2Z4HA 3DWAA 2JP1A 1X3EA 5FO9B 1KQSA 3I4OA 2WB1G 4AQYQ 4HJ5A 2ALYB 4LJZC 1R4QB 4DXFA 5FJ8G 1LTGD 2EVBA 2GA4B 2K7VA 2EXDA 5KNCA 2UXCL 2R93H 1SMYC 4BBSB 3J80i 3PF5A 1B9MA 3MXPA 3EVQA 3NXWA 1K9MC 1P8LA 1X3QA 2DY7A 1Z6HA 3HKZE 1LLRD 4JI0L 3E0JA 4ID6A 2L11A 1ZYRC 1SAPA 1J6QA 2K5WA 1QE6A 1VQ9A 2DN8A 2C9OA 2B2VA 3BG3A 3K7AH 3G6EA 2GN5A 1MGSA 1PRTC 1KTKA 4X3TA 5BN3A 4X3KA 4IUQA 1FYCA 4OWXB 1OO9B 3NQTA 5D3DA 1ET9A 2RSNA 2UU9L 4QB4A 3SHLA 4DUYQ 4ZKBB 4MHEA 1WI5A 1IW7C 2NN6G 2NN6I 1ET6A 4A3BG 2PQAB 2ATWA 4P73A 1B1ZA 4IPGA 5C5MA 5K36G 1V8QA 3M7GA 1SSOA 3CC4A 1A0IA 3TN2A 1WTRA 5IP7H 3RZDB 1I6VC 2RA4A 3J80c 1TWGB 2UXDQ 4YWKA 3GTPH 4ALPA 4C2MH 1EQVA 1PLFA 4A3JG 2F0QA 3KF8B 3KJOA 1J9OA 3TP6A 5JEAJ 1C8CA 5GAGC 3EIVA 3NELA 4NXMQ 3RLNA 2EPBA 4A3KH 4JBMA 3P1HA 4EQ5A 3FVQA 1O7IA 5ELFA 4WJ3M 3TEHB 4PZ7A 5E1FA 2Q2TA 3VYSA 4BBRG 1E3PA 1I4HA 1SJED 1RDPD 1HUNA 1STGA 3CHBD 1OXUA 1IBKQ 4JV5L 5C3EB 2MUYA 4L6TB 3AU7A 3C2PA 1Q3LA 1FGUA 2BE5D 1LO5D 2BDOA 1EWCA 1QUQA 2FMCA 1MKHA 2EYJA 1KXLA 1XYIA 3OMGA 4IUNA 2CWPA 2D0PA 2WKDA 1HNXQ 1LT4D 4DV2Q 3FRPB 2K50A 2K6AA 4BY7H 3NHHA 4DAYA 1DCZA 1TS3A 2B63H 2UXDL 1STHA 2F0VA 3K5OA 2CWAA 4XT1B 1ASZA 3PUWA 3I72A 4F7XA 3K5NA 5FLMH 3KOJA 3CD6A 5E4WC 5M3FG 2PPBC 1PTOH 4WORA 4YHHL 4RCOA 4LUOA 5BR8Q 2IY5B 1V1QA 2UUAQ 4XTCS 4NXML 4A3MH 3SEBA 1PRTB 2BCOA 1KRSA 1QB5D 1C9OA 3UE1A 3VR5A 2EYFA 4B3TQ 4KN7C 3QG1A 1HZBA 2LMCB 3J81j 2ZT9C 1H95A 1ESFA 4QF4A 3PGZA 1KD1C 2MPMA 2K5DA 1XPOA 2F0PA 4P72A 4A3LH 3K5LA 1ONLA 1BBXC 1IBKL 3N6RA 1DTJA 1YEZA 2YU9H 3GTMH 4KD4A 3NUCA 3BVMA 1SBBB 1D7QA 1TY0A 5EAYA 4IFDH 2PCFB 1CI3M 3NEMA 1RTOA 2I5HA 4A3DG 3GD7A 5IGFA 2JXMB 4KTAA 2B8FA 4B9WA 1AP0A 1MBYA 3GTJH 4OWTB 1HNXL 4DV2L 1I94Q 1S5BD 1SNOA 1U4RA 4JYAL 3M4PA 4DNRB 2AXYA 2OT2A 3J7AV 4GN4B 2G9DA 2BA1A 2HIVA 4BBSG 4DAVA 1Q86C 1JC7A 4P71A 3QJYA 3URYA 2B2YA 2ANNA 4FNFA 3MXNA 1TT2A 1LABA 2NZHA 2UUAL 1EY6A 4UAIA 5IYCH 4DR4Q 4HJ8A 5EPLA 1WJJA 4PNYA 2JA8H 2R93B 3LWEA 1UE6A 4DK6C 1NJIC 1L0WA 1HR0L 3GTGH 1QZGA 2VUMH 1VQMA 4FF1A 1EIYB 3PO3B 1Q8KA 5IGBA 3BDLA 2IJ0A 5I2XA 2PW7A 2LS01 3F1ZA 1M90C 4POGA 4XQJA 3HKZG 4IOAA 4FDBA 1PTOC 1E24A 1VF7A 3A74A 2OTJA 2IPKD 3PUXA 4ZLTF 1BO0A 3K7AB 1KNEA 1SYGA 3P75A 1YJ9A 1MSHA 4FF2A 3Q22A 5K5PA 3S2DB 1B50A 3HGBA 4R4CA 5J3BA 4CHTB 1U4MA 1L1OA 2PZTA 4KLKA 5JPMC 4C3IH 1STBA 1NE3A 3FKIG 5BN4A 4YWMA 5IT9E 2F4IA 1F2LA 1CKNB 2F03A 1PFBA 3VYTA 3ZYYX 1PFSA 1E2WA 2QA4A 2RVLA 4DR2Q 4IQZA 1CFMA 1VCIA 3M4YA 3NWSA 4XXEA 2WIIB 3I4NG 4A3GB 3K81C 1OXVA 3A8IE 5DM73 3R93A 1QVFA 3BDOA 1EFID 1HNWL 4DR4L 5C5LA 4P74A 1C7YA 3TBIB 5CV6A 1RJTA 1DD2A 4C2MB 3U9OA 4LF8Q 4FVMA 1H9KA 5KEEA 1CSQA 5M5XH 3WDNA 1VQFA 2A5HA 4K14A 3K57A 5D3IB 5C3EG 1K73C 3KBXA 4UDUC 2GVBA 4OX9L 1GUTA 1G2TA 1HPCA 3HOWB 1Y8NB 1PH6A 1D6EC 2N49A 3C46A 1LTAD 2Z8LA 4DR1Q 2JA6H 2OPUA 1MIUA 3STBD 3Q0AA 2K32A 1VQAA 1MD2D 5IWAQ 1B44D 5EPKA 4WJWA 1KNAA 1IKLA 1AN8A 4DV7Q 1N9WA 3DM3A 2ZXPA 1Z7TA 2A68D 1K1GA 2F0DA 1J8IA 3HZXA 5E7NA 3HG9A 3H94A 2IX1A 1Y14B 4Y52H 2AWOA 2IL8A 1I5FA 2DNEA 3CCSA 5KYLA 1XTCD 4LUVA 1UE1A 1T5XD 2ANRA 4C3HH 2UUCQ 4IURA 4DR2L 3CCJA 4NDXA 3RN2A 1O78A 2R7FA 1TS4A 2EYPA 4BY7B 1TWAH 1JB7A 4JVHA 2B63B 4YIJA 1NSNS 5GAHC 1ENFA 1ENAA 2F0FA 4LF8L 2NVYH 1VQOA 2SOBA 5IP9G 4BY1H 1PTOB 2Z1CA 4MNOA 1RIPA 2JEAI 3MFGA 2L12A 2HHHQ 5GQOA 4KI0A 1EY7A 2K52A 1U5KA 1SN8A 4DR1L 2HQLA 4HIKA 2C5CA 2E8GA 1YI2A 1VQCA 2O5JC 3TP7A 5IWAL 2OWOA 1XNRQ 2KECA 1A3UA 4JI8L 4DV7L 1PH3A 1ICWA 1FJGQ 2EYMA 3ERSX 2YU9B 3GTMB 3IAYA 5KGUA 2MQHA 3RZOH 2EY1A 4BXXH 3PO2B 2F0JA 1HRJA 1GUWA 1A6XA 1PA6A 2AWNA 1SRUA 3OTOQ 3HOZB 1STEA 1CQVA 4R4OA 2UUCL 3EBEA 3GTJB 1Y1WH 2Q8TA 4QQBX 2EYOA 1PRTF 2UXBQ 2R93G 1WE8A 2TMPA 5ELDA 2WKCA 3MFYA 4JI3Q 2JA7H 4L5RC 1GHKA 1DONA 2I0QA 1FR3A 3TREA 4FXDA 4GKKQ 1V1PB 2JA8B 3K7UC 2YTVA 3GTGB 3Q8DA 1SNCA 3HOYB 1LTLA 2LY7A 1L0XB 2VUMB 3UDFA 4HIOA 2XSCA 4EVOA 3DHQA 3EROA 1SMYD 5CBEE 5IGCA 3PIO3 1Z47A 1XNRL 2K5QA 1FJGL 2OF1A 3D31A 4QMFB 3K8AA 2N8NA 1JE5A 3PCOB 5AFWA 4RH6A 1ZYRD 4RKLA 3BDCA 2PI2E 3GDEA 3W1BA 2E76C 4ZUIA 3CQZH 3RZDH 1D1KA 2O2LD 2L15A 1PRTD 1I6HH 5TSSA 1UE7A 3OTOL 5FO8B 4NXNQ 5IP7G 4C3IB 4ZAIA 2UXBL 2WV6D 1YNJC 2N3SA 1M1KC 1GUGA 1FNWA 2KBNA 4DK0A 5C0XH 5IYDH 1YIJA 1IW7D 3CKIB 2BH2A 4DAMA 4YWLA 3A7LA 4JI3L 4IN3A 2R7DA 1HUMA 4DK1A 1X56A 4A3KG 3I7FA 4EQNA 4CKEA 4GKKL 2H1EA 4B8TA 2PZUA 4J6HA 5DNFA 1D5MC 3E5SA 1S3OA 4UP7A 5M5XB 3Q24A 5I6WA 4A3IB 1U4LA 1W6KA 3UDGA 1Q90A 4IPDA 1Q81C 1AFPA 2EZVA 2OQ0A 1U9RA 4AIMA 3S1RB 2PO4A 3NBIA 3RR5A 2F0NA 2JA6B 4HEDA 1XMOQ 5I9PA 2EY2A 1D8LA 3HOUH 1YITA 3FMCA 1Q46A 5E3FA 4HSVA 4IO9A 4B08A 1I4GA 1S5FD 5BN5A 3G6JB 4H0LC 1V43A 1EWHA 3D4DA 3J81E 4K5XA 4BY7G 1VQIA 3ULJA 2Y0SB 2B63G 2N55A 3QIAA 3TRZA 3F2CA 4A75A 4C3HB 1EIGA 2F52A 3RN5A 2NYZD 1WCMH 2D5DA 1EYAA 3PV0A 1EWIA 1ILQA 1TWAB 5CBAE 4A3MG 4LNQA 3Q23A 1CKOA 4MIUA 1B53A 3SK4A 1IBLL 4ABNA 5DAUA 4BWGB 3PIPA 4DAPA 3D3RA 1PXUA 1S5CD 3VYRA 2NVYB 4X66Q 4EX5A 2V1CC 2E74C 1XPRA 4BY1B 2A6EC 4HJ7A 2EYHA 4A3LG 1K8GA 1DT4A 1SFOH 1H9RA 2B2WA 4RWSC 4DXGA 1CA5A 5D14A 1R4PB 2XRSD 4HCSA 3S9WA 1HH2P 2KQ3A 4EQPA 4IFDG 4IFDI 3PSIA 2MFIA 1XMOL 4YCWA 4A76A 3S1MH 3I8ZA 4K0KQ 1EY4A 3A56A 3UDXA 1PZJD 4EGVA 2L55A 1PH2A 3K0YA 5A35A 4K5VA 3HEJA 2H4OA 4LF7Q 2IX0A 5I6YA 5GAEC 5C6AA 1KDCA 2D0OA 1EY8A 2N78A 2TSSA 2CTLA 1PTOF 3TSSA 1Y1WB 5T1IA 4R4IA 1QVCA 2F0KA 5IYCG 1PMRA 4B3MQ 2PMZB 1BUVT 1L0YB 3AEVB 3PO3H 1HQRD 2VUMG 4R9WA 4HIMA 3MHBA 2JA7B 2MHVA 3T16A 1VIHA 2KOLA 1EL0A 3VA7A 3J7YW 3T1YQ 3HOXG 3S2DH 1LACA 4ZK9B 4TQUS 4IUPA 1X3GA 3PIP3 5CV9A 2E2DC 2K5HA 1WTWA 4PG3A 5IODA 1ZZJA 4HMJA 3NK9A 1WD0A 1A62A 4NP5A 4K0KL 2KJXA 4C3IG 1YJWA 3CCRA 2RDGA 1PH8A 2RQXA 4PMBA 2X69A 1D5ZC 4HTHA 3J80E 1EY0A 1PTOD 3CQZB 2AQ3B 4LAAA 4AQYL 2Q8IB 4A3GH 4IFDJ 1B9NA 1I6HB 1AW7A 1GVPA 1X32A 4KJNA 3E9IA 1TWFH 4PZ8A 1N8RC 5DLQE 2F0MA 2PI2A 4L5TA 1A63A 1EY5A 1BOSA 2XGTA 5HY6A 1HFNA 2JQOA 1T5EA 4YCUA 1FNVA 3K0XA 2B3GA 1BR9A 3QOLA 4R8NA 4DV6Q 1STNA 1W6JA 1S4ZA 3H3VC 1QNKA 4K6LA 2B2UA 1N32Q 3HOWH 2HUGA 3BZCA 5KIXA 4DKAC 4IOCA 2ZJRA 1UAPA 4K6DA 1Y69U 2Z4IA 5EBCA 4GOPA 3T1YL 1T9HA 2CQAA 4TKOB 1GUNA 2JK8A 1H9SB 4GLVB 1SE4A 1A8VA 2YTXA 2OCEA 2JA6G 2C35B 2CTMA 5J39A 4DV3Q 3SXHA 4X64Q 1ZZIA 3U1KA 3T51B 1E1OA 2KEDA 1F77A 2PW5A 2AHOB 3I2ZA 5IYBH 4DUYL 4RGNA 4L63B 2M2LA 1ESRA 2F0UA 4HSPA 2A6HC 4JI4Q 3KF6A 2KHSA 3DLLA 4JI6Q 1SNQA 2OEOA 5J22A 1QNUA 1C48A 1PH5A 3HOUB 3BU2A 2MJ8A 2K28A 1DJRD 3FHWA 5COYA 2AQ1B 4JOIA 3H0GH 4KKTA 4H44C 3NPPA 5E4XA 5EGTA 2EXZA 4XIGS 2F0TA 1F2ZA 1SJHD 2LSSA 4DV6L 3I70A 4BY1G 1WCMB 4KJOA 1CT1D 4IPHA 2MNAA 4RKBA 1N32L 4V190 1KDAA 2IX3A 5KYIA 1EZ8A 1MJEA 2F3IA 2YYZA 2BH8A 4FF3A 3GTLH 2NVXH 2K05A 1A2UA 1AEXA 4DV3L 4S3SA 1BCPC 1G6ZA 4X64L 1OTCA 1VMCA 1SFOB 1S72A 3T4AC 2N88A 1LT6D 3PO2H 3NE5B 2R6GA 5FLXL 2ZTDA 1WD1A 1VQDA 1V9PA 5H1SE 4JI4L 4JI6L 3S14H 2Q2UA 4BXXG 3NBHA 1VQEA 5KNDA 1JWSD 4LW1A 3HOZH 2JVZA 1ZZKA 3W1GA 2AMCB 1NY4A 1VQ7A 3FP9A 4IUTA 4DNIA 3S1MB 3ERQA 4CKBA 5LMNQ 1HZCA 1Y1WG 1YNND 4L5QA 4XT3B 1YHQA 1RF2D 3M9BA 2R92H 2ENBA 3LX0A 5C44H 2ZXOA 1VQ8A 2PNHA 1Y8PB 5BR8L 2LXKA 4LF4Q 4ZUJA 4X62Q 5LMUQ 3DWPA 4WRDA 1BXTA 1XX8A 4G4KA 2VXWA 5JJZA 3HOYH 5JEAH 3ICEA 4E6IA 4B3TL 5F2DA 3MEHA 1EQRA 3MEFA 3W5OA 4GNXC 2QF7A 4GS3A 3G48A 4NMZA 4NW2A 3GTOH 5FJ8H 2EYLA 4LMQD 3CC2A 2CTJA 5NUCA 5EKLA 2F3VA 4A3FH 4JI2Q 3OWFA 4IALA 3F2DA 1AE2A 5IOCA 1RD9D 2DY8A 3IRBA 4IJLA 3IL8A 2A74C 1BNZA 1EOTA 3I4MH 3K5MA 3DUZA 4UP9A 3J7ZC 3LGJA 2PQAA 4LFBQ 3V69A 4QL5A 2HDLA 1R9TH 1I94L 1G291 1TWCB 2M9VA 5LMNL 3ND8A 2HCIA 4N9PA 4OIKA 5I9OA 5JVG3 3NTKA 2FFKB 1WVLA 3M7NA 3KJPA 4A93B 1HCZA 4HN7A 1A15A 1EYDA 1XJVA 1OXXK 1UE5A 3E0EA 5IYDG 5C0XG 5C0XI 2K14A 1EQQA 3KF8A 4OHJA 3G7LA 4LF4L 1TWFB 4X62L 1SDFA 5LMUL 1JR0D 3NWTA 1I50B 2Z6KA 5LL6S 2BA0A 3GO5A 4XDXA 3JAML 3CCUA 1SE3A 1BCPB 4O0AA 2IT1A 2O5IC 1F2YA 3VR4A 4A3IH 1VQ5A 1FVIA 3OHXC 2LKVA 1GUSA 4KV6A 3OIPA 4R4TA 3T1HQ 5FK9C 1O7LA 1UEAB 3S1RH 2JJQA 4A3JH 3PUVA 1EIFA 2BE5C 1NMFA 4B9XA 4B3RQ 3KUPA 3SK5A 2MJHA 1KL9A 2NZ1D 3H6MA 1TUAA 3ULLA 1HR0W 1PH7A 4GN5A 3HOUG 4A3EB 2F4VQ 4LFBL 1J5EQ 5HGTA 1Q1BA 3D6CA 1YJNA 3J7A5 2B39A 4JG2A 4G7ZC 3I73A 3GTKH 4DF7A 4G57A 1JCKB 1IYJB 1SR3A 1LUZA 2RSOA 1ZTGA 3R3OA 4FYDA 1CHPD 1LM0A 5JJLA 2B2VC 3IFTA 3S1NH 1WCMG 2B29A 4GNXB 1RKNA 1CZWA 1NCVA 5IE8A 3TZDA 5JAVA 3H0GB 3N52A 1O7YA 4IUVA 1JJCB 2YV5A 2JYOA 1L2FA 2WAQB 3MWYW 3GTQH 1VF5C 4O2DA 2R7ZH 3GP7A 3HOVB 5HGQA 1N34Q 3EQLC 3T1HL 1ZXTA 2JE6I 3MXGA 2QNDA 3QB3A 4Q0FA 3TP5A 2K04A 2JZXA 3GTLB 2NUCA 1NR4A 1Q12A 5C4JH 2NVXB 5G3LF 1WYDA 3H15A 1H9JA 2JA5B 2PY9A 4AH6A 5C3WA 2F4VL 1J5EL 4XQNA 2GVAA 2WINB 4ZQ3A 4TVAB 3NP8A 4B3SQ 3S14B 1YHAA 1ML0D 3EJIA 5IGGA 1BKBA 1D5XC 1O7ZA 1CA6A 1DZ1A 2VS1A 2BOSA 3BVGA 1UNSA 4RGMA 1STAA 4JBKA 3H3VI 1U4PA 4MN3A 2HT1A 4ZYSA 4J8QA 1YHBA 4KKSA 4A3DH 4DR6Q 2R92B 2OQKA 2I46A 5C44B 1TQOA 2E3UA 3OW7A 4DGZA 2A69D 3PO3G 1YVCA 2VQFQ 1IL2A 4R8IA 1BBUA 1IBMQ 2WFWA 4YY3Q 1EY9A 1Y1VH 2HHHL 4KY6A 5LL6X 1N34L 1E2VA 2FHTA 2ID0A 3A8JE 5G3LD 2K4KA 1IL8A 2VY3A 1NMGA 1HA6A 2WB1B 3A7AB 4C3JH 3VYUA 3AYHB 4QIWB 5FOBB 1D1IA 1GUOA 3GTOB 2PQUA 1SNMA 4A3FB 4UP8A 3BZKA 3CMEA 4LF5Q 3WWVA 5JOBA 1EU3A 2F0EA 3I4MB 5GADC 3ULPA 4LF9Q 2DNCA 4B3SL 3VKEA 3TS0A 1TY2A 2CW0C 4KHVA 1CKNA 2CPQA 3UI2A 4DUZQ 4A3GG 1LT3D 3AFQA 1R9TB 4BA1I 4Y7NB 4O42A 4YCVA 5ELCA 3B6YA 1ILPA 2XVSA 2FINB 1MJCA 1H9MA 5C3XA 5FLXc 1A3VA 1HZ9A 1EC6A 1PVOA 1SYEA 4ZRZA 4CGYB 3FKIH 3FPUB 3JC66 2KCMA 2K1BA 2K33A 2VQFL 1PV4A 2EJFC 4RA8A 1GO3E 2CFMA 2EOTA 4APVA 3K58A 1IBML 5C4HA 1W2BA 1QG7A 2EY5A 4QMGA 4YY3L 3HOWG 1UUPA 4KHZA 1KC8C 1X4NA 2BDNA 4ZKCB 1HHVA 5IIFA 2FJ2A 1VS0A 1JOKA 4AYBB 5A2QL 3VR2A 2EQSA 2FMRA 4JI5Q 2YQRA 1A3TA 3STBC 1B4OA 2VB3X 2ZJQA 3J81i 3SVMA 1AE3A 2Y0SE 1GOZA 3S2HH 4A3JB 3D4RA 5GROA 5IYBG 4PQXA 4EQOA 3E9HA 3CF5A 1N33Q 2B2YC 3M4OH 1CM9A 2A68C 4LF9L 3HFZB 1X54A 4BS9A 2MO1A 3A54A 2QGQA 3E6ZX 3H91A 4ILWA 5EJWA 1G2SA 4NXNL 4FXKC 1TWHH 3JAMi 4LF6Q 2HH2A 1DM0B 1IXRA 1XNQQ 2QKIC 2OPVA 3P20A 3GTKB 1WOCA 1RTNA 3I91A 3I4LA 2I5MX 4DV4Q 1QUQB 5FKAC 1GHJA 3H0GG 1GD7A 1I4XA 5FLMG 2AQ2B 2VQEQ 3NENA 3X3MA 2WAQG 1QWYA 1BCPF 3S1NB 4OIJA 1YBYA 1B3AA 1LYLA 3CPFA 1GJXA 1L1OC 1CZGA 1G6PA 4DAYB 1EEID 5M3MH 1FL0A 1X6OA 1WTQA 3GTQB 4X3SA 3W2DA 1VQJA 1IYUA 2IW3A 2R7ZB 1P16A 4H02A 4NBQA 3V96A 4WFN3 4TRDA 3A5ZB 3GQBA 1SE2A 1LTID 3MA2B 3AMUA 4OXPA 2X6GA 4LFCQ 1N33L 3PO2G 2XWJB 2SNMA 2HH3A 2SEBD 1VQBA 5C4JB 1NTGA 2ASBA 5CGKA 3JAMc 3TDQA 4RCNA 1DGSA 3HOZG 2DGYA 3SE0A 3MVVA 1FGBD 3A55A 4JVYA 3D4WA 1VQHA 5CC4A 3QO2A 4LF6L 3TS2A 5CV8A 1D2BA 4ME5A 4QUCA 1K8OA 2PMZE 5IT9L 3S24A 3DMUA 3TZUA 2SNSA 3H3VH 1F9SA 3I90A 4X6AH 3OYYA 4M1UB 5C44G 2UU9Q 2KCNA 4KD3A 1F9QA 4G7OC 2D2CC 1X65A 2VQEL 3DEOA 3CCQA 2L4NA 3MC0B 2HDMA 5T1GA 2A1AA 5I4DA 1PZKD 4FO2A 2JA8G 4DPGA 4A3DB 3UE0A 3HOYG 5JEAG 3PMFA 1GM5A 1V1PA 2L9HA 2A73B 2R3ZA 4X66L 4R1JA 2P2RA 4JI1Q 4UY8C 1E22A 4CKCA 4PMCA 3MAQA 4PZ6A 4POFA 3GV6A 4JK1C 1NBWA 1EU4A 1BVSA 4CBVA 4A3FG 4H13C 1Y1VB 3HP3A 1F9PA 3MXNB 4UPAA 4LFCL 1JQYD 3I4MG 5I2YA 4C3JB 3AFPA 4GLAC 4QY7A 1EFWA 1HTLD 2WACA 4AM3A 3L2PA 1SYFA 1TWCH 1XXGA 4NKLA 1KABA 1PH1A 2XWBB 2ZTEA 1K8MA 1JMCA 4GZYC 1G91A 3VR6A 3KDFB 4LF7L 5ELNA 4L5SA 4A93H 4JV5Q 3F8TA 4JBJA 3HS0C 1SYDA 3HKZB 1M4VA 4MTNA 2KCTA 4LK1C 1E2ZA 1ENCA 3H09A 4O1NA 1I50H 1U0LA 4ME3A 2E2IB 1IKMA 1KHIA 1EYGA 2OXPA 1L1OB 1CQFA 1LT5D 4XQQA 4B3ML 2E2HB 3I3CA 4P75A 4A4IA 4AYBG 1PYSB 4KMUC 3FKIB 2QCPX 1PYBA 4JI1L 4A3IG 2CTFA 1VQNA 1IZ6A 1Z9FA 1X55A 2CHBD 1JJ2A 1PH9A 4DR7Q 4IUUA 1E7ZA 4YHHQ 3NTHA 1HTPA 1S5DD 3I4NB 2KENA 4TSSA 5KNBA 4A3EH 2KEEA 1EIHA 1I4QA 1BQQT 5C4ZA 4KN4C 4G7HC 1V1OA 1FD7D 1OXTA 5IY0A 1ASYA 1II3A 4Q5VA 3S2HB 3D8GA 1KLUD 4GLXA 3M4OB 2Y0SG 3C1FA 3IFDA 5M9OA 1K0RA 2VNUD 1KRTA 2WP8J 1CTMA 4ODGA 4V0BA 1QZHA 4C3HG 1PFMA 5M5YH 5IGDA 4WALA 3BYTB 1BF4A 1IYVA 3CCVA 1WVNA 1Q82C 1TVXA 2EJGC 1TWHB 3BJUA 4A3CH 2IHEA 2F0IA 4OL7A 3SK8A 2NTSA 1FNUA 3O13A 3S16H 1VIGA 1E1TA 3CCEA 1BBWA 3ONAB 2CQOA 3HOVH 3FPPA 1X9NA 4HJAA 1MI2A 4DK3C 4NB3A 2NVTB 4JYAQ 2KVMA 3CCLA 2R7ZG 2QEXA 3I56A 2ES2A 5JJIA 1SE8A 2QDBA 2KCCA 3GV3A 2XIWA 3CAMA 1VQ6A 3L3OC 4C1NK 4DR7L 1Q1EA 1TXYA 5M3MB 4XYOA 2JA5H 4I7ZC 4FP5D 3V2TA 2L5TA 2DGRA 1XMQQ 1KHMA 1TS5A 1HR0Q 2A8VA 5ELBA 1Q8IA 2HIXA 5A2QE 1C0AA 1TS2A 3T13A 2NWGA 4K8IA 4RFBA 1XTDA 3KLSX 5C4XH 4DA2A 1WTOA 2M00A 4OWWB 1PH4A 2F0GA 2R61A 1JWMD 1LTTD 1TKWB 4OO1H 4RGOS 3L7ZC 4ULLA 1VQKA 1SYBA 4NPSA 3X3NA 2ZXRA 5FO7B 1M8AA 2K03A 3S17H 2B2TA 1K3RA 1UWVA 3AEVA 2JA7G 3HRZC 4I65A 1I3QH 1HNZQ 1QILA 1JOOA 4DV0Q 2CTEA 2CVRA 1TR5A 1CHQD 2VB2X 3S15H 2F0WA 1DXMA 1Y1VG 4QJFA 5CV5A 3KFUA 1HA5A 2RDHA 3EN2A 3DXJC 5EBDA 4C3JG 1QJOA 4RAUC 1CSPA 4KHPQ 4QUFA 1HNWQ 3K80C 4PV1C 4RG1A 3RD4A 1XMQL 1OXSC 3K59A 1CK1A 1WTXA 3C3LA 1LV9A 2XRQD 1GKHA 1EOVA 1VQ4A 2NVQH 1WTPA 2E5LQ 1O80A 4R4QA 3NSWA 5IGEA 1K83H 4DN4M 3A8KE 4OX9Q 1JORA 1PDQA 3KDFA 5AJ3Q 3TQYA 4Y7NH 3OW2A 3HOXH 3WOFA 3OPOA 3MZ5A 4P2CB 2EE1A 3J81L 5EQ0A 4C56C 1EYCA 1DOLA 3OWEB 4KKUA 4WANA 1UEBA 2PYKA 3DEPA 2B2WC 4JI7Q 5J1ZA 2JEBI 2NN6H 3BZDB 4A3BH 2RHSB 3M85A 1HNZL 2CTKA 1VQGA