5K36G

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
236
structure length
232
Chain Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAGVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 45
structure length 232
sequence length 236
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5k36G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5k36G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5k36G03
4DV1L 2D5DA 4FDBA 1LACA 1X54A 3RZDH 1FJGQ 1QZGA 2K32A 1CUKA 4QL5A 1L0WA 2Q2HA 1K9MC 3VA7A 4JI0Q 1I5FA 1XNQL 4KLKA 5M3MH 4GKJQ 1YBYA 5IYDH 3MXNB 2FMRA 1U5KA 1A6XA 1X3GA 3M4PA 4OWWB 1O78A 3IKJA 1KXLA 2NN6I 1KQSA 1YHQA 2UXDQ 2DUDA 5IYCH 4ME3A 4GN3B 4JI5L 3CMAA 3OW7A 3I2ZA 5GROA 3WWVA 4JYAL 2WB1G 3S1QH 2GVAA 4UPAA 4LF8L 2AWOA 4GLVB 2CQOA 3I55A 4DUZQ 1PH9A 2UUBQ 1N33L 1YNXA 5M3MG 5FLMH 1HNZQ 3EQLC 4DV0L 1PH2A 1Q1EA 1HZ9A 1VQOA 2BA1A 1KL9A 1D7QA 4IQZA 2MO0A 2VZAA 4X66L 5IP7H 3CCJA 3PO2G 4JI1Q 4HIMA 2DGRA 1TWCH 5IWAL 3ND8A 4NXMQ 3ULPA 4OO1H 2VQEL 3F2DA 1EOVA 1WI5A 1KHIA 3G71A 2JA7H 2KHIA 2CTEA 3FP9A 1OXSC 3CCMA 4IFDJ 3TQYA 1PH6A 2LMCB 4BBSG 2AXYA 5JEAH 2A19A 3NEMA 3PIPA 4LF6L 3VKEA 2PY9A 4LFBQ 5C4JH 3VR3A 1L1OB 1G51A 3QJYA 4DV3L 1IBMQ 4LF7Q 4GKKQ 4A3JH 3A8JE 4X65L 2ZTDA 4DV0Q 4NXNL 4A3KH 2EJFC 4DV6Q 3B6YA 5FJ8G 4LF8Q 2HIXA 4DNTB 4DR3L 3J7ZC 4HJ9A 5GADC 1N34L 1ZZKA 4HJ8A 4LF4Q 2JVZA 3TRZA 2D0PA 3RZOH 4GOPC 2PQUA 3KLRA 1VQPA 4IFDH 1A8VA 4A3GG 3CXCA 4EQ5A 4X66Q 1EFWA 4LF5Q 1QVCA 4OWXB 2CW0C 1K0RA 3AYHB 3D0FA 3J80i 5IYBH 1Z9FA 3DLLA 2OWOA 1X4NA 4A3IG 1YVCA 5C0XI 2IHFA 4L5SA 2OPUA 1V1QA 2QEXA 2WB1E 3HOXH 4DR4L 2VL6A 3SE0A 4JOIC 4MNOA 2Y0SG 1B8AA 2JEBI 4LFAL 3I4OA 1ZZIA 4A3EH 4NXNQ 4KKUA 2CWAA 3K81C 4QIWE 2CTKA 3IRBA 2N49A 4HIDA 1VIGA 4NBQA 3OOCA 2B8GA 4JG2A 1K1GA 1YEZA 4UP9A 1AE3A 1FL0A 3LGJA 3RLOA 1Y69U 1AH9A 3CCVA 1Q12A 4DR1Q 3CCQA 4TKOB 1EIFA 4XTCS 2MFIA 1PMRA 4GOPA 1FJGL 3UE0A 1OXUA 1VQAA 2A69C 4G7HC 4PZ6A 4JV5L 2AUKA 2UXCL 4DR4Q 4WALA 2EXDA 4A3DH 1I3QH 3ULLA 4DNRB 2JXMB 4XIGS 1GO3E 4MZ9A 4JI5Q 4A3LH 1EQRA 1O7IA 1Y14B 1DD2A 4P72A 2O5IC 3UDFA 2DN8A 1QJOA 3NE5B 4KHZA 4DR5L 1Q82C 4KI0A 4A3MH 1K8OA 5J3BA 1I94L 2B63H 1JT8A 2CPQA 1VQCA 1H9RA 1Y1VG 1T9HA 2JQOA 3SGIA 1XNRL 1X6OA 4JOIA 2R7FA 1HR0L 4OO1I 2B8FA 4AH6A 4O0AA 1VS0A 2V1CC 4LNQA 4GNXA 2JA8G 1Z7TA 3JAMi 4BXXG 1BVSA 2Y0SE 1VQHA 5BR8Q 1CSQA 5KNBA 2E74C 5C44H 1GD7A 1WFQA 5KNDA 4B3TQ 2H5XA 4YWKA 4QY7A 4JI1L 5GAEC 4K0KL 2I5HA 5ELOA 5C0XJ 1JMCA 4PMWA 3ER0A 2I0QA 4KN4C 3GTQH 3I4MH 1VQDA 1XMOQ 3E9IA 3D4RA 4OX9Q 2JA6H 4B8TA 1NMGA 1EYGA 2OCEA 4R4CA 4OGQC 3T51B 3S2DH 1QZHA 4DK0A 1GUTA 3M9BA 5IY0A 4DV4L 1RL2A 2EVBA 1RIPA 3AQQA 3T53B 2OQKA 4X65Q 3A5UA 4A76A 3RNUA 2ATWA 3S24A 1U0LA 4IJLA 1Y1WG 4LFCL 3J80c 3CRKC 4P73A 4LUOA 2HIVA 4GLXA 2K50A 1IYUA 1N36L 2GVBA 4B3RQ 4GNXC 3A7AB 1EWIA 4YHHL 3PUWA 2RHSB 2ZTCA 3K8AA 3MXUA 1HR0Q 1YIJA 1VQ5A 1Q1BA 1N32L 5BN5A 1Y8NB 1J5KA 1VQFA 1Y8PB 4I7ZC 5GQOA 2QF7A 3I4NG 1CKMA 4IPCA 5K36H 2QNDA 2V4DA 2A68D 4OXPA 3L0OA 3UDIA 1EUJA 1TWHH 1M1KC 1WCMG 3BDOA 2E2IH 4APVA 4JC0A 3CC7A 3S14H 3QG1A 2ID0A 1EQQA 1WJJA 2OTJA 1LUZA 3DM3A 3LWUA 4YCWA 4A3LG 1IZ6A 3PF5A 4R4IA 2A1AA 1A0IA 3EBEA 4HJ5A 3KF8B 4DAYB 1VQNA 4WANA 4BY1G 2NN6H 2AHOB 2R92H 2UUBL 1ASYA 4DK1A 3U4VA 1Y8OB 3KF6A 1HQMC 4DUZL 5BN4A 3CPFA 1SMXA 3OYYA 2HT1A 4IPGA 1DT4A 3HOVG 2VUMG 4AYBE 3HGBA 1UE6A 3KJOA 1IBLL 1X56A 3I7FA 2JEAI 1PYSB 3T56B 2MO1A 3U4ZA 4HJAA 1QVFA 2YV5A 4NXML 1CTMA 2B3GA 1X3FA 4OWTB 4RCNA 2UXBL 1S3OA 2YTVA 3M4QA 2IX1A 4LUZA 4A93H 4G7OC 1TXYA 2F52A 3U9SA 1X55A 2ALYB 2K14A 1SMYC 4G7ZC 2ZJQA 4Y7NH 2E2JH 5BN3A 1YITA 3CRLC 2E8GA 3CAMA 4DV2L 4A3JG 4LW1A 1GUOA 2CWPA 1XPOA 2KCTA 5IYDG 3QIAA 1GJXA 3IFTA 2ZTEA 3PUXA 4L5TA 4GKKL 2KCMA 2E3UA 1VQBA 1PYBA 1Z6HA 3A8IE 1Y1WH 3BJUA 3BZKA 2NVTH 3A7LA 4DV6L 1YNNC 1HR0W 2CTLA 5M5XH 1H9SB 4P75A 3CPWA 4LIJA 2ZJRA 1X3EA 1VDZA 4YY3Q 4JBKA 3PO3H 2CTJA 4POGA 2Q2TA 1VCIA 4JI6Q 3U1KA 3S15H 3V69A 1PV4A 3J7A5 4OO1G 4DV1Q 4A75A 3STBC 1QUQB 1YJ9A 3M3YH 5H1SE 3G4SA 1B9MA 1UEBA 2A8VA 3F2CA 3DXJC 3HKSA 3HOZG 2VY3A 4IPHA 1NY4A 4DV4Q 5JEAG 1AE2A 5AJ3Q 1BBUA 1E3PA 4X62Q 2IX0A 2PMZE 1GUSA 2K7VA 3OPOA 3CD6A 3ULJA 2VQFL 2ZM6Q 5KNCA 3E9HA 4A3FH 2UU9Q 4JI0L 3M4YA 2JA7G 1XMOL 1K8MA 1B7YB 3M85A 5IT9c 2MJHA 2PI2A 5M5YH 2BA0A 2UXDL 4BA1I 4C3HH 1YJNA 2VNUD 2E5LL 3PV0A 1VF7A 4A3MG 2IY5B 2Q8IB 5IP7G 3GTJH 1X9NA 1Q81C 3PO2H 3CW2C 1EIYB 2R7ZH 1SLJA 4A3FG 4RMFA 1IYVA 1HNXL 4H44C 2AMCB 3KYHC 1GUNA 1OXVA 2WP8J 4A3DG 1YNJC 1L1OA 1XNQQ 4DV5Q 1CKOA 2ANNA 2K52A 3PUZA 2JA8H 1SROA 2L5TA 3PUYA 3GTGH 1Q7YC 3H94A 4GLAC 1GUGA 1HTPA 1HZCA 1MIUA 2CFMA 3KDFA 4KKTA 4DUYQ 4DNIA 5IP9G 3FHWA 1ONLA 2AUJD 3NELA 3S1RH 4JBMA 4JI3Q 1YZ6A 3M4OH 3GTPH 4EX5A 1DTJA 2XGTA 1B70B 2KBNA 4L5RC 2Q2UA 1Q46A 2NVYH 1T5EA 1FR3A 3F1ZA 2YU9H 4Y52H 1VQ6A 1KRSA 3S17H 1GKHA 1PFSA 4JI7L 1IL2A 1A63A 4H0LC 2HH2A 3OTOQ 4DR2Q 2LXJA 4B3MQ 4BXXH 4RG1A 1BKBA 1XPUA 1XNRQ 3T1YQ 4IJHA 4UY8C 4DV7L 2F4VL 3HOXG 3N6RA 3U58A 3K7AH 2ES2A 1D8LA 4IPDA 1VQMA 1Z47A 4KHPL 3S16H 5GAGC 1XJVA 5IYCG 2PNRC 4DR7Q 1L1OC 2K75A 3M7NA 4PG3A 2K5NA 2R93H 2RF4A 2XTIA 4O2DA 2RCNA 1E24A 3FKIG 1CSPA 5FLMG 1E2VA 4JI3L 4DV3Q 5LMNW 4LF7L 3H0GH 2HHHQ 2NVQH 3HOUH 3HOZH 3T1HQ 1VF5C 1YHAA 1PH4A 2NZHA 2D62A 5K36G 4PV1C 3GTKH 4HIOA 3RLNA 2AWNA 3D31A 1LM0A 1HCZA 4BBRG 4LF4L 1GHJA 2I5MX 4DKAC 2BH2A 5C0XG 4NB3A 1N8RC 3VR5A 4GS3A 5GAHC 1QVGA 2BDOA 1NTGA 4JYAQ 3H0GG 2WAQG 3GDEA 3W5OA 3CCUA 5C4XG 3RN2A 1HH2P 4OX9L 5FLXc 4H13C 4JBJA 4AQYQ 1G291 1IBKQ 4BBSH 1NJIC 1XPRA 1G6PA 3F8TA 4GKJL 3A8KE 1H9SA 3HFZB 3S2HH 5C0XH 1VQEA 5A35A 1CKNA 2N78A 4X6AH 4YCVA 4UP7A 1R9TH 2CTFA 3T1HL 4A3KG 1CFMA 3PCOB 3RR5A 4C3JH 2NN6G 3I73A 4POFA 3STBD 1OXXK 3I4LA 4JCVE 2OPVA 1P16A 2K5VA 1HNWQ 1GHKA 1DGSA 1LTLA 1ZTGA 1YI2A 2F3IA 4A93G 2AKWB 1E2ZA 3GQBA 2YYZA 1N33Q 4JV5Q 2NVXH 3HOVH 2RHQB 4LWCA 3PF4A 3TS2A 1W2BA 1K8AC 1PVOA 4X64Q 1PH3A 3CCEA 3K80C 3F2BA 2VQFQ 5C44G 2L15A 4QGUA 4DR1L 2UU9L 5ELNA 2UUAQ 1BDOA 3J81i 3ICEA 1CI3M 2EJGC 2JZXA 2K33A 1O7LA 1JE5A 1K83H 1W3SA 1FVIA 1VQ4A 1HNXQ 2UXCQ 5M3FH 4L5QA 2MNAA 1C9OA 5DLQE 4B3TL 2ASBA 1ZZJA 2JA6G 1S72A 3KF6B 2Z0SA 4NPSA 5C3EH 4JI4L 2BE5D 2R7DA 5JJIA 1P8LA 1OTCA 4WJ3M 5JEAJ 2EDGA 2N3SA 3HOYH 3K0XA 3TREA 4GZYC 4X64L 3I4NH 5JJLA 1KAWA 2OQ0A 5HY6A 3CF5A 4GN4B 2YTYA 5M3FG 3VDYA 2QGQA 4JVHA 4DR2L 1SFOH 3GD7A 4GOPB 1OXTA 3TEHB 4LF5L 1VQGA 3NENA 1HNWL 2YQRA 1Q90A 1IYJB 4JI8Q 3KLWA 5BR8L 4LFCQ 4IOAA 3KOJA 3MEFA 3PIOA 4KHPQ 4DUYL 4R4OA 2B63G 1VQ8A 1BBWA 3I56A 4JI6L 1VIHA 4PZ7A 2ANRA 2D0OA 4YWLA 4LK1C 4JVYA 4A3CH 1Q86C 3CC2A 2A6ED 1H9KA 3MFYA 4TQUS 4B3ML 2EQSA 2JJQA 4JI7Q 2A6HD 1CKNB 3CCSA 1J6QA 1FYCA 2E75C 3ND9A 1JJCB 4JBWA 2WAQE 5E7NA 5M5WH 4GNXB 3RN5A 4LFAQ 4BY1H 4A4IA 4DR7L 1WOCA 2R92G 1VQ9A 2JA5H 1V8QA 3PGZA 4DK6C 4ALPA 4KKSA 2VS1A 1TKWB 1IW7C 2K4KA 4LF9L 4C2MH 4YY3L 2JA9A 2A68C 1ASZA 4B3SL 4LJZC 2LXKA 2Q2IA 1I6VC 5HGQA 2A69D 4DAMA 2KHJA 1A62A 3CP0A 1K8GA 3BZCA 3HOWH 1I50H 5AJ3L 2K5HA 4LFBL 4P74A 1ZKOA 2JE6I 3G48A 1EWHA 5FJ8H 1V43A 1PH8A 3HOUG 4DR6Q 1MJEA 1J4WA 3ERSX 3UDGA 3S1MH 1H95A 1K3RA 1FGUA 1DCZA 1IXRA 1Q8KA 2PNHA 1L2FA 2R6GA 2DGYA 3A0JA 3BG3A 4JK1C 2WFWA 3W1BA 4DR3Q 4A3GH 5C3EG 2QA4A 3A5ZB 3FMCA 1PH7A 1N32Q 3UDXA 2Z6KC 5LMNQ 1KIXA 1TU2B 3L2PA 4B3SQ 5JJKA 4JI2Q 3H3VH 4BA2I 4KMUC 3PSIA 4C3IH 4LF9Q 3PUVA 3H3VI 3L7ZC 2UXBQ 2CKZB 3WDNA 1SR3A 2PI2E 1XTDA 4MTNA 1IBLQ 3K7UC 3I72A 2DNEA 5LMUL 2B29A 4IO9A 1PA6A 4A3BH 3TS0A 4DV2Q 1YHBA 4R4TA 4AYBG 4IOCA 1N34Q 2F1MA 1Y1VH 1VQKA 3PO3G 2R7ZG 3EIVA 3NBHB 3CC4A 3H15A 2UUAL 2R93G 1EC6A 4LUVA 3VR6A 3FKIH 3T1YL 1GVPA 1VQIA 2I5LX 4GN5A 5LMNL 2ZT9C 2P2RA 2LSSA 2GN5A 2A6EC 3HKZE 4A3BG 3GTOH 1I6HH 4JI4Q 2PPBC 1C0AA 2A6HC 2D2CC 2PQAB 1E7ZA 1HNZL 3S1NH 4BBRH 1B9NA 3FPPA 1E2WA 1SE8A 2Z6KA 3CCRA 5LMUQ 4IFDG 1M90C 3I4MG 3ZJYC 3J81j 1NBWA 2EJMA 3CMEA 4DV7Q 3G6EA 1MJCA 4R4QA 1IW7D 2KA7A 5IWAQ 1KD1C 4H02A 2JA5G 4YHHQ 4JI2L 4KN7C 1E22A 3U50C 3Q8DA 1UWVA 2DNCA 3LNNA 1X65A 1N36Q 3UE1A 4QMFB 1KC8C 1X4MA 1E1OA 1V9PA 1VQJA 4B3RL 2IT1A 2BE5C 4TVAB 3KJPA 3W3AA 1I94Q 2HHHL 4L8JA 3HOWG 4BY7H 2UUCL 2FXQA 1E1TA 3AFQA 2ZJPA 4DPGA 4LF6Q 1HPCA 1NMFA 2CTMA 1XMQQ 5IYBG 1J5EL 4R1JA 3KFUA 2N8NA 3J81c 4A3IH 2MQHA 3SDZA 3AB9A 2VQEQ 1HJPA 1WVNA 1HZAA 1HZBA 2JK8A 1SRUA 4PZ8A 1KRTA 3BU2A 3E0EA 1NE3A 2BH8A 1IBML 1LYLA 1UE5A 1WCMH 4AIMA 4DV5L 4A3EG 3VR2A 1JJ2A 2HQLA 3EN2A 4AQYL 1ZYRC 4DR5Q 4J15A 4P71A 2PCFB 1QUQA 5EAYA 1IBKL 4UP8A 3HOYG 3VR4A 1YJWA 3JAMc 3W1GA 4AM3A 1UE1A 1SN8A 4DR6L 2F4VQ 2IHEA 2O5JC 4WJ4A 1WE8A 1VQLA 2KCCA 5IE8A 3OTOL 1VQ7A 1TWGH 2OTLA 1TUAA 4YWMA 1K73C 1H9JA 4HR7B 1WYDA 4K0KQ 3GO5A 1PH5A 1XMQL 2YTXA 3P20A 1GM5A 3OW2A 2UUCQ 2PQAA 3CQZH 1S40A 1MKHA 2KENA 4A3CG 1J5EQ 3AEVB 1TWFH 4OONA 3TZUA 3AEVA 1TWAH 1UE7A 3AFPA 4HJ7A 4IFDI 1JB7A 4QJFA 3RLFA 1C7YA 3CCLA 2VUMH 1PHJA 2E2HH 2E76C 3HKZG 5C4XH 2VW9A 2ZM6L 1KHMA 3KDFB 1N9WA 3A74A 5IP9H 4X62L 4QQBX 2EIFA 1H9MA 4YCUA 1JJGA 3GTMH 2NZOA 1DXMA 4JI8L 4BY7G 1LABA 2C35B 4DK3C 4HIKA 2CCZA 3GTLH 3JC66 2E5LQ 2BL5A 2HH3A 1PH1A
chains in the Genus database with same CATH superfamily
3PMFA 3RZDH 4A3GB 2KVMA 4JI0Q 1K9MC 5CORA 1I5FA 2FMRA 3MXNB 5I2XA 1O78A 2SNSA 2EYFA 4K8JA 1YHQA 4JI5L 3OW7A 5GROA 3WWVA 4LF9H 2Z6BA 1AFPA 4JV5L 3I55A 1TS2A 3K6OA 5FLMH 1HNZQ 3D4WA 1VMCA 2MO0A 2VZAA 3CCJA 4JI1Q 2DGRA 4NXMQ 3ULPA 5JAVA 1WI5A 4RKBA 1KHIA 2EE1A 2Z8LA 2KHIA 2WV6D 4A3BB 3CCMA 3UOEA 1PH6A 4BBSG 5JEAH 4LF6L 3NEMA 1EY5A 1SEBD 4WRDA 4LFBQ 2PY9A 2MHVA 5HGTA 1DOLA 2EZVA 1L1OB 4GKKQ 4A3JH 2CTJA 3B6YA 5FJ8G 4DR3L 4HJ9A 3M3YB 3KLSA 4HJ8A 2JVZA 3BZDB 2F0NA 3KLRA 4ODGA 4IFDH 3BDCA 4A3GG 3MEHA 4LF5Q 2N88A 1QVCA 1I4RA 2CW0C 5IYBH 1X4NA 2PZWA 4DR6H 1YVCA 3S15B 4DU9A 4CJ0B 1ILPA 4OELB 2VL6A 4HSVA 1B8AA 3I4OA 1ZZIA 3N52A 2CWAA 3IRBA 1VIGA 1XWEA 2L12A 3Q23A 2NYZD 1TWCB 4N8X1 1I50B 1Q12A 4V0BA 3SB1A 3V05A 4FF3A 4XTCS 4WALA 1STHA 5CV4A 4DNRB 3C46A 1O7IA 5ELCA 3UDFA 2O5IC 1QJOA 3HOUG 1Q82C 1I94L 4KI0A 4A3MH 1K8OA 1NCVA 1VQCA 1T9HA 4IALA 2JQOA 1X6OA 2B8FA 5EPKA 2E2IB 1HNZH 5M3FB 5KNBA 2E74C 3HOXB 2H5XA 3HEJA 4YWKA 5GAEC 3HOVB 2NVXB 1EOTA 5CV5A 1WVLA 1JMCA 4PMWA 2I0QA 1S5DD 3D4RA 4OX9Q 1I6HB 4B8TA 1K3BC 2F0SA 2CWFA 2OCEA 4R4CA 3M9BA 5IY0A 2EVBA 3OETA 1CK1A 2H4OA 2RKSA 4RGOS 3NWTA 2KEDA 4LUOA 2NTTA 1N36L 1N32H 1FKAH 1STYA 4YHHL 2MUYA 1YIJA 3K59A 1Y8PB 4I7ZC 5GQOA 3I4NG 1ICWA 3UDIA 4PMBA 1EUJA 2NZ1D 4APVA 4JC0A 3CC7A 1Y1WB 3NQTA 3QG1A 1SNDA 1WJJA 2OTJA 2EYLA 1LUZA 3LWUA 4JI6H 4WANA 4RGNA 1PLFA 3NTKA 5M5XB 2RDHA 2NN6H 3T13A 5FOBB 1ASYA 5BN4A 2HT1A 1SMXA 2CH4W 4IPGA 2ZQEA 1UE6A 2OEOA 3NTIA 2MO1A 3T56B 4QB4A 1MGSA 1CTMA 1DM0B 1S3OA 4A93H 2F52A 3U9SA 1PTOD 1AP0A 4Y7NH 1YITA 2E8GA 5BR8H 4A3JG 4LW1A 1GUOA 4LF5H 4C3IG 5IYDG 2HQEA 2ZTEA 1RF2D 1SDFA 2NVTH 3A7LA 5IGBA 1S5BD 4LIJA 2ZJRA 3PO3H 4POGA 1GUWA 4JI6Q 2F0TA 5DT9A 2B2TC 4A75A 3M3YH 4X3KA 3S1QB 2YU9B 3DXJC 3HOZG 2K04A 1BOSA 2Q2TA 1STBA 1AE2A 2IX0A 1GUSA 2K7VA 1WTHA 3FKIB 3ULJA 4A3FH 1K8MA 3R8BA 3E0JA 2WKCA 4JW0A 2BA0A 2KHSA 3H3VC 4A3MG 3A56A 2Q8IB 1Q81C 1LV9A 1F9SA 1I4GA 2X69A 2LFNA 1L1OA 3NPPA 4DUZH 3NSWA 3GTGH 2FINB 1Q7YC 4XT1B 4GLAC 4DUYQ 4JYAH 4DAPA 4JI3Q 1YZ6A 2XGTA 1B70B 2KBNA 4IN3A 4L5RC 1EFID 1JORA 2NVYH 4YIJA 1V9NA 1KLUD 2PZUA 1VQ6A 1WTWA 3S17H 1YNJD 3OTOQ 4RHRA 1XPUA 1TY0A 5IT9E 2F0PA 2ES2A 4IPDA 4IUQA 1Z47A 2B2YA 1XJVA 4DR7Q 4OL7A 2F3WA 1L1OC 2K75A 3MXPA 3NBIA 5J39A 3M7NA 2RF4A 4KJNA 2XWJB 4BXXG 1F2MA 1E2VA 3SHLA 2HHHQ 4HAEA 3HOZH 1VF5C 1YHAA 3UI2A 2NZHA 3K58A 5KEEA 4HIOA 4BBRG 4DKAC 2BH2A 1HFNA 1XMQH 2K28A 5GAHC 1TS4A 3DWQA 2C5CA 5KIXA 3GDEA 3W5OA 5FO9B 1HH2P 4JBJA 1G6PA 1NJIC 4GKJL 3A8KE 2B2YC 2EYPA 1V1PB 4LAAA 5A35A 1CKNA 1R9TH 2CTFA 3T1HL 2RCFA 3AU7A 3RR5A 4POFA 3MZ5A 4XT3B 1AEXA 1P16A 4JI4H 1CZGA 1U4PA 1YI2A 1N33Q 2YYZA 3TS2A 1W2BA 1K8AC 4X64Q 3CCEA 2UU9L 5F2DA 2CTEA 3J81i 2JZXA 3VYUA 1TY2A 1K83H 4CBVA 1HNXQ 1SYDA 2I07B 2K1BA 4X3UA 1PFMA 1ZZJA 4BY1B 2Z0SA 5J1ZA 4JI2H 3NP8A 4KK7A 4B3TH 2N3SA 3FAUA 3CF5A 1XYIA 2K5DA 4GN4B 2YTYA 4NDXA 3KK7A 1SFOH 3GD7A 1OXTA 1D5ZC 4L63B 3PQIA 4JI8Q 5BR8L 2DJFC 4LFCQ 4IOAA 1LTTD 1Y1VB 3PIOA 3E5SA 3EVQA 3QWNA 1VQ8A 3I56A 4LF4H 1SYCA 1H9KA 2EQSA 4JI7Q 3M7GA 1CKNB 2WAQE 1WTPA 3LWEA 2R92G 1VQ9A 2JA5H 1V8QA 4YY3L 2JA9A 1S5FD 4B3SL 1I6VC 1WTRA 2B39A 1A62A 1U9RA 2NB0A 1EU4A 2FHTA 5AJ3L 2K5HA 4P74A 3J7AV 2F0FA 1TQOA 1JC7A 3S1MH 1H95A 3D4DA 1K3RA 1FGUA 1RTOA 1JR0D 3DEPA 1L2FA 2R6GA 2F0KA 2R7ZB 2WFWA 4A3GH 1N32Q 2QA4A 4EVOA 3L2PA 4EGVA 1BCPF 1F9PA 3WDNA 4MTNA 1IBLQ 4XXEA 5LMUL 1FNVA 2F1MA 1ENAA 3EIVA 4DR5H 5D65A 1VQIA 2I5LX 3Q0AA 2ZT9C 2IJ0A 4EQNA 1I6HH 3H09A 2F3VA 2A6HC 2PQAB 4CHTB 1E7ZA 2Y3MA 1B9NA 4CDCC 2F0HA 3CCRA 5CV8A 3ZJYC 1AN8A 1NBWA 4DXFA 3I91A 1XNRH 2JA5G 5IWAQ 4B3MH 2D9UA 4KN7C 5IGDA 3Q8DA 5L37A 4QMFB 1CM9A 1X65A 2BDNA 3LNNA 3UE1A 4AQYH 1EZ6A 4BY7H 2UUCL 3TP8A 2ZJPA 5EGTA 1HPCA 4Q5VA 2B2UA 1XMQQ 2EXZA 4R1JA 1SYBA 1FJGH 2O2LD 2MJ8A 4A3DB 1PFNA 3V96A 1HZAA 2JK8A 1KRTA 2XRQD 3E0EA 1NE3A 3GR5A 5D14A 1LYLA 1WCMH 4AIMA 2FJ2A 1JJ2A 3VR2A 2HQLA 3EN2A 4UAIA 4DR5Q 4E9JA 5FK9C 2QDLA 3VR4A 3RZDB 1YJWA 2FFKB 3W1GA 2JN4A 1SN8A 3BDLA 3AMUA 2F4VQ 2K03A 3C3LA 2KCCA 1VQ7A 1K73C 3GO5A 2F0GA 1XMQL 3P20A 2KCNA 2PQAA 3CQZH 1MKHA 1S40A 1J5EQ 1B1ZA 1TWFH 3P7JA 4OONA 3TZUA 4RHSA 3AFPA 2G9DA 3CU7A 1JB7A 4P2CB 3CCLA 2HD3A 1PHJA 1PRTF 5EJWA 1KHMA 3R2IA 1UUPA 4ZRZA 1HHVA 2M9VA 4JI8L 4BY7G 2CCZA 4A3IB 2TSSA 2ICIA 4DV1L 5FO8B 1L0WA 2Q2HA 1VBIA 4KLKA 4DV1H 1QNKA 3M4PA 3IKJA 3VYSA 1KXLA 2NN6I 1ZYRD 1XTCD 2DUDA 4ME3A 3I2ZA 4K6DA 1EEFD 2WB1G 3S1QH 4LF8L 1V8CA 2CQOA 5C5MA 1SXTA 1PH9A 2UUBQ 1YNXA 2F0EA 4ZQ3A 5M3MG 1EU3A 1X9ZA 1D7QA 4IQZA 3TDQA 2G8YA 4HIMA 4OO1H 1G91A 2VQEL 4OHJA 4F87A 4IFDJ 5A2QL 1C4QA 2LMCB 2AXYA 2EY2A 3VKEA 1LTSD 5C4JH 1G51A 1J9OA 4B9XA 5FLXL 3Q24A 3J80W 2ZTDA 2EJFC 4DV6Q 4BS9A 4C3JG 4DNTB 4LF8Q 1KDAA 2M00A 5C44B 2D0PA 4C2MB 4A3MB 1EFWA 3EJIA 1K0RA 3AYHB 4OWXB 3D0FA 1Z9FA 4L5SA 5EBDA 3W2DA 3MXNA 2O4CA 2QEXA 4C1NK 4JOIC 3CKIB 4LFAL 4A3EH 3HOZB 4CGYB 2CTKA 3JAMW 4NMZA 1I4QA 3OOCA 2B8GA 1STNA 1IBLH 5C6AA 1U4MA 1QOHA 2WIIB 1I4PA 1PMRA 1FJGL 3UE0A 1VQAA 2A69C 4G7HC 1CA6A 3S1MB 4DR4Q 2EXDA 4C1NI 4A3DH 1I3QH 1WTOA 5JPNC 4MZ9A 4P72A 2H1EA 4CJ2C 2B63B 2CPQA 5CC4A 4DR3H 1H9RA 1AW7A 3MWYW 1A3VA 4JOIA 1HR0L 5COYA 1VS0A 4GNXA 1Z7TA 1ESFA 1BVSA 1VQHA 1HA5A 5BR8Q 5C44H 1WFQA 4B3TQ 1KDCA 4K0KL 5JPMC 2BL5A 5T1IA 3GTQH 3E9IA 2JA6H 4UDUC 1EY9A 2JA6B 1NAPA 4OGQC 3SK5A 3T4AC 1SSOA 2XNAC 2FMCA 4HEDA 3T51B 4DK0A 1QZHA 1B53A 1GUTA 1RL2A 1QG7A 3T53B 2OQKA 4A76A 3A5UA 3RNUA 3S9WA 2EOTA 4IJLA 1QILA 5CGKA 1Y1WG 4GLXA 2HIVA 2K50A 1N33H 1IYUA 2L11A 2PMZB 3A7AB 4KHPH 2F0UA 2ZTCA 3PUWA 5C4ZA 3MXUA 1HR0Q 5A2QE 1Y8NB 1J5KA 1EQVA 1PZJD 2V4DA 2A68D 4A3KB 1TIID 1TWHH 5CYUA 1TWHB 3SK8A 2E2IH 3S14H 2ID0A 2LS01 3DM3A 2F0MA 4YCWA 2A1AA 4K8IA 3D8GA 5TSSA 4DAYB 3WOFA 4KHVA 2L0CA 4JI0H 3BYTB 4DK1A 2XWBB 4CKCA 3KF6A 1HQMC 3MHBA 3OHXC 2VUMG 3HOVG 3KJOA 1X56A 2YV5A 4NXML 1X3FA 2UXBL 5EKKA 4LUZA 1ENCA 2IPKD 1SMYC 3CRLC 3CAMA 3J80L 4DV2L 1HFGA 3I3CA 2KCTA 4DR2H 2F0OA 3QIAA 4GKKL 2KCMA 3EA6A 1VQBA 3J81L 1Z6HA 1Y1WH 2UUCH 3BZKA 1IBKH 2AQ1B 2CTLA 2IW3A 3QOLA 4Q0FA 5M5XH 5C4XB 3FRPB 4JBKA 4H8AA 3U1KA 1VCIA 5J22A 1SE4A 3S15H 4DV5H 3K0YA 1QUQB 1ZEQX 4DV3H 5H1SE 1BNZA 1B9MA 2QCPX 2A8VA 4DV4Q 3H6MA 1NY4A 5JEAG 5AJ3Q 4GKJH 4IUVA 2PMZE 3OPOA 4DXGA 3BYYB 2J7ZA 5KNCA 4JI0L 3NUCA 4F88A 4KY6A 1OO9B 1XMOL 3T1YH 2VQEH 4BA1I 1YJNA 2PW7A 3PV0A 2RSOA 3GTJH 2SOBA 1EIYB 4I65A 1SLJA 1Z2IA 4DN4M 1YNJC 5CV7A 1XNQQ 5I6YA 2K52A 1SE2A 1GUGA 2CFMA 2ZXOA 4KKTA 4DNIA 5IP9G 3M4OH 1N36H 3NELA 1KTKA 1DTJA 1AZQA 3F1ZA 1FR3A 2YU9H 2F4VH 2JA5B 1IL2A 1BO0A 2LXJA 4B3MQ 4BXXH 4RG1A 1ET9A 4IJHA 3K7AH 1D8LA 1SYGA 3S16H 2C9OA 2PNRC 4FYDA 4OIKA 1I4HA 3C2PA 2RCNA 3FKIG 1CSPA 4IURA 4JI3L 4F7XA 5K5PA 2D62A 5IT9W 5K36G 1EY8A 3RLNA 2AWNA 3D31A 4JI7H 1GHJA 1B50A 4NB3A 1N8RC 3VR5A 4GS3A 4BBRB 4QUCA 1CQFA 3H0GG 5C4XG 3RN2A 1ET6A 2F0DA 2NVYB 4DAVA 1XPRA 3F8TA 1D1IA 3HFZB 3V2TA 5C0XH 4HCSA 1QB5D 5ELEA 1HR0H 3RMHA 4C3JH 2PQEA 1JICA 2LTMA 2OPVA 4PDBA 3I0PA 3IAYA 1ZTGA 1KNEA 2AKWB 3GQBA 4JV5Q 2EY6A 2NVXH 3HOVH 2RHQB 4LWCA 3OSSD 4GKKH 1PRTC 1PH3A 3H0GB 2Q8RE 2VQFQ 1HQRD 4DR1L 3E3XA 3ICEA 4RAUC 2UXCQ 2ASBA 1C9OA 5DLQE 1EL0A 1S72A 4NPSA 1NR2A 4JI4L 3VA5A 2BE5D 1LTAD 5JJIA 1OTCA 2UXBH 1S4ZA 4NXMH 2EYHA 3TREA 5JJLA 1X3QA 2OQ0A 3FPUB 2RSNA 4FF2A 1HRJA 1UEAB 3KOJA 1STAA 4DUYL 4B3RH 2B63G 1BBWA 4JI6L 3KDKA 4PZ7A 2UUAH 2D0OA 4LK1C 2SDFA 4A3CH 2A6ED 2ENBA 2JJQA 3CCSA 1J6QA 3ND9A 4FNFA 4C3HB 4LF7H 2F0VA 4DK6C 1BCPB 4LF9L 2K4KA 1PFBA 4C2MH 1ASZA 2A68C 2LXKA 2A69D 1K8GA 1HUNA 1I50H 5IWAH 1I4XA 2AQ2B 1WHRA 4LFBL 1F0XA 1ZKOA 4BY7B 1PH8A 1O7YA 1MJEA 4K6LA 1J4WA 1SNPA 3DMUA 1DCZA 4UY8C 2DGYA 3HKZB 3BG3A 1EIGA 4DR3Q 2PT7G 5C3EG 1PH7A 1G8ZD 4DFAA 2WAQB 3LX0A 5LMNQ 3KLSX 1J8IA 4BA2I 4JI5H 4C3IH 3PUVA 3H3VI 2G5DA 4PMCA 4XYQA 2FMMA 4FXKC 4NZTM 2B29A 2PO4A 1RJTA 4R4TA 4IOCA 1VQKA 4LFBH 3G6JB 3K57A 2UUAL 4IUUA 3TN2A 3SK4A 1SAPA 3VR6A 3FKIH 3DWAA 2GN5A 1ICFB 3Q22A 1SE3A 3HKZE 4A3BG 3OTOH 1C0AA 2PPBC 1HNWH 4NZRM 3S2DB 1HA6A 3FPPA 1E2WA 4N8FA 2Z6KA 2CWHA 5G3LD 1SNMA 4DV7Q 1G6ZA 3GTQB 4R4QA 1A2TA 3QO2A 5AFWA 2VUMB 3U50C 1UWVA 1N36Q 1S5ED 1V9PA 1VQJA 5I6WA 1I94Q 2JP1A 2FXQA 4DPGA 2E2JB 1J5EL 2N8NA 4A3IH 2MQHA 3SDZA 3DUZA 3AB9A 4QF4A 1RCVD 5C4JB 3GP7A 2KEEA 1FNWA 4AQYL 1ZYRC 4QMGA 1PTOF 2XN9C 1X0AA 2I46A 1IBKL 1PDQA 5KRUA 5JVH3 1J5EH 2O5JC 1VQLA 3OTOL 4XDXA 5KYIA 2HDLA 2OTLA 1H9JA 1WYDA 5LMNH 3HRZC 2ZXRA 1PH5A 1F2LA 3OW2A 1A2UA 3E6ZX 1PYWD 4A3CG 2UXDH 3OMCA 4IFDI 5FKAC 5EPLA 3RLFA 2Y0SB 2VW9A 5IP9H 4X62L 4FXDA 2EIFA 1AZPA 3GTMH 1LABA 1KLGD 2C35B 4DK3C 1CZWA 2HH3A 3MFGA 1LTRD 2B2WA 1LACA 2EYOA 1QZGA 1CUKA 3BVGA 1XNQL 4GKJQ 4B9WA 5M3MH 2R61A 4JI3H 2JYOA 1KQSA 4JVZA 4GN3B 4YY3H 2GVAA 2AWOA 1KNAA 1R4QB 2EYJA 3EQLC 4DV0L 1PH2A 1Q1EA 1KL9A 3PO2G 3I8ZA 5IWAL 3ND8A 1EY7A 2B2WC 2E5LH 4MN3A 2F0QA 1PRTB 1EOVA 3DM1A 2JA7H 3G71A 4FF4A 3FP9A 3PO2B 1OXSC 3TMEA 3PIPA 1EZ8A 4ID6A 4ZKCB 5D3DA 3FEWX 3VR3A 1WTJA 3PO3B 1IBMQ 4DV3L 4LF7Q 1TT2A 1R9TB 1Q8IA 1BCPD 4NXNL 4A3KH 1EY6A 1JOOA 2L4NA 1B3QA 1MSGA 4XQJA 4LF4Q 3OWFA 3TRZA 4ZKBB 2PQUA 1VQPA 1XMOH 1A8VA 4H7BA 1EYAA 2OWOA 3J80i 3DLLA 4A3IG 3DHQA 1V1QA 5DEHA 4HCEA 2WB1E 4MNOA 2Y0SG 2Z9HA 4QIWE 1JWSD 2N49A 4R8NA 2HDMA 2WKDA 1K1GA 4DV6H 1AE3A 5CBAE 2RBMA 4TSSA 4DR1Q 4FF1A 4TKOB 2MFIA 1SMYD 1OXUA 2UXCL 3SK6A 2JXMB 1GO3E 1DD2A 2M8WA 4OD6A 4DR5L 5E4XA 1VIHA 3A54A 4K14A 1B4OA 4NW2A 5T1GA 1Y1VG 4ZAIA 3SGIA 5EBCA 4X66H 3L3OC 4AH6A 1K83B 3L9AX 3S1RB 4LNQA 4QUFA 2JA8G 1SEIA 4X3SA 3QR8A 5I9OA 4FO2A 4B8CD 2NVQB 4JI1L 2HCIA 5ELOA 1A3UA 5C0XJ 3ER0A 2J0TD 3X3MA 3URYA 1NMGA 1XNQH 1EYGA 4DV4L 4RCOA 3AQQA 5C4HA 4X65Q 1JWMD 4LFCL 5I2YA 4P73A 1IHZA 1CT1D 3WOEA 4JV5H 4B3RQ 3TP5A 3I4NB 3K8AA 2RHSB 3VYTA 1VQ5A 2QEJC 4JPBW 4LFCH 3M4OB 4RH6A 1CKMA 2QNDA 3L0OA 1M1KC 1WCMG 3BDOA 4R4IA 3EBEA 4HJ5A 1VQNA 2QW7A 4ULLA 2PW5A 4BY1G 3Q6SA 2AHOB 2UUBL 3HOWB 3F2UA 4IUPA 2JSOA 4QCLA 1DT4A 4AYBE 1QVFA 2KOLA 2JEAI 1PYSB 4HJAA 3U4ZA 2UXDL 1MHWC 1JT8A 4OWTB 1DJRD 2IX1A 4A93B 3SVMA 3D6WA 2ALYB 3H91A 4M8AA 4G7ZC 2E2JH 1TS3A 1U4RA 1HXYD 5ELBA 3IFTA 4L5TA 2E3UA 2IL8A 4DV6L 1D6EC 1YNNC 1HR0W 4OIJA 1ZXTA 4P75A 3CPWA 1V1PA 1VDZA 4YY3Q 3NHHA 2NTSA 3TSSA 4U68A 1PV4A 3J7A5 4OO1G 1WTXA 3STBC 1UAPA 3K5NA 3FVQA 5C3EB 2VY3A 4IPHA 1SJED 3OWEB 4DR1H 1BBUA 1E3PA 2CTMA 3CD6A 2F4IA 4KD4A 2ZM6Q 2UU9Q 4A3FB 2A1SA 3M4YA 3JAME 5IT9c 2PI2A 4C3HH 1LT5D 1R4PB 1T5XD 2IY5B 5IP7G 2RVLA 1X9NA 1O80A 3CW2C 2R7ZH 2K1HA 4RMFA 1HNXL 2AMCB 3KYHC 1GUNA 1OXVA 2WP8J 4DV5Q 1MSHA 1CKOA 2ANNA 2JA8H 3PUYA 2E2DC 1UNSA 2E2HB 4YHHH 3H94A 3R3OA 1MIUA 3KDFA 1L0XB 2D9IA 3FHWA 4HMIA 1SYEA 4EX5A 3I70A 3EFXD 2Q2UA 1Q46A 1PQXA 4Y52H 2F0IA 1KRSA 3I90A 5C5LA 2LRRA 2HH2A 5LL6b 1DYQA 1MBYA 5D3IB 2DJGC 1TWGB 2F4VL 1B2TA 2Z4HA 2GA4B 3HOXG 4ZK9B 3J7YW 1QNUA 5IYCG 4X62H 4PG3A 2K5NA 2XTIA 4O2DA 1RD9D 5FLMG 1M4VA 4CDFC 2NVQH 3H0GH 1PH4A 1IKLA 2PZTA 3R93A 4PV1C 1AN7A 3MXGA 2I5MX 5C0XG 3QOJA 1QVGA 1NTGA 2X6LA 3PIO3 3SXHA 3CCUA 3J81W 3RD4A 4OX9L 4H13C 4AQYQ 1G291 2XIWA 1S03G 1H9SA 4C3IB 4M1UB 2CHBD 3S2HH 4X6AH 1WCMB 4UP7A 5EKIA 4N9TA 4A3KG 3PCOB 3GTPB 2DY7A 2NN6G 3I73A 1OXXK 1I3QB 4JCVE 3NQIA 2XRSD 1HNWQ 4FJSA 1LTLA 4A93G 4KV6A 1E2ZA 1MD2D 4K2LA 2K5QA 3PF4A 3C1FA 1DOKA 1SNOA 1LT6D 2F0LA 5C44G 4QGUA 1LT4D 1CI3M 2EJGC 1JE5A 5EQ0A 4DV2H 1W3SA 1FVIA 4L5QA 3ZYYX 2JA6G 3KF6B 1KDBA 2R7DA 5JJZA 1P8LA 4WJ3M 1TWFB 5JEAJ 4E6IA 3HOYB 4NXNH 3HOYH 5E1FA 4J6HA 4X64L 5HY6A 4G4KA 5M3FG 4DR2L 2Z1CA 3TEHB 4LF5L 2WINB 3NENA 1HNWL 2UUBH 3KLWA 3HP3A 2BOSA 3D6CA 4KHPQ 3PIP3 4XQNA 5EKLA 4PNYA 2ANRA 1UG8A 4Z9CB 1W6JA 3CC2A 1F9QA 4TQUS 4L6TB 2A6HD 3GTMB 1WTQA 1FYCA 1JJCB 2E75C 4IUTA 3HS0C 4RKLA 2DY8A 3RN5A 4U673 4DR7L 1WOCA 2OXPA 3PGZA 4KKSA 2VS1A 1TKWB 5IT9L 3X3NA 2OF1A 2KUMA 2F0JA 3NK9A 4DAMA 2KHJA 2CH4A 3CP0A 1BF4A 3G48A 5FJ8H 1EWHA 1F9RA 3ERSX 2SEBD 2J4XA 2PNHA 3A0JA 1IXRA 1Q8KA 3DEOA 3O13A 3FMCA 3UDXA 4B3SQ 4JI2Q 3H3VH 3J80E 3PSIA 4KMUC 2UXBQ 4LF9Q 4EQOA 2HUGA 2CKZB 1SR3A 4XYOA 1XTDA 1SFOB 3K7UC 4IO9A 1PA6A 4C56C 4A3BH 3TS0A 4DV2Q 4KJOA 1N34Q 1PTOC 1Y1VH 4RGMA 1EC6A 4LUVA 1GVPA 2QDBA 4GN5A 2P2RA 2LSSA 5EPJA 2D2CC 1HNZL 3S1NH 4BBRH 5LMUQ 1SE8A 3CQZB 3K5LA 1M90C 3J81j 4A3EB 4KY5A 4BWGB 3VYRA 1LTBD 1MJCA 2B2TA 3G6EA 2X06A 4H02A 4JI2L 4YHHQ 4K5WA 3GABA 2DNCA 4F8MA 2F0WA 1X4MA 2BE5C 1LTGD 4LF6Q 1E1TA 2MP1A 1NMFA 2VQFH 3J81c 1ILQA 2VQEQ 2BCOA 1ODHA 1HZBA 1SRUA 4I7AA 2HHHH 4A3EG 4J15A 4P71A 1MSZA 2PCFB 1QUQA 3HOYG 5IODA 4DR6L 2UU9H 5CMDA 5DNFA 3DWPA 1V1OA 2IHEA 5G3LF 3BS1A 4WJ4A 1WE8A 5IE8A 1B44D 1TWGH 3TZDA 1TUAA 4YWMA 3K5MA 1ENFA 1K28A 3BVMA 2YTXA 4HTHA 4O42A 2EPBA 3T1HH 3AEVB 3AEVA 1TWAH 1EYDA 1TVXA 4CKEA 1STGA 1S5CD 2E2HH 5C4XH 2ZM6L 2O4XA 5E4WC 1N9WA 2K05A 1BCPC 1H9MA 3A55A 1I6UA 2VXWA 1PH1A 3R2TA 2ZXPA 2D5DA 4FDBA 1X54A 1FJGQ 4QIWB 2K32A 4QL5A 5NUCA 1KAAA 2L55A 4DAYA 3VA7A 5IYDH 1YBYA 2LTLA 2R92B 1U5KA 1X3GA 1RKNA 4C3JB 4OWWB 1A6XA 1D1KA 2UXDQ 5IYCH 3CMAA 3SEBA 4JYAL 4UPAA 1N33L 4GLVB 4DUZQ 4RA8A 1SNQA 2PYKA 1HZ9A 1VQOA 2BA1A 1L0YB 4X66L 5IP7H 3GTKB 1SNCA 5FO7B 1G2TA 1TWCH 5JVG3 5IGCA 1LTID 3F2DA 3OSOA 1BR9A 3TQYA 2UXCH 2A19A 5CR3A 3ERQA 2XVSA 3QJYA 4X64H 1JOQA 3A8JE 4X65L 4DV0Q 4N9PA 1IKMA 1CHPD 2HIXA 4KTAA 3J7ZC 2NWGA 5GADC 1N34L 1ZZKA 5HURA 1I94H 5LL6S 3RZOB 2Q8TA 4O1NA 3RZOH 4GOPC 1NXUA 2QILA 3S17B 3CXCA 4EQ5A 4X66Q 3ONAB 1CA5A 5C0XI 2OPUA 2IHFA 5M5WB 2LY7A 4K5XA 2LKVA 4IZ8A 3HOXH 4DR4L 3SE0A 3K5OA 1GOZA 2M2LA 2JEBI 1SJHD 4S3SA 4NXNQ 4KKUA 3K81C 1W6KA 4LFAH 4HIDA 4NBQA 4X65H 4JG2A 1YEZA 4UP9A 3RLOA 1FL0A 3LGJA 1AH9A 1Y69U 1II3A 3CCVA 3CCQA 4KY7A 5JOBA 3J7AF 2FPHX 1EIFA 4GOPA 1A3TA 1PZID 4PZ6A 4LF6H 2VKCA 4OX9H 2AUKA 3MVVA 1MI2A 1EIHA 1JE4A 3ULLA 4XIGS 4JI5Q 4A3LH 1EQRA 1KABA 1Y14B 2DN8A 4KHZA 2VB2X 2N55A 3NE5B 2B63H 5J3BA 1XNRL 2R7FA 1PZKD 3IFDA 4OO1I 5LMUH 4O0AA 2V1CC 1SYFA 3JAMi 3P1HA 2Y0SE 3MC0B 1CSQA 1GD7A 4LF8H 5KNDA 4QY7A 2X6GA 5CV6A 2I5HA 4KN4C 3I4MH 1VQDA 3C1EA 1XMOQ 1PTOB 1PTOH 4FVMA 5M5YB 4TRDA 3S1NB 3GV6A 1RIPA 4DV0H 2M6QA 2ATWA 3S24A 1U0LA 3J80c 3CRKC 4BBSB 4B3SH 4JI8H 1YNND 4JI1H 2GVBA 4GNXC 1EWIA 3MAQA 4PQXA 4DR7H 2ZM6H 1Q1BA 5BN5A 1VQFA 1X32A 2QF7A 4IPCA 5K36H 4ABNA 4OXPA 1TS5A 1M8AA 2NBFA 1EQQA 1STEA 2B2UC 2CQAA 3NWSA 4A3LG 1IZ6A 3PF5A 1A0IA 3KF8B 1CHQD 1JCKB 2R92H 5CV9A 3TBIB 3S2DH 5E3FA 2EY5A 1F77A 3U4VA 3RUZA 1FNUA 3OIPA 4ZCKA 1Y8OB 4DUZL 3CPFA 1JWUD 3GTJB 3HGBA 3BVZA 1IBLL 3I7FA 1K0SA 1WD0A 1NNXA 5A2QW 2B3GA 3HG9A 4RCNA 2YTVA 3M4QA 1TXYA 3IL8A 4G7OC 1X55A 2K14A 2XSCA 4A3JB 3QB3A 2ZJQA 2B2VC 5BN3A 1LT3D 2CWPA 1XPOA 5FLXE 2RDGA 3T16A 4ZUIA 3J7AK 4DA2A 1GJXA 3PUXA 1PYBA 3A8IE 2QKIC 5DAUA 3BJUA 1DZ1A 2WB1B 3GTGB 3NCVA 1H9SB 3GKUA 1X3EA 2ICEC 3EZJA 3V69A 1IBMH 4DV1Q 1YJ9A 3G4SA 4HN7A 1UEBA 3F2CA 3HKSA 5M9OA 4X62Q 3D3RA 4LMQD 3NBHA 2MGSA 3FDTA 2VQFL 3E9HA 1BUVT 1IL8A 1CQVA 2JA7G 2MJHA 1B7YB 3M85A 5M5YH 1G2SA 5LHY1 2VNUD 2E5LL 4CKBA 1VF7A 3PO2H 1O7ZA 4A3FG 1IYVA 4H44C 4A3DG 5CBEE 1LLRD 4ILWA 2OT2A 1FD7D 3PUZA 1SROA 2L5TA 4C3HG 3NXWA 4G57A 4HMJA 1HZCA 1HTPA 3J81E 1N32L 3S1RH 1ONLA 2AUJD 4JBMA 1Q3LA 1X3PA 5C3WA 3GTPH 2A5HA 1D5MC 1EY0A 1T5EA 2WACA 4DV7H 1WD1A 1RDPD 2P5ZX 1GKHA 1PFSA 4JI7L 1A63A 4H0LC 1PRTD 1RODA 4DR2Q 1BKBA 1XNRQ 4EQPA 3T1YQ 2CPMA 4DV7L 3U58A 3N6RA 2K01A 1S20A 1VQMA 4KHPL 4MHEA 5GAGC 4ME5A 1BQQT 2SNMA 5IIFA 1FGBD 2R93H 4HSPA 2R93B 1E24A 3ITPA 5IGEA 5LMNW 4DV3Q 4LF7L 3HOUH 3T1HQ 2R3ZA 3HOUB 2F03A 4DV4H 1E0BA 3GTKH 3OMGA 2RDFA 4FXGC 1LM0A 1HCZA 1EY4A 4LF4L 3TP7A 3SR1A 2A74C 2CW0D 2BDOA 5KGUA 4JYAQ 4DUYH 1EQTA 1XXGA 2WAQG 1F2ZA 3NTHA 4NKLA 2MPMA 5FLXc 1IBKQ 2KQ3A 4BBSH 3MA2B 4MTKA 2NVTB 1VQEA 4K5VA 2N78A 4YCVA 1ESRA 1CFMA 3STBD 3I4LA 2RQXA 2K5VA 1GHKA 1DGSA 2Z4IA 4CJ1B 2F3IA 3G7LA 3S14B 4J8QA 2L1BA 1JOKA 1PVOA 5I4DA 3K80C 3F2BA 4WORA 2L15A 2UUAQ 3K7AB 5ELNA 1BDOA 3KDGA 2K33A 1O7LA 1QCBD 1VQ4A 3GTOB 1D5XC 1ML0D 2KJXA 3S16B 2TMPA 4R8IA 5M3FH 4K2KA 2MNAA 4B3TL 1NR4A 3KBGA 1NSNS 2K6AA 5C3EH 1D2BA 4B08A 4CDDC 2EDGA 3K0XA 3I4NH 4GZYC 1KAWA 1SBBB 3VDYA 2QGQA 4JVHA 4GOPB 1VQGA 3KUPA 1Q90A 1IYJB 2YQRA 3MEFA 4WFN3 5KYLA 1B3AA 4R4OA 3KF8A 1QWYA 4YWLA 1N34H 5M3MB 4RWSC 4XQQA 4ZYSA 4JVYA 1Q86C 4B3ML 3MFYA 1C48A 1JQYD 4DGZA 1HTLD 1TR5A 5M5WH 4JBWA 5E7NA 5ISRA 1XRHA 4GNXB 3RF2A 4LFAQ 4BY1H 4A4IA 1C8CA 4ALPA 1IW7C 4RFBA 4J1MA 3I4MB 1QE6A 2Q2IA 4LJZC 4OEMB 5HGQA 4X3TA 2L9HA 3HOWH 3BZCA 2A73B 1BXTA 1DOMA 2JE6I 2EYMA 1V43A 3EROA 4V190 4DR6Q 2JA7B 3UDGA 4FP5D 3OYYA 2G9HD 4JK1C 3W1BA 1F2YA 1EWCA 3A5ZB 2Z6KC 4K0KH 1KIXA 1TU2B 2FFMA 5JJKA 4FJUA 4EC5A 3L7ZC 1VMPA 2PI2E 1RHPA 3I72A 2DNEA 5DM63 2VB3X 3OIQA 3P75A 5IGGA 1HNXH 1YHBA 4AYBG 3PO3G 1JB3A 2R7ZG 3CC4A 3NBHB 2B2VA 3H15A 2R93G 4R9WA 4IUNA 3T1YL 2EY1A 5LMNL 5DM73 4DF7A 2A6EC 1EEID 3GTOH 4JI4Q 4ZUJA 2AQ3B 4CDEC 3I4MG 3HZXA 4IFDG 2EJMA 3CMEA 1HUMA 1GXDC 1KD1C 1IW7D 2KA7A 4RGTA 1E22A 4OCHA 1A15A 3S2HB 1KC8C 1E1OA 2LF0A 4B3RL 2IT1A 4TVAB 3KJPA 4KD3A 3W3AA 2HHHL 3HOWG 3MTSA 4L8JA 5ELFA 4DR4H 3AFQA 1DONA 1LO5D 4Y7NB 1PXUA 3KBXA 5IYBG 1WTVA 3KFUA 1RTNA 2HCCA 3GV3A 1TWAB 5ELDA 1HJPA 1WVNA 4ZLTF 4NP5A 4PZ8A 5LL6X 3BU2A 5C3XA 2BH8A 1IBML 3QD7X 1UE5A 4DV5L 2RA4A 3TP6A 2K5WA 5EAYA 5I9PA 3CHBD 5FLXW 4UP8A 3JAMc 4AM3A 1UE1A 2IWHA 4G08A 2CVRA 5IOCA 3U9OA 2NUCA 2KECA 5IGFA 4AYBB 1U4LA 4HR7B 4K0KQ 1NUCA 1GM5A 2UUCQ 2KENA 1UE7A 4HJ7A 4QJFA 1C7YA 1BBXC 2VUMH 4MIUA 2E76C 3HKZG 4WJWA 3JAML 2JA8B 3KDFB 1XX8A 3A74A 4UHVA 4QQBX 4YCUA 1EYCA 1JJGA 2NZOA 1DXMA 3GTLB 4HIKA 3GTLH 2IX3A 3JC66 2E5LQ
chains in the Genus database with same CATH topology
3PMFA 3RZDH 4A3GB 2KVMA 4JI0Q 1K9MC 5CORA 1I5FA 2FMRA 5I2XA 3MXNB 1O78A 2SNSA 2EYFA 4K8JA 1YHQA 4JI5L 3OW7A 5GROA 3WWVA 1AFPA 4JV5L 3I55A 1TS2A 3K6OA 5FLMH 1HNZQ 3D4WA 1VMCA 2MO0A 2VZAA 3CCJA 4JI1Q 2DGRA 4NXMQ 3ULPA 5JAVA 1WI5A 4RKBA 2EE1A 1KHIA 2Z8LA 2WV6D 2KHIA 4A3BB 3CCMA 1PH6A 4BBSG 5JEAH 4LF6L 3NEMA 1EY5A 1SEBD 4WRDA 4LFBQ 2PY9A 2MHVA 5HGTA 1DOLA 2EZVA 1L1OB 4GKKQ 4A3JH 2CTJA 3B6YA 5FJ8G 4DR3L 4HJ9A 3M3YB 3KLSA 4HJ8A 2JVZA 3BZDB 2F0NA 3KLRA 4ODGA 4IFDH 3BDCA 4A3GG 3MEHA 4LF5Q 2N88A 1QVCA 1I4RA 2CW0C 5IYBH 1X4NA 2PZWA 1YVCA 3S15B 4DU9A 4CJ0B 1ILPA 4HSVA 2VL6A 1B8AA 3I4OA 1ZZIA 3N52A 2CWAA 3IRBA 1VIGA 1XWEA 2L12A 3Q23A 2NYZD 1TWCB 1I50B 1Q12A 4V0BA 3V05A 4FF3A 4XTCS 4WALA 1STHA 5CV4A 4DNRB 3C46A 1O7IA 5ELCA 2O5IC 3UDFA 1QJOA 3HOUG 1Q82C 1I94L 4KI0A 4A3MH 1K8OA 1NCVA 1VQCA 4IALA 1T9HA 2JQOA 1X6OA 2B8FA 5EPKA 2E2IB 5M3FB 5KNBA 2E74C 3HOXB 3HEJA 2H5XA 4YWKA 5GAEC 3HOVB 2NVXB 1EOTA 5CV5A 1WVLA 1JMCA 4PMWA 2I0QA 1S5DD 3D4RA 4OX9Q 1I6HB 4B8TA 2F0SA 2OCEA 4R4CA 3M9BA 5IY0A 2EVBA 1CK1A 2H4OA 2RKSA 4RGOS 3NWTA 2KEDA 4LUOA 2NTTA 1N36L 1STYA 4YHHL 2MUYA 1YIJA 3K59A 1Y8PB 4I7ZC 5GQOA 3I4NG 1ICWA 3UDIA 4PMBA 1EUJA 2NZ1D 4APVA 4JC0A 3CC7A 1Y1WB 3NQTA 3QG1A 1SNDA 1WJJA 2OTJA 2EYLA 1LUZA 3LWUA 4WANA 4RGNA 1PLFA 3NTKA 5M5XB 2RDHA 2NN6H 3T13A 5FOBB 1ASYA 5BN4A 2HT1A 1SMXA 4IPGA 1UE6A 2OEOA 3NTIA 2MO1A 3T56B 4QB4A 1MGSA 1CTMA 1DM0B 1S3OA 4A93H 2F52A 3U9SA 1PTOD 1AP0A 4Y7NH 1YITA 2E8GA 4A3JG 4LW1A 1GUOA 4C3IG 5IYDG 2HQEA 2ZTEA 1RF2D 1SDFA 2NVTH 3A7LA 5IGBA 1S5BD 4LIJA 2ZJRA 3PO3H 4POGA 1GUWA 4JI6Q 2F0TA 2B2TC 4A75A 3M3YH 4X3KA 3S1QB 2YU9B 3DXJC 3HOZG 2K04A 1BOSA 2Q2TA 1STBA 1AE2A 2IX0A 1GUSA 2K7VA 3FKIB 3ULJA 4A3FH 1K8MA 3R8BA 3E0JA 2WKCA 2BA0A 2KHSA 3H3VC 4A3MG 3A56A 2Q8IB 1Q81C 1LV9A 1F9SA 1I4GA 2X69A 2LFNA 3NPPA 1L1OA 3NSWA 3GTGH 2FINB 1Q7YC 4XT1B 4GLAC 4DUYQ 4DAPA 4JI3Q 1YZ6A 4IN3A 1B70B 2KBNA 2XGTA 4L5RC 1EFID 1JORA 4YIJA 2NVYH 1KLUD 2PZUA 1VQ6A 1WTWA 3S17H 1YNJD 3OTOQ 4RHRA 1XPUA 1TY0A 5IT9E 2F0PA 2ES2A 4IUQA 4IPDA 1Z47A 2B2YA 1XJVA 4DR7Q 4OL7A 2F3WA 1L1OC 5J39A 3M7NA 3MXPA 3NBIA 2K75A 2RF4A 4KJNA 2XWJB 4BXXG 1F2MA 1E2VA 3SHLA 2HHHQ 4HAEA 3HOZH 1VF5C 3UI2A 1YHAA 2NZHA 3K58A 5KEEA 4HIOA 4BBRG 4DKAC 2BH2A 1HFNA 2K28A 5GAHC 1TS4A 3DWQA 2C5CA 5KIXA 5FO9B 3GDEA 3W5OA 1HH2P 4JBJA 1G6PA 1NJIC 4GKJL 3A8KE 2B2YC 2EYPA 1V1PB 4LAAA 5A35A 1CKNA 1R9TH 2CTFA 3T1HL 3AU7A 3RR5A 4POFA 3MZ5A 4XT3B 1AEXA 1P16A 1CZGA 1U4PA 1YI2A 1N33Q 2YYZA 3TS2A 1W2BA 1K8AC 4X64Q 3CCEA 2UU9L 5F2DA 2CTEA 3J81i 2JZXA 3VYUA 1TY2A 4CBVA 1K83H 1HNXQ 1SYDA 2I07B 2K1BA 4X3UA 1PFMA 1ZZJA 4BY1B 2Z0SA 5J1ZA 3NP8A 4KK7A 2N3SA 1XYIA 3CF5A 2K5DA 4NDXA 2YTYA 4GN4B 3KK7A 1SFOH 3GD7A 1OXTA 1D5ZC 4L63B 4JI8Q 5BR8L 4LFCQ 4IOAA 1LTTD 1Y1VB 3PIOA 3E5SA 3EVQA 3QWNA 1VQ8A 3I56A 1SYCA 1H9KA 2EQSA 4JI7Q 3M7GA 1CKNB 2WAQE 1WTPA 3LWEA 2R92G 1VQ9A 2JA5H 1V8QA 4YY3L 2JA9A 1S5FD 4B3SL 1I6VC 1WTRA 2B39A 1A62A 1U9RA 2NB0A 1EU4A 2FHTA 5AJ3L 2K5HA 3J7AV 4P74A 2F0FA 1TQOA 1JC7A 3S1MH 1H95A 3D4DA 1K3RA 1FGUA 1RTOA 1JR0D 3DEPA 1L2FA 2R6GA 2F0KA 2R7ZB 2WFWA 4A3GH 1N32Q 2QA4A 4EVOA 3L2PA 4EGVA 1BCPF 1F9PA 3WDNA 4MTNA 1IBLQ 4XXEA 5LMUL 1FNVA 2F1MA 1ENAA 3EIVA 5D65A 1VQIA 2I5LX 3Q0AA 2ZT9C 2IJ0A 4EQNA 1I6HH 3H09A 2F3VA 2A6HC 4CHTB 2PQAB 1E7ZA 1B9NA 2F0HA 3CCRA 5CV8A 3ZJYC 1AN8A 1NBWA 4DXFA 3I91A 2JA5G 5IWAQ 2D9UA 4KN7C 5IGDA 3Q8DA 4QMFB 1CM9A 2BDNA 3LNNA 1X65A 3UE1A 1EZ6A 4BY7H 2UUCL 3TP8A 2ZJPA 5EGTA 1HPCA 4Q5VA 2B2UA 1XMQQ 2EXZA 4R1JA 1SYBA 2O2LD 2MJ8A 4A3DB 1PFNA 3V96A 1HZAA 2JK8A 1KRTA 2XRQD 3E0EA 1NE3A 5D14A 1LYLA 1WCMH 4AIMA 2FJ2A 1JJ2A 3VR2A 2HQLA 3EN2A 4UAIA 4DR5Q 5FK9C 3VR4A 3RZDB 1YJWA 2FFKB 3W1GA 1SN8A 3BDLA 3AMUA 2F4VQ 2K03A 3C3LA 2KCCA 1VQ7A 1K73C 3GO5A 2F0GA 1XMQL 3P20A 2KCNA 2PQAA 3CQZH 1MKHA 1S40A 1J5EQ 1B1ZA 1TWFH 3P7JA 3TZUA 4OONA 4RHSA 3CU7A 2G9DA 3AFPA 1JB7A 4P2CB 3CCLA 1PHJA 1PRTF 5EJWA 1KHMA 3R2IA 1UUPA 4ZRZA 1HHVA 2M9VA 4JI8L 4BY7G 2CCZA 4A3IB 2TSSA 2ICIA 4DV1L 5FO8B 1L0WA 2Q2HA 4KLKA 1QNKA 3M4PA 3IKJA 3VYSA 1KXLA 2NN6I 1ZYRD 1XTCD 2DUDA 4ME3A 3I2ZA 4K6DA 1EEFD 2WB1G 3S1QH 4LF8L 2CQOA 5C5MA 1SXTA 1PH9A 2UUBQ 2F0EA 1YNXA 4ZQ3A 5M3MG 1EU3A 1D7QA 4IQZA 3TDQA 4HIMA 4OO1H 1G91A 2VQEL 4OHJA 4F87A 4IFDJ 5A2QL 1C4QA 2LMCB 2AXYA 2EY2A 3VKEA 1LTSD 5C4JH 1G51A 1J9OA 4B9XA 5FLXL 3Q24A 2ZTDA 2EJFC 4DV6Q 4BS9A 4C3JG 4DNTB 4LF8Q 1KDAA 2M00A 5C44B 2D0PA 4C2MB 4A3MB 1EFWA 3EJIA 1K0RA 3AYHB 4OWXB 3D0FA 1Z9FA 4L5SA 5EBDA 3W2DA 3MXNA 2QEXA 4C1NK 4JOIC 3CKIB 4LFAL 4A3EH 3HOZB 4CGYB 2CTKA 4NMZA 1I4QA 3OOCA 2B8GA 1STNA 5C6AA 1U4MA 1QOHA 2WIIB 1I4PA 1PMRA 1FJGL 3UE0A 1VQAA 2A69C 4G7HC 1CA6A 3S1MB 4DR4Q 2EXDA 4C1NI 4A3DH 1WTOA 1I3QH 5JPNC 4MZ9A 4P72A 2H1EA 4CJ2C 2B63B 2CPQA 5CC4A 1H9RA 1AW7A 3MWYW 1A3VA 4JOIA 1HR0L 5COYA 1VS0A 4GNXA 1Z7TA 1ESFA 1BVSA 1VQHA 1HA5A 5BR8Q 5C44H 1WFQA 4B3TQ 1KDCA 4K0KL 5JPMC 2BL5A 5T1IA 3GTQH 3E9IA 2JA6H 4UDUC 1EY9A 2JA6B 1NAPA 4OGQC 3SK5A 3T4AC 1SSOA 2XNAC 2FMCA 4HEDA 3T51B 4DK0A 1QZHA 1B53A 1GUTA 1RL2A 1QG7A 3T53B 2OQKA 4A76A 3A5UA 3RNUA 3S9WA 2EOTA 4IJLA 1QILA 5CGKA 1Y1WG 4GLXA 2HIVA 2K50A 1IYUA 2L11A 2PMZB 3A7AB 2F0UA 3PUWA 5C4ZA 2ZTCA 3MXUA 1HR0Q 5A2QE 1Y8NB 1J5KA 1EQVA 1PZJD 2V4DA 2A68D 4A3KB 1TIID 1TWHH 5CYUA 1TWHB 3SK8A 2E2IH 3S14H 2ID0A 2LS01 3DM3A 2F0MA 4YCWA 2A1AA 4K8IA 3D8GA 5TSSA 4DAYB 3WOFA 4KHVA 2L0CA 3BYTB 4DK1A 2XWBB 4CKCA 3KF6A 1HQMC 3MHBA 3OHXC 2VUMG 3HOVG 3KJOA 1X56A 2YV5A 4NXML 1X3FA 2UXBL 5EKKA 4LUZA 1ENCA 2IPKD 1SMYC 3CRLC 3J80L 3CAMA 4DV2L 1HFGA 3I3CA 2KCTA 2F0OA 3QIAA 4GKKL 3EA6A 2KCMA 1VQBA 3J81L 1Z6HA 1Y1WH 3BZKA 2AQ1B 2CTLA 2IW3A 3QOLA 4Q0FA 5C4XB 5M5XH 3FRPB 4JBKA 3U1KA 1VCIA 5J22A 1SE4A 3S15H 3K0YA 1QUQB 1ZEQX 1BNZA 5H1SE 1B9MA 2QCPX 2A8VA 4DV4Q 3H6MA 1NY4A 5JEAG 5AJ3Q 4IUVA 2PMZE 3OPOA 4DXGA 3BYYB 2J7ZA 5KNCA 4JI0L 3NUCA 4F88A 4KY6A 1OO9B 1XMOL 4BA1I 1YJNA 2PW7A 3PV0A 2RSOA 3GTJH 2SOBA 1EIYB 4I65A 1SLJA 4DN4M 1YNJC 5CV7A 1XNQQ 5I6YA 2K52A 1SE2A 1GUGA 2CFMA 2ZXOA 4KKTA 4DNIA 5IP9G 3M4OH 3NELA 1KTKA 1DTJA 1AZQA 3F1ZA 1FR3A 2YU9H 2JA5B 1IL2A 1BO0A 2LXJA 4B3MQ 4BXXH 4RG1A 1ET9A 4IJHA 3K7AH 1D8LA 1SYGA 3S16H 2C9OA 2PNRC 4FYDA 4OIKA 1I4HA 3C2PA 2RCNA 3FKIG 1CSPA 4IURA 4F7XA 4JI3L 5K5PA 2D62A 5K36G 1EY8A 3RLNA 2AWNA 3D31A 1GHJA 1B50A 4NB3A 1N8RC 3VR5A 4BBRB 4GS3A 4QUCA 1CQFA 3H0GG 5C4XG 3RN2A 1ET6A 2F0DA 2NVYB 4DAVA 1XPRA 3F8TA 1D1IA 3V2TA 3HFZB 5C0XH 4HCSA 1QB5D 5ELEA 3RMHA 4C3JH 2PQEA 1JICA 2OPVA 3IAYA 1ZTGA 1KNEA 2AKWB 3GQBA 4JV5Q 2EY6A 2NVXH 3HOVH 2RHQB 4LWCA 1PRTC 1PH3A 3H0GB 2Q8RE 2VQFQ 1HQRD 4DR1L 3ICEA 4RAUC 2UXCQ 2ASBA 1C9OA 5DLQE 1EL0A 1S72A 4NPSA 1NR2A 4JI4L 3VA5A 2BE5D 1LTAD 5JJIA 1OTCA 1S4ZA 2EYHA 3TREA 5JJLA 1X3QA 2OQ0A 3FPUB 2RSNA 4FF2A 1HRJA 1UEAB 3KOJA 1STAA 4DUYL 2B63G 1BBWA 4JI6L 4PZ7A 2D0OA 4LK1C 2SDFA 4A3CH 2A6ED 2ENBA 2JJQA 3CCSA 1J6QA 3ND9A 4FNFA 4C3HB 2F0VA 4DK6C 1BCPB 4LF9L 2K4KA 1PFBA 4C2MH 1ASZA 2A68C 2LXKA 2A69D 1HUNA 1K8GA 1I50H 1I4XA 2AQ2B 4LFBL 1ZKOA 4BY7B 1PH8A 1O7YA 1MJEA 4K6LA 1J4WA 1SNPA 3DMUA 1DCZA 4UY8C 2DGYA 3HKZB 3BG3A 1EIGA 4DR3Q 5C3EG 1PH7A 1G8ZD 4DFAA 2WAQB 3LX0A 5LMNQ 3KLSX 1J8IA 4BA2I 4C3IH 3PUVA 3H3VI 4PMCA 4XYQA 2FMMA 4FXKC 2PO4A 2B29A 1RJTA 4R4TA 4IOCA 1VQKA 3G6JB 3K57A 2UUAL 4IUUA 3TN2A 3SK4A 1SAPA 3VR6A 3FKIH 3DWAA 2GN5A 3Q22A 1SE3A 3HKZE 4A3BG 1C0AA 2PPBC 3S2DB 1HA6A 3FPPA 1E2WA 2Z6KA 5G3LD 1SNMA 4DV7Q 1G6ZA 3GTQB 4R4QA 1A2TA 3QO2A 5AFWA 2VUMB 3U50C 1UWVA 1N36Q 1S5ED 5I6WA 1V9PA 1VQJA 1I94Q 2JP1A 2FXQA 4DPGA 2E2JB 1J5EL 2N8NA 4A3IH 2MQHA 3SDZA 3DUZA 3AB9A 4QF4A 1RCVD 5C4JB 3GP7A 2KEEA 1FNWA 4AQYL 1ZYRC 4QMGA 1PTOF 2XN9C 2I46A 1IBKL 1PDQA 5KRUA 5JVH3 2O5JC 1VQLA 3OTOL 4XDXA 5KYIA 2HDLA 2OTLA 1H9JA 1WYDA 3HRZC 2ZXRA 1PH5A 1F2LA 3OW2A 1A2UA 3E6ZX 1PYWD 4A3CG 3OMCA 4IFDI 5FKAC 5EPLA 3RLFA 2Y0SB 2VW9A 4FXDA 5IP9H 4X62L 2EIFA 1AZPA 3GTMH 1LABA 1KLGD 2C35B 4DK3C 1CZWA 2HH3A 3MFGA 1LTRD 2B2WA 1LACA 2EYOA 1QZGA 1CUKA 3BVGA 1XNQL 4GKJQ 4B9WA 5M3MH 2R61A 2JYOA 1KQSA 4GN3B 2GVAA 2AWOA 1KNAA 1R4QB 2EYJA 3EQLC 4DV0L 1PH2A 1Q1EA 1KL9A 3PO2G 3I8ZA 5IWAL 3ND8A 1EY7A 2B2WC 4MN3A 2F0QA 1PRTB 1EOVA 3DM1A 2JA7H 3G71A 4FF4A 3PO2B 3FP9A 1OXSC 3TMEA 3PIPA 1EZ8A 4ID6A 4ZKCB 5D3DA 3FEWX 3VR3A 3PO3B 1IBMQ 4DV3L 4LF7Q 1TT2A 1R9TB 1Q8IA 1BCPD 4NXNL 4A3KH 1EY6A 1JOOA 2L4NA 4XQJA 1MSGA 4LF4Q 3OWFA 3TRZA 4ZKBB 2PQUA 1VQPA 1A8VA 4H7BA 1EYAA 2OWOA 3J80i 3DLLA 4A3IG 3DHQA 1V1QA 5DEHA 4HCEA 2WB1E 4MNOA 2Y0SG 4QIWE 1JWSD 4R8NA 2N49A 2HDMA 2WKDA 1K1GA 1AE3A 5CBAE 2RBMA 4TSSA 4DR1Q 4FF1A 4TKOB 2MFIA 1SMYD 1OXUA 2UXCL 3SK6A 2JXMB 1GO3E 1DD2A 4DR5L 5E4XA 1VIHA 3A54A 4K14A 1B4OA 4NW2A 5T1GA 1Y1VG 4ZAIA 3SGIA 5EBCA 3L3OC 3S1RB 1K83B 3L9AX 4AH6A 4LNQA 4QUFA 2JA8G 4X3SA 5I9OA 4FO2A 2NVQB 4JI1L 2HCIA 5ELOA 1A3UA 5C0XJ 3ER0A 2J0TD 3X3MA 3URYA 1NMGA 1EYGA 4DV4L 4RCOA 3AQQA 5C4HA 4X65Q 1JWMD 4LFCL 5I2YA 4P73A 1IHZA 1CT1D 3WOEA 4B3RQ 3TP5A 3I4NB 3K8AA 2RHSB 3VYTA 1VQ5A 2QEJC 3M4OB 4RH6A 1CKMA 2QNDA 3L0OA 1M1KC 1WCMG 3BDOA 4R4IA 3EBEA 4HJ5A 1VQNA 4ULLA 2PW5A 4BY1G 3Q6SA 2AHOB 2UUBL 3HOWB 3F2UA 4IUPA 2JSOA 4QCLA 1DT4A 4AYBE 1QVFA 2KOLA 2JEAI 1PYSB 4HJAA 3U4ZA 2UXDL 1JT8A 4OWTB 1DJRD 2IX1A 4A93B 3SVMA 3D6WA 3H91A 2ALYB 4M8AA 4G7ZC 2E2JH 1TS3A 1U4RA 1HXYD 5ELBA 3IFTA 4L5TA 2E3UA 2IL8A 4DV6L 1D6EC 1YNNC 1HR0W 4OIJA 1ZXTA 4P75A 3CPWA 1V1PA 1VDZA 4YY3Q 3NHHA 2NTSA 3TSSA 4U68A 1PV4A 3J7A5 4OO1G 1WTXA 3STBC 1UAPA 3K5NA 3FVQA 5C3EB 2VY3A 4IPHA 1SJED 3OWEB 1BBUA 1E3PA 2CTMA 3CD6A 2F4IA 4KD4A 2ZM6Q 2UU9Q 4A3FB 3M4YA 3JAME 5IT9c 2PI2A 4C3HH 1LT5D 1R4PB 1T5XD 2IY5B 5IP7G 2RVLA 1X9NA 1O80A 3CW2C 2R7ZH 4RMFA 1HNXL 2AMCB 3KYHC 1GUNA 1OXVA 2WP8J 4DV5Q 1MSHA 1CKOA 2ANNA 2JA8H 3PUYA 2E2DC 1UNSA 2E2HB 3H94A 3R3OA 1MIUA 3KDFA 1L0XB 3FHWA 4HMIA 1SYEA 4EX5A 3I70A 3EFXD 2Q2UA 1Q46A 4Y52H 2F0IA 3I90A 5C5LA 1KRSA 2HH2A 1DYQA 1MBYA 5D3IB 1TWGB 2F4VL 1B2TA 2Z4HA 2GA4B 3HOXG 4ZK9B 3J7YW 1QNUA 5IYCG 4PG3A 2K5NA 2XTIA 4O2DA 1RD9D 5FLMG 1M4VA 2NVQH 3H0GH 1PH4A 1IKLA 2PZTA 3R93A 4PV1C 3MXGA 2I5MX 5C0XG 3QOJA 1QVGA 1NTGA 2X6LA 3PIO3 3SXHA 3CCUA 3RD4A 4OX9L 4H13C 4AQYQ 1G291 2XIWA 1H9SA 4C3IB 4M1UB 2CHBD 3S2HH 4X6AH 1WCMB 5EKIA 4UP7A 4N9TA 4A3KG 3PCOB 3GTPB 2DY7A 2NN6G 3I73A 1OXXK 1I3QB 4JCVE 3NQIA 2XRSD 1HNWQ 1LTLA 4A93G 4KV6A 1E2ZA 1MD2D 4K2LA 2K5QA 3PF4A 3C1FA 1DOKA 1SNOA 1LT6D 2F0LA 5C44G 4QGUA 1LT4D 1CI3M 2EJGC 5EQ0A 1JE5A 1W3SA 1FVIA 4L5QA 3ZYYX 2JA6G 3KF6B 1KDBA 2R7DA 5JJZA 1P8LA 4WJ3M 1TWFB 5JEAJ 4E6IA 3HOYB 3HOYH 5E1FA 4J6HA 4X64L 5HY6A 4G4KA 5M3FG 4DR2L 2Z1CA 3TEHB 4LF5L 2WINB 3NENA 1HNWL 3KLWA 3HP3A 2BOSA 3D6CA 4KHPQ 3PIP3 4XQNA 5EKLA 4PNYA 2ANRA 4Z9CB 1W6JA 3CC2A 1F9QA 4TQUS 4L6TB 2A6HD 3GTMB 1WTQA 1FYCA 2E75C 4IUTA 4RKLA 3HS0C 1JJCB 2DY8A 3RN5A 4U673 4DR7L 1WOCA 2OXPA 3PGZA 4KKSA 3X3NA 1TKWB 5IT9L 2VS1A 2OF1A 2KUMA 2F0JA 3NK9A 4DAMA 1BF4A 2KHJA 3CP0A 3G48A 5FJ8H 1EWHA 1F9RA 3ERSX 2SEBD 2J4XA 3DEOA 1IXRA 2PNHA 1Q8KA 3A0JA 3O13A 3FMCA 3UDXA 4B3SQ 4JI2Q 3H3VH 3J80E 4KMUC 3PSIA 2UXBQ 4LF9Q 4EQOA 2HUGA 2CKZB 1SR3A 4XYOA 1SFOB 1XTDA 3K7UC 4IO9A 1PA6A 4C56C 4A3BH 3TS0A 4DV2Q 4KJOA 1N34Q 1PTOC 4RGMA 1Y1VH 1EC6A 4LUVA 1GVPA 2QDBA 4GN5A 2P2RA 2LSSA 5EPJA 2D2CC 1HNZL 3S1NH 4BBRH 5LMUQ 3CQZB 1SE8A 3K5LA 1M90C 4A3EB 3J81j 4BWGB 4KY5A 3VYRA 1LTBD 1MJCA 2B2TA 3G6EA 4H02A 4JI2L 4YHHQ 4K5WA 2DNCA 4F8MA 2F0WA 1X4MA 2BE5C 1LTGD 4LF6Q 1E1TA 2MP1A 1NMFA 3J81c 1ILQA 2VQEQ 2BCOA 1HZBA 1SRUA 4A3EG 4J15A 4P71A 2PCFB 1QUQA 3HOYG 5IODA 4DR6L 5CMDA 5DNFA 3DWPA 1V1OA 3BS1A 5G3LF 2IHEA 4WJ4A 1WE8A 5IE8A 1B44D 1TWGH 3TZDA 1TUAA 4YWMA 3K5MA 1ENFA 3BVMA 2YTXA 4HTHA 4O42A 2EPBA 3AEVB 3AEVA 1TWAH 1EYDA 1TVXA 4CKEA 1STGA 1S5CD 2E2HH 5C4XH 2ZM6L 2O4XA 5E4WC 1N9WA 2K05A 1BCPC 1H9MA 3A55A 2VXWA 1PH1A 3R2TA 2ZXPA 2D5DA 4FDBA 1X54A 1FJGQ 4QIWB 2K32A 4QL5A 5NUCA 1KAAA 2L55A 4DAYA 3VA7A 5IYDH 1YBYA 2R92B 1U5KA 1A6XA 1RKNA 4C3JB 1X3GA 4OWWB 1D1KA 2UXDQ 5IYCH 3CMAA 3SEBA 4JYAL 4UPAA 1N33L 4GLVB 4DUZQ 4RA8A 1SNQA 2PYKA 1HZ9A 1VQOA 2BA1A 1L0YB 4X66L 5IP7H 3GTKB 1SNCA 5FO7B 1G2TA 1TWCH 5JVG3 5IGCA 1LTID 3F2DA 3OSOA 1BR9A 3TQYA 2A19A 5CR3A 3ERQA 2XVSA 3QJYA 1JOQA 3A8JE 4X65L 4DV0Q 4N9PA 1IKMA 1CHPD 2HIXA 4KTAA 3J7ZC 2NWGA 5GADC 1N34L 1ZZKA 5HURA 5LL6S 3RZOB 2Q8TA 4O1NA 3RZOH 4GOPC 2QILA 3S17B 3CXCA 4EQ5A 4X66Q 3ONAB 1CA5A 5C0XI 2OPUA 2IHFA 5M5WB 2LY7A 4K5XA 2LKVA 4IZ8A 3HOXH 4DR4L 3SE0A 3K5OA 1GOZA 2M2LA 2JEBI 1SJHD 4S3SA 4NXNQ 4KKUA 3K81C 1W6KA 4HIDA 4NBQA 4JG2A 1YEZA 4UP9A 3RLOA 1FL0A 3LGJA 1AH9A 1Y69U 1II3A 3CCVA 3CCQA 4KY7A 5JOBA 3J7AF 1EIFA 4GOPA 1A3TA 1PZID 4PZ6A 2AUKA 3MVVA 1MI2A 1EIHA 1JE4A 3ULLA 4XIGS 4JI5Q 4A3LH 1KABA 1EQRA 1Y14B 2DN8A 4KHZA 2VB2X 2N55A 3NE5B 2B63H 5J3BA 1XNRL 2R7FA 1PZKD 3IFDA 4OO1I 4O0AA 2V1CC 1SYFA 3JAMi 3P1HA 2Y0SE 3MC0B 1CSQA 1GD7A 5KNDA 4QY7A 2X6GA 5CV6A 2I5HA 4KN4C 3I4MH 1VQDA 3C1EA 1XMOQ 1PTOB 1PTOH 4FVMA 5M5YB 4TRDA 3S1NB 3GV6A 1RIPA 2ATWA 3S24A 1U0LA 3J80c 3CRKC 4BBSB 1YNND 2GVBA 4GNXC 1EWIA 3MAQA 4PQXA 1Q1BA 5BN5A 1VQFA 1X32A 2QF7A 4IPCA 5K36H 4ABNA 4OXPA 1TS5A 1M8AA 2NBFA 1EQQA 1STEA 2B2UC 2CQAA 3NWSA 4A3LG 1IZ6A 3PF5A 1A0IA 3KF8B 1CHQD 1JCKB 2R92H 5CV9A 3TBIB 3S2DH 5E3FA 2EY5A 1F77A 3U4VA 3RUZA 1FNUA 3OIPA 1Y8OB 4DUZL 3CPFA 1JWUD 3GTJB 3HGBA 3BVZA 1IBLL 3I7FA 1WD0A 2B3GA 3HG9A 4RCNA 2YTVA 3M4QA 3IL8A 4G7OC 1TXYA 2XSCA 1X55A 2K14A 4A3JB 3QB3A 2ZJQA 2B2VC 5BN3A 1LT3D 2CWPA 1XPOA 5FLXE 2RDGA 3T16A 4ZUIA 4DA2A 1GJXA 3PUXA 1PYBA 3A8IE 2QKIC 5DAUA 1DZ1A 3BJUA 2WB1B 3GTGB 1H9SB 2ICEC 1X3EA 3V69A 4DV1Q 1YJ9A 3G4SA 4HN7A 1UEBA 3F2CA 3HKSA 5M9OA 4X62Q 3D3RA 4LMQD 3NBHA 2MGSA 3FDTA 2VQFL 3E9HA 1BUVT 1IL8A 1CQVA 2JA7G 2MJHA 1B7YB 3M85A 5M5YH 1G2SA 5LHY1 2VNUD 2E5LL 4CKBA 1VF7A 3PO2H 1O7ZA 4A3FG 1IYVA 4H44C 4A3DG 5CBEE 1LLRD 4ILWA 2OT2A 1FD7D 3PUZA 1SROA 2L5TA 4C3HG 3NXWA 4G57A 4HMJA 3J81E 1HTPA 1HZCA 1N32L 3S1RH 1ONLA 2AUJD 4JBMA 1Q3LA 1X3PA 5C3WA 3GTPH 2A5HA 1D5MC 1EY0A 1T5EA 2WACA 1WD1A 1RDPD 1GKHA 1PFSA 4JI7L 1A63A 4H0LC 1PRTD 1RODA 4DR2Q 1BKBA 1XNRQ 4EQPA 3T1YQ 4DV7L 3U58A 3N6RA 2K01A 1VQMA 4KHPL 4MHEA 5GAGC 4ME5A 1BQQT 2SNMA 5IIFA 1FGBD 2R93H 4HSPA 2R93B 1E24A 3ITPA 5IGEA 5LMNW 4DV3Q 4LF7L 3HOUH 3T1HQ 2R3ZA 3HOUB 2F03A 1E0BA 3GTKH 3OMGA 2RDFA 4FXGC 1LM0A 1HCZA 1EY4A 4LF4L 3TP7A 3SR1A 2A74C 2CW0D 2BDOA 5KGUA 4JYAQ 1EQTA 1XXGA 2WAQG 1F2ZA 3NTHA 4NKLA 2MPMA 5FLXc 1IBKQ