5K36G

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
236
structure length
232
Chain Sequence
b'MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAGVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 45
structure length 232
sequence length 236
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5k36G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5k36G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5k36G03
1EYGA 3CCLA 3CF5A 2UXDL 4R4QA 5IYCH 1N34Q 1K3RA 4GZYC 2VS1A 1Q46A 1KHMA 3F1ZA 3L0OA 1SROA 2NVTH 4NXNL 4QY7A 1YNXA 1KQSA 2OCEA 2N49A 4B3SL 2E76C 4LNQA 3M9BA 1Q7YC 3PV0A 3PUVA 4R4OA 1Z9FA 2F4VQ 3KJPA 1XPOA 1PH5A 2E74C 5C4JH 4AH6A 4GNXA 1CKNB 2O5JC 1E2ZA 2K52A 2AHOB 5DLQE 2BA0A 3TQYA 3VR5A 1PMRA 2FXQA 2UU9Q 3CC7A 3FP9A 3BZKA 3K81C 1YI2A 2A6EC 3A8KE 4IPHA 4A3GG 4AM3A 2KENA 3T1YQ 1V9PA 3W5OA 3T56B 3UDXA 5ELNA 1JJCB 2NVYH 4IPGA 4DV5Q 2B8FA 4KKSA 3OTOQ 2ZJQA 3CQZH 1VQJA 3LGJA 1K8GA 1XTDA 2PY9A 3S2HH 2R93G 4JI5L 4RCNA 2WB1E 1PH1A 5AJ3L 4DV7Q 2VQFL 1VQBA 1UE6A 4GOPB 4JG2A 1PH8A 1HNWL 4LFAQ 5JJKA 1O7IA 1CUKA 2GN5A 4LWCA 1PH3A 4QJFA 3CCEA 4DV4Q 1EWIA 2O5IC 1K73C 4FDBA 3M4QA 4B3MQ 4P72A 1RL2A 3RN5A 5JJLA 1TUAA 3UDIA 4LF8Q 2F1MA 4BXXH 3UDGA 3A7AB 1BKBA 3D4RA 1EQRA 4GKKL 1UEBA 1HZCA 4DV0Q 1I94L 1H95A 4GOPC 1IW7D 2E3UA 2JJQA 1G291 2P2RA 4JI0L 2HHHL 3BG3A 3CMEA 1TWGH 3J81i 2ZTCA 1L2FA 5C0XH 1SFOH 2HIXA 3CPFA 2CTFA 3CMAA 2R7ZH 5IYDH 1EIFA 5K36H 4A3FG 3HOZG 2MO1A 2BA1A 3HOUH 3I4NG 1TU2B 2ZM6L 2NN6I 4YWLA 3EIVA 3PSIA 3F2DA 5KNCA 1VCIA 3I4MG 3E0EA 3CCQA 1HR0L 3OW7A 3I4OA 1KD1C 1RIPA 5JEAH 3BDOA 4YHHL 2UUCQ 4DUZQ 2K5HA 3TRZA 3F2BA 4JI8Q 2VNUD 3LWUA 4DR5L 3P20A 3RR5A 1EIYB 5GROA 3FPPA 3VR4A 4LF9L 1N36L 1G51A 1B70B 1MIUA 4A75A 2JEBI 1YEZA 2NZOA 1GUNA 3I55A 3PO2G 3HOYH 2K50A 3FKIG 2PCFB 2HIVA 2E75C 3CC2A 1JB7A 1FYCA 1AE3A 4GKJQ 4KN7C 3SGIA 3G71A 3ULLA 3CCSA 4L5QA 2AMCB 2Z6KC 1JJ2A 2R92G 2K14A 1VQNA 4JI2L 3H0GG 1HZAA 3NENA 2UXCL 2ZTDA 3JC66 1KL9A 4P75A 1EFWA 1XMOQ 1OXSC 2KHJA 1L0WA 4TKOB 3V69A 1H9JA 4DK0A 1MKHA 1WJJA 1FVIA 2PMZE 4OWWB 1A62A 3KFUA 1V1QA 3S15H 2D0PA 3L7ZC 1WYDA 4C3IH 3K80C 4X66L 3A0JA 1YBYA 4C2MH 2V4DA 4IFDH 2RF4A 4AIMA 4YCUA 4JI4Q 1FJGL 4B8TA 3BZCA 1ZZKA 1GUGA 1OXTA 1J6QA 3PCOB 2UUAL 2IT1A 5IYBG 2ZT9C 2ZJRA 3VDYA 5LMUL 2K4KA 1VQFA 2E5LQ 4LFCL 2BH2A 3M7NA 3K8AA 3D0FA 1GHJA 1HPCA 1C7YA 1WOCA 1XPRA 3AEVA 4BBRH 1NY4A 3NEMA 4BY7G 1YNNC 4A3EG 3HGBA 1A6XA 2VW9A 4X64L 1B9NA 3A8IE 3HOXH 1P16A 4B3RQ 2JE6I 2A19A 5JJIA 2YU9H 1GHKA 1ZZIA 2B63G 1GUOA 1KIXA 2XTIA 2D62A 2PPBC 2EVBA 4LF6L 4JI3Q 3MFYA 2ANRA 4JOIC 4JYAQ 1NJIC 3B6YA 3KJOA 2ATWA 3T1HQ 4GN5A 4PMWA 1YVCA 2YYZA 4DK3C 4YY3Q 3EBEA 1MJCA 1VQIA 1Q8KA 2DN8A 4GS3A 3GTMH 1VQ9A 1Y69U 1X6OA 2BDOA 1EQQA 1YITA 2JA5G 4AQYL 1Q82C 4LF5L 3HOWG 4A93G 1E22A 3ULJA 1VQ5A 3J7A5 4NBQA 1ZTGA 4I7ZC 2V1CC 1ZZJA 1ONLA 1K8AC 4A3GH 4HIOA 2K32A 3KLRA 3VR6A 4JI7Q 4EX5A 1IYJB 1VDZA 2Y0SG 3GO5A 4DK6C 4DR1L 3BJUA 3H94A 4DR6Q 4DNTB 2EJFC 1JE5A 1O78A 2VQEQ 2AUJD 1IW7C 2YV5A 3FMCA 1I5FA 5C4XG 1XNRQ 1SE8A 2K5NA 1CKNA 4A3KG 1I6HH 1Y14B 4B3TQ 2KCCA 3A7LA 4QGUA 4KI0A 1AH9A 4JI1L 4JI6L 2B8GA 4JV5L 4X62Q 5M5YH 1ZKOA 4GLXA 3QG1A 3GTQH 1FR3A 1UE5A 3I56A 4DV3L 4IQZA 1YJ9A 5M3MG 2HT1A 5FJ8G 2WP8J 1L1OA 1QZGA 1KAWA 4DV2Q 1X4NA 2JA6G 1HJPA 2EJGC 4DUYL 3EQLC 2VUMG 1VQKA 1IZ6A 1X65A 2IHFA 4RG1A 4GOPA 2OPUA 2B3GA 1I6VC 2D5DA 4GLVB 1WFQA 2NZHA 3PIOA 1Y1WG 3HOZH 2UXDQ 1LABA 4APVA 1OXVA 3T53B 4KKUA 1IYVA 1IBML 2AWOA 1CSPA 1XNQL 1Y8PB 1JT8A 1Q1EA 4BY1G 3ND8A 1KC8C 1KHIA 2WB1G 2R6GA 4NXNQ 4A4IA 2BH8A 2KBNA 4B3SQ 1I3QH 5IWAL 3I2ZA 4JBMA 1VQHA 5LMNL 1L1OB 2E8GA 3U4VA 4LF4L 3CW2C 2E2HH 3UDFA 2I5HA 3S14H 2N78A 1N8RC 3FKIH 1Z7TA 4A3CG 2KHIA 2QA4A 2MFIA 1N9WA 4B3ML 4WJ4A 5C0XI 1Y1VG 4DR7Q 2MNAA 4A3JG 5HY6A 4LF8L 3F8TA 2QEXA 2R92H 2Z0SA 1Q1BA 1E7ZA 2ID0A 4UPAA 1T5EA 3GTOH 2Z6KA 1L1OC 1J5KA 4JI5Q 5AJ3Q 2K33A 2VQFQ 3M4YA 1HNZL 1Q90A 1HNWQ 4LJZC 4IO9A 1CFMA 1XMQL 1PYSB 2EDGA 4PG3A 2CWAA 1EUJA 4LK1C 3SE0A 1XPUA 1C0AA 4LUVA 2Q2IA 4H02A 4XIGS 5C44G 1W3SA 4DV1L 1KRSA 3UE0A 3PF4A 2QNDA 1LTLA 1SLJA 4JCVE 3STBC 3HOVH 4GKKQ 5EAYA 4Y52H 2JA7G 1I94Q 3AYHB 2CTKA 2PNRC 1U0LA 1NMFA 3H15A 1GO3E 1VQDA 5BN5A 3BU2A 4JI0Q 2HHHQ 2OTLA 3CCRA 4JBJA 5E7NA 4JK1C 1LACA 4WANA 4JVYA 1WI5A 4BA2I 5M5WH 1ASZA 3CAMA 2OQ0A 4A3LH 3W3AA 4LIJA 4KHPL 2JXMB 2Q2HA 1B8AA 2ZM6Q 2ZTEA 3VA7A 1IL2A 4BY7H 4A3MH 4A3EH 1N32L 1HR0Q 2IX1A 4A3IG 4WJ3M 3CC4A 1X55A 4DAYB 2ALYB 2N8NA 4YHHQ 4O0AA 4X65L 4IPCA 5C0XJ 4NXML 3NELA 4J15A 2B63H 1VQOA 4DR5Q 1YZ6A 1XMOL 4IFDI 1H9SB 4LF9Q 3I4LA 2K75A 1N36Q 1FL0A 1YHQA 4DR3L 2CTMA 1SN8A 3CCUA 1SMYC 4DV6L 3Q8DA 2IY5B 5JEAJ 3S1RH 1SR3A 3ULPA 1NE3A 1PYBA 5GAEC 4C3HH 4WALA 3U9SA 2OQKA 4JOIA 3N6RA 4OO1H 3GTJH 4DK1A 4JI2Q 2UXCQ 5BR8L 4GN4B 1PH6A 2JA5H 1PFSA 3HOWH 3K7UC 1QVGA 1VQCA 1HTPA 2A69C 2KCTA 3A8JE 2PI2A 1T9HA 3DM3A 4UP7A 3PO3G 2KA7A 4YCVA 1VIGA 3CRKC 2D0OA 4JBKA 5C0XG 2E5LL 1EOVA 4QIWE 3WWVA 4X66Q 2VL6A 3QIAA 3VKEA 4DR2L 2CFMA 1CI3M 1H9KA 3CCJA 3AFQA 1IYUA 3G48A 5GAHC 1TKWB 3W1BA 2WFWA 5JEAG 2JZXA 1FJGQ 3S1NH 1D8LA 3JAMi 1CTMA 5A35A 1V43A 2CTLA 5C4XH 1AE2A 1X3GA 1QZHA 4HJ7A 5M3FH 2IHEA 3DLLA 4KN4C 1IBLL 3D31A 4HIMA 3AFPA 5LMUQ 4LFBL 1Q86C 1UWVA 3TS2A 3STBD 1A8VA 1TXYA 4LFCQ 4OGQC 3T51B 1YHBA 4ALPA 2ANNA 1DD2A 1PH4A 3MXUA 3PF5A 3MEFA 1HNXL 2NN6G 1E2VA 5FJ8H 4X64Q 2UXBL 3K7AH 2JA6H 2BE5D 1M90C 2OPVA 3H3VI 4QL5A 4KHZA 3M3YH 2I5MX 2AWNA 4LF7L 1DT4A 3J7ZC 2L5TA 2VUMH 2NVXH 3U50C 3ZJYC 3TREA 3A5UA 3ER0A 1Y8NB 4OWTB 4DKAC 4YWKA 1KRTA 4G7ZC 4LF6Q 3EN2A 1IBKL 2JQOA 4JBWA 4R1JA 3OPOA 3U1KA 4DR4L 1UE7A 4PZ6A 1M1KC 3M4OH 1VQ7A 1SMXA 1P8LA 3CPWA 2OWOA 4K0KL 3U4ZA 3E9IA 4LW1A 1VS0A 3TS0A 4G7HC 4DPGA 2KCMA 2CWPA 2VZAA 3CCMA 1NBWA 1J5EL 4OX9L 3H3VH 1HH2P 4AQYQ 1G6PA 3GD7A 4LF5Q 2PNHA 1WCMG 2JA8G 5FLMG 3OOCA 2UUBL 2R93H 1HZBA 4A3CH 3CCVA 2NVQH 1DGSA 3NBHB 1ASYA 1N33L 2GVAA 1K0RA 3ICEA 4AYBG 4JVHA 2EJMA 1WVNA 1Y1VH 1QUQB 4DR1Q 3PUXA 1YHAA 2A69D 4A3JH 4R4TA 4PZ7A 5IE8A 2MJHA 1PA6A 1N34L 2LSSA 5IP9G 5IT9c 4JC0A 2CKZB 3HOXG 1X4MA 4KMUC 3KF8B 4H44C 3RZOH 4POGA 1E1TA 4AYBE 1VIHA 3IFTA 1K8OA 2F4VL 3KDFB 1PHJA 2WAQE 4UP8A 3GQBA 3VR2A 4JI1Q 3U58A 3A5ZB 1QJOA 1Y8OB 4JI6Q 4JV5Q 3J80c 2Q2UA 4TVAB 3GTKH 2UU9L 5C44H 1PH2A 4DV3Q 4A3FH 1Z6HA 3I4NH 3T1YL 4UY8C 1WE8A 4A3BG 4A3DG 4IJHA 1A0IA 2JA9A 1EC6A 1B7YB 1VF5C 2JA7H 2LMCB 2R7FA 3I4MH 4DUYQ 4DV5L 4GN3B 2CPQA 3OTOL 1X54A 1GVPA 1GM5A 2A68D 2LXJA 1Q81C 4C3JH 2GVBA 4DAMA 2DUDA 2B29A 2AXYA 2YTXA 1JJGA 4DV7L 1VQAA 2LXKA 1IBMQ 1XNQQ 5IP7G 3PO2H 1HR0W 2PI2E 2JVZA 2MO0A 3KF6A 4LFAL 1X3FA 3KLWA 4DR7L 4A3IH 1E3PA 4DV4L 4HJ9A 1CKMA 5IWAQ 2DNCA 1GD7A 5LMNQ 2A1AA 4LF4Q 3H0GH 3IRBA 2YQRA 3RLNA 2XGTA 1YJWA 1LYLA 2DGRA 1TWAH 4GNXB 5C3EG 4MZ9A 4DV0L 2MQHA 2H5XA 3GTGH 1FGUA 4BBSG 5BN4A 3F2CA 4X6AH 4HJ8A 2CQOA 1GUSA 1HZ9A 3S1MH 3KF6B 4KKTA 1Q12A 3TEHB 5KNDA 5IYCG 1BBUA 3MXNB 3AB9A 4L5RC 1TWHH 4PZ8A 1S40A 1VQGA 1HNZQ 1YIJA 2CCZA 4GNXC 1OXUA 1MJEA 3GTLH 2UUCL 4DUZL 3PO3H 4KLKA 1XMQQ 1H9SA 3S16H 2ZJPA 1O7LA 4JI8L 2A6HC 2F3IA 4A76A 3HKSA 5IYBH 3AQQA 2JK8A 3S24A 2IX0A 4IPDA 4NPSA 2K7VA 1H9MA 5GADC 4DNIA 2BE5C 4DV1Q 3PUZA 1QVCA 1SRUA 2FMRA 4GKJL 2BL5A 4BA1I 1BVSA 1PV4A 1VQ4A 1TWFH 4OO1I 1S3OA 1UE1A 3UE1A 3CXCA 4OONA 1VF7A 3ERSX 5KNBA 2VY3A 3G4SA 4MTNA 3KOJA 3W1GA 1DXMA 1C9OA 3K0XA 2EQSA 1PVOA 4KHPQ 4IJLA 4LUZA 1X3EA 3NE5B 2PQUA 3I73A 1N32Q 2NN6H 1NMGA 1LUZA 3SDZA 2AUKA 3J81c 1VQ6A 4L5SA 2PQAA 4P74A 5ELOA 3HFZB 4X65Q 4XTCS 2ES2A 2A6ED 3HKZG 3I7FA 4NXMQ 5IY0A 2HH2A 1XJVA 4ME3A 3RLFA 4LUOA 4BXXG 1GUTA 1DCZA 5J3BA 2E2JH 3I72A 2K5VA 1W2BA 4JI4L 4DR3Q 1QVFA 2JEAI 4R4CA 4R4IA 4DV6Q 3LNNA 3DXJC 4A93H 1PH9A 1IXRA 5GQOA 4HJ5A 1A63A 5HGQA 5H1SE 2R7DA 3CD6A 4Y7NH 4GLAC 4QMFB 2CTEA 3HKZE 1JMCA 1VQ8A 4RMFA 2Q8IB 2R7ZG 2AKWB 1E24A 2RHSB 3A74A 4P71A 5IYDG 4IOCA 5K36G 2OTJA 5BR8Q 2I5LX 3HOUG 4YWMA 3WDNA 3S17H 2PQAB 3HOVG 4POFA 1GKHA 1K83H 2N3SA 2CTJA 1WCMH 2JA8H 5FLMH 4DNRB 4PV1C 1I50H 3OYYA 4B3RL 1LM0A 3GDEA 1PH7A 2UUAQ 2C35B 2QGQA 3PIPA 4A3LG 4A3KH 3S1QH 1GJXA 4DR2Q 1YNJC 3HOYG 3S2DH 4A3MG 1ZYRC 3RZDH 4IFDJ 4JI3L 4HIKA 1E2WA 1B9MA 1H9RA 5IP9H 4JYAL 1J4WA 3PUWA 3TZUA 2A6HD 4L8JA 2YTYA 3T1HL 1K1GA 2A68C 3VR3A 5BN3A 5M3MH 3OW2A 4YY3L 1X56A 5FLXc 1VQMA 3RLOA 1IBLQ 1VQEA 4HJAA 4LFBQ 1HCZA 4NB3A 3KYHC 4OWXB 2RCNA 4HR7B 4G7OC 3E9HA 2Q2TA 1Y1WH 3CP0A 1HNXQ 1CSQA 3L2PA 3GTPH 1QUQA 2DNEA 1YJNA 4IOAA 4A3BH 1NTGA 4A3DH 4JI7L 4OO1G 2UXBQ 1D7QA 4HIDA 3AEVB 3FHWA 4BY1H 1DTJA 4EQ5A 1EWHA 2EXDA 4DR6L 1CKOA 4LF7Q 4TQUS 3JAMc 2EIFA 1OTCA 2E2IH 4O2DA 4IFDG 2VQEL 2I0QA 3M4PA 2DGYA 4OXPA 3G6EA 1R9TH 1IBKQ 4YCWA 1BBWA 1Z47A 4L5TA 3J80i 1V8QA 1VQPA 1KXLA 3KDFA 4DR4Q 2HQLA 1XNRL 5IP7H 2QF7A 1HQMC 1U5KA 4H13C 4K0KQ 4B3TL 3PGZA 3J81j 2YTVA 2L15A 4QQBX 4MNOA 1E1OA 5LMNW 1TWCH 3IKJA 1K8MA 1VQLA 4X62L 5GAGC 2A8VA 3RN2A 1J5EQ 4H0LC 4OX9Q 2WAQG 4BBRG 1BDOA 3QJYA 3PUYA 2RHQB 2ASBA 4UP9A 5M3FG 2CW0C 5C3EH 2UUBQ 3ND9A 1S72A 4DV2L 2D2CC 3CRLC 5M5XH 2Y0SE 1X9NA 3RNUA 2F52A 1N33Q 4BBSH 1OXXK 4P73A 2HH3A 3M85A 1K9MC
chains in the Genus database with same CATH superfamily
2KEEA 3C1FA 1EYGA 3DM1A 2H1EA 4CJ0B 1O7YA 3CCLA 2NTTA 3CF5A 1J8IA 2UXDL 5JVG3 4R4QA 2O2LD 4G08A 3MTSA 2M6QA 5IYCH 4ID6A 4K6LA 2FMMA 2IL8A 1N34Q 4ME5A 1K3RA 3KBXA 2SNMA 4GZYC 2VS1A 1Q46A 1KHMA 4U68A 3F1ZA 3L0OA 4E9JA 1LT5D 1SROA 3NTIA 2NVTH 4NXNL 1HUNA 4QY7A 4ZYSA 1YNXA 1S5BD 1KQSA 3C3LA 2OCEA 2N49A 4B3SL 2E76C 1YNJD 2RA4A 4LNQA 3M9BA 1Q7YC 3PV0A 2NVYB 3PUVA 1YNND 4R4OA 1ZYRD 2SOBA 1Z9FA 2F4VQ 4B3RH 4EGVA 3KJPA 2K05A 2B2TC 1TY2A 1XPOA 1PH5A 2E74C 2XVSA 5C4JH 4AH6A 4S3SA 4GNXA 1CKNB 1SJHD 3EA6A 4ZLTF 2O5JC 5JOBA 1E2ZA 5ELFA 4OD6A 2K52A 2AHOB 2IW3A 5DLQE 2BA0A 3D3RA 3TQYA 3VR5A 4IUPA 1PMRA 2FXQA 2UU9Q 3CC7A 3FP9A 3C2PA 1F9PA 3BZKA 3K81C 1YI2A 2A6EC 3A8KE 5KIXA 3PIP3 1CT1D 4KJOA 4IPHA 1XTCD 1EY8A 2CH4W 4JI3H 4A3GG 4AM3A 2KENA 3T1YQ 2LY7A 2XRQD 3PQIA 5ELDA 4JYAH 1V9PA 3W5OA 4CKBA 3T56B 3UDXA 2A1SA 5ELNA 3T1HH 1JJCB 2NVYH 4IPGA 4DFAA 4DV5Q 2B8FA 3J7YW 4KKSA 3OTOQ 3RMHA 4YY3H 4ZQ3A 2ZJQA 3GTOB 4X3UA 3MXNA 3CQZH 1WTOA 1EFID 1VQJA 1E0BA 3LGJA 5FKAC 1STYA 1HA5A 1EY9A 1K8GA 4K14A 1XTDA 2PY9A 3S2HH 2R93G 5E4XA 4QIWB 4JI5L 2WB1E 4RCNA 1PH1A 5AJ3L 4DV7Q 4RKLA 3TP6A 4B08A 2VQFL 4RFBA 1VQBA 1UE6A 4GOPB 4PMCA 3HG9A 4JG2A 1PH8A 2LTMA 3MAQA 3RF2A 1LTRD 1HNWL 4LFAQ 5JJKA 1O7IA 4OIJA 2AQ3B 1CUKA 2GN5A 1AZQA 1RTOA 5LL6X 1PYWD 4LWCA 4XQNA 1PH3A 3KDGA 4QJFA 3CCEA 3Q22A 2O4CA 4DV4Q 1EWIA 2O5IC 2X69A 4JI7H 1S5CD 1K73C 4ODGA 1DM0B 4FDBA 3M4QA 4B3MQ 4P72A 1RL2A 4Q0FA 3NWTA 1SFOB 1G8ZD 3RN5A 5JJLA 1EEFD 2R7ZB 3BVGA 1TUAA 4HSVA 3AMUA 1U9RA 3UDIA 4DR6H 4LF8Q 4IURA 3HOUB 2F1MA 3A56A 4BXXH 1PLFA 1TY0A 3UDGA 3A7AB 3A55A 3HOVB 2VQEH 2HDLA 1BKBA 1SEIA 3D4RA 5EKLA 1GOZA 1Z2IA 1EQRA 4GKKL 3D6WA 4G4KA 1UEBA 4XXEA 1HZCA 4DV0Q 2K1HA 2ZQEA 4HAEA 1I94L 1H95A 5KGUA 4GOPC 1IW7D 2J4XA 1XNRH 1SE3A 2E3UA 2JJQA 2CWHA 1G291 2G9DA 4OELB 3SK8A 1MD2D 1VMCA 2P2RA 4ULLA 4JI0L 4P2CB 1CHQD 2HHHL 3BG3A 3GKUA 3CMEA 1TWGH 3J81i 3QOJA 1GUWA 2ZTCA 4B3TH 5JJZA 1L2FA 5C0XH 1KTKA 1SFOH 4KJNA 2QW7A 2HIXA 3CPFA 2CW0D 3CMAA 2CTFA 2R7ZH 5IYDH 1EIFA 2QDLA 5EKIA 4A3FG 3HOZG 2UXBQ 5K36H 2VXWA 2MO1A 2BA1A 3HOUH 3HOYB 3UI2A 3I4NG 1TU2B 4X62H 2ZM6L 2NN6I 3DWPA 4YWLA 3EIVA 3PSIA 3F2DA 5KNCA 1VCIA 3I4MG 3P75A 4XQQA 2RSOA 3E0EA 3CCQA 1HR0L 1MHWC 1RD9D 1T5XD 3OW7A 3I4OA 3J81L 1KD1C 1RIPA 5JEAH 3BDOA 4YHHL 2UUCQ 4DUZQ 4DV2H 2K5HA 3TRZA 3F2BA 5E4WC 2SDFA 4JI8Q 2VNUD 3LWUA 2F0UA 3HZXA 1A2UA 4DR5L 3P20A 1WTXA 4X3TA 3NCVA 3RR5A 1EIYB 5GROA 2XWJB 3FPPA 3VR4A 4LF9L 1N36L 1G51A 1B70B 1MIUA 4A75A 4B8CD 2JEBI 1YEZA 2NZOA 1LT6D 1GUNA 3I55A 3PO2G 3HOYH 4EC5A 2K50A 2QDBA 1QCBD 1SE2A 3FKIG 4V190 2PCFB 2HIVA 2F0IA 2E75C 3CC2A 1JB7A 1CA5A 4QUCA 1FYCA 1AE3A 2UXDH 5K5PA 1STGA 4GKJQ 3H91A 2RCFA 4KN7C 3SGIA 2O4XA 3NTKA 3G71A 4U673 5ELCA 2N88A 3ULLA 2KUMA 4IALA 3CCSA 3MVVA 2KCNA 4L5QA 5EPLA 4C3HB 1CHPD 1RODA 2AMCB 5CC4A 4ZKBB 3GTJB 2Z6KC 4NXNH 2L12A 1JJ2A 4C3IB 1SYDA 4B3SH 2R92G 2K14A 1VQNA 4JI2L 3H0GG 1HZAA 3NENA 2UXCL 1IKLA 5E3FA 2ZTDA 3JC66 2XN9C 1KL9A 3SK5A 4EQOA 1XYIA 1Q8IA 4P75A 1FNUA 1JOKA 1KDAA 1EFWA 4KD4A 4C2MB 5ISRA 4BWGB 3SR1A 1XMOQ 2F0VA 1OXSC 1MSZA 1STAA 4K8IA 2KHJA 1L0WA 4TKOB 2KVMA 5DM73 1HA6A 3CHBD 3V69A 3NQTA 5I4DA 1H9JA 1MKHA 1WJJA 4K2KA 1FVIA 4HN7A 4DK0A 2PMZE 2HCCA 3PIO3 4OWWB 2Y3MA 1A62A 3KFUA 1V1QA 3S15H 2D0PA 3L7ZC 1WYDA 1ET6A 1SNDA 1B1ZA 2EYLA 4C3IH 3K80C 4ZKCB 2FHTA 4X66L 1V1PA 1KAAA 2LRRA 1B3AA 3A0JA 4RGMA 4F87A 1YBYA 2HCIA 4CKEA 3IAYA 1NR4A 2WV6D 4C2MH 2XIWA 2V4DA 4K8JA 2J7ZA 1EY4A 4IFDH 2RF4A 2WAQB 3DHQA 4AIMA 4YCUA 4BBRB 3BDLA 4JI4Q 1FJGL 4B8TA 3BZCA 1ZZKA 1GUGA 1OXTA 2DJFC 4NDXA 4JI5H 4JVZA 1J6QA 4KK7A 3PCOB 2UUAL 5CV9A 2VQFH 3TDQA 5KYLA 4N9TA 3HOXB 1PFNA 2IT1A 4KHVA 5FLXL 3Q24A 1HNWH 5IYBG 1GXDC 2EE1A 2ZT9C 2ZJRA 1U4MA 4CGYB 3VDYA 1C48A 3QO2A 5LMUL 3MXGA 1B50A 2K4KA 1VQFA 2E5LQ 1SE4A 1I4PA 4IUUA 4G57A 1G6ZA 4LFCL 2BH2A 3M7NA 2Z4IA 3K8AA 4FF2A 4ABNA 5F2DA 3D0FA 1GHJA 1PZJD 1HPCA 3D8GA 1C7YA 4PQXA 1WOCA 4MIUA 1K3BC 1XPRA 1PRTF 3AEVA 4BBRH 1NY4A 1JOQA 3NEMA 4BY7G 1YNNC 4A3EG 3HGBA 1QNKA 1A6XA 5I9PA 3K7AB 3HS0C 2VW9A 4X64L 1B9NA 2OT2A 1TS5A 4ZUJA 4WFN3 4QMGA 4GKKH 3A8IE 3HOXH 4TRDA 1P16A 4B3RQ 5D3DA 1F2LA 2JE6I 2A19A 5JJIA 1I94H 2YU9H 1GHKA 5M9OA 1ZZIA 2B63G 1GUOA 1KIXA 3MHBA 3JAML 2XTIA 5EPKA 4JI0H 1HUMA 2D62A 2HHHH 1LTBD 2PPBC 1WVLA 1JC7A 2EVBA 3RD4A 1V8CA 2SNSA 4LF6L 4JI3Q 2QCPX 1JICA 5DNFA 2X06A 3MFYA 2ANRA 4KTAA 5LL6b 3K5OA 4JOIC 4JYAQ 4C56C 1PRTB 1NJIC 3B6YA 3KJOA 1SEBD 2ATWA 4J1MA 3T1HQ 4A3GB 4GN5A 4PMWA 3E0JA 1YVCA 2YYZA 1HR0H 4DK3C 5C6AA 5T1GA 4YY3Q 5DEHA 3EBEA 2F0KA 4YHHH 1MJCA 1VQIA 1Q8KA 2DN8A 4GS3A 2FJ2A 2G8YA 3GTMH 4DN4M 2F0GA 1VQ9A 2IX3A 1S03G 1X6OA 1Y69U 2PT7G 4DR5H 2BDOA 4BS9A 1EQQA 2MJ8A 1YITA 2JA5G 4AQYL 1Q82C 1XX8A 4LF5L 3HOWG 4LF9H 4A93G 1E22A 1N36H 2R93B 2NVQB 3ULJA 1DZ1A 1VQ5A 3J7A5 4NBQA 3TP5A 2L55A 2Z1CA 1XRHA 1ZTGA 2V1CC 4I7ZC 1ZZJA 1ONLA 3D6CA 1K8AC 4A3GH 4HIOA 1A3TA 4FVMA 4IZ8A 2K32A 3KLRA 3VR6A 4JI7Q 2PZTA 3HEJA 3L3OC 4IN3A 4EX5A 1IYJB 2F0FA 1VDZA 2WACA 2Y0SG 3GO5A 4M1UB 3SB1A 4KD3A 4DK6C 4DR1L 3BJUA 2PZWA 3H94A 4DR6Q 4DNTB 1BO0A 2EJFC 1BBXC 5M5YB 4JI2H 1JE5A 1O78A 2UXCH 2L11A 5C4ZA 2VQEQ 2AUJD 2BCOA 1IW7C 2YV5A 4OIKA 3FMCA 5IGBA 2JN4A 1ILQA 3J7AF 2NYZD 1I5FA 5C4XG 1M8AA 1XNRQ 1SE8A 1WD1A 2K5NA 3OIPA 1CKNA 4A3KG 1I6HH 3GV6A 1Y14B 2M2LA 1IKMA 4B3TQ 2KCCA 2PZUA 3TP8A 1B4OA 2F0HA 3A7LA 3X3NA 3MXPA 2KEDA 4QGUA 4KI0A 3SEBA 1AH9A 4JI1L 3M7GA 2B2VC 1I4GA 2B8GA 5EQ0A 4JI6L 4JV5L 4X62Q 4C1NK 5M5YH 4X66H 1ZKOA 4GLXA 4A3FB 3HOZB 3QG1A 3GTQH 5IGDA 1FR3A 4Z9CB 4NZRM 1F0XA 4F7XA 1UE5A 1TR5A 1JCKB 3I56A 4DV3L 3G7LA 4IQZA 1YJ9A 5M3MG 5EBDA 2FINB 1SYEA 2F0TA 2HT1A 5FJ8G 2WP8J 1L1OA 1FJGH 1QZGA 1MI2A 3I4MB 3IFDA 3WOFA 1KAWA 4DV2Q 1A15A 1KNAA 1X4NA 2DJGC 2JA6G 2D9IA 3LX0A 1HJPA 1I3QB 2UUAH 2EJGC 4DUYL 3NK9A 1RF2D 1QNUA 3EQLC 2VUMG 1VQKA 1IZ6A 3U9OA 1X65A 2IHFA 2L1BA 4RG1A 2KECA 5ELBA 4DAVA 4GOPA 2OPUA 1LO5D 2E2HB 5LMUH 2B3GA 1I6VC 2D5DA 3EVQA 4GLVB 3S14B 1IL8A 1WFQA 2NZHA 4O1NA 3PIOA 3VYUA 3VYRA 1Y1WG 3HOZH 2J0TD 2UXDQ 3PO2B 4LFCH 1LABA 4APVA 1OXVA 3K58A 1PTOF 3FKIB 1AP0A 3T53B 4KKUA 1IYVA 2RVLA 2A73B 2AWOA 2BDNA 1CSPA 1IBML 1XNQL 1Y8PB 4NMZA 1JT8A 1Q1EA 4BY1G 1QOHA 3ND8A 1KHIA 1KC8C 2WB1G 4TSSA 2R6GA 5EGTA 4NXNQ 1SNCA 2ZXRA 4RKBA 2RBMA 4A4IA 2EXZA 2BH8A 2KBNA 4B3SQ 3G6JB 1I3QH 4X64H 2RDHA 1A3UA 2L9HA 5IWAL 1EOTA 3I2ZA 5L37A 1BUVT 1D1IA 2R92B 4JBMA 1VQHA 3EFXD 1FD7D 3H0GB 5LMNL 1L1OB 2E8GA 3U4VA 1DJRD 1WTQA 4LF4L 4PNYA 3CW2C 2E2HH 3NHHA 3UDFA 3FEWX 2I5HA 3HKZB 1TWAB 3S14H 5C5LA 1TS3A 2N78A 3SK4A 5CV6A 1SYCA 1BR9A 1O7ZA 1N8RC 2LF0A 1JB3A 3FKIH 1Z7TA 1CQFA 5DAUA 2NBFA 4K5VA 4A3CG 4LF6H 1S5ED 1HNXH 1PTOB 3GABA 1WD0A 2KHIA 1QE6A 2QA4A 2MFIA 2ZXPA 1N9WA 1CQVA 4B3ML 3R8BA 3C1EA 4WJ4A 5C0XI 1Y1VG 4DR7Q 2NUCA 2MNAA 4A3JG 5HY6A 2DY7A 4LF8L 3F8TA 2QEXA 2K04A 2R92H 2Z0SA 1E7ZA 1Q1BA 2ID0A 1X3QA 1SNPA 4UPAA 1T5EA 2F0EA 1D1KA 1CK1A 3GTOH 3DMUA 2Z6KA 3DEPA 3K5NA 3FVQA 1L1OC 1J5KA 1PRTD 1KDCA 4UAIA 4JI5Q 3OETA 4AQYH 5AJ3Q 3K5MA 4LF5H 2K33A 2KQ3A 3M4YA 1CZWA 2VQFQ 1HNZL 1Q90A 4H8AA 4HMIA 5J22A 2RDGA 1NCVA 1HNWQ 4LJZC 4C1NI 4IO9A 1CFMA 1XMQL 1PYSB 2EDGA 2XWBB 4IUTA 4IUNA 4PG3A 4FJSA 2CWAA 4MHEA 1EUJA 1LTAD 2PQEA 4LAAA 1MBYA 4L63B 4LK1C 3SE0A 1XPUA 3BZDB 3DWAA 4DR1H 1C0AA 5M5WB 4LUVA 2Q2IA 4H02A 4XIGS 1AN7A 1FNVA 5C44G 1W3SA 4DV1L 1EIHA 1KRSA 1II3A 3OWEB 3UE0A 1EQTA 3PF4A 2QNDA 4BY7B 4A3MB 1LTLA 1SLJA 4JCVE 3STBC 4A3EB 3HOVH 4GKKQ 2F0QA 3K59A 5EAYA 3GR5A 4B9WA 4Y52H 4RH6A 2JA7G 1I94Q 3AYHB 2CTKA 2C9OA 1F2YA 1I4RA 4NP5A 1U0LA 2PNRC 1NMFA 3H15A 1GO3E 1VQDA 1D6EC 1W6KA 5BN5A 1ESRA 2Z8LA 3BU2A 4JI0Q 2HHHQ 2OTLA 3CCRA 2OEOA 3K57A 4JBJA 5E7NA 2B63B 4JK1C 1LACA 4C3JG 1DOMA 4WANA 2JYOA 4JVYA 1WI5A 1KDBA 4BA2I 5M5WH 1ASZA 3CAMA 2M8WA 2OQ0A 4A3LH 4JI1H 3W3AA 4LIJA 4JI6H 4KHPL 4JV5H 1PQXA 4MTKA 2R61A 2JXMB 2Q2HA 1B8AA 2ZM6Q 3BYYB 1X32A 2ZTEA 4FJUA 3VA7A 4XDXA 1IL2A 4BY7H 4A3MH 4A3EH 3S1RB 1N32L 4I7AA 4DV3H 5CR3A 1HR0Q 2IX1A 4A3IG 3T16A 4KY5A 2F3VA 1KLUD 1LTTD 3KLSA 3CC4A 4WJ3M 1X55A 4DAYB 2ALYB 3MFGA 2N8NA 4YHHQ 4O0AA 4X65L 4X3KA 3S9WA 2EYJA 4IPCA 5EKKA 3BVZA 3GV3A 4NKLA 5C0XJ 4NXML 3NELA 4J15A 2B63H 4DR5Q 1VQOA 4DUYH 1YZ6A 1XMOL 4JW0A 1UNSA 4IFDI 1ZEQX 1H9SB 4LF9Q 2K75A 3I4LA 1N36Q 2K03A 1HXYD 1FL0A 1YHQA 2JA5B 2MPMA 2FFMA 4DR3L 2CTMA 1AN8A 1SN8A 3HOWB 3CCUA 1X9ZA 1SMYC 3R2IA 5JPMC 4DV6L 2G5DA 3Q8DA 2F0SA 2XRSD 3I3CA 1QWYA 5A2QE 2IY5B 5JEAJ 1TT2A 3S1RH 5A2QW 1SR3A 1IBMH 1XNQH 3ULPA 4DXGA 1NE3A 2E2DC 4RGTA 5CORA 1PYBA 1I4HA 3NQIA 5GAEC 3T13A 4C3HH 4WALA 3K0YA 2OQKA 3U9SA 2B2WA 2Y0SB 3N6RA 4JOIA 1BQQT 5IGGA 3I90A 4OO1H 3GTJH 4DK1A 3EROA 4JI2Q 2UXCQ 1EYDA 5IWAH 1I4QA 5BR8L 5G3LF 1JWSD 3TP7A 4GN4B 1PH6A 5LMNH 1JWUD 2JA5H 5CBAE 4LF4H 1PFSA 3UOEA 1F2MA 3HOWH 3K7UC 2WIIB 1I50B 1QVGA 3NUCA 3S1NB 1VQCA 1HTPA 1J9OA 2A69C 3E3XA 2KCTA 4WORA 3A8JE 1SNQA 2PI2A 1SAPA 2B39A 1T9HA 3DM3A 3E5SA 4LFAH 4OCHA 4UP7A 5C4XB 1ICWA 2QKIC 3PO3G 5EBCA 2KA7A 4YCVA 1EWCA 5M3FB 1VIGA 3CRKC 2D0OA 2P5ZX 4JBKA 5C0XG 4CKCA 1JWMD 2GA4B 2E5LL 3S1QB 2F0NA 1M4VA 5KRUA 4B3MH 1EOVA 1BF4A 4FXGC 3H6MA 4QIWE 3WWVA 4X66Q 2VL6A 3OWFA 3QIAA 4DR2L 2CFMA 3VKEA 1CI3M 1H9KA 2OF1A 4LF8H 5IT9E 3TZDA 3AFQA 4IUQA 3CCJA 1IYUA 3G48A 5GAHC 1TKWB 5IT9W 5CBEE 4K2LA 3W1BA 1LLRD 1PTOD 1WHRA 4FO2A 2WFWA 5JEAG 2JZXA 1FJGQ 3S1NH 1SYFA 4R8IA 5M3MB 1D8LA 3JAMi 1CTMA 5A35A 2OXPA 1V43A 2CTLA 5C4XH 1RJTA 1AEXA 4DR6L 1AE2A 1X3GA 1QZHA 1UAPA 1HNZH 2JA6B 4HJ7A 4WJWA 2IHEA 3DLLA 5M3FH 1BCPF 2Q8RE 4KN4C 1IBLL 3M3YB 3D31A 3J7AK 1XMQH 4HIMA 1CZGA 3AFPA 3J80E 3D4WA 5LMUQ 2VUMB 4LFBL 2NVXB 1ENCA 1Q86C 1UWVA 3J80W 3TS2A 1JE4A 3STBD 1FGBD 1A8VA 1TXYA 4CHTB 3VYSA 4LFCQ 1C4QA 4OGQC 4RA8A 2D9UA 1D5XC 1S20A 4K6DA 3T51B 3NSWA 1RHPA 1YHBA 5ELEA 4ALPA 1Y1WB 1DD2A 2ANNA 2DY8A 1PH4A 3MXUA 3PF5A 3NBIA 3MEFA 3P7JA 1HNXL 2B2UC 4DV1H 2NN6G 1E2VA 2B2VA 1WTJA 5FJ8H 3M4OB 1NUCA 1TS2A 2TMPA 1JORA 4X64Q 2UXBL 3V2TA 2WB1B 3KBGA 2B2WC 5KYIA 3K7AH 2JA6H 2BE5D 1M90C 2OPVA 3H3VI 4QL5A 4KHZA 3M3YH 2I5MX 4OEMB 2IPKD 2AWNA 3K6OA 5NUCA 4LF7L 1DT4A 5IGEA 3J7ZC 2E2IB 2L5TA 4OL7A 2VUMH 2NVXH 2EYMA 1NXUA 3U50C 3ZJYC 3TREA 3A5UA 2VB2X 3ER0A 1Y8NB 4OHJA 5D65A 4OWTB 1B53A 4DKAC 4YWKA 1KRTA 4G7ZC 4LF6Q 3EN2A 1IBKL 1S5FD 2JQOA 4JBWA 4R1JA 3OPOA 3U1KA 3LWEA 4KHPH 2EOTA 4DR4L 1UE7A 4PZ6A 1M1KC 3VYTA 1X0AA 2FMCA 1EZ8A 3SVMA 3M4OH 1VQ7A 1EU4A 1SMXA 3WOEA 1P8LA 3CPWA 1SSOA 4J6HA 2OWOA 3QR8A 1N32H 4K0KL 3U4ZA 3BVMA 3NPPA 3E9IA 1STEA 3ERQA 4LW1A 1VS0A 1PRTC 1QILA 1R4PB 1Y1VB 1EY7A 1SMYD 3PMFA 4X65H 3TS0A 4DGZA 4A3JB 2VKCA 4G7HC 1EL0A 4DPGA 1MSGA 2RKSA 2KCMA 2CWPA 4NXMH 3KF8A 1SBBB 2VZAA 3CCMA 1NBWA 1J5EL 1STNA 4OX9L 3EJIA 1HH2P 2HD3A 3H3VH 1XMOH 4FF4A 4AQYQ 1G6PA 3GD7A 1CM9A 4LF5Q 2EY5A 2PNHA 4MN3A 1ODHA 3H3VC 1WCMG 2JA8G 5M5XB 5FLMG 3OOCA 2UUBL 4DR3H 2R93H 1HZBA 4A3CH 2PW7A 3CCVA 2NVQH 4DV6H 1UEAB 3MWYW 4CJ2C 1DGSA 3NBHB 5KEEA 1RKNA 3IL8A 3KLSX 2B2YC 1ASYA 3RZOB 5E1FA 4XQJA 1N33L 3OSOA 2GVAA 3KDKA 1K0RA 3ICEA 1D7QA 4AYBG 4JVHA 2EJMA 1WVNA 1Y1VH 4HEDA 1QUQB 4DR1Q 1HRJA 3PUXA 1YHAA 1PDQA 2A69D 4A3JH 4R4TA 4PZ7A 5IE8A 4IUVA 3C46A 2MJHA 5BR8H 1PA6A 3HP3A 3Q6SA 5CGKA 3GTKB 5IIFA 2CQAA 2F0OA 1N34L 2LSSA 5C44B 5IP9G 1IHZA 4RAUC 1DYQA 5IT9c 1QG7A 2AQ2B 4CDEC 4JC0A 2CKZB 4KY7A 3HOXG 3Q23A 3I4NB 1X4MA 3D4DA 3DEOA 1NNXA 5FK9C 4KMUC 3KF8B 2WKDA 4H44C 3RZOH 2JA7B 4POGA 1E1TA 4AYBE 1VIHA 3IFTA 1K8OA 3FPUB 4RGNA 5I6YA 2F4VL 3KDFB 4EQPA 2F0JA 1PHJA 2WAQE 1AW7A 4UP8A 4RGOS 2E5LH 3GQBA 3VR2A 1DOLA 5HGTA 4JI1Q 4C3JB 3U58A 3A5ZB 1QJOA 1Y8OB 4JI6Q 4JV5Q 5CYUA 1SDFA 3RUZA 3J80c 3BS1A 4DR2H 1EZ6A 2Q2UA 4TVAB 3GTKH 2UU9L 5C44H 1PH2A 4DV3Q 4A3FH 1Z6HA 2X6GA 4ZCKA 3I4NH 3T1YL 4UY8C 1EU3A 1WE8A 4A3BG 4A3DG 4IJHA 1A0IA 2JA9A 3O13A 1EC6A 4A3IB 1B7YB 1VF5C 2JA7H 2LMCB 2R7FA 3I4MH 5HURA 3QWNA 3R2TA 2HUGA 1U4LA 4CBVA 5LHY1 4DUYQ 1LV9A 2PMZB 4GN3B 4DV5L 3CQZB 3OTOL 2CPQA 3I91A 3MC0B 2F0MA 4EVOA 1X54A 5IGFA 2Q8TA 2Z9HA 5DM63 1GVPA 1GM5A 2A68D 4ZK9B 1IBLH 2LXJA 5G3LD 1Q81C 3S2HB 2A74C 1PZKD 1WTVA 4DAPA 2MUYA 1A2TA 4C3JH 2GVBA 4DAMA 2DUDA 2K1BA 2B29A 1D5MC 4LFBH 2AXYA 4RCOA 2A5HA 2YTXA 1JJGA 1FNWA 4DV7L 1VQAA 2NWGA 4FXKC 3H09A 2LXKA 3FAUA 1IBMQ 3J81E 1XNQQ 4PMBA 5IP7G 3PO2H 1HR0W 2PI2E 2JVZA 1BOSA 1NR2A 2MO0A 3KF6A 4V0BA 4LFAL 3J81W 5FOBB 4PDBA 1X3FA 2F3WA 3CU7A 4QUFA 4B9XA 4X3SA 3KLWA 4DR7L 5D3IB 5FO8B 1VBIA 4A3IH 3GTGB 1E3PA 2IWHA 4DV4L 3ZYYX 2UXBH 4HJ9A 1CKMA 5IWAQ 2DNCA 2F4IA 1ENFA 2M9VA 1STHA 3S1MB 1GD7A 4R8NA 5LMNQ 4I65A 2A1AA 4LF7H 4LF4Q 3QOLA 1VMPA 2MP1A 5C3XA 3H0GH 3IRBA 2YQRA 1X3PA 3RLNA 2XGTA 1YJWA 4L6TB 1TS4A 2EZVA 1LYLA 2DGRA 1QB5D 1TWAH 4GNXB 5C3EG 4MZ9A 1TWHB 3VA5A 4DV0L 1IBKH 4YIJA 2NZ1D 3GTLB 2MQHA 2H5XA 4DR4H 3PO3B 1PTOH 3GTGH 1BCPD 1FGUA 1TWGB 1I6UA 3S16B 4BBSG 1PZID 4J8QA 3SHLA 5BN4A 1PTOC 2K5DA 4CJ1B 3F2CA 4X6AH 4K0KH 4HJ8A 1R4QB 2CQOA 3URYA 1GUSA 1HZ9A 1EY0A 2MHVA 5CV7A 3KF6B 1NSNS 3S1MH 4KKTA 1Q12A 3V96A 5IGCA 3TEHB 4DU9A 5KNDA 1STBA 5IYCG 3Q0AA 4DAYA 1BBUA 1J5EH 4OX9H 3MXNB 5D14A 3AB9A 3KUPA 4UHVA 1I4XA 4L5RC 1XXGA 1TWHH 1UG8A 2LKVA 4PZ8A 1S40A 1VQGA 1PFBA 1YIJA 1HNZQ 4FYDA 3FRPB 5AFWA 2CCZA 4GNXC 1OXUA 1MJEA 1U4PA 2UUBH 3GTLH 1TWFB 2UUCL 2NTSA 4DUZL 3PO3H 4KLKA 1XMQQ 1EQVA 1H9SA 3S16H 2ZJPA 1O7LA 2HQEA 4JI8L 1PFMA 2EYPA 3TMEA 1TIID 2A6HC 1N33H 3ONAB 2F3IA 4A76A 1RTNA 3HRZC 2WKCA 3HKSA 5IYBH 2NB0A 3F2UA 2EYHA 3AQQA 2JK8A 3SXHA 3S24A 3MZ5A 1ESFA 2IX0A 1JOOA 4IPDA 2N55A 4NPSA 3KK7A 2K7VA 1H9MA 5GADC 4DNIA 2KHSA 2BE5C 2CWFA 4DV1Q 1G91A 2F0LA 1SRUA 1QVCA 3OMGA 1S5DD 3PUZA 2FMRA 4GKJL 2CVRA 2F0WA 2BL5A 2L4NA 4BA1I 2LS01 1N34H 1F9RA 1A3VA 1BVSA 1PV4A 1VQ4A 5FLXE 3E6ZX 4N8FA 4N9PA 1F9SA 1TWFH 5FLXW 4XT3B 4OO1I 1S3OA 1UE1A 3UE1A 3AU7A 3CXCA 4FP5D 2HDMA 1VF7A 4OONA 1L0YB 3ERSX 2FPHX 5KNBA 2VY3A 2F4VH 3X3MA 1B3QA 3G4SA 3R3OA 2M00A 4MTNA 3KOJA 2EY1A 1DXMA 3SK6A 3W1GA 2E2JB 3TSSA 1C9OA 1ENAA 3K0XA 2EQSA 4FXDA 3DUZA 1PVOA 4KHPQ 4IJLA 4LUZA 5JPNC 2KOLA 2PYKA 1X3EA 2XNAC 3NE5B 1V9NA 2PQUA 2K6AA 3S15B 2BOSA 3I73A 4A93B 2UU9H 1WTWA 1N32Q 1NMGA 2NN6H 1LUZA 3P1HA 4RHSA 2ZXOA 2SEBD 3SDZA 2AUKA 3OMCA 3J81c 1TQOA 1VQ6A 2PQAA 4P74A 4Y7NB 4L5SA 3T1YH 5I9OA 5ELOA 1U4RA 3HFZB 1HQRD 2AQ1B 1EYAA 3JAME 4X65Q 4XTCS 2ES2A 2A6ED 3OSSD 2B2UA 3JAMW 3HKZG 3I7FA 4NXMQ 1DONA 5IY0A 2HH2A 1BXTA 4DV5H 2EPBA 1XJVA 4ME3A 3OTOH 2PO4A 3RLFA 4LUOA 2LFNA 4BXXG 4HCEA 1GUTA 1DCZA 5IOCA 4HSPA 5J3BA 2I07B 2E2JH 2VB3X 3S17B 3I72A 3EZJA 2K5VA 1W2BA 4JI4L 5I2YA 1KABA 2EY2A 1K83B 4DR3Q 5EPJA 1QVFA 3J7AV 2JEAI 2CH4A 4R4CA 1SYGA 1WCMB 4R4IA 4DV6Q 1SNOA 5J39A 2JA8B 3LNNA 2K5WA 2RQXA 4DV7H 4QCLA 3DXJC 4A93H 1PH9A 2Z4HA 1IXRA 5GQOA 1B2TA 1L0XB 4HJ5A 1Q3LA 1A63A 5HGQA 3NWSA 3I8ZA 2X6LA 5H1SE 4F8MA 2R7DA 4Q5VA 4Y7NH 1BNZA 3ITPA 3CD6A 2CHBD 4GLAC 3FDTA 4QMFB 4DR7H 2CTEA 2QEJC 3HKZE 5DT9A 4AYBB 1JMCA 1VQ8A 2K28A 4M8AA 1EY5A 4A3KB 4RMFA 2Q8IB 1LT3D 4DV4H 2R7ZG 3V05A 2AKWB 1E24A 2RHSB 3A74A 4P71A 3W2DA 5IYDG 4IOCA 1RCVD 4DF7A 4H7BA 5K36G 2OTJA 5BR8Q 2I5LX 5LL6S 3HOUG 3S2DB 1ICFB 1D2BA 4YWMA 3BDCA 1XWEA 3WDNA 3S17H 2PQAB 3HOVG 3RZDB 1HTLD 4POFA 1GKHA 1S4ZA 1K83H 2N3SA 1DOKA 2CTJA 1WCMH 2JA8H 4FF3A 5FLMH 4DNRB 4PV1C 1I50H 3R93A 2KJXA 2FFKB 2YU9B 1W6JA 3OYYA 5I2XA 2F03A 4DV0H 4B3RL 1HFNA 1LM0A 3GDEA 2F0DA 1PH7A 1FKAH 5T1IA 2UUAQ 5COYA 1EIGA 2C35B 2QGQA 3OIQA 2I46A 3PIPA 4A3LG 4A3KH 2ICIA 3S1QH 4ILWA 2B2YA 1GJXA 4DR2Q 5TSSA 1YNJC 2JSOA 3HOYG 3S2DH 1K28A 1O80A 4A3MG 1ZYRC 3RZDH 5C5MA 1V1PB 4IFDJ 4K5XA 4JI3L 4HIKA 4K5WA 1E2WA 2TSSA 5I6WA 1B9MA 1H9RA 1EEID 2RSNA 5IP9H 4JYAL 1J4WA 3PUWA 3TZUA 2A6HD 2F0PA 4L8JA 3GTPB 2YTYA 3T1HL 1K1GA 2A68C 1EYCA 5A2QL 3OHXC 3VR3A 3TN2A 4F88A 1ET9A 4A3DB 4A3BB 5BN3A 5M3MH 2G9HD 4BY1B 3CKIB 3OW2A 4YY3L 3I0PA 1KNEA 3GTMB 5IODA 1X56A 5FLXc 1VQMA 2LTLA 3RLOA 4DA2A 1G2TA 2UUCH 1IBLQ 4DUZH 1VQEA 1G2SA 5C3WA 4HJAA 4JI8H 4RHRA 4LFBQ 5CMDA 1HCZA 4NB3A 3N52A 1BCPB 3KYHC 1K0SA 4OWXB 4FF1A 1ILPA 3NBHA 2RCNA 1SXTA 1KLGD 1MGSA 1R9TB 2ZM6H 3DWQA 4HR7B 4KV6A 1F9QA 4G7OC 3TBIB 3E9HA 2Q2TA 2MGSA 1Y1WH 3CP0A 1HNXQ 4CDDC 1CSQA 1C8CA 3L2PA 3GTPH 1QUQA 4C3HG 1SYBA 4GKJH 2DNEA 2H4OA 1YJNA 2K5QA 1LTID 4IOAA 4A3BH 1NTGA 2K01A 4XYOA 4JI7L 4A3DH 1TVXA 4HIDA 4OO1G 4ZUIA 3BYTB 3FHWA 3NTHA 3AEVB 5J1ZA 4BY1H 4WRDA 4C3IG 2R3ZA 1DTJA 1MSHA 2L0CA 4E6IA 4EQ5A 1EWHA 3I70A 2EXDA 1CKOA 3NXWA 4LF7Q 4FNFA 1PXUA 1TWCB 4HTHA 4ZAIA 1V1OA 1OO9B 4NW2A 4HCSA 1HHVA 4TQUS 3JAMc 2EIFA 1OTCA 2E2IH 1AFPA 3MA2B 4O2DA 2B2TA 4IFDG 2VQEL 2I0QA 3M4PA 2DGYA 4ZRZA 1CA6A 4N8X1 5IT9L 4OXPA 1BCPC 3G6EA 1LTSD 1NAPA 3QB3A 1R9TH 1IBKQ 4XYQA 1WTHA 4HMJA 4YCWA 1BBWA 2EYOA 3L9AX 1Z47A 5CV4A 4L5TA 5EJWA 3J80i 5C3EB 1V8QA 5CV5A 1VQPA 1KXLA 3KDFA 4DR4Q 2HQLA 1XNRL 4NZTM 5IP7H 1I6HB 4CDFC 5JVH3 2WINB 2QF7A 2CPMA 1UUPA 1HQMC 1RDPD 1HFGA 5C4HA 1U5KA 1WTPA 2ICEC 1JR0D 4H13C 3K5LA 2JP1A 2Z6BA 4K0KQ 2XSCA 4B3TL 3QD7X 1LT4D 3PGZA 2RDFA 2C5CA 2YTVA 1LTGD 2L15A 3J81j 4BBSB 4QQBX 3NP8A 4MNOA 5FO9B 4CDCC 2EYFA 1E1OA 5LMNW 4QF4A 1TWCH 4QB4A 3IKJA 1K8MA 4RWSC 1VQLA 4EQNA 3GTQB 4X62L 3J80L 5GAGC 2IJ0A 1JQYD 1SNMA 2A8VA 3RN2A 1J5EQ 4H0LC 4OX9Q 5JAVA 2WAQG 4BBRG 1BDOA 3QJYA 3A54A 4KY6A 3PUYA 1WTRA 2RHQB 2ASBA 4UP9A 5M3FG 1F2ZA 1F77A 1SJED 2CW0C 5FO7B 5C3EH 2UUBQ 3ND9A 4JI4H 1S72A 5CV8A 4JPBW 2QILA 4DV2L 2D2CC 2NVTB 3CRLC 5M5XH 2Y0SE 4XT1B 2EY6A 2ENBA 1B44D 1ML0D 1X9NA 4DXFA 4LMQD 3T4AC 1D5ZC 1ZXTA 4O42A 1EY6A 3RNUA 2F52A 1N33Q 1AZPA 4R9WA 4BBSH 3MEHA 4UDUC 2PW5A 5C4JB 1OXXK 4P73A 2HH3A 3GP7A 3M85A 1K9MC
chains in the Genus database with same CATH topology
2KEEA 3C1FA 1EYGA 3DM1A 2H1EA 4CJ0B 1O7YA 3CCLA 2NTTA 3CF5A 1J8IA 2UXDL 5JVG3 4R4QA 2O2LD 3MTSA 5IYCH 4ID6A 4K6LA 2FMMA 2IL8A 1N34Q 4ME5A 1K3RA 3KBXA 2SNMA 4GZYC 2VS1A 1Q46A 1KHMA 4U68A 3F1ZA 3L0OA 1LT5D 1SROA 3NTIA 2NVTH 4NXNL 1HUNA 4QY7A 4ZYSA 1YNXA 1S5BD 1KQSA 3C3LA 2OCEA 2N49A 4B3SL 2E76C 1YNJD 2RA4A 4LNQA 3M9BA 1Q7YC 3PV0A 2NVYB 3PUVA 1YNND 4R4OA 1ZYRD 2SOBA 1Z9FA 2F4VQ 4EGVA 3KJPA 2K05A 2B2TC 1TY2A 1XPOA 1PH5A 2E74C 2XVSA 5C4JH 4AH6A 4S3SA 4GNXA 1CKNB 1SJHD 3EA6A 4ZLTF 2O5JC 5JOBA 1E2ZA 5ELFA 2K52A 2AHOB 2IW3A 5DLQE 2BA0A 3D3RA 3TQYA 3VR5A 4IUPA 1PMRA 2FXQA 2UU9Q 3CC7A 3C2PA 3FP9A 1F9PA 3BZKA 3K81C 1YI2A 2A6EC 3A8KE 5KIXA 3PIP3 1CT1D 4KJOA 4IPHA 1XTCD 1EY8A 4A3GG 4AM3A 2KENA 3T1YQ 2LY7A 2XRQD 5ELDA 1V9PA 3W5OA 4CKBA 3T56B 3UDXA 5ELNA 1JJCB 2NVYH 4IPGA 4DFAA 4DV5Q 2B8FA 3J7YW 4KKSA 3OTOQ 3RMHA 4ZQ3A 3GTOB 2ZJQA 4X3UA 3MXNA 3CQZH 1WTOA 1EFID 1VQJA 1E0BA 3LGJA 5FKAC 1STYA 1HA5A 1EY9A 1K8GA 4K14A 1XTDA 2PY9A 3S2HH 2R93G 5E4XA 4QIWB 4JI5L 4RCNA 2WB1E 1PH1A 5AJ3L 4DV7Q 4RKLA 3TP6A 4B08A 2VQFL 4RFBA 1VQBA 1UE6A 4GOPB 4PMCA 3HG9A 4JG2A 1PH8A 3MAQA 1LTRD 1HNWL 4LFAQ 5JJKA 1O7IA 4OIJA 2AQ3B 1CUKA 2GN5A 1AZQA 1RTOA 5LL6X 1PYWD 4XQNA 4LWCA 1PH3A 4QJFA 3CCEA 3Q22A 4DV4Q 1EWIA 2O5IC 2X69A 1S5CD 1K73C 4ODGA 1DM0B 4FDBA 3M4QA 4B3MQ 4P72A 1RL2A 4Q0FA 3NWTA 1SFOB 1G8ZD 3RN5A 5JJLA 1EEFD 2R7ZB 3BVGA 1TUAA 4HSVA 3AMUA 1U9RA 3UDIA 4LF8Q 4IURA 3HOUB 2F1MA 3A56A 4BXXH 1PLFA 1TY0A 3UDGA 3A7AB 3A55A 3HOVB 2HDLA 1BKBA 3D4RA 5EKLA 1GOZA 1EQRA 4GKKL 3D6WA 4G4KA 4XXEA 1UEBA 1HZCA 4DV0Q 4HAEA 1I94L 1H95A 5KGUA 4GOPC 1IW7D 2J4XA 1SE3A 2E3UA 2JJQA 1G291 2G9DA 3SK8A 1MD2D 1VMCA 2P2RA 4ULLA 4JI0L 4P2CB 1CHQD 2HHHL 3BG3A 3CMEA 1TWGH 3J81i 3QOJA 1GUWA 2ZTCA 5JJZA 1L2FA 5C0XH 1KTKA 1SFOH 4KJNA 2HIXA 3CPFA 2CW0D 3CMAA 2CTFA 2R7ZH 5IYDH 1EIFA 5EKIA 5K36H 4A3FG 3HOZG 2UXBQ 2VXWA 2MO1A 2BA1A 3HOUH 3HOYB 3UI2A 3I4NG 1TU2B 2ZM6L 2NN6I 3DWPA 4YWLA 3EIVA 3PSIA 3F2DA 5KNCA 1VCIA 3I4MG 3P75A 4XQQA 2RSOA 3E0EA 3CCQA 1HR0L 1RD9D 1T5XD 3OW7A 3I4OA 3J81L 1KD1C 1RIPA 5JEAH 3BDOA 4YHHL 2UUCQ 4DUZQ 2K5HA 3TRZA 3F2BA 5E4WC 2SDFA 4JI8Q 2VNUD 3LWUA 2F0UA 3HZXA 1A2UA 4DR5L 3P20A 1WTXA 4X3TA 3RR5A 1EIYB 5GROA 2XWJB 3FPPA 3VR4A 4LF9L 1N36L 1G51A 1B70B 1MIUA 4A75A 2JEBI 1YEZA 2NZOA 1LT6D 1GUNA 3I55A 3PO2G 3HOYH 2QDBA 2K50A 1QCBD 1SE2A 3FKIG 4V190 2PCFB 2HIVA 2F0IA 2E75C 3CC2A 1JB7A 1CA5A 4QUCA 1FYCA 1AE3A 5K5PA 1STGA 4GKJQ 3H91A 4KN7C 3SGIA 2O4XA 3NTKA 3G71A 4U673 5ELCA 2N88A 3ULLA 2KUMA 4IALA 3CCSA 3MVVA 2KCNA 5EPLA 4C3HB 4L5QA 1RODA 1CHPD 5CC4A 2AMCB 4ZKBB 3GTJB 2Z6KC 2L12A 1JJ2A 4C3IB 1SYDA 2R92G 2K14A 1VQNA 4JI2L 3H0GG 1HZAA 3NENA 2UXCL 1IKLA 5E3FA 2ZTDA 3JC66 2XN9C 4EQOA 3SK5A 1XYIA 1KL9A 1Q8IA 4P75A 1FNUA 1JOKA 1KDAA 1EFWA 4KD4A 4C2MB 5ISRA 4BWGB 3SR1A 1XMOQ 2F0VA 1OXSC 1STAA 4K8IA 2KHJA 1L0WA 4TKOB 2KVMA 5DM73 1HA6A 3CHBD 3V69A 3NQTA 5I4DA 1H9JA 4K2KA 4DK0A 1MKHA 1FVIA 4HN7A 1WJJA 2PMZE 2HCCA 3PIO3 4OWWB 1A62A 3KFUA 1V1QA 3S15H 2D0PA 3L7ZC 1WYDA 1ET6A 1SNDA 1B1ZA 2EYLA 4C3IH 3K80C 4ZKCB 2FHTA 4X66L 1V1PA 1KAAA 1B3AA 4F87A 4RGMA 3A0JA 1YBYA 2HCIA 4CKEA 3IAYA 1NR4A 2WV6D 4C2MH 2XIWA 2V4DA 4K8JA 2J7ZA 1EY4A 4IFDH 2WAQB 3DHQA 2RF4A 4AIMA 4YCUA 4BBRB 3BDLA 4JI4Q 1FJGL 4B8TA 3BZCA 1ZZKA 1GUGA 1OXTA 4NDXA 1J6QA 4KK7A 3PCOB 2UUAL 5CV9A 3TDQA 5KYLA 4N9TA 3HOXB 1PFNA 2IT1A 4KHVA 5FLXL 3Q24A 5IYBG 1GXDC 2EE1A 2ZT9C 2ZJRA 1U4MA 4CGYB 3VDYA 1C48A 3QO2A 5LMUL 3MXGA 1B50A 2K4KA 1VQFA 2E5LQ 1SE4A 1I4PA 4IUUA 4G57A 1G6ZA 4LFCL 2BH2A 3M7NA 2Z4IA 3K8AA 4FF2A 4ABNA 5F2DA 3D0FA 1GHJA 1PZJD 1HPCA 3D8GA 1C7YA 4PQXA 1WOCA 4MIUA 1XPRA 1PRTF 3AEVA 4BBRH 1NY4A 1JOQA 3NEMA 4BY7G 1YNNC 4A3EG 3HGBA 1QNKA 1A6XA 5I9PA 3K7AB 3HS0C 2VW9A 4X64L 1B9NA 2OT2A 1TS5A 4ZUJA 4WFN3 4QMGA 3A8IE 3HOXH 4TRDA 1P16A 4B3RQ 5D3DA 1F2LA 2JE6I 2A19A 5JJIA 2YU9H 1GHKA 5M9OA 1ZZIA 2B63G 1GUOA 1KIXA 3MHBA 3JAML 2XTIA 5EPKA 1HUMA 2D62A 1LTBD 2PPBC 1WVLA 1JC7A 2EVBA 3RD4A 2SNSA 4LF6L 4JI3Q 2QCPX 1JICA 5DNFA 3MFYA 2ANRA 4KTAA 3K5OA 4JOIC 4JYAQ 4C56C 1PRTB 1NJIC 3B6YA 3KJOA 1SEBD 2ATWA 4J1MA 4A3GB 3T1HQ 4PMWA 4GN5A 3E0JA 1YVCA 2YYZA 4DK3C 5C6AA 5T1GA 4YY3Q 5DEHA 3EBEA 2F0KA 1MJCA 1VQIA 1Q8KA 2DN8A 4GS3A 2FJ2A 3GTMH 4DN4M 2F0GA 1VQ9A 2IX3A 1Y69U 1X6OA 2BDOA 4BS9A 1EQQA 2MJ8A 1YITA 2JA5G 4AQYL 1Q82C 1XX8A 4LF5L 3HOWG 4A93G 1E22A 2R93B 2NVQB 3ULJA 1DZ1A 1VQ5A 3J7A5 4NBQA 3TP5A 2L55A 2Z1CA 1ZTGA 4I7ZC 2V1CC 1ZZJA 1ONLA 3D6CA 1K8AC 4A3GH 4HIOA 1A3TA 4FVMA 4IZ8A 2K32A 3KLRA 3VR6A 4JI7Q 2PZTA 3HEJA 3L3OC 4IN3A 4EX5A 2F0FA 1IYJB 1VDZA 2WACA 2Y0SG 3GO5A 4M1UB 4KD3A 4DK6C 4DR1L 3BJUA 2PZWA 3H94A 4DR6Q 4DNTB 1BO0A 2EJFC 1BBXC 5M5YB 1JE5A 1O78A 2L11A 5C4ZA 2VQEQ 2AUJD 2BCOA 1IW7C 2YV5A 4OIKA 3FMCA 5IGBA 3J7AF 1ILQA 2NYZD 1I5FA 5C4XG 1M8AA 1XNRQ 1SE8A 1WD1A 3OIPA 2K5NA 1CKNA 4A3KG 1I6HH 3GV6A 1Y14B 2M2LA 1IKMA 4B3TQ 2KCCA 2PZUA 3TP8A 1B4OA 2F0HA 3A7LA 3X3NA 3MXPA 2KEDA 4QGUA 4KI0A 3SEBA 1AH9A 4JI1L 3M7GA 2B2VC 1I4GA 2B8GA 5EQ0A 4JI6L 4JV5L 4X62Q 4C1NK 5M5YH 1ZKOA 4GLXA 4A3FB 3HOZB 3QG1A 3GTQH 5IGDA 1FR3A 4Z9CB 4F7XA 1UE5A 1TR5A 1JCKB 3I56A 4DV3L 3G7LA 4IQZA 1YJ9A 5M3MG 5EBDA 2FINB 1SYEA 2F0TA 2HT1A 5FJ8G 2WP8J 1L1OA 3I4MB 1MI2A 1QZGA 3IFDA 3WOFA 1KAWA 4DV2Q 1A15A 1KNAA 1X4NA 2JA6G 3LX0A 1HJPA 1I3QB 2EJGC 4DUYL 3NK9A 1RF2D 1QNUA 3EQLC 2VUMG 1VQKA 3U9OA 1IZ6A 1X65A 2IHFA 2L1BA 4RG1A 2KECA 5ELBA 4DAVA 4GOPA 2OPUA 1LO5D 2E2HB 2B3GA 1I6VC 2D5DA 3EVQA 4GLVB 3S14B 1IL8A 1WFQA 2NZHA 4O1NA 3PIOA 3VYUA 3VYRA 1Y1WG 3HOZH 2J0TD 2UXDQ 3PO2B 1LABA 4APVA 1OXVA 3K58A 1PTOF 3FKIB 1AP0A 3T53B 4KKUA 1IYVA 2RVLA 2A73B 2AWOA 2BDNA 1CSPA 1IBML 1XNQL 1Y8PB 4NMZA 1JT8A 1Q1EA 4BY1G 1QOHA 3ND8A 1KHIA 1KC8C 2WB1G 4TSSA 2R6GA 5EGTA 4NXNQ 1SNCA 2ZXRA 4RKBA 2RBMA 4A4IA 2EXZA 2BH8A 2KBNA 4B3SQ 3G6JB 1I3QH 2RDHA 1A3UA 2L9HA 5IWAL 1EOTA 3I2ZA 1BUVT 1D1IA 2R92B 4JBMA 3EFXD 1VQHA 1FD7D 3H0GB 5LMNL 1L1OB 2E8GA 3U4VA 1DJRD 1WTQA 4LF4L 4PNYA 3CW2C 2E2HH 3NHHA 3UDFA 3FEWX 2I5HA 3HKZB 1TWAB 3S14H 5C5LA 1TS3A 3SK4A 2N78A 5CV6A 1SYCA 1BR9A 1O7ZA 1N8RC 1JB3A 3FKIH 1Z7TA 1CQFA 5DAUA 2NBFA 4K5VA 4A3CG 1S5ED 1PTOB 1WD0A 2KHIA 1QE6A 2QA4A 2MFIA 2ZXPA 1N9WA 1CQVA 4B3ML 3R8BA 3C1EA 4WJ4A 5C0XI 1Y1VG 4DR7Q 2NUCA 2MNAA 4A3JG 5HY6A 2DY7A 4LF8L 3F8TA 2QEXA 2K04A 2R92H 2Z0SA 1Q1BA 1E7ZA 2ID0A 1X3QA 1SNPA 4UPAA 1T5EA 2F0EA 1D1KA 1CK1A 3GTOH 3DMUA 3DEPA 2Z6KA 3K5NA 3FVQA 1L1OC 1J5KA 1PRTD 1KDCA 4UAIA 4JI5Q 5AJ3Q 3K5MA 2K33A 2KQ3A 3M4YA 1CZWA 2VQFQ 1HNZL 1Q90A 4HMIA 5J22A 2RDGA 1NCVA 1HNWQ 4LJZC 4C1NI 4IO9A 1CFMA 1XMQL 1PYSB 2EDGA 2XWBB 4IUTA 4IUNA 4PG3A 2CWAA 4MHEA 1EUJA 1LTAD 2PQEA 4LAAA 1MBYA 4L63B 4LK1C 3SE0A 1XPUA 3BZDB 3DWAA 1C0AA 5M5WB 4LUVA 2Q2IA 4H02A 4XIGS 1FNVA 5C44G 1EIHA 1W3SA 4DV1L 1KRSA 1II3A 3OWEB 3UE0A 1EQTA 3PF4A 2QNDA 4BY7B 4A3MB 4A3EB 1LTLA 1SLJA 4JCVE 3STBC 3HOVH 4GKKQ 2F0QA 3K59A 5EAYA 4B9WA 4Y52H 4RH6A 2JA7G 1I94Q 3AYHB 2CTKA 2C9OA 1F2YA 1I4RA 4NP5A 2PNRC 1U0LA 1NMFA 3H15A 1W6KA 1GO3E 1D6EC 5BN5A 1VQDA 1ESRA 2Z8LA 3BU2A 4JI0Q 2HHHQ 2OTLA 3CCRA 2OEOA 3K57A 2B63B 4JBJA 5E7NA 4JK1C 1LACA 4C3JG 1DOMA 4WANA 2JYOA 4JVYA 1WI5A 1KDBA 4BA2I 5M5WH 1ASZA 3CAMA 2OQ0A 4A3LH 3W3AA 4LIJA 4KHPL 2R61A 2JXMB 2Q2HA 1B8AA 2ZM6Q 3BYYB 1X32A 2ZTEA 3VA7A 4XDXA 1IL2A 4BY7H 4A3MH 4A3EH 3S1RB 1N32L 5CR3A 1HR0Q 2IX1A 4A3IG 3T16A 4KY5A 2F3VA 1KLUD 1LTTD 3KLSA 3CC4A 4WJ3M 1X55A 4DAYB 2ALYB 3MFGA 2N8NA 4YHHQ 4O0AA 4X65L 4X3KA 3S9WA 2EYJA 4IPCA 5EKKA 3BVZA 3GV3A 4NKLA 5C0XJ 4NXML 3NELA 4J15A 2B63H 4DR5Q 1VQOA 1YZ6A 1XMOL 1UNSA 4IFDI 1ZEQX 1H9SB 4LF9Q 3I4LA 2K75A 1N36Q 2K03A 1HXYD 1FL0A 1YHQA 2JA5B 2MPMA 4DR3L 2CTMA 1AN8A 3HOWB 1SN8A 3CCUA 1SMYC 3R2IA 5JPMC 4DV6L 3Q8DA 2F0SA 2XRSD 3I3CA 1QWYA 5A2QE 2IY5B 5JEAJ 1TT2A 3S1RH 1SR3A 3ULPA 4DXGA 1NE3A 2E2DC 4RGTA 5CORA 1PYBA 1I4HA 3NQIA 5GAEC 3T13A 4C3HH 4WALA 3K0YA 3U9SA 2OQKA 2B2WA 2Y0SB 3N6RA 4JOIA 1BQQT 5IGGA 3I90A 4OO1H 3GTJH 4DK1A 3EROA 4JI2Q 2UXCQ 1EYDA 1I4QA 5BR8L 5G3LF 1JWSD 3TP7A 4GN4B 1PH6A 1JWUD 2JA5H 5CBAE 1PFSA 1F2MA 3HOWH 3K7UC 2WIIB 1I50B 3S1NB 3NUCA 1QVGA 1VQCA 1HTPA 1J9OA 2A69C 2KCTA 4WORA 3A8JE 1SNQA 2PI2A 1SAPA 2B39A 1T9HA 3DM3A 3E5SA 4UP7A 5C4XB 1ICWA 2QKIC 3PO3G 5EBCA 2KA7A 4YCVA 1EWCA 5M3FB 1VIGA 3CRKC 2D0OA 4JBKA 5C0XG 4CKCA 1JWMD 2GA4B 2E5LL 3S1QB 2F0NA 1M4VA 5KRUA 1EOVA 1BF4A 4FXGC 3H6MA 4QIWE 3WWVA 4X66Q 2VL6A 3OWFA 3QIAA 4DR2L 2CFMA 3VKEA 1CI3M 1H9KA 2OF1A 5IT9E 3TZDA 3AFQA 4IUQA 3CCJA 1IYUA 3G48A 5GAHC 1TKWB 5CBEE 4K2LA 3W1BA 1LLRD 1PTOD 4FO2A 2WFWA 5JEAG 2JZXA 1FJGQ 3S1NH 1SYFA 4R8IA 5M3MB 1D8LA 3JAMi 1CTMA 5A35A 2OXPA 1V43A 2CTLA 5C4XH 1RJTA 1AEXA 4DR6L 1AE2A 1X3GA 1QZHA 1UAPA 2JA6B 4HJ7A 4WJWA 2IHEA 3DLLA 5M3FH 1BCPF 2Q8RE 4KN4C 3M3YB 1IBLL 3D31A 4HIMA 1CZGA 3AFPA 3J80E 3D4WA 5LMUQ 2VUMB 2NVXB 4LFBL 1ENCA 1Q86C 1UWVA 3TS2A 1JE4A 3STBD 1FGBD 1A8VA 1TXYA 4CHTB 3VYSA 4LFCQ 1C4QA 4OGQC 4RA8A 2D9UA 1D5XC 4K6DA 3T51B 3NSWA 1RHPA 5ELEA 1Y1WB 1YHBA 4ALPA 1DD2A 2ANNA 2DY8A 1PH4A 3MXUA 3PF5A 3NBIA 3MEFA 3P7JA 1HNXL 2B2UC 2NN6G 1E2VA 2B2VA 5FJ8H 3M4OB 1NUCA 1TS2A 2TMPA 1JORA 4X64Q 2UXBL 3V2TA 2WB1B 3KBGA 2B2WC 5KYIA 3K7AH 2JA6H 2BE5D 1M90C 2OPVA 3H3VI 4QL5A 4KHZA 3M3YH 2I5MX 2IPKD 2AWNA 3K6OA 5NUCA 4LF7L 1DT4A 5IGEA 3J7ZC 2E2IB 2L5TA 4OL7A 2VUMH 2NVXH 2EYMA 3U50C 3ZJYC 3TREA 3A5UA 2VB2X 3ER0A 1Y8NB 4OHJA 5D65A 4OWTB 1B53A 4DKAC 4YWKA 1KRTA 4G7ZC 4LF6Q 3EN2A 1IBKL 1S5FD 2JQOA 4JBWA 4R1JA 3OPOA 3U1KA 3LWEA 2EOTA 4DR4L 1UE7A 4PZ6A 1M1KC 3VYTA 2FMCA 1EZ8A 3SVMA 3M4OH 1VQ7A 1EU4A 1SMXA 3WOEA 1P8LA 3CPWA 1SSOA 4J6HA 2OWOA 4K0KL 3U4ZA 3BVMA 3NPPA 3E9IA 1STEA 3ERQA 4LW1A 1VS0A 1PRTC 1QILA 1R4PB 1Y1VB 1EY7A 1SMYD 3PMFA 4A3JB 4DGZA 3TS0A 4G7HC 1EL0A 4DPGA 1MSGA 2RKSA 2KCMA 2CWPA 3KF8A 1SBBB 2VZAA 3CCMA 1NBWA 1J5EL 1STNA 4OX9L 3EJIA 1HH2P 3H3VH 4FF4A 4AQYQ 1G6PA 3GD7A 1CM9A 4LF5Q 2EY5A 2PNHA 4MN3A 3H3VC 1WCMG 2JA8G 5M5XB 5FLMG 3OOCA 2UUBL 2R93H 1HZBA 4A3CH 2PW7A 3CCVA 2NVQH 1UEAB 3MWYW 4CJ2C 1DGSA 3NBHB 5KEEA 1RKNA 3IL8A 3KLSX 2B2YC 3RZOB 1ASYA 5E1FA 4XQJA 1N33L 3OSOA 2GVAA 1K0RA 3ICEA 1D7QA 4AYBG 4JVHA 2EJMA 1WVNA 1Y1VH 4HEDA 1QUQB 4DR1Q 1HRJA 3PUXA 1YHAA 1PDQA 2A69D 4A3JH 4R4TA 4PZ7A 5IE8A 4IUVA 3C46A 2MJHA 1PA6A 3HP3A 3Q6SA 5CGKA 3GTKB 5IIFA 2CQAA 2F0OA 1N34L 5C44B 2LSSA 5IP9G 1IHZA 4RAUC 1DYQA 5IT9c 1QG7A 2AQ2B 4JC0A 2CKZB 4KY7A 3HOXG 3Q23A 3I4NB 1X4MA 3D4DA 3DEOA 5FK9C 4KMUC 3KF8B 2WKDA 4H44C 3RZOH 2JA7B 4POGA 1E1TA 4AYBE 1VIHA 3IFTA 1K8OA 3FPUB 4RGNA 5I6YA 2F4VL 3KDFB 4EQPA 2F0JA 1PHJA 2WAQE 1AW7A 4UP8A 4RGOS 3GQBA 3VR2A 1DOLA 5HGTA 4JI1Q 4C3JB 3U58A 3A5ZB 1QJOA 1Y8OB 4JI6Q 4JV5Q 5CYUA 1SDFA 3RUZA 3J80c 3BS1A 1EZ6A 2Q2UA 4TVAB 3GTKH 2UU9L 5C44H 1PH2A 4DV3Q 4A3FH 1Z6HA 2X6GA 3I4NH 3T1YL 4UY8C 1EU3A 1WE8A 4A3BG 4A3DG 4IJHA 1A0IA 2JA9A 3O13A 1EC6A 4A3IB 1B7YB 1VF5C 2JA7H 2LMCB 2R7FA 3I4MH 5HURA 3QWNA 3R2TA 2HUGA 1U4LA 4CBVA 5LHY1 4DUYQ 1LV9A 2PMZB 4GN3B 4DV5L 3CQZB 3OTOL 2CPQA 3I91A 3MC0B 2F0MA 4EVOA 1X54A 5IGFA 2Q8TA 5DM63 1GVPA 1GM5A 2A68D 4ZK9B 2LXJA 5G3LD 1Q81C 3S2HB 2A74C 1PZKD 1WTVA 4DAPA 2MUYA 1A2TA 4C3JH 2GVBA 4DAMA 2K1BA 2DUDA 2B29A 1D5MC 2AXYA 4RCOA 2A5HA 2YTXA 1JJGA 1FNWA 4DV7L 1VQAA 2NWGA 4FXKC 3H09A 2LXKA 1IBMQ 3J81E 1XNQQ 4PMBA 5IP7G 3PO2H 1HR0W 2PI2E 2JVZA 1BOSA 1NR2A 4V0BA 2MO0A 3KF6A 4LFAL 5FOBB 1X3FA 2F3WA 3CU7A 4QUFA 4B9XA 4X3SA 3KLWA 4DR7L 5D3IB 5FO8B 3GTGB 4A3IH 1E3PA 2IWHA 4DV4L 3ZYYX 4HJ9A 1CKMA 5IWAQ 2DNCA 2F4IA 1ENFA 2M9VA 1STHA 3S1MB 1GD7A 4R8NA 5LMNQ 4I65A 2A1AA 4LF4Q 3QOLA 1VMPA 2MP1A 5C3XA 3H0GH 3IRBA 2YQRA 1X3PA 3RLNA 2XGTA 1YJWA 4L6TB 1TS4A 2EZVA 1LYLA 2DGRA 1QB5D 1TWAH 4GNXB 5C3EG 4MZ9A 1TWHB 3VA5A 4DV0L 4YIJA 2NZ1D 3GTLB 2MQHA 2H5XA 3PO3B 1PTOH 3GTGH 1BCPD 1FGUA 1TWGB 3S16B 4BBSG 1PZID 4J8QA 3SHLA 5BN4A 1PTOC 2K5DA 4CJ1B 3F2CA 4X6AH 4HJ8A 1R4QB 2CQOA 3URYA 1GUSA 2MHVA 1EY0A 5CV7A 1HZ9A 3KF6B 1NSNS 3S1MH 4KKTA 1Q12A 3V96A 5IGCA 3TEHB 4DU9A 5KNDA 1STBA 5IYCG 3Q0AA 4DAYA 1BBUA 3MXNB 5D14A 3AB9A 3KUPA 1I4XA 4L5RC 1XXGA 1TWHH 2LKVA 4PZ8A 1S40A 1VQGA 1PFBA 1YIJA 4FYDA 1HNZQ 3FRPB 5AFWA 2CCZA 4GNXC 1OXUA 1MJEA 1U4PA 3GTLH 1TWFB 2UUCL 2NTSA 4DUZL 3PO3H 4KLKA 1XMQQ 1EQVA 1H9SA 3S16H 2ZJPA 1O7LA 2HQEA 4JI8L 1PFMA 2EYPA 3TMEA 1TIID 2A6HC 3ONAB 2F3IA 4A76A 1RTNA 3HRZC 2WKCA 3HKSA 5IYBH 2NB0A 3F2UA 2EYHA 3AQQA 3SXHA 2JK8A 3S24A 3MZ5A 1ESFA 2IX0A 1JOOA 4IPDA 2N55A 4NPSA 3KK7A 2K7VA 1H9MA 5GADC 4DNIA 2KHSA 2BE5C 4DV1Q 1G91A 2F0LA 3OMGA 3PUZA 1QVCA 1S5DD 1SRUA 2FMRA 4GKJL 2CVRA 2F0WA 2BL5A 2L4NA 4BA1I 2LS01 1F9RA 1A3VA 1BVSA 1PV4A 1VQ4A 5FLXE 3E6ZX 4N9PA 1F9SA 1TWFH 4XT3B 4OO1I 1S3OA 1UE1A 3UE1A 3AU7A 3CXCA 4FP5D 2HDMA 1VF7A 4OONA 1L0YB 3ERSX 5KNBA 2VY3A 3X3MA 3G4SA 3R3OA 2M00A 4MTNA 3KOJA 2EY1A 1DXMA 3SK6A 2E2JB 3W1GA 3TSSA 1C9OA 1ENAA 3K0XA 2EQSA 4FXDA 3DUZA 1PVOA 4KHPQ 4IJLA 4LUZA 5JPNC 2KOLA 2PYKA 2XNAC 1X3EA 3NE5B 2PQUA 2K6AA 3S15B 2BOSA 3I73A 4A93B 1WTWA 1N32Q 2NN6H 1NMGA 1LUZA 3P1HA 4RHSA 2ZXOA 2SEBD 3SDZA 2AUKA 3OMCA 3J81c 1TQOA 1VQ6A 4Y7NB 2PQAA 4P74A 4L5SA 5I9OA 5ELOA 1U4RA 3HFZB 1HQRD 2AQ1B 1EYAA 3JAME 4X65Q 4XTCS 2ES2A 2A6ED 2B2UA 3HKZG 3I7FA 4NXMQ 1DONA 5IY0A 2HH2A 1BXTA 2EPBA 1XJVA 4ME3A 2PO4A 3RLFA 4LUOA 2LFNA 4BXXG 4HCEA 1GUTA 1DCZA 5IOCA 4HSPA 5J3BA 2I07B 2E2JH 2VB3X 3S17B 3I72A 2K5VA 1W2BA 4JI4L 5I2YA 1KABA 2EY2A 1K83B 4DR3Q 5EPJA 3J7AV 1QVFA 2JEAI 4R4CA 1SYGA 1WCMB 4R4IA 2JA8B 1SNOA 5J39A 4DV6Q 3LNNA 2K5WA 2RQXA 4QCLA 3DXJC 4A93H 1PH9A 2Z4HA 1B2TA 1IXRA 5GQOA 1L0XB 4HJ5A 1Q3LA 1A63A 5HGQA 3NWSA 3I8ZA 2X6LA 5H1SE 4F8MA 2R7DA 4Q5VA 1BNZA 4Y7NH 3ITPA 3CD6A 2CHBD 4GLAC 3FDTA 4QMFB 2CTEA 2QEJC 3HKZE 4AYBB 1JMCA 1VQ8A 2K28A 4M8AA 1EY5A 4A3KB 4RMFA 2Q8IB 1LT3D 2R7ZG 3V05A 2AKWB 1E24A 2RHSB 3W2DA 3A74A 4P71A 5IYDG 4IOCA 1RCVD 4DF7A 4H7BA 5K36G 2OTJA 5BR8Q 5LL6S 2I5LX 3HOUG 3S2DB 1D2BA 4YWMA 3BDCA 1XWEA 3WDNA 3S17H 2PQAB 3HOVG 3RZDB 1HTLD 4POFA 1GKHA 1S4ZA 1K83H 2N3SA 1DOKA 2CTJA 1WCMH 2JA8H 4FF3A 5FLMH 4DNRB 4PV1C 1I50H 3R93A 2KJXA 2FFKB 2YU9B 1W6JA 3OYYA 5I2XA 2F03A 4B3RL 1HFNA 1LM0A 3GDEA 2F0DA 1PH7A 5T1IA 2UUAQ 5COYA 1EIGA 2C35B 2QGQA 3OIQA 2I46A 3PIPA 4A3LG 4A3KH 2ICIA 3S1QH 4ILWA 2B2YA 1GJXA 4DR2Q 5TSSA 1YNJC 2JSOA 3HOYG 3S2DH 1O80A 4A3MG 1ZYRC 3RZDH 5C5MA 1V1PB 4IFDJ 4K5XA 4JI3L 4HIKA 4K5WA 1E2WA 2TSSA 5I6WA 1B9MA 1H9RA 1EEID 2RSNA 5IP9H 4JYAL 1J4WA 3PUWA 3TZUA 2A6HD 2F0PA 4L8JA