5K36G

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
236
structure length
232
Chain Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAGVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 45
structure length 232
sequence length 236
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5k36G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5k36G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5k36G03
2C35B 1YNXA 2AMCB 1XNQQ 3OW2A 4JI1Q 1CFMA 2AUKA 1TU2B 4H02A 2EVBA 4DR1Q 4G7ZC 1VQ7A 1X56A 3CD6A 1E2VA 3MEFA 2EIFA 2IHFA 1G6PA 3T1YL 2JA6G 1NMGA 3PV0A 2EXDA 3PIOA 2NVYH 4OONA 1Q81C 4LF6L 5ELOA 2A8VA 2MJHA 1DTJA 4DV4L 4AQYQ 2RHQB 2P2RA 4A3IH 1VQFA 4YWLA 1WVNA 3CF5A 1U0LA 1GKHA 2JQOA 4GKKQ 4R4QA 3PF5A 3UDFA 4PZ7A 4DV2Q 1I50H 1KHIA 1B70B 5FJ8H 1HH2P 2JE6I 4DV3L 4NXML 4YWMA 1QVFA 1HJPA 1XNRL 2R92G 3HOWG 3J7A5 3FMCA 1E3PA 1H9MA 4DR2L 2CWPA 1PH6A 1DT4A 1X65A 3CCRA 2PY9A 1VS0A 2UUAQ 1J5EQ 4OWWB 4A3GH 2CTEA 5LMNL 2ALYB 3PO2G 4DV6L 4IFDI 2JA7G 2Y0SG 5IYDG 2DNEA 2MO1A 2UUBL 2VW9A 3ERSX 4LF8Q 1CKNB 1PYSB 3K0XA 2A68C 2B63H 4DV1L 1VQ8A 4IPDA 2D5DA 1M1KC 2UU9Q 1I3QH 3FP9A 3HKZE 3RZOH 1GUOA 4DR6L 2E74C 4BA2I 2A6HD 4DK3C 1VQMA 3HOZH 3AFQA 5JJLA 2HH3A 1GD7A 2XTIA 1Q86C 4GLXA 3HOVG 2B63G 1EYGA 4WJ3M 5H1SE 2YU9H 1K0RA 1GVPA 2JA7H 4GS3A 4JYAQ 4DV0Q 1TKWB 4R4CA 2Z0SA 3I4MG 4DR5Q 3D0FA 4A3CH 1J5KA 1YZ6A 4BY1G 3KOJA 4MZ9A 2UXCL 2YQRA 1VF5C 1UE7A 2ZTCA 5JEAJ 4DV3Q 1HNXL 5C0XG 1ASZA 4NXMQ 3T56B 1X55A 1NBWA 2WFWA 2YTYA 3I4NH 2F1MA 2E5LL 1MIUA 1HPCA 3PF4A 4BXXH 1PMRA 1EC6A 4QMFB 2NVXH 1WCMH 1N33Q 4IJHA 2I5HA 1HNZL 1MJEA 1O78A 1Q90A 1Y8OB 1LYLA 1TWCH 3GQBA 1K8MA 3D4RA 3PSIA 5K36G 3I7FA 3SGIA 1H9JA 3ZJYC 5GAEC 2CTJA 4HJ9A 2QNDA 3KJOA 3UDIA 3CC7A 1CTMA 4DV5L 5IE8A 4C3IH 3F2DA 1XPRA 4IPGA 4Y7NH 4JYAL 2ES2A 1YNJC 4AM3A 4JI2L 2K32A 1SMYC 1YVCA 2Y0SE 2CFMA 3CCSA 2AWOA 4GKJQ 3HFZB 4JI1L 4KHZA 4A3JH 4ME3A 2FXQA 5J3BA 1R9TH 1Y69U 4DR4Q 2A68D 1W3SA 2RCNA 1L1OC 1EQQA 2CTKA 4RCNA 1L1OB 4YY3L 3A8JE 4A3KH 4P75A 2E8GA 4DUYL 4HJ8A 1JMCA 4UY8C 4UPAA 1SLJA 4AH6A 2UXCQ 1X3FA 5C4XH 1GO3E 5KNBA 1HR0W 1XPUA 1EOVA 1X9NA 1IW7C 5BN5A 1V43A 1V1QA 1GM5A 2ZT9C 1PVOA 1VIGA 2V1CC 5C4JH 1XMQL 2ZTDA 4LUVA 3BDOA 5ELNA 1VQOA 4GKKL 3L0OA 4IOAA 4DKAC 2K5NA 4JBWA 4GLVB 1B9MA 3GTGH 4JBKA 3S1NH 4R4OA 2R7FA 2WB1G 3JC66 1N8RC 4DR7Q 1LM0A 1VQLA 4WJ4A 4X66Q 2UUAL 4JV5Q 3K81C 4JI2Q 1GUSA 2WB1E 1I5FA 3UDXA 3DLLA 3TS2A 3A8KE 1K3RA 2AKWB 4LFAQ 1IZ6A 2KHJA 4X65L 4DNIA 3ULPA 4A3CG 4QL5A 1GHJA 3SDZA 2E3UA 4JI8L 1VQ9A 1YIJA 3E9IA 5IWAQ 1W2BA 3KLWA 4LF9Q 1UE6A 3BZKA 4PG3A 1RL2A 2K5HA 4OWXB 4P72A 5IT9c 2E76C 2YV5A 3CCLA 4JI0Q 2JA6H 2BL5A 2DN8A 2AUJD 2VQEL 5IYBH 4KLKA 2JA5H 4LUOA 1XMQQ 3ULJA 3W5OA 4DV6Q 2B29A 2KHIA 1S72A 2EQSA 2E2JH 1WYDA 2LXJA 3H15A 5GAGC 1H9SA 3K7UC 3J81j 4L5RC 1T5EA 1B7YB 2NN6I 3T53B 1VQPA 2JVZA 4A3BH 5IP9H 2F3IA 1XNQL 2RF4A 1SMXA 1IBLL 2FMRA 4YHHQ 3QJYA 1PH9A 1ZKOA 3HOXH 2UXBL 1QUQB 4EX5A 2ZTEA 2CTLA 1VQJA 4H13C 1XJVA 3TQYA 1N32L 5JJKA 2K5VA 2A6HC 4GNXB 4A3FG 3M4YA 4JVYA 5K36H 1K83H 2RHSB 1VIHA 2HIVA 4LF5L 4LF9L 1NJIC 2KCMA 1A0IA 3AYHB 3RLNA 1PA6A 1IBKL 1HTPA 1FJGQ 3KF6A 4X62L 3HOYG 2OTJA 3S14H 1SFOH 3M4PA 2YYZA 1I6HH 3GD7A 3HOXG 2PI2E 3CQZH 3KF8B 2D0PA 1PH3A 1SE8A 2VL6A 5DLQE 1HZCA 3BZCA 1K9MC 1X4NA 1TXYA 3OPOA 2NN6H 3AEVA 1Y1VG 4KHPQ 1X54A 4OX9Q 2K4KA 1H9RA 1GHKA 3J80i 5LMNW 4DV7Q 1VF7A 4DNRB 3RN5A 4B3ML 2PMZE 4GKJL 2HH2A 5C0XI 1Z6HA 1XMOQ 1X3GA 3F2BA 4JG2A 3S1MH 4LF6Q 2JEBI 1LUZA 2I0QA 4PV1C 1P16A 4LFCQ 2CCZA 1U5KA 4BBSG 4LJZC 4HJAA 2VUMG 3ER0A 4Y52H 1IYUA 1BDOA 1Q8KA 1A62A 2GVBA 3HOYH 1KRSA 2JXMB 3A5ZB 3UE0A 1PH8A 3FKIG 3CMAA 3PCOB 4HR7B 1IL2A 2N78A 4K0KQ 3KYHC 4B3RQ 4JC0A 1VQBA 1BBUA 5GADC 4GOPA 3BJUA 4UP7A 3I4MH 1TWFH 4YY3Q 2K50A 5GQOA 4PZ6A 3NE5B 4LFBQ 1PFSA 1EQRA 1OXXK 3CPWA 5IYDH 3V69A 2Q2HA 1FJGL 1EIFA 3TRZA 3JAMc 1JJGA 4DR5L 3A8IE 5FJ8G 2UUBQ 2Q2UA 1VQAA 2K52A 1YHQA 4DV0L 2EJGC 4A3LG 4A4IA 4H44C 3VR6A 1HZ9A 2JJQA 3M4QA 4LIJA 2H5XA 3U58A 3OTOQ 4DR3L 1NE3A 4C3JH 1VDZA 2BH2A 5HGQA 2KCTA 4OO1G 2MQHA 4C2MH 3JAMi 1O7IA 4LWCA 1FYCA 4QIWE 2EJMA 1N9WA 3H0GG 4B3RL 1JE5A 3S17H 4A3GG 3CP0A 4G7OC 2CKZB 3I2ZA 1SR3A 1E7ZA 4X64L 1VQIA 3GTLH 3VR4A 3OW7A 4A3EH 1KHMA 3GO5A 3GTQH 4DV4Q 2N8NA 3TEHB 1ZZIA 2OPUA 4X65Q 1YJNA 1H95A 3CCVA 1I6VC 4JI7Q 5C44G 3CRKC 2JA9A 4LW1A 2GVAA 3BU2A 4A3LH 1KL9A 3RNUA 1X6OA 4P73A 1HNZQ 3KDFA 4BBRH 4A3MH 5LMUQ 5C3EG 1FVIA 5BR8Q 2ZJRA 4TVAB 1XPOA 1TWGH 3I4NG 4GN5A 2ZM6L 3FPPA 2NN6G 1TWAH 4IFDG 2HIXA 3G48A 3PUWA 3NEMA 1EWIA 1Z47A 3F1ZA 2Q2TA 3RLOA 2IX1A 5EAYA 1EWHA 4OO1I 1IYJB 2VS1A 2F52A 1YJWA 4L5SA 1EFWA 1NTGA 1WI5A 1YJ9A 4LF8L 4IFDJ 4ALPA 2MO0A 1GUGA 4IPHA 4YHHL 3I73A 2NVQH 4QQBX 1JJ2A 2UXBQ 1VQ4A 1HQMC 3Q8DA 2ANRA 3QIAA 1L2FA 2ID0A 4MTNA 3CCEA 5M3MG 4YCVA 4DR2Q 3G71A 1QZHA 2UUCL 2JK8A 1NMFA 2QGQA 2NZOA 1YI2A 2PPBC 1IBKQ 1WFQA 5C44H 1PH2A 3CC2A 1ZZKA 4JOIA 2PI2A 4LUZA 2VUMH 1S3OA 2R7ZH 1CI3M 1ZZJA 3S2DH 2JZXA 1V8QA 2A6ED 2F4VQ 1DGSA 4JI3Q 3HOZG 2WAQE 2ZM6Q 1PHJA 4DR6Q 4JI5L 1FR3A 2B3GA 3CRLC 1Q7YC 3RLFA 2V4DA 1Q12A 3K8AA 1AE2A 1D8LA 4HIDA 2OTLA 2E75C 4A3FH 1GJXA 4KN7C 3L2PA 4JCVE 3I56A 3S2HH 4K0KL 3LNNA 1X4MA 3SE0A 3PUYA 2IX0A 1VQNA 2ASBA 1C0AA 4BA1I 4UP8A 5M3MH 2VQFQ 4KKUA 4LFAL 1JT8A 5IP9G 5M5YH 1WE8A 4NXNQ 4LFBL 4KMUC 1S40A 4A3DG 3I72A 3GTJH 2D62A 1Z9FA 5IYCH 1N33L 3IFTA 4OGQC 1ASYA 1WCMG 4HIMA 1Q82C 3QG1A 2E2HH 1Y8NB 3S24A 2R93G 2KBNA 1IXRA 1GUNA 2PQAA 1HZBA 3G6EA 3T1YQ 2OQ0A 1VQ5A 5GAHC 2JEAI 1EIYB 4LF4Q 4A3DH 1E24A 4GN4B 1QVGA 5KNDA 3T51B 1BVSA 4L5TA 3U4ZA 2QA4A 1T9HA 4DV5Q 2UUCQ 4LF7Q 3A5UA 1PH5A 2VQFL 2B8FA 2L5TA 4A75A 1RIPA 3BG3A 4POGA 3M4OH 1TUAA 1J6QA 3MXUA 5C3EH 2O5IC 2A6EC 1NY4A 1M90C 2A69C 1LTLA 2VNUD 3GTOH 1QVCA 3EQLC 4I7ZC 3LWUA 1HZAA 1L1OA 3NENA 2ANNA 2Q2IA 3W1BA 1KXLA 4H0LC 3M9BA 2BDOA 1SROA 3MFYA 1YHBA 1OXSC 2NZHA 2YTXA 4R4TA 5FLMG 3KDFB 1FL0A 2DUDA 5IP7H 4OX9L 3GTPH 3W1GA 4BY7G 4IO9A 2UXDQ 1E2WA 2AHOB 4JBJA 2MFIA 4JBMA 1O7LA 5M3FG 3VR2A 1YITA 1HNWQ 1VQCA 4O0AA 4O2DA 4C3HH 3WDNA 1UWVA 2BE5D 4G7HC 4PMWA 3EIVA 4APVA 3T1HQ 3S16H 4FDBA 4JI6L 3H3VI 2Z6KC 3CAMA 1E22A 1AE3A 2LXKA 1KC8C 1JB7A 4JI6Q 1UEBA 4JK1C 2BH8A 5M5XH 4IOCA 3KF6B 3STBD 1A6XA 4HIKA 1VQ6A 2DGYA 4IJLA 1B9NA 4YWKA 4NB3A 3UDGA 1BKBA 2IT1A 5LMUL 3E0EA 2CWAA 1PH1A 4QJFA 1YHAA 3HOUH 2E2IH 2A1AA 4X6AH 3RZDH 1Y14B 4DK6C 4EQ5A 3U1KA 1IYVA 1AH9A 5AJ3Q 1I94L 4BBRG 4A3MG 3AEVB 2AWNA 3TZUA 4BBSH 2HQLA 1Y1VH 3K80C 4YCUA 4B3SQ 3WWVA 3CCQA 4B3TQ 3KFUA 1K1GA 2DNCA 2KA7A 1PH4A 5JJIA 2E5LQ 4A3KG 1Y8PB 3MXNB 4DK1A 3PO3G 3AFPA 2F4VL 1ZTGA 5BN4A 1YBYA 3H3VH 1KAWA 1VQEA 4JI0L 1CKNA 1KIXA 1N32Q 3OYYA 2K14A 1HR0L 4WALA 3VKEA 2ZJQA 4AQYL 4A3BG 1Q1EA 4IQZA 2D2CC 1H9SB 3AQQA 2KCCA 2EJFC 4X64Q 2QEXA 3HOUG 2PQUA 1N36Q 1E1OA 4AYBE 1PYBA 1SRUA 3OTOL 1SN8A 4DR3Q 2JA8H 3A74A 2CPQA 2YTVA 2PCFB 2K75A 4UP9A 1G291 1QUQA 3LGJA 2K7VA 1H9KA 3M85A 5C0XH 1XTDA 3CPFA 1VQDA 2BE5C 4AYBG 4DV2L 4R1JA 3PGZA 3A7LA 4GNXA 3RN2A 2R7ZG 2UU9L 4BY1H 1EUJA 4A3IG 1K73C 3S15H 3M3YH 2CW0C 4LK1C 1VQHA 4B3MQ 2ATWA 2IHEA 1GUTA 3D31A 3CMEA 5BR8L 3VA7A 1FGUA 4DV1Q 4B3TL 3ICEA 2ZJPA 4NXNL 2HHHL 1PV4A 4QY7A 1N36L 5HY6A 2DGRA 4LF7L 5IP7G 1Z7TA 1WOCA 3CC4A 4BY7H 3VR5A 4DK0A 1K8AC 1YEZA 1CSQA 2I5MX 5M3FH 1QZGA 4DAMA 4JI7L 3I4LA 2LMCB 3L7ZC 1CKOA 1HR0Q 3U4VA 4DNTB 3PUXA 1L0WA 4KHPL 1DCZA 1B8AA 3HKSA 2N49A 4JI4L 1DD2A 3H0GH 4GNXC 4L5QA 3J81i 1G51A 2R92H 3HOWH 3KLRA 4RG1A 1OXUA 4JI8Q 2PNRC 3ULLA 4X66L 4XIGS 5GROA 3UE1A 2VQEQ 4A3JG 1N34Q 1KD1C 2PNHA 1OTCA 3HOVH 3DXJC 4DAYB 1Y1WG 1ZYRC 4KKTA 1V9PA 4JVHA 2GN5A 2Z6KA 3FHWA 2HT1A 4POFA 3PO2H 2D0OA 2OCEA 3EBEA 5E7NA 4DR1L 4TQUS 2IY5B 4GOPB 1K8GA 2L15A 3F8TA 4GOPC 4NBQA 2Q8IB 3A0JA 2KENA 3PUZA 5IYCG 4DUZL 3GTMH 3VDYA 1DXMA 4IPCA 1QJOA 4HIOA 3TS0A 1MKHA 2A19A 4RMFA 2HHHQ 1E2ZA 2PQAB 1OXTA 2BA1A 1TWHH 4MNOA 2B8GA 4IFDH 5BN3A 1WJJA 3I55A 4OO1H 4B8TA 3EN2A 2QF7A 4KKSA 1VCIA 1IBLQ 4HJ7A 2CTFA 1Y1WH 2JA8G 4L8JA 4A93G 1A63A 5AJ3L 1I94Q 1KRTA 3HGBA 2OQKA 3HKZG 3G4SA 4DUZQ 3AB9A 1UE1A 3DM3A 1XNRQ 4JOIC 4OXPA 3OOCA 1J5EL 2NVTH 2O5JC 3ND8A 4BXXG 3IKJA 4GZYC 4OWTB 3U9SA 1OXVA 3STBC 4DUYQ 4HJ5A 1N34L 2R6GA 1IBMQ 3PIPA 2CQOA 1XMOL 3PUVA 3S1QH 4LNQA 3VR3A 5IYBG 5FLXc 3CCJA 5IY0A 1C7YA 1PH7A 2VY3A 2LSSA 1X3EA 4B3SL 5A35A 5KNCA 2MNAA 2VZAA 3CCMA 3TREA 3I4OA 1JJCB 4J15A 2K33A 1Q1BA 1BBWA 3J80c 4NPSA 4DV7L 1K8OA 4AIMA 5JEAG 1VQKA 4A93H 3J81c 5C0XJ 4LF4L 4JV5L 3W3AA 3M7NA 4P74A 2OWOA 1CSPA 2UXDL 4KI0A 3CCUA 3GDEA 4DR7L 1ONLA 3CXCA 4TKOB 1CKMA 4P71A 3FKIH 2BA0A 3RR5A 3H94A 1D7QA 1HNXQ 4LFCL 1A8VA 2R93H 4QGUA 4KN4C 1UE5A 3K7AH 3N6RA 1E1TA 1KQSA 2WAQG 2A69D 1CUKA 3T1HL 1IBML 2EDGA 4YCWA 5IWAL 4JI3L 4DPGA 4A76A 1LACA 3B6YA 3E9HA 1MJCA 4R4IA 4GN3B 3J7ZC 1C9OA 3GTKH 1J4WA 3P20A 4PZ8A 3U50C 3F2CA 3S1RH 4XTCS 5C4XG 2CTMA 4WANA 3KJPA 3ND9A 2R7DA 3IRBA 5FLMH 3A7AB 1IW7D 1Q46A 2WP8J 3NBHB 2AXYA 1LABA 1HNWL 3NELA 2I5LX 1YNNC 5JEAH 1P8LA 2XGTA 5M5WH 4X62Q 4JI5Q 4DR4L 1HCZA 1VQGA 5LMNQ 4LF5Q 4GLAC 3PO3H 4A3EG 3CW2C 2JA5G 2OPVA 2N3SA 4JI4Q
chains in the Genus database with same CATH superfamily
2AMCB 3OW2A 2GA4B 3OETA 4H02A 4DR1Q 3IFDA 4XQQA 3MEFA 3CU7A 4C3IG 2HHHH 3T1YL 4DV4H 3PV0A 1WTRA 1RCVD 1Q81C 2X6GA 4AQYQ 2P2RA 1SEIA 3PMFA 4X3SA 3MZ5A 3GTQB 1D1IA 4R4QA 3SHLA 4DV2Q 1Y1VB 3GTLB 2F0DA 4FXGC 1HH2P 4DV3L 3DWAA 1HJPA 1KDBA 3NUCA 3FMCA 1H9MA 2CWPA 3HP3A 1DT4A 1PTOD 2RA4A 4IFDI 2ZQEA 2IWHA 2MO1A 5LL6S 2F4IA 2NWGA 4DV1L 1VQ8A 5C3XA 3S9WA 3OIPA 5C4XB 2E74C 1STEA 1TS2A 5JJLA 4DV1H 2QCPX 2UU9H 1DJRD 4ZQ3A 3D6WA 4OD6A 1K0RA 2JA7H 3DMUA 4HCSA 4DR2H 4R4CA 4OCHA 2K5WA 4DR5Q 1J5KA 2RDHA 4F87A 3KOJA 4MZ9A 5DM63 2UXCL 4C3HB 4DV3Q 1HNXL 1ASZA 3T56B 4GKKH 2CW0D 5ELCA 5C44B 3MTSA 1N33Q 4IJHA 4BY7B 3OSSD 1LYLA 1Q90A 1K8MA 3SGIA 5K36G 3VYUA 1LTID 4JI4H 2XIWA 4G57A 4EGVA 5KEEA 1CTMA 4KD4A 5EPLA 3HOUB 4BY1B 4Q0FA 4X65H 4KJOA 2CFMA 1BNZA 5EKLA 2J4XA 1EQQA 4RCNA 1X3FA 5KNBA 1I4XA 1EOVA 4NXMH 1VIGA 2V1CC 1PTOH 3BDOA 1VQOA 4IOAA 1B9MA 3S1NH 2L11A 1N8RC 1LM0A 4JV5Q 1PFNA 1I4QA 1I5FA 2EYLA 5FO9B 3TS2A 3A8KE 1K3RA 4LFAQ 1LT3D 1BUVT 1YNJD 4X65L 1HA6A 4QL5A 3SDZA 2E3UA 1VQ9A 3ITPA 3BZKA 4DV5H 5IT9c 4RAUC 1HXYD 2DN8A 2AUJD 4RCOA 4DFAA 2VQEL 5IYBH 4KLKA 1MSGA 2B29A 3S17B 2PW5A 1VMPA 2L9HA 1H9SA 3BVZA 5FOBB 5IP9H 1XNQL 2FMRA 2RF4A 1SMXA 1Q3LA 1IBLL 1N32H 1PH9A 5EKIA 5M5YB 2ZTEA 3S16B 4H13C 4Y7NB 2A6HC 4GNXB 3M4YA 1K83H 2HIVA 3AYHB 5C4HA 1IBKL 3RLNA 1PZKD 1I6HH 3GD7A 5COYA 2G9HD 2LFNA 1KNAA 1SE8A 5I2YA 2HDMA 1EY7A 3T13A 1K9MC 2PT7G 1TXYA 2WACA 3P75A 4OX9Q 3D6CA 1H9RA 1GHKA 4GKJL 4B3ML 2PMZE 1V1PB 3K57A 5C0XI 3S1MH 4FYDA 1I4GA 1TWFB 1LUZA 2JEBI 4LFCQ 1U5KA 2PW7A 1Q8KA 1BDOA 2Q8TA 3HOYH 1DZ1A 5E3FA 2JXMB 1B53A 1X32A 2N78A 2VXWA 1PDQA 4F8MA 2PMZB 4K8JA 1C4QA 1LT6D 2F0FA 3KBXA 1OXXK 4OIJA 3V69A 4A3BB 1FJGL 4ODGA 4FVMA 2Q2UA 2M8WA 2K52A 1YHQA 2EJGC 4A3LG 3V96A 4A3KB 1LTSD 2JJQA 4OL7A 1I4RA 2H5XA 3U58A 4DUYH 3DM1A 4JI6H 4LWCA 4HMJA 2EJMA 1JE5A 2K5DA 3I2ZA 1E7ZA 1VQIA 2RBMA 3GTLH 3OW7A 4A3EH 1Q8IA 4RHSA 5TSSA 1ZZIA 1UG8A 1EQTA 2OPUA 5EKKA 1KDCA 3CRKC 1TS3A 4LFAH 2B2VC 4DAYA 2BCOA 3N52A 3KDFA 4ILWA 4KTAA 5LMUQ 2K1BA 3VA5A 5BR8Q 2NVXB 4HSVA 2KJXA 2ZM6L 2SEBD 2HIXA 1TWAH 3TSSA 3NEMA 2PZUA 4CJ1B 2IX1A 4IFDG 2KVMA 1DONA 5CV4A 1ENCA 2VS1A 4IFDJ 5IYDH 1NTGA 4LF8L 4CHTB 2MO0A 3I73A 1JJ2A 1SNOA 2Z4HA 4DR5H 2IW3A 4HTHA 4DXFA 4DR2Q 2BDNA 4YCVA 1TY0A 5M3MG 1A3TA 3G71A 1NXUA 2XVSA 3NSWA 1IBKQ 5C44H 2PI2A 1ZZJA 1JOOA 2EYPA 2A6ED 2F4VQ 1G91A 2WAQE 4DR6Q 1FR3A 2B3GA 3IAYA 2K28A 1Q7YC 4EQNA 3K8AA 1Q12A 2F0KA 5C5LA 4HIDA 2E75C 4DAPA 1JICA 3SR1A 4A3FH 3S2HH 5KRUA 3PUYA 3V05A 4NBQA 2ASBA 4UP8A 1FNUA 2XRSD 4C1NI 1SYBA 1N33H 1NR2A 3KLSA 4A3DG 5IGBA 4A3MB 5IYCH 1N33L 3IFTA 3QOLA 4OGQC 1ASYA 3LX0A 4HIMA 2E2HH 3QG1A 2KBNA 3T1YQ 4B8TA 1HZBA 3R93A 4HMIA 1EIYB 1E24A 1STAA 5KNDA 3TBIB 4L5TA 2VQFL 5DT9A 4B9XA 1RIPA 1TUAA 3TP6A 3MXUA 3I70A 1NY4A 2EYOA 1F2ZA 2AQ2B 2CQAA 1LTLA 3FPUB 1TWCB 1QVCA 4CBVA 4I7ZC 5LHY1 3GTOH 1FKAH 3NENA 2KEEA 4R4TA 2NZHA 3MFYA 5FLMG 1HRJA 1KTKA 4XT3B 1E0BA 2DUDA 5IP7H 3GTPH 1E2WA 4JBMA 5M3FG 2RCFA 1J5EH 3WDNA 1D2BA 2BE5D 4G7HC 4CGYB 1EY9A 3T1HQ 3S16H 3H3VI 2Z6KC 1KC8C 4ZUJA 5K5PA 2G5DA 3MXGA 2DGYA 4AQYH 5CC4A 1B9NA 2IT1A 5LMUL 4QJFA 2E2IH 1Y14B 3BDCA 5AJ3Q 1PZJD 1TS5A 3K80C 1PXUA 1K1GA 3WWVA 3QB3A 2F03A 3SB1A 4KD3A 1F9SA 4DK1A 3FKIB 1YBYA 1KAWA 1VQEA 3HZXA 1CKNA 4IALA 1KIXA 3PO3B 1N32Q 5IT9E 4IQZA 4PQXA 4ZUIA 2D2CC 5IGFA 1CHQD 2EJFC 4X64Q 1N36Q 4A3DH 3OTOL 3OSOA 4DR3Q 1EEID 2YTVA 3U9OA 2K75A 5M9OA 4K5WA 1G291 3LGJA 2K7VA 4JPBW 4O1NA 5C0XH 4AYBG 1VQDA 3TP7A 3S15H 5IT9W 4BY1H 1K73C 3M3YH 2WIIB 4E9JA 5EPJA 1SNCA 4LFBH 2AQ1B 1M4VA 4H8AA 4N9PA 1BXTA 1PV4A 1N36L 4LF7L 5IP7G 1WOCA 1Z7TA 3EROA 4ZYSA 4JV5H 1EEFD 1K8AC 5M3FH 4DA2A 3S1QB 1CKOA 4DNTB 2B63B 1EQVA 3I8ZA 2N49A 3H0GH 1SXTA 1HUMA 4JI8Q 2VQEQ 4DR4H 2P5ZX 4A3JG 1KD1C 2PNHA 1WVLA 1SDFA 1Y1WG 5ELBA 1V9PA 3PO2H 1HR0H 1GXDC 5E7NA 4DR1L 1K8GA 2L15A 3PUZA 2ICEC 1DXMA 3M4OB 3I90A 1HHVA 4K6LA 3C2PA 1U9RA 1TWHH 4MNOA 3I55A 3EN2A 2QF7A 1IBLQ 1VCIA 1A2UA 1Z2IA 1EU3A 1A63A 5A2QL 1XNRQ 4JOIC 4OXPA 1J5EL 2WKDA 1TWGB 5D3DA 4OWTB 1IBMQ 2R6GA 2RQXA 3PIPA 2CQOA 3VR3A 3TZDA 2NUCA 5IYBG 5FLXc 3CCJA 1IKLA 3JAMW 4A93B 5A35A 2VZAA 4J15A 1BBWA 3J80c 3EVQA 3MA2B 4DAVA 2JA6B 1B2TA 4A93H 2KQ3A 3NWSA 3J81c 3J7AF 2NBFA 3BZDB 2OWOA 2UXDL 4KI0A 4IZ8A 1UNSA 3EJIA 4TKOB 3LWEA 3L3OC 3FKIH 4WFN3 1O7ZA 1D7QA 4LFCL 1A8VA 4QGUA 5EBDA 4KN4C 3K7AH 5I9OA 2WV6D 4DPGA 1LACA 4P2CB 1MJCA 3P20A 1RKNA 4XTCS 4EC5A 3KJPA 3IL8A 4UHVA 3DWPA 4PNYA 3NELA 1YNNC 3VYSA 2UXDH 1NSNS 1GOZA 1P8LA 2QEJC 1HCZA 3E3XA 4GLAC 1RODA 3CW2C 1MJEA 3GV6A 4IUVA 1XXGA 1WTWA 3URYA 4JI1Q 1C8CA 1CFMA 3OMGA 3PQIA 1TU2B 2EVBA 1VQ7A 3JAML 1E2VA 3QR8A 2FHTA 3TP5A 5LMNH 1NMGA 3PIOA 1AW7A 3K5NA 4LF6L 2A8VA 1ZEQX 1DTJA 5ISRA 2F0OA 2NVTB 4YWLA 1WVNA 3CF5A 3VYRA 3J80W 2F3VA 2X69A 3UDFA 3PF5A 2EOTA 1KHIA 3HOWG 4QB4A 4CDDC 1E3PA 5JPNC 4DR2L 1D5MC 4ULLA 1X65A 4OELB 1QG7A 2DY8A 2F0UA 3GABA 2Y0SG 4LF8Q 2UUBL 1CKNB 1PYSB 1EIHA 2A68C 1BBXC 4DR6L 2FFKB 1PRTD 3HOZH 1CK1A 2B2TA 4GLXA 1U4RA 3HS0C 4WJ3M 2YU9H 1GVPA 4XYQA 5DEHA 4GS3A 4JYAQ 5JVH3 3I4MG 1YZ6A 2YQRA 1U4LA 4R8IA 2UXBH 1AN7A 5JEAJ 2LS01 1BO0A 5G3LD 2WFWA 1NBWA 2YTYA 3R2IA 2F1MA 4A3DB 3DWQA 4QMFB 4MIUA 3BVGA 3MWYW 3G6JB 1HNZL 3J81L 2EXZA 5C3EB 1HNZH 3KJOA 1S20A 3UDIA 2R92B 4QUCA 5IE8A 1XPRA 3F2DA 3H0GB 4Z9CB 1JC7A 2F0QA 2K32A 2AWOA 1TR5A 4GKJQ 3DHQA 1Y69U 2PZWA 1ET9A 2RCNA 1PRTF 1L1OC 4NZTM 4QUFA 5IGCA 2QKIC 4P75A 2R7ZB 4UY8C 1ZYRD 1JE4A 1L0XB 4AH6A 1SLJA 1JMCA 3H3VC 5C4XH 1GO3E 2M00A 4C2MB 1XPUA 1X9NA 2JYOA 1IW7C 2ZXRA 5BN5A 5CMDA 1XMQL 4K5VA 2ZTDA 4LUVA 5ELNA 4JYAH 3L0OA 4NDXA 2K5NA 4GLVB 2UUBH 3GTGH 4JBKA 2R7FA 2WB1G 3DEOA 1RHPA 1HNXH 1VQLA 2M9VA 3KDKA 2UUAL 1TQOA 5EQ0A 3K81C 4YY3H 4JI2Q 1DM0B 2WB1E 3UDXA 2AKWB 1IZ6A 4DNIA 3ULPA 1GHJA 4EQOA 4JI8L 4RGOS 3E9IA 1J4WA 3GTMH 1UE6A 2F0MA 1RL2A 4OWXB 4LF6H 1AZQA 2FMMA 2BL5A 3MVVA 1B1ZA 2JA5H 4LUOA 1XMQQ 1F0XA 4DV6Q 2KHIA 2EQSA 2LXJA 2F0SA 3J81j 3K7UC 4L5RC 3T53B 1VQPA 3S2HB 2KEDA 2JVZA 2E2DC 1LTBD 3HOXH 1HTLD 1SYDA 1XJVA 3TQYA 4BWGB 4A3FG 1QCBD 3AU7A 3CQZB 1NJIC 2KCMA 1PA6A 1FJGQ 3HOYG 2B2VA 2Y0SB 1LLRD 2YYZA 2JSOA 1MSHA 3CQZH 2D0PA 1PH3A 1STHA 5DLQE 1R4PB 3BZCA 1Y1VG 3J80i 5LMNW 4DV7Q 4DNRB 2HD3A 1Z6HA 1XMOQ 1X3GA 3F2BA 4LF6Q 4LJZC 4HJAA 1IYUA 1A62A 3A5ZB 1PH8A 5CV8A 3CMAA 3PCOB 4HR7B 1FNVA 1IL2A 4JC0A 1EY5A 1BBUA 1JQYD 3I4MH 4YY3Q 2K50A 4TSSA 3R8BA 2XN9C 3K5LA 2Q2HA 5KYLA 3JAMc 1JJGA 1AEXA 2HDLA 4DR5L 2UUBQ 1VQAA 4DV0L 3NQTA 4H44C 1BCPF 1HZ9A 3M4QA 4KJNA 3OTOQ 4DR3L 4MTKA 3G7LA 4C3JH 4DV2H 2MQHA 4DR3H 1ICWA 3H0GG 4B3RL 3S17H 4A3GG 2CKZB 1SR3A 4XQJA 3EA6A 4I7AA 3GO5A 2CVRA 5I9PA 1XYIA 4XQNA 3HOVB 1I6VC 4LW1A 2R93B 1EYAA 3NXWA 4FJSA 1RD9D 2Q8RE 1PTOC 2ZM6H 2B2UC 2FFMA 3GTJB 4TVAB 1XPOA 1TWGH 3I4NG 1I4HA 1UEAB 3G48A 1TT2A 3L9AX 3PUWA 1Z47A 3F1ZA 3I3CA 1EWHA 3S1RB 4QF4A 2JN4A 1YJWA 4ZKBB 1EFWA 1XWEA 2CTKA 2NVQH 4K2LA 1VQ4A 2ID0A 3CCEA 5M5WB 4N8FA 2JK8A 1QWYA 2PPBC 1SNMA 1G8ZD 3OHXC 1PH2A 1CI3M 3S2DH 1DGSA 4JI3Q 4JI5L 1AZPA 3RLFA 4LF8H 2CHBD 3I56A 4KN7C 3L2PA 4JCVE 1GJXA 4EQPA 4K0KL 3LNNA 3SE0A 5FO7B 2IX0A 4C3JG 5M3MH 4KKUA 5DNFA 1S40A 1RTOA 2A73B 1Z9FA 4IUUA 5D14A 2D9UA 2I07B 3S24A 2R93G 1IXRA 1GUNA 2J7ZA 3G6EA 4LF4Q 5GAHC 5HURA 4ID6A 3OTOH 4NW2A 1SFOB 4DV5Q 4LF7Q 1QOHA 1WTJA 3A5UA 1PH5A 2B8FA 2NB0A 3GTGB 5ELDA 4A75A 3BG3A 2Z4IA 4C3HG 2M2LA 2A6EC 5JVG3 1M90C 5D3IB 2A69C 1XNQH 3EQLC 4MHEA 2JA5B 1KXLA 3M9BA 2F4VH 1OXSC 2YTXA 5F2DA 4OX9L 4BY7G 5CV5A 3W1GA 4JVZA 5CV7A 1IBKH 1HNWQ 1O7LA 1YITA 4V190 4C3HH 5IGEA 3EIVA 4XYOA 1N34H 4DN4M 4ZLTF 1XX8A 1STNA 3CAMA 1E22A 1AE3A 2LXKA 1DOKA 3RD4A 4IOCA 3KF6B 2G9DA 4NB3A 3UDGA 4ZKCB 1PH1A 1YHAA 3HOUH 1I3QB 4X6AH 2RSOA 4BS9A 5CV6A 3MHBA 4O42A 4B3SQ 3S1NB 1V9NA 2KA7A 1FGBD 2MP1A 2E5LQ 4A3KG 1Y8PB 2F0LA 3MXNB 3PO3G 1M8AA 3AFPA 3RZDB 3H3VH 5KGUA 4DF7A 3OYYA 2K14A 3RMHA 2ZJQA 2NYZD 4A3BG 1Q1EA 4BBSB 2KCCA 2F0IA 2F3WA 4YIJA 1EL0A 2PQUA 1E1OA 2JA8H 3A74A 2PCFB 1QUQA 1B44D 2EE1A 3M85A 1PVOA 3CPFA 2R7ZG 1F9QA 3RN2A 1CA5A 4C3IB 5C4ZA 4B3MQ 4C1NK 1GUTA 2IL8A 1Y1WB 4LMQD 2L4NA 1BCPB 2I5MX 5C5MA 1HR0Q 3U4VA 4KHPL 2NTTA 2VB3X 1DD2A 1G51A 3HOWH 4X66L 1IBML 1EIGA 4XIGS 5GROA 3UE1A 3HOVH 4KKTA 2A74C 3SK5A 2JA7B 2LKVA 2HT1A 3FHWA 4XT1B 4POFA 1V1OA 2D0OA 2OCEA 3E0JA 3EBEA 4TQUS 4XDXA 4GOPB 4J1MA 2KENA 1SMYD 1K83B 2DY7A 4HSPA 1QJOA 2Z1CA 5IODA 4RMFA 2HCCA 2HHHQ 1E2ZA 3NQIA 3X3NA 1LO5D 4IFDH 2MGSA 4OO1H 2JA8G 4JI5H 4NKLA 1I94Q 2OQKA 3HKZG 1DYQA 3DUZA 4R9WA 3NCVA 4K8IA 1N36H 5DAUA 4GZYC 2K1HA 1A2TA 3STBC 4DUYQ 3NTHA 3S1QH 4LNQA 1V1PA 1UUPA 1WTOA 2VY3A 2LSSA 4B3SL 5KNCA 2F0VA 2MNAA 2K01A 2K33A 1JWUD 3QOJA 4NPSA 4DV7L 3K7AB 1RDPD 4AIMA 5M3MB 1VQKA 5CV9A 4JV5L 1WTVA 1CSPA 4DR7L 1RJTA 1EU4A 2BA0A 4S3SA 3UI2A 5M3FB 4NZRM 1PRTB 3BVMA 2AQ3B 2A69D 1CUKA 2B63H 1LT5D 2EDGA 2ZXOA 2WINB 3A54A 3E9HA 4CKEA 3T1HH 4KY7A 4IUNA 2C5CA 3F2CA 2LRRA 5C4XG 1KNEA 1NAPA 4F7XA 4OX9H 2CTMA 4M8AA 4WANA 2R7DA 4RFBA 3IRBA 1PTOB 1IW7D 1Q46A 3UOEA 1B3QA 2I5LX 5JEAH 2XGTA 4JI5Q 4LF5Q 4A3EG 1O7YA 1W6JA 2N3SA 4C56C 1JR0D 2ZXPA 1JORA 4PMBA 2AUKA 5T1GA 3BDLA 4G7ZC 3CD6A 2EIFA 3D3RA 1G6PA 2EXDA 3H6MA 2KCNA 2NVYH 2MJHA 4DV4L 3T1YH 3T16A 4FXDA 1S5FD 1VQFA 1CZGA 1GKHA 1U0LA 4GKKQ 2WKCA 3Q6SA 1I6HB 2F0PA 5IIFA 1I50H 5FJ8H 2OT2A 4NXML 1WTXA 1ML0D 2HH3A 1PH6A 3HKZB 3CCRA 4FJUA 1J5EQ 4A3GH 5LMNL 3PO2G 2JA7G 2DNEA 2ANNA 4FNFA 3ERSX 3KFUA 3RZOH 4IPDA 2D5DA 3QWNA 2UU9Q 1I3QH 3HKZE 5C6AA 4BA2I 4DK3C 3AFQA 2XTIA 1Q86C 1BR9A 3HOVG 2B63G 1EYGA 3FDTA 3I91A 1BCPC 5H1SE 2LTLA 2EY1A 1TKWB 4RKBA 3WOEA 4A3CH 3D0FA 4BY1G 2EYHA 2ZTCA 4NXMQ 5C0XG 3I4NH 2UXCH 4CKCA 1F2YA 1MIUA 4BXXH 5E4XA 1EC6A 3PSIA 4FF3A 3GQBA 3ZJYC 3I7FA 5GAEC 1H9JA 2CTJA 3SK6A 4C3IH 4IPGA 4Y7NH 1CQVA 2ES2A 4JYAL 1SMYC 1YVCA 2Y0SE 3CCSA 3S14B 1K28A 3GTPB 4A3JH 3PO2B 1R9TH 2FXQA 4YHHH 2L55A 4X62H 2A68D 1F9RA 4A3KH 3A8JE 4K5XA 2E8GA 3TMEA 2UXCQ 3PIP3 1HR0W 3K5MA 4DV3H 1GM5A 2F0JA 1ENAA 4JI8H 4GKKL 4A3EB 3CHBD 5NUCA 4JBWA 4R4OA 2XSCA 1WTPA 3JC66 3C46A 4WJ4A 1JWMD 4WJWA 3GTMB 1S5CD 2IX3A 1QE6A 3DLLA 3NTKA 1PQXA 2KHJA 1TY2A 1ZXTA 1SYEA 1YIJA 1W2BA 5IWAQ 3KLWA 3CCLA 4P72A 2JA6H 1EY4A 3HOYB 3J81W 5ELFA 3ULJA 1HQRD 5GAGC 3U1KA 1B7YB 1T5EA 2NN6I 4ZAIA 1WTQA 2MUYA 2F3IA 1ESRA 3QJYA 5E4WC 1ZKOA 5FKAC 4HEDA 4EX5A 2CTLA 1VQJA 5JJKA 2Z9HA 1WD1A 5K36H 2RHSB 1VIHA 2ENBA 1SAPA 4LF9L 2OTJA 3PIO3 3KF6A 5I2XA 3M4PA 5CORA 5M5XB 1KLGD 1NR4A 4V0BA 3KF8B 2B2UA 2EY6A 4FF4A 1X4NA 3OPOA 4X3KA 3AEVA 4CDEC 1X54A 2K4KA 1B4OA 4DXGA 3RN5A 2HH2A 2VQEH 2A1SA 2PQEA 2K03A 3Q22A 3BS1A 2I0QA 4PV1C 4BBSG 2CCZA 1EZ6A 5J22A 1U4PA 1KRSA 2CH4A 3UE0A 2VUMB 3R2TA 3J80L 4K0KQ 4KY5A 4B3RQ 1VQBA 5CR3A 3NP8A 2NVYB 4GOPA 1QNUA 2CWHA 4A3JB 3NE5B 3A55A 1PFSA 4LFBQ 1EQRA 1GUWA 3TRZA 3D4DA 3A8IE 4H7BA 1TIID 4A4IA 3VR6A 3EZJA 3J81E 1NE3A 1VDZA 2BH2A 2KCTA 1A3VA 1FYCA 4X64H 4TRDA 1N9WA 5JJZA 3CP0A 4E6IA 2F0WA 3VR4A 1X3QA 1KHMA 5J39A 1CZWA 3TEHB 4RGMA 3HOXB 3S1MB 2XNAC 4X65Q 1H95A 4A3GB 3CCVA 2E5LH 3M7GA 4J8QA 4JI7Q 1J8IA 2JA9A 3BU2A 1WHRA 3RNUA 5KYIA 5C4JB 4ZK9B 4BBRH 1STBA 1MD2D 4KK7A 2QNDA 3K5OA 1UAPA 1AFPA 5EAYA 5IOCA 4OO1I 1IYJB 4L5SA 1WI5A 1YJ9A 4ALPA 4IPHA 4QQBX 3Q24A 5FLXL 3DEPA 3QIAA 1ICFB 1STYA 2QGQA 1YI2A 2OEOA 4JOIA 4LUZA 5G3LF 2R7ZH 1TS4A 2JZXA 1RF2D 1SE4A 1V8QA 4CJ2C 5A2QW 1QNKA 1WCMB 5LMUH 2B2TC 2OTLA 1AE2A 3BYTB 5ELEA 3MAQA 3ERQA 1C48A 1OO9B 4JI7H 1PYWD 4XXEA 3TP8A 4KHPH 2SNSA 1C0AA 4BA1I 4HN7A 2VQFQ 1JT8A 5IP9G 5I4DA 3I72A 4B08A 1Q82C 4N9TA 2PQAA 4JI6Q 2OQ0A 1SSOA 3X3MA 2JEAI 4UDUC 2QA4A 1BVSA 2UUCQ 4KHPQ 1T9HA 4K2KA 1BQQT 4POGA 1J6QA 4I65A 4ZCKA 1WD0A 1L1OA 3W1BA 3O13A 2BDOA 3P1HA 1EYDA 3KDFB 4IO9A 4JBJA 4O2DA 1PTOF 2SNMA 4RHRA 5IT9L 1EYCA 1G6ZA 4APVA 4JI6L 4X3UA 3M3YB 2BH8A 3STBD 1A6XA 1S4ZA 3V2TA 4IJLA 1G2SA 4YWKA 1BKBA 2FJ2A 2CWAA 3KF8A 2A1AA 3RZDH 4DK6C 1MBYA 4EQ5A 1AH9A 4DGZA 1I94L 4A3MG 1EY0A 2RDGA 3AEVB 2AWNA 2OF1A 3TZUA 4BBSH 1Y1VH 3CCQA 4B3TQ 1EY8A 2DNCA 1PH4A 5DM73 3NWTA 5JJIA 2KUMA 1EZ8A 2J0TD 1JB3A 1ZTGA 1JOKA 5BN4A 3R3OA 4JI0L 3Q0AA 1KABA 4WALA 3VKEA 1LTAD 2IJ0A 4KV6A 1H9SB 3AQQA 1JWSD 3FAUA 2MPMA 3HOUG 2N55A 2CPQA 1HFGA 1H9KA 1PZID 5CYUA 1XTCD 4DV2L 1EFID 4GNXA 4R1JA 3PGZA 2UU9L 3A56A 4A3IG 1BF4A 2CW0C 4X3TA 4B3TH 2ATWA 2IHEA 1F9PA 3D31A 3VA7A 3ICEA 4B3TL 2ZJPA 4JI3H 1STGA 4PMCA 1I50B 5HY6A 2DGRA 2EZVA 4A3FB 3CC4A 3CKIB 4CJ0B 1YEZA 1CSQA 1LTTD 3I4LA 2LMCB 4JI7L 2H4OA 1B8AA 4LFCH 4JI4L 4GNXC 4L5QA 2B2WA 3GTKB 2E2JH 4OHJA 1XMOH 1OTCA 1QB5D 4JVHA 2E2JB 2D9IA 3F8TA 2Q8IB 3A0JA 4DUZL 3HG9A 2A19A 1JOQA 1K3BC 2PQAB 2RKSA 2B2WC 3MFGA 3K59A 2K04A 5BN3A 3KBGA 4KKSA 4CDFC 1KRTA 1SNQA 3HGBA 1IKMA 5D65A 1DOLA 2SOBA 3AB9A 4DUZQ 3OOCA 3ND8A 4BXXG 4G4KA 1OXVA 4DV6H 1N34L 3PUVA 5IWAH 1C7YA 1X3EA 3VYTA 1JJCB 2DJGC 4WRDA 2FMCA 1K8OA 5JEAG 2L1BA 5IGDA 5JPMC 4P74A 3GV3A 1SE3A 2HUGA 3CXCA 4P71A 1I4PA 3H94A 1SYCA 1KLUD 1HNXQ 2R93H 1PRTC 1SEBD 1UE5A 1E1TA 1CQFA 4YCWA 4JI3L 3J7ZC 1CM9A 4PZ8A 3U50C 2K6AA 2E2IB 1PFBA 3H09A 3MXNA 3ND9A 5FLMH 1MSZA 3FRPB 1MHWC 2Z8LA 3SK4A 3NBHB 2EYFA 1LABA 1SJED 3NK9A 4X62Q 4DR4L 3S15B 2JA5G 2C35B 1YNXA 1XNQQ 2EPBA 5LL6b 1SNDA 4IUTA 1V8CA 3NHHA 5JOBA 3ZYYX 4DR1H 1X56A 3NBIA 1X3PA 2XRQD 5C3WA 2IHFA 4A3IB 4LF7H 1ET6A 2JA6G 4OONA 5ELOA 2TSSA 5E1FA 2RHQB 3NTIA 4A3IH 4CKBA 2JQOA 4PZ7A 1B70B 1HA5A 1QVFA 5JAVA 1WTHA 2JE6I 1XNRL 1D1KA 4YWMA 4UAIA 2R92G 3J7A5 2E2HB 1VS0A 2UUAQ 4ZRZA 2EYJA 4OWWB 1HNWH 2CTEA 2ALYB 4FXKC 4DV6L 2G8YA 4J6HA 2O4CA 2VW9A 3K0XA 3M4OH 1M1KC 4JI2H 3FP9A 1A3UA 2CPMA 2XWBB 1GUOA 4PDBA 2A6HD 1VQMA 1GD7A 3KK7A 2SDFA 5EJWA 4MN3A 4DV0Q 2Z0SA 4FF1A 4QIWB 1LTRD 3K0YA 1ODHA 1VF5C 1UE7A 1MGSA 1X55A 1NCVA 4B9WA 2E5LL 1HPCA 3PF4A 1PMRA 2NVXH 1WCMH 2I5HA 1EY6A 4FP5D 4C3JB 1O78A 1Y8OB 2FINB 1TWCH 5IYDG 3GTOB 3D4RA 2KHSA 1SNPA 4HJ9A 3HOWB 5L37A 3CC7A 4DV5L 3AMUA 3HEJA 1YNJC 4AM3A 3MC0B 4JI2L 5CGKA 3HFZB 4JI1L 4KHZA 4LF5H 4ME3A 5J3BA 3KUPA 1SYGA 2XWJB 1W3SA 1L1OB 4YY3L 1F2MA 4DUYL 4HJ8A 4UPAA 1B50A 4K6DA 3C1EA 3J80E 1BCPD 2F0NA 3D4WA 1V43A 1V1QA 4IURA 2ZT9C 5C4JH 2B2YC 4DKAC 1FD7D 2JA8B 1MI2A 4DR7Q 4LAAA 1EOTA 4X66Q 1D5ZC 4HCEA 5FLXE 1GUSA 3NBHA 4IUPA 3E5SA 5FO8B 3P7JA 1CHPD 4B3MH 1L0YB 1PFMA 2I46A 4LF9Q 4PG3A 4IUQA 2K5HA 2E76C 2YV5A 4JI0Q 3D8GA 1D5XC 3W5OA 1S72A 1WYDA 4R8NA 3H15A 3ONAB 1XNRH 4A3BH 5KIXA 3SVMA 1AP0A 4YHHQ 3J7YW 2UXBL 3GR5A 5EBCA 2OXPA 1QUQB 3KDGA 1VMCA 1N32L 1IBLH 2K5VA 2PZTA 4WORA 4JVYA 4RH6A 2QW7A 4LF5L 4JI1H 1A0IA 2VB2X 1HTPA 4X62L 4DR6H 3S14H 1SFOH 2Y3MA 3HOXG 2PI2E 4RGNA 1LT4D 2VL6A 3Q23A 2M6QA 5HGTA 1HZCA 1EWCA 1ILPA 2K5QA 2NN6H 5T1IA 2NTSA 1XMQH 1VF7A 4JG2A 2LTMA 1P16A 3EFXD 4LF9H 1AN8A 4Y52H 2VUMG 4OIKA 2GVBA 1QILA 5CBEE 2QDLA 3FKIG 3KYHC 1TWAB 5GADC 3BJUA 4UP7A 4NP5A 1TWFH 1CT1D 3S2DB 1FJGH 5GQOA 2EY5A 4PZ6A 2KECA 3CPWA 4ABNA 1EIFA 2WB1B 5CBAE 5FLXW 5FJ8G 5EGTA 1DOMA 4LIJA 2CWFA 4EVOA 5HGQA 4OO1G 4C2MH 3RZOB 3TDQA 3T4AC 1O7IA 3JAMi 1YNND 4QIWE 2X6LA 3QO2A 1T5XD 4G7OC 5I6YA 4X64L 3KLSX 1X9ZA 2LF0A 2JP1A 3GTQH 4NXNH 4DV4Q 2N8NA 1SJHD 3OWEB 2B2YA 4GKJH 4CDCC 3TN2A 2IPKD 3W2DA 4U673 1YJNA 1CA6A 5C44G 3K58A 4A3LH 2GVAA 1KL9A 1B3AA 1X6OA 4P73A 1HNZQ 1IL8A 2NZ1D 4F88A 4A3MH 5C3EG 1FVIA 2ZJRA 4X66H 2EYMA 4B3RH 4GN5A 4OEMB 3FPPA 1SBBB 1SYFA 2NN6G 1F77A 2Q2TA 2PY9A 5LL6X 1EWIA 3RLOA 3HRZC 2F52A 1K0SA 4YHHL 1GUGA 3E6ZX 2UXBQ 3FVQA 2A5HA 1HQMC 3Q8DA 2ANRA 1L2FA 3OMCA 4MTNA 2O2LD 4DV0H 1R9TB 1QZHA 2UUCL 1NMFA 2NZOA 3CC2A 1ZZKA 1WFQA 5EPKA 2QILA 2VUMH 1S3OA 3HOZG 1HUNA 2F0TA 2ZM6Q 1IHZA 1PHJA 3CRLC 2V4DA 1D6EC 1D8LA 4L63B 2R3ZA 1X4MA 2UUAH 1VQNA 2R61A 1LTGD 4B8CD 4LFAL 5M5YH 2UUCH 1WE8A 4NXNQ 2RDFA 4KMUC 4RWSC 1FNWA 3GTJH 4FO2A 3J7AV 2D62A 1BOSA 4BBRB 1S03G 1WCMG 2DJFC 1Y8NB 2O4XA 4LFBL 2ICIA 1VQ5A 1I94H 3C1FA 4RGTA 1II3A 4GN4B 1QVGA 2WAQB 3T51B 3U4ZA 1PLFA 2Z6BA 1ESFA 3I4NB 3C3LA 2L5TA 1RTNA 2YU9B 5C3EH 2O5IC 3OIQA 2F0GA 2F0HA 2VNUD 1G2TA 1HZAA 3LWUA 2Q2IA 4H0LC 1YHBA 1SROA 3RUZA 1FL0A 2UXDQ 3H91A 2AHOB 2MFIA 2NVQB 1HFNA 3VR2A 1VQCA 4O0AA 1TVXA 1UWVA 4PMWA 4RA8A 4FDBA 1VBIA 4KY6A 1JB7A 1UEBA 3I4MB 4JK1C 5M5XH 2PYKA 3QD7X 5FK9C 4HIKA 1NUCA 4IN3A 1VQ6A 1S5BD 3E0EA 4L6TB 5BR8H 1IYVA 1R4QB 4BBRG 2MJ8A 2HQLA 4KHVA 4YCUA 5A2QE 3GKUA 2HQEA 2MHVA 4HAEA 2F4VL 1JCKB 5IGGA 1HR0L 4AQYL 1ILQA 1IBMH 3F2UA 2QEXA 3JAME 3SK8A 4AYBE 1PYBA 1SRUA 1SN8A 3HOZB 1SE2A 2RVLA 3SEBA 2VKCA 4UP9A 2FPHX 3BYYB 2EY2A 2VQFH 3SXHA 1XTDA 2BE5C 1S5ED 4FF2A 2TMPA 3A7LA 1EUJA 2L12A 2L0CA 4LK1C 1VQHA 4B3SH 3CMEA 5BR8L 1FGUA 4RKLA 4DV1Q 4NXNL 2HHHL 1NNXA 2HCIA 4QY7A 1XRHA 4BY7H 3VR5A 4M1UB 4DK0A 1QZGA 4DR7H 1J9OA 4DAMA 3OWFA 3L7ZC 4K0KH 2F0EA 3PUXA 1L0WA 1DCZA 4AYBB 3HKSA 4U68A 1KDAA 3J81i 2R92H 3KLRA 4RG1A 1OXUA 3ULLA 2PNRC 1N34Q 4DR4Q 2N88A 4DV7H 3DXJC 4DAYB 1ZYRC 1KAAA 2PO4A 4DU9A 2GN5A 2Z6KA 2BOSA 4DUZH 1W6KA 2IY5B 4ME5A 4GOPC 1O80A 5IYCG 3VDYA 2B39A 4IPCA 4HIOA 3TS0A 1MKHA 1OXTA 2BA1A 1S5DD 2H1EA 5I6WA 2B8GA 5AFWA 1WJJA 4QMGA 4HJ7A 2CTFA 3WOFA 1Y1WH 3I0PA 4L8JA 2QDBA 4A93G 4Q5VA 2RSNA 5AJ3L 4LF4H 3G4SA 3DM3A 1UE1A 1TWHB 2NVTH 2O5JC 3IKJA 3U9SA 4HJ5A 2KOLA 2C9OA 4JW0A 1XMOL 4JI0H 3K6OA 5IY0A 1X0AA 1PH7A 3RF2A 1ENFA 2K05A 3CCMA 3TREA 3I4OA 4N8X1 1Q1BA 1F2LA 2CH4W 5C0XJ 4LF4L 3W3AA 3M7NA 5J1ZA 3CCUA 3GDEA 1ONLA 1CKMA 3RR5A 3FEWX 3MEHA 3N6RA 1KQSA 4A3CG 2WAQG 3NPPA 3T1HL 5IWAL 4A76A 2LY7A 3B6YA 1I6UA 4R4IA 4GN3B 2X06A 1C9OA 3GTKH 4NMZA 3S1RH 1U4MA 3GP7A 4G08A 3MXPA 3J7AK 3A7AB 1LV9A 2WP8J 2AXYA 1HNWL 4K14A 4QCLA 5M5WH 1VQGA 5LMNQ 3PO3H 1A15A 2OPVA 3ER0A 4JI4Q
chains in the Genus database with same CATH topology
2AMCB 3OW2A 2GA4B 4H02A 4DR1Q 3IFDA 4XQQA 4C3IG 3CU7A 3MEFA 3T1YL 3PV0A 1WTRA 1RCVD 1Q81C 2X6GA 4AQYQ 2P2RA 3PMFA 4X3SA 3MZ5A 3GTQB 1D1IA 4R4QA 3SHLA 4DV2Q 1Y1VB 3GTLB 2F0DA 4FXGC 1HH2P 4DV3L 3DWAA 1KDBA 1HJPA 3NUCA 3FMCA 1H9MA 2CWPA 3HP3A 1DT4A 1PTOD 2RA4A 4IFDI 2IWHA 2MO1A 5LL6S 2F4IA 2NWGA 4DV1L 1VQ8A 5C3XA 3S9WA 3OIPA 5C4XB 2E74C 1STEA 1TS2A 5JJLA 2QCPX 1DJRD 4ZQ3A 3D6WA 1K0RA 2JA7H 3DMUA 4HCSA 4R4CA 2K5WA 4DR5Q 1J5KA 2RDHA 4F87A 3KOJA 5DM63 4MZ9A 2UXCL 4C3HB 4DV3Q 1HNXL 1ASZA 3T56B 2CW0D 5ELCA 5C44B 3MTSA 1N33Q 4IJHA 4BY7B 1LYLA 1Q90A 1K8MA 3SGIA 5K36G 3VYUA 1LTID 2XIWA 4G57A 4EGVA 5KEEA 1CTMA 4KD4A 5EPLA 3HOUB 4BY1B 4Q0FA 4KJOA 2CFMA 1BNZA 5EKLA 2J4XA 1EQQA 4RCNA 1X3FA 5KNBA 1I4XA 1EOVA 1VIGA 2V1CC 1PTOH 3BDOA 1VQOA 4IOAA 1B9MA 3S1NH 2L11A 1N8RC 1LM0A 4JV5Q 1PFNA 1I4QA 1I5FA 2EYLA 5FO9B 3TS2A 3A8KE 1K3RA 4LFAQ 1LT3D 1BUVT 1YNJD 4X65L 1HA6A 4QL5A 3SDZA 2E3UA 1VQ9A 3ITPA 3BZKA 5IT9c 4RAUC 1HXYD 2DN8A 2AUJD 4RCOA 4DFAA 2VQEL 5IYBH 4KLKA 1MSGA 2B29A 3S17B 2PW5A 1VMPA 2L9HA 1H9SA 3BVZA 5FOBB 5IP9H 1XNQL 2FMRA 2RF4A 1SMXA 1Q3LA 1IBLL 1PH9A 5EKIA 5M5YB 2ZTEA 3S16B 4H13C 4Y7NB 2A6HC 4GNXB 3M4YA 1K83H 2HIVA 3AYHB 5C4HA 1IBKL 3RLNA 1PZKD 1I6HH 3GD7A 5COYA 2G9HD 2LFNA 1KNAA 1SE8A 5I2YA 2HDMA 1EY7A 3T13A 1K9MC 2WACA 1TXYA 3P75A 4OX9Q 3D6CA 1H9RA 1GHKA 4GKJL 4B3ML 2PMZE 1V1PB 3K57A 5C0XI 3S1MH 4FYDA 1I4GA 1TWFB 2JEBI 1LUZA 4LFCQ 1U5KA 2PW7A 2Q8TA 1BDOA 1DZ1A 1Q8KA 3HOYH 5E3FA 2JXMB 1B53A 1X32A 2N78A 2VXWA 1PDQA 4F8MA 2PMZB 4K8JA 1C4QA 1LT6D 2F0FA 3KBXA 1OXXK 4OIJA 3V69A 4A3BB 1FJGL 4ODGA 4FVMA 2Q2UA 2K52A 1YHQA 2EJGC 4A3LG 3V96A 4A3KB 1LTSD 4OL7A 2JJQA 1I4RA 2H5XA 3U58A 3DM1A 4LWCA 4HMJA 2EJMA 1JE5A 2K5DA 3I2ZA 1E7ZA 2RBMA 1VQIA 3GTLH 3OW7A 4A3EH 1Q8IA 4RHSA 5TSSA 1ZZIA 1EQTA 2OPUA 5EKKA 1KDCA 3CRKC 1TS3A 2B2VC 4DAYA 2BCOA 3N52A 3KDFA 4ILWA 4KTAA 5LMUQ 2K1BA 3VA5A 5BR8Q 2NVXB 4HSVA 2KJXA 2ZM6L 2SEBD 2HIXA 4CJ1B 3TSSA 4IFDG 2IX1A 2PZUA 1DONA 1TWAH 2KVMA 3NEMA 5CV4A 1ENCA 2VS1A 4IFDJ 5IYDH 1NTGA 4LF8L 4CHTB 2MO0A 3I73A 1JJ2A 1SNOA 2Z4HA 2IW3A 4HTHA 4DXFA 4DR2Q 2BDNA 4YCVA 1TY0A 5M3MG 1A3TA 3G71A 2XVSA 3NSWA 1IBKQ 5C44H 2PI2A 1ZZJA 1JOOA 2EYPA 2A6ED 2F4VQ 1G91A 2WAQE 4DR6Q 1FR3A 2B3GA 3IAYA 2K28A 1Q7YC 4EQNA 5C5LA 1Q12A 2F0KA 3K8AA 4HIDA 2E75C 4DAPA 1JICA 3SR1A 4A3FH 3S2HH 5KRUA 3PUYA 3V05A 4NBQA 2ASBA 4UP8A 1FNUA 2XRSD 4C1NI 1SYBA 1NR2A 3KLSA 4A3DG 5IGBA 4A3MB 5IYCH 1N33L 3IFTA 3QOLA 4OGQC 1ASYA 3LX0A 4HIMA 2E2HH 3QG1A 2KBNA 3T1YQ 4B8TA 1HZBA 3R93A 4HMIA 1EIYB 1E24A 1STAA 5KNDA 3TBIB 4L5TA 2VQFL 4B9XA 1RIPA 1TUAA 3TP6A 3MXUA 3I70A 2EYOA 1NY4A 1F2ZA 2AQ2B 2CQAA 3FPUB 1LTLA 1TWCB 4CBVA 5LHY1 4I7ZC 1QVCA 3GTOH 3NENA 2KEEA 4R4TA 3MFYA 2NZHA 5FLMG 1HRJA 1KTKA 4XT3B 1E0BA 2DUDA 5IP7H 3GTPH 1E2WA 4JBMA 5M3FG 3WDNA 1D2BA 2BE5D 4G7HC 4CGYB 1EY9A 3T1HQ 3S16H 3H3VI 2Z6KC 1KC8C 4ZUJA 5K5PA 3MXGA 2DGYA 5CC4A 1B9NA 2IT1A 5LMUL 4QJFA 2E2IH 3BDCA 1Y14B 5AJ3Q 1PZJD 1TS5A 3K80C 1PXUA 1K1GA 3WWVA 3QB3A 2F03A 4KD3A 1F9SA 4DK1A 3FKIB 1YBYA 1KAWA 3HZXA 1VQEA 4IALA 1CKNA 1KIXA 3PO3B 1N32Q 5IT9E 4ZUIA 4IQZA 4PQXA 5IGFA 2D2CC 1CHQD 2EJFC 4X64Q 1N36Q 4A3DH 3OTOL 3OSOA 4DR3Q 1EEID 3U9OA 5M9OA 2K75A 2YTVA 4K5WA 1G291 3LGJA 2K7VA 4O1NA 5C0XH 4AYBG 1VQDA 3TP7A 3S15H 4BY1H 1K73C 3M3YH 2WIIB 5EPJA 1SNCA 2AQ1B 1M4VA 4N9PA 1BXTA 1PV4A 1N36L 4LF7L 5IP7G 1Z7TA 1WOCA 3EROA 4ZYSA 1EEFD 1K8AC 5M3FH 4DA2A 3S1QB 1CKOA 4DNTB 2B63B 1EQVA 3I8ZA 2N49A 3H0GH 1SXTA 1HUMA 4JI8Q 2VQEQ 4A3JG 1KD1C 2PNHA 1WVLA 1SDFA 1Y1WG 5ELBA 1V9PA 3PO2H 1GXDC 5E7NA 4DR1L 1K8GA 2L15A 3PUZA 2ICEC 1DXMA 3M4OB 3I90A 1HHVA 4K6LA 3C2PA 1U9RA 1TWHH 4MNOA 3I55A 3EN2A 2QF7A 1IBLQ 1VCIA 1A2UA 1EU3A 1A63A 5A2QL 1XNRQ 4JOIC 4OXPA 1J5EL 2WKDA 1TWGB 5D3DA 4OWTB 1IBMQ 2R6GA 2RQXA 3PIPA 2CQOA 3VR3A 3TZDA 2NUCA 5IYBG 5FLXc 3CCJA 1IKLA 4A93B 5A35A 2VZAA 4J15A 1BBWA 4DAVA 3EVQA 3MA2B 2JA6B 3J80c 1B2TA 4A93H 2KQ3A 3NWSA 3J7AF 3J81c 2NBFA 3BZDB 2OWOA 2UXDL 4KI0A 4IZ8A 1UNSA 3EJIA 4TKOB 3LWEA 3L3OC 3FKIH 4WFN3 1O7ZA 1D7QA 4LFCL 1A8VA 4QGUA 5EBDA 4KN4C 3K7AH 5I9OA 2WV6D 4DPGA 1LACA 4P2CB 1MJCA 3P20A 1RKNA 4XTCS 3KJPA 3IL8A 3DWPA 4PNYA 3NELA 1YNNC 3VYSA 1NSNS 1GOZA 2QEJC 1P8LA 1HCZA 4GLAC 1RODA 3CW2C 1MJEA 3GV6A 4IUVA 1XXGA 1WTWA 3URYA 4JI1Q 1C8CA 1CFMA 3OMGA 1TU2B 2EVBA 1VQ7A 3JAML 1E2VA 2FHTA 3TP5A 1NMGA 3PIOA 1AW7A 3K5NA 4LF6L 2A8VA 1ZEQX 1DTJA 5ISRA 2F0OA 2NVTB 4YWLA 1WVNA 3CF5A 3VYRA 2F3VA 2X69A 3UDFA 3PF5A 2EOTA 1KHIA 3HOWG 4QB4A 5JPNC 1E3PA 4DR2L 1D5MC 4ULLA 1X65A 1QG7A 2DY8A 2F0UA 2Y0SG 4LF8Q 2UUBL 1EIHA 1CKNB 1PYSB 2A68C 1BBXC 4DR6L 2FFKB 1PRTD 3HOZH 1CK1A 2B2TA 4GLXA 1U4RA 3HS0C 4WJ3M 2YU9H 1GVPA 4XYQA 5DEHA 4GS3A 4JYAQ 5JVH3 3I4MG 1YZ6A 2YQRA 1U4LA 4R8IA 5JEAJ 2LS01 1BO0A 5G3LD 2WFWA 1NBWA 2YTYA 3R2IA 2F1MA 4A3DB 3DWQA 4QMFB 4MIUA 3BVGA 3MWYW 3G6JB 1HNZL 3J81L 2EXZA 5C3EB 3KJOA 2R92B 3UDIA 4QUCA 5IE8A 1XPRA 3F2DA 3H0GB 4Z9CB 1JC7A 2F0QA 2K32A 2AWOA 1TR5A 4GKJQ 3DHQA 1Y69U 2PZWA 1ET9A 2RCNA 1PRTF 1L1OC 4QUFA 5IGCA 2QKIC 4P75A 2R7ZB 4UY8C 1ZYRD 1JE4A 1L0XB 3H3VC 1SLJA 4AH6A 1JMCA 5C4XH 4C2MB 2M00A 1GO3E 1XPUA 1X9NA 2JYOA 1IW7C 2ZXRA 5BN5A 5CMDA 1XMQL 4K5VA 2ZTDA 4LUVA 5ELNA 3L0OA 4NDXA 2K5NA 4GLVB 3GTGH 4JBKA 2R7FA 2WB1G 3DEOA 1RHPA 1VQLA 2M9VA 2UUAL 1TQOA 5EQ0A 3K81C 4JI2Q 1DM0B 2WB1E 3UDXA 2AKWB 1IZ6A 4DNIA 3ULPA 1GHJA 4EQOA 4JI8L 4RGOS 3E9IA 1J4WA 3GTMH 1UE6A 2F0MA 1RL2A 4OWXB 1AZQA 2FMMA 2BL5A 3MVVA 1B1ZA 2JA5H 4LUOA 1XMQQ 4DV6Q 2KHIA 2EQSA 2LXJA 2F0SA 3J81j 3K7UC 4L5RC 3T53B 3S2HB 1VQPA 2KEDA 2JVZA 2E2DC 1LTBD 3HOXH 1HTLD 1SYDA 1XJVA 3TQYA 4BWGB 4A3FG 1QCBD 3AU7A 3CQZB 1NJIC 2KCMA 1PA6A 1FJGQ 3HOYG 2B2VA 2Y0SB 1LLRD 2YYZA 2JSOA 1MSHA 3CQZH 2D0PA 1PH3A 1STHA 5DLQE 1R4PB 3BZCA 1Y1VG 3J80i 5LMNW 4DV7Q 4DNRB 1Z6HA 1XMOQ 1X3GA 3F2BA 4LF6Q 4LJZC 4HJAA 1IYUA 1A62A 3A5ZB 1PH8A 5CV8A 3CMAA 3PCOB 4HR7B 1FNVA 1IL2A 4JC0A 1EY5A 1BBUA 1JQYD 3I4MH 4YY3Q 4TSSA 2K50A 3R8BA 2XN9C 3K5LA 2Q2HA 5KYLA 3JAMc 1JJGA 1AEXA 2HDLA 4DR5L 2UUBQ 1VQAA 4DV0L 3NQTA 4H44C 1BCPF 4KJNA 1HZ9A 3M4QA 3OTOQ 4DR3L 4C3JH 3G7LA 2MQHA 1ICWA 3H0GG 4B3RL 3S17H 4A3GG 2CKZB 1SR3A 4XQJA 3EA6A 3GO5A 2CVRA 1XYIA 5I9PA 4XQNA 3HOVB 1I6VC 4LW1A 2R93B 1EYAA 3NXWA 1RD9D 2Q8RE 1PTOC 2B2UC 3GTJB 4TVAB 1XPOA 1TWGH 3I4NG 1UEAB 1I4HA 3L9AX 1TT2A 3G48A 3PUWA 1Z47A 3F1ZA 3I3CA 1EWHA 3S1RB 4QF4A 1YJWA 4ZKBB 1EFWA 1XWEA 2CTKA 2NVQH 4K2LA 1VQ4A 2ID0A 3CCEA 5M5WB 2JK8A 1QWYA 2PPBC 1SNMA 1G8ZD 3OHXC 1PH2A 1CI3M 3S2DH 1DGSA 4JI3Q 4JI5L 1AZPA 3RLFA 2CHBD 1GJXA 4KN7C 3L2PA 4JCVE 3I56A 4EQPA 4K0KL 3LNNA 3SE0A 5FO7B 2IX0A 4C3JG 5M3MH 4KKUA 5DNFA 1S40A 1RTOA 2A73B 1Z9FA 4IUUA 5D14A 2D9UA 2I07B 3S24A 2R93G 1IXRA 1GUNA 2J7ZA 3G6EA 4LF4Q 5GAHC 5HURA 4ID6A 4NW2A 1SFOB 4DV5Q 4LF7Q 1QOHA 3A5UA 1PH5A 2B8FA 2NB0A 3GTGB 5ELDA 4A75A 3BG3A 2Z4IA 4C3HG 2M2LA 2A6EC 5JVG3 1M90C 5D3IB 2A69C 3EQLC 4MHEA 2JA5B 1KXLA 3M9BA 1OXSC 2YTXA 5F2DA 4OX9L 4BY7G 5CV5A 3W1GA 5CV7A 1HNWQ 1O7LA 1YITA 4V190 4C3HH 5IGEA 4XYOA 3EIVA 4DN4M 4ZLTF 1XX8A 1STNA 3CAMA 1E22A 1AE3A 2LXKA 1DOKA 3RD4A 4IOCA 3KF6B 2G9DA 4NB3A 3UDGA 4ZKCB 1PH1A 1YHAA 3HOUH 1I3QB 4X6AH 2RSOA 4BS9A 5CV6A 3MHBA 4O42A 4B3SQ 3S1NB 2KA7A 1FGBD 2MP1A 2E5LQ 4A3KG 1Y8PB 2F0LA 3MXNB 3PO3G 1M8AA 3AFPA 3RZDB 3H3VH 5KGUA 4DF7A 3OYYA 2K14A 3RMHA 2ZJQA 2NYZD 4A3BG 1Q1EA 4BBSB 2KCCA 2F0IA 2F3WA 4YIJA 1EL0A 2PQUA 1E1OA 2JA8H 3A74A 2PCFB 1QUQA 1B44D 2EE1A 3M85A 1PVOA 3CPFA 2R7ZG 1F9QA 3RN2A 1CA5A 4C3IB 5C4ZA 4B3MQ 4C1NK 1GUTA 2IL8A 1Y1WB 4LMQD 2L4NA 1BCPB 2I5MX 5C5MA 1HR0Q 3U4VA 4KHPL 2NTTA 2VB3X 1DD2A 1G51A 3HOWH 4X66L 1IBML 1EIGA 4XIGS 5GROA 3UE1A 3HOVH 4KKTA 2A74C 3SK5A 2JA7B 2LKVA 2HT1A 4XT1B 3FHWA 4POFA 1V1OA 3E0JA 2D0OA 2OCEA 3EBEA 4TQUS 4XDXA 4GOPB 4J1MA 2KENA 1SMYD 1K83B 2DY7A 4HSPA 1QJOA 2Z1CA 5IODA 4RMFA 2HCCA 2HHHQ 1E2ZA 3NQIA 3X3NA 1LO5D 4IFDH 2MGSA 4OO1H 2JA8G 4NKLA 1I94Q 2OQKA 3HKZG 1DYQA 3DUZA 4R9WA 4K8IA 5DAUA 4GZYC 1A2TA 3STBC 4DUYQ 3NTHA 3S1QH 4LNQA 1V1PA 1UUPA 1WTOA 2VY3A 2LSSA 4B3SL 5KNCA 2F0VA 2MNAA 2K01A 2K33A 1JWUD 3QOJA 4NPSA 4DV7L 3K7AB 1RDPD 4AIMA 5M3MB 1VQKA 5CV9A 4JV5L 1WTVA 1CSPA 4DR7L 1RJTA 1EU4A 2BA0A 4S3SA 3UI2A 5M3FB 1PRTB 3BVMA 2AQ3B 2A69D 1CUKA 2B63H 1LT5D 2EDGA 2ZXOA 2WINB 3A54A 3E9HA 4CKEA 4KY7A 4IUNA 2C5CA 3F2CA 5C4XG 1KNEA 1NAPA 4F7XA 2CTMA 4M8AA 4WANA 2R7DA 4RFBA 3IRBA 1PTOB 1IW7D 1Q46A 2I5LX 5JEAH 2XGTA 4JI5Q 4LF5Q 4A3EG 1O7YA 1W6JA 2N3SA 4C56C 1JR0D 2ZXPA 1JORA 4PMBA 2AUKA 5T1GA 3BDLA 4G7ZC 3CD6A 2EIFA 3D3RA 1G6PA 2EXDA 3H6MA 2KCNA 2NVYH 2MJHA 4DV4L 3T16A 4FXDA 1S5FD 1VQFA 1CZGA 1GKHA 1U0LA 4GKKQ 2WKCA 3Q6SA 1I6HB 2F0PA 5IIFA 1I50H 5FJ8H 2OT2A 4NXML 1WTXA 1ML0D 2HH3A 1PH6A 3HKZB 3CCRA 1J5EQ 4A3GH 5LMNL 3PO2G 2JA7G 2DNEA 2ANNA 4FNFA 3ERSX 3KFUA 3RZOH 4IPDA 2D5DA 3QWNA 2UU9Q 1I3QH 3HKZE 5C6AA 4BA2I 4DK3C 3AFQA 2XTIA 1Q86C 1BR9A 3HOVG 2B63G 1EYGA 3FDTA 3I91A 1BCPC 5H1SE 2EY1A 1TKWB 4RKBA 3WOEA 4A3CH 3D0FA 4BY1G 2EYHA 2ZTCA 4NXMQ 5C0XG 3I4NH 4CKCA 1F2YA 1MIUA 4BXXH 5E4XA 1EC6A 3PSIA 4FF3A 3GQBA 3ZJYC 3I7FA 5GAEC 1H9JA 2CTJA 3SK6A 4C3IH 4IPGA 4Y7NH 1CQVA 2ES2A 4JYAL 1SMYC 1YVCA 3S14B 2Y0SE 3CCSA 3GTPB 4A3JH 3PO2B 1R9TH 2FXQA 2L55A 2A68D 1F9RA 4A3KH 3A8JE 4K5XA 2E8GA 3TMEA 2UXCQ 3PIP3 1HR0W 3K5MA 1GM5A 2F0JA 1ENAA 4GKKL 4A3EB 3CHBD 5NUCA 4JBWA 4R4OA 2XSCA 1WTPA 3JC66 3C46A 4WJ4A 1JWMD 4WJWA 3GTMB 1S5CD 2IX3A 1QE6A 3DLLA 3NTKA 2KHJA 1TY2A 1ZXTA 1SYEA 1YIJA 1W2BA 5IWAQ 3KLWA 3CCLA 4P72A 2JA6H 1EY4A 3HOYB 5ELFA 3ULJA 1HQRD 5GAGC 3U1KA 1T5EA 4ZAIA 2NN6I 1WTQA 1B7YB 2MUYA 2F3IA 1ESRA 3QJYA 5E4WC 1ZKOA 5FKAC 4HEDA 4EX5A 2CTLA 1VQJA 5JJKA 1WD1A 5K36H 2RHSB 1VIHA 2ENBA 1SAPA 4LF9L 2OTJA 3PIO3 3KF6A 5I2XA 3M4PA 5CORA 5M5XB 1KLGD 1NR4A 4V0BA 3KF8B 2B2UA 2EY6A 4FF4A 1X4NA 3OPOA 4X3KA 3AEVA 1X54A 2K4KA 1B4OA 4DXGA 3RN5A 2HH2A 2PQEA 2K03A 3Q22A 3BS1A 2I0QA 4PV1C 4BBSG 2CCZA 1EZ6A 5J22A 1U4PA 1KRSA 3UE0A 2VUMB 3R2TA 3J80L 4K0KQ 4KY5A 4B3RQ 5CR3A 1VQBA 3NP8A 2NVYB 4GOPA 1QNUA 4A3JB 3NE5B 3A55A 1PFSA 1GUWA 1EQRA 4LFBQ 3TRZA 3D4DA 3A8IE 4H7BA 1TIID 4A4IA 3VR6A 3J81E 1NE3A 1VDZA 2BH2A 2KCTA 1A3VA 1FYCA 4TRDA 1N9WA 5JJZA 3CP0A 4E6IA 2F0WA 3VR4A 1X3QA 1KHMA 5J39A 1CZWA 3TEHB 3HOXB 4RGMA 3S1MB 2XNAC 4X65Q 1H95A 4A3GB 3CCVA 3M7GA 4J8QA 4JI7Q 1J8IA 2JA9A 3BU2A 3RNUA 5KYIA 5C4JB 4ZK9B 4BBRH 1STBA 1MD2D 4KK7A 2QNDA 3K5OA 1UAPA 1AFPA 5EAYA 5IOCA 4OO1I 1IYJB 4L5SA 1WI5A 1YJ9A 4ALPA 4IPHA 4QQBX 3Q24A 5FLXL 3DEPA 3QIAA 1STYA 2QGQA 1YI2A 2OEOA 4JOIA 4LUZA 5G3LF 2R7ZH 1TS4A 2JZXA 1RF2D 1SE4A 1V8QA 4CJ2C 1QNKA 1WCMB 2B2TC 2OTLA 3BYTB 3MAQA 5ELEA 1AE2A 3ERQA 1C48A 1OO9B 1PYWD 4XXEA 3TP8A 2SNSA 1C0AA 4BA1I 4HN7A 2VQFQ 1JT8A 5IP9G 5I4DA 3I72A 4B08A 1Q82C 4N9TA 2PQAA 4JI6Q 2OQ0A 1SSOA 3X3MA 2JEAI 4UDUC 2QA4A 1BVSA 2UUCQ 4KHPQ 1T9HA 4K2KA 1BQQT 4POGA 4I65A 1J6QA 1WD0A 1L1OA 3W1BA 3O13A 2BDOA 3P1HA 1EYDA 3KDFB 4IO9A 4JBJA 4O2DA 1PTOF 2SNMA 4RHRA 5IT9L 1EYCA 1G6ZA 4APVA 4JI6L 4X3UA 3M3YB 2BH8A 3STBD 1A6XA 1S4ZA 3V2TA 4IJLA 1G2SA 4YWKA 1BKBA 2FJ2A 3KF8A 2CWAA 2A1AA 3RZDH 4DK6C 1MBYA 4EQ5A 1AH9A 4DGZA 1I94L 4A3MG 1EY0A 2RDGA 3AEVB 2AWNA 2OF1A 3TZUA 4BBSH 1Y1VH 3CCQA 4B3TQ 1EY8A 2DNCA 1PH4A 5DM73 3NWTA 5JJIA 2KUMA 1EZ8A 2J0TD 1JB3A 1ZTGA 1JOKA 5BN4A 3R3OA 4JI0L 3Q0AA 1KABA 4WALA 3VKEA 1LTAD 2IJ0A 1H9SB 4KV6A 3AQQA 1JWSD 2MPMA 3HOUG 2N55A 2CPQA 1HFGA 1H9KA 1PZID 5CYUA 1XTCD 4DV2L 1EFID 4GNXA 4R1JA 3PGZA 2UU9L 3A56A 4A3IG 1BF4A 2CW0C 4X3TA 2ATWA 2IHEA 1F9PA 3D31A 3VA7A 3ICEA 4B3TL 2ZJPA 1STGA 4PMCA 1I50B 5HY6A 2DGRA 2EZVA 4A3FB 3CC4A 3CKIB 4CJ0B 1YEZA 1CSQA 1LTTD 3I4LA 2LMCB 4JI7L 2H4OA 1B8AA 4JI4L 4GNXC 4L5QA 2B2WA 3GTKB 2E2JH 4OHJA 1OTCA 1QB5D 4JVHA 2E2JB 3F8TA 2Q8IB 3A0JA 4DUZL 3HG9A 2A19A 1JOQA 2PQAB 2RKSA 2B2WC 3MFGA 3K59A 2K04A 5BN3A 3KBGA 4KKSA 1KRTA 1SNQA 3HGBA 1IKMA 5D65A 1DOLA 2SOBA 3AB9A 4DUZQ 3OOCA 3ND8A 4BXXG 4G4KA 1OXVA 1N34L 3PUVA 1C7YA 1X3EA 3VYTA 1JJCB 4WRDA 2FMCA 1K8OA 5JEAG 2L1BA 5IGDA 5JPMC 4P74A 3GV3A 1SE3A 2HUGA 3CXCA 4P71A 1I4PA 3H94A 1SYCA 1KLUD 1HNXQ 2R93H 1PRTC 1SEBD 1UE5A 1E1TA 1CQFA 4YCWA 4JI3L 3J7ZC 1CM9A 4PZ8A 3U50C 2K6AA 2E2IB 1PFBA 3H09A 3MXNA 3ND9A 5FLMH 3FRPB 2Z8LA 3SK4A 3NBHB 2EYFA 1LABA 1SJED 3NK9A 4X62Q 4DR4L 3S15B 2JA5G 2C35B 1YNXA 1XNQQ 2EPBA 1SNDA 4IUTA 3NHHA 5JOBA 3ZYYX 3NBIA 1X56A 1X3PA 2XRQD 5C3WA 2IHFA 4A3IB 1ET6A 2JA6G 4OONA 5ELOA 2TSSA 5E1FA 2RHQB 3NTIA 4A3IH 4CKBA 2JQOA 4PZ7A 1HA5A 1B70B 1QVFA 5JAVA 2JE6I 1XNRL 2R92G 1D1KA 4YWMA 4UAIA 3J7A5 2E2HB 1VS0A 2UUAQ 4ZRZA 2EYJA 4OWWB 2CTEA 4FXKC 2ALYB 4DV6L 4J6HA 2VW9A 3K0XA 3M4OH 1M1KC 3FP9A 1A3UA 2XWBB 1GUOA 2A6HD 1VQMA 1GD7A 3KK7A 2SDFA 5EJWA 4MN3A 4DV0Q 2Z0SA 4FF1A 4QIWB 1LTRD 3K0YA 1VF5C 1UE7A 1MGSA 1X55A 1NCVA 4B9WA 2E5LL 1HPCA 3PF4A 1PMRA 2NVXH 1WCMH 2I5HA 1EY6A 4FP5D 4C3JB 1O78A 1Y8OB 2FINB 3GTOB 1TWCH 5IYDG 3D4RA 2KHSA 1SNPA 4HJ9A 3HOWB 3CC7A 4DV5L 3AMUA 3HEJA 1YNJC 4AM3A 3MC0B 4JI2L 5CGKA 3HFZB 4JI1L 4KHZA 4ME3A 5J3BA 3KUPA 1SYGA 2XWJB 1W3SA 1L1OB 4YY3L 1F2MA 4DUYL 4HJ8A 4UPAA 1B50A 4K6DA 3C1EA 3J80E 1BCPD 2F0NA 3D4WA 1V43A 4IURA 1V1QA 2ZT9C 5C4JH 2B2YC 4DKAC 1FD7D 2JA8B 1MI2A 4DR7Q 4LAAA 1EOTA 4X66Q 1D5ZC 4HCEA 5FLXE 1GUSA 3NBHA 4IUPA 3E5SA 5FO8B 3P7JA 1CHPD 1L0YB 1PFMA 2I46A 4LF9Q 4PG3A 4IUQA 2K5HA 2E76C 2YV5A 4JI0Q 3D8GA 1D5XC 3W5OA 1S72A 1WYDA 4R8NA 3H15A 3ONAB 4A3BH 5KIXA 3SVMA 1AP0A 4YHHQ 3J7YW 2UXBL 5EBCA 2OXPA 1QUQB 1VMCA 1N32L 2PZTA 2K5VA 4WORA 4JVYA 4RH6A 4LF5L 1A0IA 2VB2X 1HTPA 4X62L 3S14H 1SFOH 3HOXG 2PI2E 4RGNA 1LT4D 2VL6A 3Q23A 5HGTA 1HZCA 1EWCA 1ILPA 2K5QA 2NN6H 5T1IA 2NTSA 1VF7A 4JG2A 3EFXD 1P16A 1AN8A 4Y52H 2VUMG 4OIKA 2GVBA 1QILA 5CBEE 3FKIG 3KYHC 1TWAB 5GADC 3BJUA 4UP7A 4NP5A 1TWFH 1CT1D 3S2DB 5GQOA 2EY5A 4PZ6A 2KECA 3CPWA 4ABNA 1EIFA 2WB1B 5CBAE 5FJ8G 5EGTA 1DOMA 4LIJA 4EVOA 5HGQA 4OO1G 3RZOB 4C2MH 3TDQA 3T4AC 1O7IA 3JAMi 1YNND 4QIWE 2X6LA 3QO2A 1T5XD 4G7OC 5I6YA 4X64L 3KLSX 2JP1A 3GTQH 4DV4Q 2N8NA 1SJHD 3OWEB 2B2YA 3TN2A 2IPKD 3W2DA 4U673 1CA6A 1YJNA 5C44G 3K58A 4A3LH 2GVAA 1KL9A 1B3AA 1X6OA 4P73A 1HNZQ 1IL8A 2NZ1D 4F88A 4A3MH 5C3EG 1FVIA 2ZJRA 2EYMA 4GN5A 1SBBB 1SYFA 2NN6G 3FPPA 1F77A 2Q2TA 2PY9A 5LL6X 1EWIA 3RLOA 3HRZC 2F52A 4YHHL 1GUGA 3E6ZX 2UXBQ 3FVQA 2A5HA 1HQMC 3Q8DA 2ANRA 1L2FA 3OMCA 4MTNA 2O2LD 1R9TB 1QZHA 2UUCL 1NMFA 2NZOA 3CC2A 1ZZKA 1WFQA 5EPKA 2QILA 2VUMH 1S3OA 1HUNA 3HOZG 2F0TA 2ZM6Q 1IHZA 1PHJA 3CRLC