5K36G

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
236
structure length
232
Chain Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAGVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 45
structure length 232
sequence length 236
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5k36G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5k36G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5k36G03
4AH6A 3A7AB 4L5TA 3D4RA 2JXMB 1EUJA 4IFDH 2NVTH 1JJGA 1I5FA 5IYDG 2KBNA 2ZJQA 4HJAA 1QZHA 1IW7C 2UUBL 4G7OC 2K50A 2R92G 1Z9FA 4B3MQ 2UUBQ 3KJPA 4WALA 1A62A 1I6VC 2LXJA 4APVA 3GTQH 4P71A 3U1KA 3HOYH 2JEBI 5KNDA 2A6HD 4DK3C 3KJOA 1QUQA 1HNZL 3HOZH 1A6XA 5FJ8G 2OCEA 1X54A 1KRSA 3J81i 4X65Q 1QVFA 1G6PA 3GTJH 1ONLA 1VQGA 1K73C 3M7NA 1LM0A 4QMFB 1TU2B 5IYBH 3W1BA 1Y1VG 5M3MH 4QL5A 3D0FA 1AE2A 3K7AH 4MTNA 4LUZA 4OO1I 4DV2Q 3MFYA 3RLNA 3RNUA 4HIOA 4DV6L 4LFCL 4IPGA 2UU9Q 1IBML 4A3DG 3RZOH 5LMUL 2IT1A 1W3SA 3F8TA 1NBWA 3AEVA 4X66L 4DV6Q 1H95A 2PY9A 4DNRB 1BBUA 5J3BA 1H9SA 3CXCA 3P20A 4J15A 1LACA 3E9HA 4A3BH 3MXUA 1HNXL 4JBKA 1Y1WG 3K81C 1HZAA 3TZUA 1EYGA 1WFQA 4A3MH 2ZJPA 3TS2A 1HNXQ 2D0PA 1KC8C 3J80c 4Y52H 3M3YH 1NE3A 2F52A 2QGQA 4KHPQ 4H0LC 1PA6A 1FJGQ 1KIXA 2MO1A 1XNQQ 1RIPA 1V9PA 4DR7L 3S24A 1KXLA 4LK1C 3S1NH 4DV4L 4DR7Q 1SROA 2YQRA 2EQSA 1V8QA 2PCFB 4DV4Q 2ZT9C 3NENA 4IOCA 1PYBA 1GD7A 5KNCA 2A1AA 1JB7A 1H9JA 3AFPA 1VDZA 4JV5Q 4DV5L 2JA6H 1K9MC 1VQDA 4HIDA 2PQAB 1SLJA 3I4MG 4A3IH 3KDFB 3VR2A 1VCIA 1HZCA 2WP8J 3AB9A 3HOXG 4POGA 4YCVA 2O5JC 3GTLH 4YHHQ 1R9TH 2MFIA 4YCUA 3HOVG 4BY7G 2NN6I 3H15A 4YWMA 4HIKA 1NY4A 4R4TA 4HR7B 1AE3A 2Y0SG 4X64Q 5C44G 4R4CA 4QGUA 5GAHC 3UDXA 1YNJC 1PFSA 3MXNB 1EOVA 5ELNA 1Q7YC 1WCMG 2ZM6L 2A19A 2ATWA 3J81c 3ND9A 3UDFA 4A4IA 3CMEA 2YU9H 2HHHQ 3H94A 3CCUA 2JK8A 4A3JH 2ANNA 1T5EA 3HFZB 3PO2G 4RG1A 1PH2A 4BXXH 3BJUA 3SDZA 4JBWA 3G4SA 3UE0A 5IP7H 2QA4A 5JEAG 1L0WA 4OO1H 2DGRA 3SGIA 2NVYH 4OWTB 3MEFA 1L1OB 2BE5D 1SE8A 4GZYC 3RLFA 3TS0A 5C0XG 4LNQA 5M3FH 2R93G 3PGZA 4R4IA 4L5SA 1K8MA 1U0LA 3M4OH 5LMNL 4R1JA 2R7ZG 3ULPA 2L15A 1ASYA 4IOAA 1K8OA 3STBC 5LMNQ 2KCTA 1G291 4B3SL 5C4XG 1ZYRC 3FMCA 4JOIC 2RCNA 2QF7A 3I4NH 4K0KQ 1VQOA 1QZGA 2CWAA 4GOPB 1N36L 3S2DH 5FLMH 3U58A 3VR3A 1I94L 4WJ3M 1CUKA 4DV0L 3CCEA 4BBSG 3CW2C 3T51B 4AYBG 1QVGA 2D5DA 4TQUS 1XPRA 1I94Q 1YJ9A 4DUZL 4DPGA 4POFA 2ASBA 4DK0A 1GUGA 3I73A 3AYHB 1H9MA 4JI4L 1E24A 4DUZQ 2B63G 4AIMA 4LF9Q 3VR6A 1E1OA 2JA5H 4DV1L 4OONA 1L1OA 3GTGH 4PMWA 4PZ7A 3PCOB 2WAQG 2ES2A 2HQLA 4A76A 2PNHA 2Y0SE 4LF7L 3PIOA 1YHAA 3FKIH 1V43A 4P74A 1U5KA 3K7UC 3CCSA 4LF4L 1IBKQ 3HKSA 1SFOH 4X6AH 3U9SA 1CKNB 2YTYA 1GO3E 2K5NA 1XNRL 2RHSB 5C3EG 3T53B 5BR8L 1DCZA 4C3HH 1FR3A 1NJIC 3G71A 1CTMA 2RF4A 2Q8IB 2VZAA 4DUYL 4OWWB 3E9IA 3CCJA 1MJCA 2QNDA 2NN6H 4MZ9A 2Z0SA 3UE1A 1B7YB 3PSIA 1NMFA 4DUYQ 2IX1A 5GAEC 2V4DA 2VQEL 1IZ6A 1K8GA 1X3EA 3A7LA 2UXBL 2CPQA 2OTJA 3PO3H 2BH2A 4G7ZC 1SRUA 2E8GA 2VQEQ 3BG3A 1KQSA 2HH3A 4GS3A 3W3AA 1H9KA 1E2VA 5IY0A 2E2IH 2L5TA 2DNEA 4C3IH 2Q2IA 3F1ZA 3J81j 1J5KA 4DAMA 3GTMH 4B3RQ 1GJXA 1VQCA 1BKBA 2ALYB 2ID0A 2I5LX 2R7DA 1XMOQ 1VQ7A 3JAMc 3LNNA 4JI0Q 4KLKA 2WB1G 1N32L 1CKNA 2E75C 3HKZG 1HTPA 4B3ML 1Q1BA 1Q86C 1PYSB 4FDBA 3T1YQ 1N32Q 4LIJA 4IFDG 3TREA 1UE6A 2JEAI 4AYBE 1VQHA 4QY7A 2DGYA 2R92H 4DR6L 4GKJQ 1O7LA 1W2BA 3PF4A 1GKHA 4GN4B 1VQKA 4AQYQ 1L1OC 4DR6Q 1PVOA 1IYUA 1Z6HA 2WAQE 3HOYG 1CFMA 4X65L 1K8AC 2LSSA 1HZBA 5FJ8H 3I55A 3LWUA 4NPSA 4DR1L 3HOUH 1PH8A 4A93H 2E5LQ 1OXXK 4DR3L 4TKOB 4A3KH 3CC4A 2HH2A 4IJLA 5IP9H 1YZ6A 4DR1Q 2CWPA 1SR3A 4GOPC 4DR3Q 2CTKA 2Z6KA 5JJIA 4XIGS 1DD2A 4DV2L 2K52A 3CC2A 3GDEA 2NVQH 5GAGC 2UU9L 3KYHC 2I5HA 3CPFA 4P72A 2NVXH 4LUVA 2B29A 4RMFA 4JI1L 3ULLA 1YNNC 2YTVA 2DNCA 1GHJA 1EQQA 4JI6Q 2HIVA 2K7VA 2EVBA 4JI1Q 2E3UA 1O7IA 1HCZA 1IBLQ 4G7HC 2B8GA 4IPCA 2PNRC 1KHMA 4IQZA 5GQOA 4DR5Q 4PV1C 1OXVA 3V69A 1SMYC 1GUOA 3TQYA 3BU2A 2JA8H 3S14H 1WOCA 2A6ED 4XTCS 1MIUA 1XPOA 4NBQA 1Q1EA 1RL2A 1TXYA 4KHPL 1JJ2A 4PG3A 3QJYA 4A3BG 1IYVA 1L2FA 1FJGL 3T1HL 4C2MH 1Q81C 3GTOH 2B3GA 3FHWA 2WB1E 1XNQL 1YHQA 3T56B 1IL2A 1I50H 2QEXA 1YI2A 3HKZE 1IXRA 1Q8KA 1JJCB 3T1HQ 4DNIA 2BL5A 1X6OA 2ANRA 1HR0Q 1FYCA 4HJ9A 1Q46A 4OXPA 4H44C 1E2WA 1YITA 2IHFA 2D2CC 4UP7A 5ELOA 1VQ9A 4JVYA 2I5MX 1HPCA 4JV5L 2UUAQ 4A75A 2Q2HA 4JOIA 3TEHB 5BN3A 2KCMA 4HJ5A 1Y14B 1OXSC 3S2HH 1CSPA 1TWAH 3BZKA 2GVAA 3CP0A 4YHHL 3I4LA 1KAWA 2Z6KC 2MJHA 1G51A 3NELA 1T9HA 4GKKL 2JA6G 3CCRA 3HOWH 2UXCQ 3PUVA 3CCQA 2CTEA 5JJKA 1GUTA 4A3IG 2F3IA 4X64L 2LXKA 4GKKQ 2UUCQ 1TWCH 3H3VH 4KI0A 1X65A 4LUOA 4KKUA 1C9OA 4A3EH 5HGQA 1X3GA 4WANA 2DN8A 1D8LA 5AJ3Q 2RHQB 2HHHL 3VR5A 3M4QA 1GM5A 1WCMH 4JI8Q 2OQKA 1CSQA 1P16A 3DXJC 2WFWA 2OQ0A 4H13C 3GTKH 5IYCH 2Q2UA 3STBD 3F2BA 3H0GH 3S1QH 1XTDA 3CF5A 3M9BA 4GNXB 3PUXA 4QIWE 2R7FA 1J5EQ 2JA9A 1DXMA 4Y7NH 4BY1H 5K36G 4LFAL 4DV7L 2PQAA 3KDFA 3IRBA 3CCLA 4DR2Q 4BBRH 5HY6A 4LW1A 4A3JG 4L5RC 3J7ZC 1M1KC 3FPPA 4LFAQ 4DV7Q 1MJEA 4BXXG 2EJMA 2JA7G 1X3FA 1XMQQ 5IP7G 1BVSA 5C0XH 5M5XH 4OO1G 1YBYA 1BBWA 4EQ5A 5M5WH 4YY3Q 3A74A 2YV5A 4A3LG 2AMCB 3PV0A 2CFMA 3EQLC 4JI5Q 5M3FG 4NXNL 4K0KL 3S16H 1TWFH 4A3CG 1ZKOA 1SMXA 5C4XH 1A0IA 3OTOL 4NXNQ 2P2RA 5LMNW 4R4QA 1CI3M 3OTOQ 1KD1C 1E7ZA 4A3FG 2A68C 1OTCA 5JJLA 1P8LA 4JVHA 4A3GH 2AWNA 1VIGA 5FLMG 4LF9L 4NXML 3EBEA 3PUWA 1GUNA 2OPVA 4LWCA 4DR4Q 1B9MA 3ND8A 1EFWA 1VQLA 2AXYA 1OXUA 2PI2A 4H02A 4X62Q 4NXMQ 2B63H 2E2HH 1FGUA 3G48A 1EWHA 1NTGA 5A35A 4R4OA 3PUYA 1IBKL 4LF6Q 1X56A 1VQBA 3TRZA 4UY8C 1K1GA 2NZOA 2JA5G 4MNOA 3RZDH 4LF8Q 3WDNA 3QIAA 2MO0A 1EIFA 3VA7A 4TVAB 3OW2A 5JEAJ 3UDGA 3S1RH 3M4YA 2VW9A 3FKIG 3K80C 3F2DA 5C0XJ 3A0JA 3E0EA 1PMRA 3U4VA 5GADC 1VQ8A 2ZJRA 4JI2Q 3VR4A 4GOPA 4O2DA 1HJPA 4I7ZC 3VDYA 4JI7Q 1S40A 1UE1A 1IW7D 3RN5A 1EIYB 1VQAA 1Y8PB 1I6HH 5C4JH 3S17H 1UEBA 4OX9Q 2VUMH 3GO5A 2NN6G 4IO9A 2D0OA 3GQBA 4DK1A 4UPAA 4L8JA 2K75A 4B3RL 4JI3Q 3CCMA 3PO3G 1XMOL 2JJQA 4LFBQ 3CCVA 3CQZH 2BA0A 4JI0L 4DV3Q 1Q90A 1J6QA 1PH7A 3T1YL 1TWGH 1WYDA 2JVZA 3G6EA 1N34L 5IYDH 3K0XA 2OPUA 2E74C 2EJFC 4GNXC 2KA7A 1PH9A 4GKJL 1TWHH 1Z47A 1ZZKA 2KHIA 1N34Q 3BDOA 2BDOA 4JK1C 4AQYL 2AKWB 1CKOA 1YIJA 2BA1A 3U50C 1EQRA 1VQFA 3CD6A 1EC6A 1XJVA 3ICEA 4PZ6A 2MNAA 2AHOB 1SN8A 1VIHA 1X4MA 3H3VI 2CTMA 1DGSA 1I3QH 1FVIA 5GROA 2B8FA 4JG2A 2OWOA 3AEVB 4RCNA 4BA1I 3ER0A 1WVNA 3DM3A 2YYZA 3LGJA 3I56A 2E5LL 2A69C 2E2JH 2I0QA 1PH5A 1H9SB 4EX5A 3Q8DA 1XPUA 3HOZG 3PIPA 4IPHA 3RN2A 1N8RC 1YJNA 2V1CC 1OXTA 1HNZQ 3D31A 4P75A 3HOUG 4A93G 4GLXA 1VQ5A 1YNXA 1X4NA 4A3KG 4OWXB 5IP9G 2F4VL 2D62A 1PH4A 1Y1VH 4QQBX 3CC7A 4JI6L 3W5OA 2CTJA 1S3OA 1TKWB 1CKMA 1JT8A 3ULJA 4KHZA 2F4VQ 5IYBG 3FP9A 1IBLL 5M3MG 5C0XI 4A3DH 5IE8A 1E22A 3RLOA 1UWVA 4B3TL 4IPDA 1VQIA 2VNUD 4DR5L 2BH8A 3I4OA 3CRKC 4GLAC 5EAYA 3NE5B 3KOJA 2A6HC 3WWVA 4B3TQ 2CW0C 1MKHA 4IFDJ 1O78A 5E7NA 2CCZA 2KCCA 4JBJA 1GVPA 1EWIA 4LFCQ 1IBMQ 5LMUQ 1Y1WH 1HH2P 3L7ZC 1FL0A 4X66Q 1PV4A 3I2ZA 2FMRA 3OPOA 2VS1A 2JA8G 1KRTA 1VQ4A 2R6GA 1VQJA 3M85A 2CKZB 3A8JE 1HR0L 1A63A 4LJZC 4A3MG 4O0AA 3PF5A 1IYJB 3KFUA 3S15H 2VY3A 4AM3A 2AUKA 4BA2I 2K32A 3M4PA 3NBHB 1DTJA 3CAMA 2EDGA 3I72A 2UXDL 2UUAL 1NMGA 1HR0W 3CPWA 4JBMA 1PHJA 3UDIA 2UXDQ 3J7A5 3IKJA 1VQPA 1WE8A 2H5XA 5H1SE 2OTLA 3S1MH 2E76C 1UE7A 1VQNA 3JC66 1VQEA 3EN2A 5BN4A 1UE5A 1ZZJA 2PPBC 2XGTA 3I4MH 2UXCL 4JYAL 2A6EC 1B9NA 1WI5A 3K8AA 2UUCL 3HOXH 1Q82C 3W1GA 3A8IE 4JC0A 4YWLA 4JYAQ 4OGQC 3A5ZB 1YJWA 2FXQA 4IJHA 2N49A 3HOVH 1D7QA 1HNWL 4DV5Q 4BY7H 4DKAC 1A8VA 2ZTDA 1E3PA 3HOWG 5AJ3L 5C44H 2KENA 5DLQE 2YTXA 4JI8L 1HNWQ 2AUJD 1LUZA 2JE6I 1K3RA 3L0OA 1LTLA 2K14A 4A3EG 1GUSA 5BN5A 1Z7TA 1J5EL 1V1QA 3QG1A 3KF6B 1BDOA 2HIXA 2KHJA 1Y69U 1X55A 2K5VA 4HJ7A 2N8NA 2DUDA 3PUZA 5IYCG 2EJGC 4DR2L 3PO2H 3H0GG 2ZM6Q 1M90C 4DNTB 5K36H 1JE5A 3GTPH 4ALPA 2A68D 1XMQL 2GN5A 5JEAH 4HJ8A 3OW7A 4DAYB 4YCWA 1B8AA 2K4KA 4BY1G 1ASZA 4IFDI 1QJOA 3IFTA 2IX0A 4YY3L 2JA7H 1C0AA 4LF5L 3VKEA 4KMUC 1AH9A 4BBRG 3JAMi 2R93H 4JI5L 4C3JH 2R7ZH 4LF5Q 1S72A 1E2ZA 2VL6A 2O5IC 1E1TA 4A3LH 1B70B 2JZXA 1VS0A 3N6RA 4KKSA 2K5HA 3A8KE 1K83H 1YEZA 1KHIA 4A3CH 1J4WA 1YVCA 1TUAA 2N3SA 1VQ6A 3EIVA 2CQOA 4UP9A 5IT9c 5KNBA 2A8VA 1ZTGA 1LYLA 2Q2TA 1KL9A 3KF6A 2IHEA 4JCVE 4UP8A 1PH3A 3I4NG 2HT1A 4A3FH 4WJ4A 3KLRA 4P73A 1HQMC 4BBSH 4DR4L 4GNXA 5FLXc 2EXDA 4B3SQ 4X62L 2ZTCA 2PMZE 1QVCA 2K33A 1N36Q 2ZTEA 3I7FA 4A3GG 2IY5B 1VF7A 3AQQA 4LF6L 1GHKA 1C7YA 3U4ZA 2CTLA 2BE5C 3HGBA 3OYYA 4DV0Q 1JMCA 4LF8L 4GLVB 3GD7A 3DLLA 2PI2E 1LABA 1PH1A 4HIMA 3ERSX 3BZCA 4PZ8A 1H9RA 2NZHA 4JI4Q 4KKTA 3SE0A 2MQHA 3RR5A 1N9WA 3A5UA 4DV1Q 1X9NA 4JI2L 3CRLC 2LMCB 2VQFL 2CTFA 5C3EH 1WJJA 2PQUA 1Y8NB 1N33L 3B6YA 4LF7Q 4ME3A 4DK6C 4JI7L 2VQFQ 5M5YH 1PH6A 4QJFA 4LF4Q 1N33Q 3KLWA 4GN5A 1Y8OB 4OX9L 1XNRQ 5BR8Q 1VQMA 1K0RA 4JI3L 3J80i 3AFQA 4KN7C 4LFBL 1VF5C 5IWAL 3OOCA 2EIFA 3NEMA 4L5QA 1DT4A 1QUQB 4DV3L 2VUMG 4KN4C 2C35B 4B8TA 1YHBA 2GVBA 4NB3A 1HZ9A 5IWAQ 3L2PA 2UXBQ 2F1MA 3ZJYC 2A69D 3CMAA 4GN3B 4YWKA 1Q12A 2XTIA 2N78A 3KF8B 2JQOA 3F2CA 1ZZIA 2AWOA
chains in the Genus database with same CATH superfamily
5M5YB 5TSSA 4C1NK 4AH6A 3KBGA 3E0JA 3A7AB 4L5TA 1PZKD 2WV6D 1MSZA 3D4RA 3J81W 1EU4A 2JXMB 1EUJA 1IKLA 5A2QW 2NVTH 4IFDH 5E3FA 1LTGD 1JJGA 3DWAA 4JV5H 1F2LA 1I5FA 5IYDG 3NCVA 2KBNA 4X3TA 1BUVT 1BCPB 2ZJQA 5JPNC 2M2LA 3SVMA 1S03G 4HJAA 1QZHA 3LX0A 1IW7C 2UUBL 1SNOA 4WORA 3RMHA 4G7OC 2K50A 3SR1A 4DXGA 3K5MA 1KABA 4B9XA 3MAQA 2R92G 1Z9FA 1EZ6A 4B3MQ 2UUBQ 2R3ZA 1RKNA 5I9PA 4YHHH 3KJPA 4FF2A 2EYLA 1SYEA 2F0WA 4WALA 1A62A 3VYUA 3KLSA 4GKKH 5C3WA 1I6VC 3QOLA 2LXJA 4APVA 1QNKA 4P71A 3GTQH 3U1KA 3PO3B 3HOYH 4CHTB 1BBXC 4X64H 2I07B 2JEBI 1SXTA 5KNDA 5IODA 2A6HD 4DK3C 1JWUD 2HDLA 3J7YW 3KJOA 1QUQA 1AEXA 2CW0D 1HNZL 1STEA 1L0XB 3HOZH 1W6KA 2G9HD 2PZWA 4C3IB 1A6XA 2O4CA 1UUPA 3QWNA 1SDFA 3HG9A 3GTMB 2WB1B 3ITPA 5FJ8G 1UEAB 3BVMA 2OCEA 2QW7A 1BF4A 2OF1A 1X54A 4CJ0B 2F0GA 1KRSA 1PFMA 3J81i 2HHHH 3KF8A 4X65Q 2X06A 1QVFA 2NVTB 1G6PA 3GTJH 1LT4D 3SB1A 2VXWA 4XQJA 1ONLA 4E9JA 1ZZIA 1X3PA 1GUWA 3TN2A 2VB3X 2KECA 1VQGA 1K73C 5J39A 4K14A 3M7NA 1LM0A 5ELEA 4QMFB 1UNSA 1D1IA 4RGTA 3SHLA 1TU2B 5IYBH 3KDKA 3W1BA 1Y1VG 5M3MH 1TS4A 4QL5A 3D0FA 1I4HA 4DAPA 1AE2A 3K7AH 3QR8A 4LUZA 4MTNA 2G8YA 4OO1I 1ML0D 4DV2Q 3MFYA 3OMCA 4S3SA 3RLNA 2XVSA 3PQIA 1SNPA 4LFAH 3A56A 3RNUA 4HIOA 4DV6L 4LFCL 4IPGA 3HOYB 2UU9Q 1IBML 4A3DG 3RZOH 5LMUL 1FKAH 2IT1A 1FGBD 4DFAA 2F0FA 1W3SA 3F8TA 1NBWA 3TP5A 3AEVA 4X66L 4DV6Q 1H95A 4DU9A 1CZGA 1MSHA 3HOZB 2PY9A 4DNRB 1BBUA 1SBBB 5J3BA 3SK6A 4QUCA 3K5OA 1H9SA 3CXCA 4ILWA 5LMNH 2XRQD 3P20A 2F3VA 4J15A 1LACA 5CV5A 1PXUA 1NCVA 3GKUA 5CV9A 3E9HA 3HOUB 4A93B 4A3BH 3MXUA 4RGOS 1HNXL 4JBKA 2SEBD 1Y1WG 3K81C 1JR0D 1HZAA 2TMPA 3TZUA 4K0KH 3N52A 5EBCA 3VYTA 1EYGA 1WFQA 4A3MH 2ZJPA 1U4LA 3SK4A 1HNXQ 3QOJA 3TS2A 4FXDA 2D0PA 4RGMA 4OCHA 3KUPA 3OTOH 4HSVA 2XRSD 1KC8C 3J80c 4KV6A 4Y52H 1PRTB 5CORA 3M3YH 1NE3A 4X3SA 2F52A 5M3MB 2QGQA 2NVQB 4KHPQ 2P5ZX 4K5WA 3K7AB 4H0LC 3MC0B 1PA6A 3E3XA 2KEEA 4DGZA 4J6HA 1FJGQ 1KIXA 2KOLA 2MO1A 3TZDA 2K6AA 1XNQQ 1RDPD 1RIPA 1V9PA 4DR7L 1SYBA 4NMZA 3JAME 3BDCA 3RZOB 5G3LD 4RHSA 3S24A 4LF9H 4NXMH 1KXLA 4LK1C 3S1NH 4QIWB 3HZXA 4DV4L 4DR7Q 2EYHA 2RCFA 1SROA 1BCPF 2YQRA 3P7JA 2EQSA 2OXPA 1A15A 1V8QA 1DOKA 2PCFB 3AU7A 4V190 4DV4Q 1LT6D 2ZT9C 5D14A 1RCVD 1AN8A 3NENA 4IOCA 3OSOA 1PYBA 3I3CA 2QCPX 1GD7A 1IBKH 5KNCA 1VMPA 4OEMB 2A1AA 1SE2A 1JB7A 1H9JA 3AFPA 1VDZA 4JV5Q 4DV5L 2JA6H 1K9MC 1VQDA 4HIDA 2PQAB 4A3MB 1SLJA 3I4MG 2X6GA 3KDFB 4A3IH 3VR2A 1VCIA 1EQTA 3QO2A 1HZCA 2K1HA 1S5DD 4C2MB 2WP8J 3GTOB 1F2YA 3AB9A 3HOXG 4POGA 3JAMW 2RSOA 5DNFA 3FAUA 5IGFA 2MP1A 3I91A 4YCVA 1J9OA 3MWYW 2O5JC 1V8CA 3GTLH 4H8AA 1BCPC 1NSNS 4YHHQ 2MFIA 1R9TH 4YCUA 3HOVG 1SJED 2RA4A 2K04A 4BY7G 2NN6I 3H15A 4YWMA 4HIKA 1NY4A 4R4TA 1AE3A 2Y0SG 4HR7B 5I6YA 3NBHA 5KEEA 4X64Q 5C44G 1Z2IA 4R4CA 4QGUA 5GAHC 2MPMA 3S1NB 3UDXA 1YNJC 1EZ8A 1PFSA 3MXNB 1EOVA 3K5LA 5ELNA 1Q7YC 2F0PA 3I90A 4BS9A 1WCMG 1JOKA 5NUCA 2ZM6L 2SNMA 1ET9A 2A19A 2VQEH 4EQNA 4N8X1 2ATWA 3J81c 3CKIB 4RCOA 1TS5A 5C4HA 3F2UA 3ND9A 2DY7A 3UDFA 4A4IA 3CMEA 2YU9H 2IPKD 1DJRD 2ENBA 3S9WA 2HHHQ 3H94A 1ICWA 2PMZB 3M7GA 2XN9C 5C4ZA 3CCUA 4B3RH 1EY6A 2NB0A 4FXGC 2JK8A 4NZTM 3V96A 3S2HB 1NXUA 4A3JH 2ANNA 1T5EA 3HFZB 3TP6A 3PO2G 4RG1A 1CA5A 1XMOH 1JOOA 1PH2A 4BXXH 3BJUA 3QB3A 4JBWA 3SDZA 2FPHX 4JI0H 2AQ1B 2SOBA 3UE0A 3G4SA 1STAA 4QCLA 5IP7H 4FJSA 4ID6A 2QA4A 5JEAG 2QDBA 1L0WA 3GTLB 3V05A 4OO1H 1X32A 2JSOA 4I7AA 4CBVA 2DGRA 3SGIA 3T1YH 2NVYH 4OWTB 2JN4A 3MEFA 1L1OB 1N32H 1TWCB 1SE8A 2BE5D 4GZYC 3RLFA 2VKCA 1F9QA 1N34H 1SNQA 3TS0A 5C0XG 4LNQA 3RF2A 2A73B 5M3FH 2R93G 3PGZA 4R4IA 4L5SA 4GKJH 1K8MA 1U0LA 3M4OH 5LMNL 4C3JG 2IJ0A 4R1JA 2R7ZG 4CKBA 3ULPA 2L15A 1JB3A 4AQYH 4PNYA 1ASYA 4IOAA 3BDLA 4DR6H 1K8OA 2EXZA 3STBC 5LMNQ 2KCTA 2L9HA 1PRTF 1G291 2B2VA 2IWHA 5FKAC 4IN3A 5CV8A 4B3SL 2BOSA 5C4XG 1ZYRC 4G57A 3FMCA 3H0GB 2LS01 4JOIC 2RCNA 2QF7A 1LTBD 2HD3A 3I4NH 4B8CD 4K0KQ 1VQOA 5LL6b 1QZGA 2B39A 2CWAA 4GOPB 1N36L 1XX8A 3S2DH 5EKKA 5FLMH 3NXWA 3U58A 4A3JB 1ENCA 3VR3A 1I94L 1HHVA 4ZKBB 2B2TA 2E5LH 4WJ3M 1CUKA 4IUUA 4BY1B 3OMGA 2XSCA 1MGSA 3KK7A 4DV0L 3CCEA 4BBSG 1F0XA 1R4QB 3CW2C 4IZ8A 2F0KA 3T51B 5J22A 4ABNA 4AYBG 1QVGA 4G08A 2D5DA 4TQUS 4DR1H 1XPRA 1I94Q 4DR3H 2HCIA 4BBRB 1YJ9A 4OELB 1S5CD 4DUZL 1ICFB 4DPGA 1SJHD 3NQIA 4POFA 2ASBA 2NVYB 1STBA 4DK0A 5C6AA 4O42A 4DA2A 3SK5A 1GUGA 3AYHB 3I73A 2JP1A 5E1FA 1H9MA 2F0OA 1PRTC 4JI4L 5CYUA 1E24A 4DUZQ 2Z4IA 2B63G 4AIMA 5M3FB 1I4XA 4LF9Q 3VR6A 1E1OA 1SNCA 4J8QA 2JA5H 4DV1L 3M4OB 4OONA 1D6EC 1L1OA 5EBDA 3OWEB 3GTGH 4KK7A 4PMWA 4PZ7A 3PCOB 2F4VH 2WAQG 2ES2A 2HQLA 4A76A 1JQYD 4JI6H 2PNHA 2Y0SE 1KLGD 4LF7L 3PIOA 1YHAA 3FKIH 1V43A 4P74A 2FFMA 4OHJA 1U5KA 3K7UC 3CCSA 1EY7A 4LF4L 3URYA 4FJUA 1IBKQ 1IBLH 3HKSA 2LTMA 3EROA 1SFOH 3I4NB 2LFNA 3U9SA 4X6AH 1MSGA 4KTAA 2RSNA 1CKNB 2YTYA 1GO3E 2K5NA 3EJIA 1XNRL 4JW0A 3S2DB 2RHSB 5C3EG 4DR5H 1EFID 3T53B 3NSWA 3BZDB 5BR8L 1DCZA 4C3HH 1FR3A 3FDTA 1NJIC 1JICA 3G71A 4IURA 1CTMA 2G9DA 2RF4A 1PTOH 2Q8IB 4A3GB 2VZAA 1EWCA 5DT9A 4DUYL 1O80A 1F2ZA 4OWWB 1B3QA 3E9IA 1G91A 3MTSA 3CCJA 1MJCA 2QNDA 2AQ2B 2NN6H 4RAUC 4MZ9A 2Z0SA 3UE1A 1B7YB 3PSIA 1NMFA 4DUYQ 1X9ZA 2IX3A 2IX1A 2TSSA 5GAEC 2V4DA 4CJ2C 1IZ6A 2VQEL 1K8GA 1X3EA 5IGBA 3D3RA 3T1HH 3A7LA 5EQ0A 2UXBL 2CPQA 2OTJA 1HR0H 1F77A 3PO3H 2BH2A 4V0BA 4G7ZC 2FFKB 1SRUA 2E8GA 2VQEQ 3K58A 2HQEA 3BG3A 1KDBA 1KQSA 4XYOA 2HH3A 4GS3A 3W3AA 1H9KA 1E2VA 1Q8IA 5IY0A 2E2IH 2L5TA 2DNEA 4C3IH 2Q2IA 3F1ZA 3J81j 1J5KA 3DEPA 1K28A 4DAMA 1S4ZA 1SFOB 3GTMH 4B3RQ 3S1RB 1GJXA 1TQOA 1VQCA 1BKBA 4UHVA 2ALYB 2ID0A 4OD6A 2UUAH 5CGKA 2I5LX 2PW7A 3X3MA 2R7DA 4TRDA 2WACA 1XMOQ 3NTIA 4C3HB 1VQ7A 2B2TC 3JAMc 3LNNA 4JI0Q 4KLKA 2WB1G 1N32L 1CKNA 2WKDA 1KNAA 2M9VA 2E75C 3HKZG 1PTOB 2NZ1D 4CDDC 1HTPA 4IALA 3MZ5A 1NUCA 4HEDA 4B3ML 1Q1BA 1Q86C 1PYSB 2L11A 1HA5A 4FDBA 5D3DA 3T1YQ 1N32Q 1SE4A 4LIJA 1HRJA 4IFDG 1DM0B 1I4RA 5JPMC 3TREA 1UE6A 2JEAI 2F0TA 4AYBE 2UXCH 3TMEA 1VQHA 1V1OA 4QY7A 2DGYA 2R92H 4DR6L 2F0HA 4GKJQ 1O7LA 1I6HB 3K0YA 1W2BA 5C5MA 4JVZA 3PF4A 1XWEA 1GKHA 1STNA 2PYKA 4GN4B 1AZPA 2UUCH 1VQKA 4AQYQ 1L1OC 4DR6Q 4J1MA 1PVOA 1EY8A 2CWHA 1IYUA 2L1BA 1KDAA 4XYQA 2RQXA 1ZXTA 1Z6HA 2E2IB 4LAAA 2J7ZA 2WAQE 4PMBA 3HOYG 5IT9L 3ONAB 1CFMA 4X65L 1BO0A 4ZAIA 4CDEC 1K8AC 2LSSA 4JI8H 1HZBA 2RKSA 3NTHA 5FJ8H 3I55A 4KHVA 3LWUA 4NPSA 4DR1L 3HOUH 1PH8A 4A93H 2E5LQ 1OXXK 3NTKA 4DR3L 5FLXL 2F0IA 4TKOB 4IUVA 4A3KH 4ZKCB 3CC4A 2HH2A 1HFNA 1QOHA 1ILPA 4IJLA 1TWGB 1YZ6A 5IP9H 4DR1Q 2CWPA 1SR3A 1JC7A 1A2UA 3GP7A 1EYDA 2N55A 4GOPC 4DR3Q 4HMJA 1J5EH 2EE1A 1ESRA 2CTKA 2Z6KA 1V9NA 2H4OA 4EC5A 2F0LA 5JJIA 2C5CA 2Z9HA 3R8BA 4XIGS 4DV2L 1DD2A 2K52A 1TS3A 2L4NA 1CQVA 3CC2A 5DM63 3DWQA 3GDEA 1DZ1A 2NVQH 4RHRA 5GAGC 2UU9L 3KYHC 2I5HA 3CPFA 4P72A 4DR2H 2R92B 2NVXH 5FLXW 4LUVA 5E4WC 2B29A 5CV6A 4RMFA 4JI1L 4DV7H 3ULLA 1YNNC 2YTVA 5IGEA 1QWYA 2C9OA 4U68A 2DNCA 1GHJA 1EQQA 3TBIB 1XMQH 4JI6Q 1FNWA 4P2CB 2HIVA 2K7VA 2Z8LA 3EFXD 2EVBA 3BVZA 3EA6A 4JI1Q 5HURA 2EYMA 2E3UA 1O7IA 1HCZA 4YY3H 4FXKC 5C3XA 1U9RA 1IBLQ 4LF5H 1B4OA 5FO8B 2FJ2A 4G7HC 1L0YB 2B8GA 4IPCA 1PZID 2NTTA 3D6WA 4JI5H 2PQEA 2PNRC 1KHMA 4IQZA 5GQOA 1G2TA 4DR5Q 4PV1C 1WTOA 1OXVA 4RH6A 3V69A 5C5LA 1SMYC 4KD3A 4R9WA 1GUOA 1KAAA 3BU2A 3TQYA 4QMGA 2JA8H 3S14H 4A3KB 1WOCA 1QNUA 2A6ED 4XTCS 4NXNH 5CV4A 1MIUA 1XPOA 4NBQA 1KTKA 1Q1EA 1RL2A 4K2KA 1IHZA 4RKLA 1TT2A 1TXYA 4K5XA 4CJ1B 5LL6X 2KCNA 4EGVA 4KHPL 1JJ2A 2CH4A 4PG3A 3QJYA 4A3BG 2EZVA 3NWTA 1IYVA 1L2FA 2OEOA 2K5DA 3T1HL 1FJGL 4UAIA 4C2MH 1Q81C 3GTOH 2A5HA 2B3GA 3ERQA 3FHWA 2WB1E 1XNQL 1WTXA 1YHQA 3T56B 1IL2A 1I50H 2QEXA 1Y1VB 2MUYA 3HKZE 1YI2A 1IXRA 5DAUA 4BWGB 1Q8KA 2CVRA 1JJCB 2NVXB 2Z4HA 2EY1A 2JYOA 3T1HQ 1UG8A 4DNIA 4HTHA 2BL5A 1X6OA 1QCBD 2ANRA 1BCPD 1HR0Q 1WHRA 1FYCA 5I2YA 4DR4H 4HJ9A 2M6QA 4R8IA 1Q46A 4X62H 4OXPA 3C1FA 5KYIA 5LHY1 1S5BD 2PZUA 4H44C 3NQTA 1E2WA 2XIWA 2QDLA 1PTOF 3CU7A 4DN4M 2IHFA 2D2CC 4UP7A 5ELOA 1YITA 1ODHA 1VQ9A 4LF6H 3OIPA 4JVYA 4HCEA 2I5MX 1HPCA 2K01A 4CKEA 4JV5L 5CR3A 2UUAQ 4A75A 2Q2HA 4JOIA 4LF8H 3TEHB 4CKCA 2QILA 5BN3A 2EY5A 2KCMA 4HJ5A 1I6UA 1Y14B 2JA8B 3S14B 1OXSC 5KRUA 2F0DA 1Y1WB 2E2DC 1NNXA 2J0TD 5J1ZA 4K2LA 2HDMA 3S2HH 1CSPA 4RGNA 1TWAH 2Y3MA 3BZKA 2GVAA 2KEDA 3CP0A 4MHEA 1B1ZA 4YHHL 3I4LA 1KAWA 2Z6KC 2MJHA 1C48A 1G51A 3NELA 4JI2H 1T9HA 4GKKL 2JA6G 2HUGA 1I50B 3CCRA 3HOWH 2UXCQ 3PUVA 3CCQA 3R2TA 5JJKA 3BS1A 3TP7A 1GUTA 2CTEA 4A3IG 2F3IA 1PTOC 5IGDA 4X64L 2LXKA 2D9UA 1N33H 4GKKQ 4L6TB 4JI7H 2UUCQ 1TWCH 5K5PA 4PDBA 2EPBA 2IL8A 4CGYB 3H3VH 1X65A 4KI0A 4LUOA 4KKUA 1RTOA 1IKMA 1C9OA 2PO4A 4A3EH 5HGQA 1X3GA 4WANA 4OX9H 4N9TA 5L37A 1JORA 2DN8A 1D8LA 5AJ3Q 1WTHA 2RHQB 2HHHL 1E0BA 3M4QA 3VR5A 1WCMH 1GM5A 1CK1A 4OIKA 4JI8Q 1EL0A 5FOBB 2OQKA 1CSQA 1EEFD 1P16A 3DXJC 2WFWA 2OQ0A 4H13C 1X0AA 3GTKH 4JI3H 5IYCH 4XT3B 2Q2UA 3STBD 3F2BA 2RVLA 1JOQA 3H0GH 3S1QH 1G2SA 4YIJA 1XTDA 3CF5A 1MD2D 2F0MA 4QUFA 2ZQEA 4LFBH 4ZUJA 1ZYRD 1RD9D 3M9BA 3KDGA 4NP5A 2MHVA 3BYTB 4GNXB 4DV3H 3PUXA 4QIWE 2R7FA 1J5EQ 3I4MB 1TWAB 1STHA 2JA9A 2F0SA 1DXMA 3T13A 4Y7NH 1BOSA 4BY1H 1ENAA 2O2LD 5K36G 4QB4A 4LFAL 2EYFA 4DV7L 4F7XA 2PQAA 2LRRA 2CWFA 3HOWB 3LWEA 3KDFA 3IRBA 3CCLA 2QEJC 4DR2Q 1EYAA 4BBRH 2CQAA 4LW1A 2EOTA 5HY6A 3Q0AA 4A3JG 4L5RC 3V2TA 3J7ZC 3EZJA 1TY0A 1J8IA 2LY7A 1M1KC 3HOVB 3FPPA 3IL8A 4LFAQ 4DV7Q 1MJEA 5ELFA 2EJMA 5FO7B 3IAYA 4BXXG 2JA7G 1STYA 1X3FA 4BY7B 1WVLA 1XMQQ 5IP7G 1BVSA 4IUTA 3T4AC 5C0XH 2Y0SB 5ELBA 5M5XH 3RD4A 5C44B 2LF0A 1YBYA 1PRTD 1SNMA 1BBWA 4EQ5A 5M5WH 4A3EB 4OO1G 3PIO3 4YY3Q 3A74A 1CZWA 2YV5A 4A3LG 2AMCB 1SEBD 3PV0A 1EOTA 2CFMA 4MIUA 5EPLA 3EQLC 1WCMB 3VYRA 4JI5Q 1VMCA 5M3FG 1ILQA 4NXNL 4K0KL 1EIHA 1HUNA 3S16H 1TWFH 2RDHA 2A1SA 2UUBH 3MXNA 3GTKB 4A3CG 1ZKOA 1SMXA 3S1QB 5C4XH 1A0IA 1AP0A 3OTOL 1WTQA 4PMCA 2KHSA 4NXNQ 2P2RA 1B2TA 5LMNW 1A3VA 3G7LA 4R4QA 5JOBA 4EQPA 4F88A 1CI3M 1OO9B 1ET6A 3OTOQ 1KD1C 1E7ZA 4N9PA 4Y7NB 4ZK9B 1QG7A 4A3FG 3DEOA 2A68C 1OTCA 1HA6A 5JJLA 1P8LA 4JVHA 3FVQA 1HQRD 4A3GH 2XWJB 3NP8A 2AWNA 3GTPB 1VIGA 4DXFA 2ICIA 5FLMG 1HNZH 2K5QA 3Q23A 1SYCA 4LF9L 4NXML 3EBEA 3PUWA 1GUNA 2OPVA 1I4QA 4LWCA 3GV6A 1S5ED 3SXHA 4DR4Q 1B9MA 3ND8A 1EFWA 1VQLA 3D4WA 2AXYA 1OXUA 2PI2A 1LTID 4H02A 5I4DA 4X62Q 4FO2A 3KBXA 5M5XB 1TR5A 2EY6A 4NXMQ 2EY2A 2B63H 2E2HH 5M5WB 4NKLA 2XWBB 1FGUA 3G48A 2F0JA 1EWHA 1NTGA 2DJGC 2R7ZB 5F2DA 2AQ3B 1DONA 5A35A 4R4OA 3K59A 3PUYA 1IBKL 3HS0C 3U9OA 4LF6Q 1X56A 1VQBA 3TRZA 4UY8C 3K5NA 3S16B 1K1GA 1TWFB 2NZOA 1K83B 2JA5G 4MNOA 4LMQD 3RZDH 4LF8Q 3WDNA 3FPUB 3QIAA 2G5DA 2MO0A 1EIFA 3VA7A 4TVAB 3OW2A 5C4XB 5JEAJ 1UAPA 3UDGA 1WTVA 2Q8TA 3S1RH 3M4YA 2PT7G 4B3TH 4HN7A 2VW9A 3FKIG 3K80C 4I65A 3F2DA 3NHHA 2EYJA 2K1BA 5C0XJ 3A0JA 3IFDA 4DV6H 4LFCH 1SYDA 3E0EA 3K57A 1PMRA 1IBMH 3U4VA 5LMUH 5GADC 4K5VA 1VQ8A 3I8ZA 2ZJRA 1WD1A 4JI2Q 3VR4A 4GOPA 4BBSB 1CHPD 4AYBB 4X66H 4Q5VA 1KDCA 3A55A 4O2DA 1I4PA 1M8AA 1HJPA 3HRZC 4C3HG 5IOCA 1JE4A 3MA2B 2RBMA 4I7ZC 4JPBW 3VDYA 4JI7Q 1S40A 4B08A 4ZYSA 1UE1A 1IW7D 3DMUA 3RN5A 1VQAA 1EIYB 1BXTA 3SK8A 1Y8PB 3C3LA 2B63B 1I6HH 5C4JH 3S17H 1HNXH 1UEBA 2E2HB 3J7AK 5CC4A 4OX9Q 2VUMH 1TS2A 3GO5A 2NN6G 3I0PA 4IO9A 5D3IB 2D0OA 4Z9CB 1M4VA 2Z6BA 3GQBA 4HSPA 4UPAA 4DK1A 4L8JA 2K75A 4B3RL 4PQXA 3L3OC 2B2UA 3KLSX 3RZDB 4JI3Q 5DEHA 3K6OA 3CCMA 3PO3G 5E4XA 1XMOL 2JJQA 1Q3LA 3D6CA 3ZYYX 4LFBQ 3CCVA 1EYCA 3CQZH 2BA0A 4JI0L 2UXDH 5KGUA 4DV3Q 4NW2A 1Q90A 1WTWA 5JJZA 1T5XD 1KNEA 5C3EB 4FF3A 1S20A 1TIID 2RDFA 1DOLA 2M00A 4DR7H 3VYSA 1J6QA 4TSSA 4C3IG 1PH7A 4ZQ3A 3T1YL 5CBAE 4IUPA 1TWGH 1HFGA 1WYDA 2JVZA 3G6EA 1N34L 5IYDH 2B2YA 4DV4H 3K0XA 2OPUA 4XQNA 2E74C 2EJFC 4Q0FA 4GNXC 1RTNA 2KA7A 1PH9A 1JWSD 4GKJL 1TWHH 1Z47A 2J4XA 4H7BA 4N8FA 1B50A 1ESFA 1ZZKA 2N88A 1AFPA 2KHIA 1N34Q 3BDOA 2BDOA 1R4PB 4JK1C 4AQYL 4F8MA 2PW5A 2AKWB 1CKOA 2KVMA 4JYAH 1YIJA 5C4JB 3S17B 2BA1A 3U50C 2A74C 5IT9E 1EQRA 2X69A 1VQFA 3CD6A 2VUMB 1EC6A 1XJVA 4WJWA 3ICEA 4PZ6A 2D9IA 4DV5H 2MNAA 2AHOB 1SN8A 1VIHA 2BDNA 1X4MA 1CM9A 4MN3A 3H3VI 2CTMA 1DGSA 1I3QH 5EKLA 1YNND 1FVIA 3D8GA 3J7AF 3H3VC 2WINB 5GROA 5FLXE 1FNVA 1HNWH 4F87A 2VB2X 1FD7D 2B8FA 3BYYB 4JG2A 2OWOA 3AEVB 3ER0A 4RCNA 4BA1I 1WVNA 1I4GA 1WD0A 3DM3A 2QKIC 2YYZA 3LGJA 3I56A 2E5LL 5IIFA 1HXYD 1B53A 2A69C 2E2JH 3CQZB 3VA5A 2M8WA 2I0QA 5D65A 1PH5A 1H9SB 4EX5A 3Q8DA 1XPUA 1LT3D 3GABA 3HOZG 3PIPA 4IPHA 1O7YA 4OL7A 3RN2A 1N8RC 2H1EA 1YJNA 2EYOA 3CHBD 4QF4A 4RFBA 1D5XC 1SMYD 1XXGA 2F0VA 4ZUIA 2RDGA 2V1CC 3I70A 1OXTA 1HNZQ 2NUCA 3HKZB 3D31A 3E5SA 4P75A 5JVG3 2DJFC 3HOUG 4A93G 1NR2A 5IT9W 4GLXA 1TWHB 4DF7A 1VQ5A 1YNXA 1JCKB 2ZM6H 3C2PA 1X4NA 4A3KG 4DAVA 3TP8A 2K05A 4MTKA 4OWXB 5IP9G 2F4VL 2D62A 1PH4A 2WIIB 3HEJA 1Y1VH 4QQBX 3CC7A 4JI6L 3W5OA 5ISRA 2CTJA 4NZRM 1RODA 1S3OA 2F0NA 1TKWB 3MXGA 1CKMA 5COYA 1JT8A 4FF4A 3ULJA 4KHZA 2F4VQ 5IYBG 3OHXC 3FP9A 4M1UB 1IBLL 5M3MG 5C0XI 4A3DH 1I3QB 1D5ZC 5IE8A 3H91A 1E22A 3RLOA 1UWVA 4B3TL 4IPDA 4RWSC 1VQIA 1PFNA 2NYZD 2VNUD 4DR5L 4ULLA 2B2UC 2BH8A 3I4OA 4XXEA 3CRKC 4GLAC 5EAYA 5DM73 3KOJA 3NE5B 2A6HC 3GTQB 3WWVA 3PMFA 4G4KA 2E2JB 4B3TQ 2CW0C 3GV3A 1MHWC 1MKHA 5EPKA 4IFDJ 3Q22A 1IL8A 1O78A 5E7NA 2CCZA 2KCCA 4JBJA 4EVOA 1GVPA 3DM1A 4C1NI 1EWIA 2ZXPA 4LFCQ 4NDXA 1IBMQ 3FEWX 5LMUQ 1VBIA 1D1KA 4IUQA 1Y1WH 1HH2P 1XRHA 4RA8A 3L7ZC 1FL0A 3R93A 4X66Q 1PV4A 3I2ZA 2B2YC 2FMRA 1WTJA 3WOFA 5EGTA 3OPOA 4CDCC 2VS1A 2JA8G 1KRTA 1VQ4A 2R6GA 3GTJB 1VQJA 3M85A 2CKZB 3A8JE 1HR0L 4HCSA 1A63A 4LJZC 3EVQA 4A3MG 4O0AA 4B3SH 1PLFA 3PF5A 1IYJB 1LTRD 3KFUA 3S15H 1JWMD 2VY3A 2F0UA 4AM3A 2AUKA 1NR4A 4BA2I 2K32A 1PTOD 3M4PA 1FNUA 4L63B 1N36H 4A3DB 1EY0A 2KUMA 2SNSA 3NBHB 1I94H 1DTJA 3CAMA 2EDGA 2FINB 3I72A 2UXDL 5FK9C 2UUAL 1NMGA 3OSSD 1G8ZD 4KD4A 1HR0W 4DV0H 3CPWA 3BVGA 4JBMA 1YNJD 1SSOA 4ZCKA 1PHJA 3O13A 3UDIA 2FMMA 4K8JA 2UXDQ 4DUZH 5JVH3 4O1NA 3IKJA 3J7A5 1VQPA 1WE8A 2H5XA 5H1SE 2OTLA 3S1MH 2E76C 1UE7A 2PZTA 1VQNA 1HUMA 4KJNA 1G6ZA 1A3UA 2F03A 4JI4H 3JC66 1BNZA 1VQEA 2MGSA 3EN2A 5G3LF 5BN4A 1D5MC 1UE5A 4DV1H 1EQVA 1ZZJA 2OT2A 2PPBC 2XGTA 4XT1B 3JAML 3I4MH 2UXCL 2CH4W 3NWSA 5I2XA 4JYAL 2A6EC 4KY6A 4A3BB 3HP3A 1B9NA 1WI5A 4LF7H 3K8AA 2UUCL 3NBIA 2VQFH 3HOXH 3OETA 1Q82C 2NTSA 3W1GA 5KYLA 3A8IE 4JC0A 2CPMA 4YWLA 4JYAQ 4WFN3 4OGQC 1U4PA 1F9PA 3A5ZB 3A54A 2FXQA 4IJHA 1YJWA 3S15B 3GR5A 4LF4H 3TSSA 4M8AA 1LTAD 2N49A 3HOVH 1D7QA 1HNWL 4DV5Q 4BY7H 4DKAC 1A8VA 3M3YB 1RHPA 2ZTDA 1XNRH 1E3PA 4CDFC 3HOWG 5AJ3L 5LL6S 5C44H 2KENA 5DLQE 2YTXA 1PDQA 5BR8H 4JI8L 1HNWQ 2AUJD 1LUZA 1S5FD 2JE6I 2K03A 3TDQA 3UI2A 1ENFA 1K3RA 1AW7A 5CV7A 3L0OA 1LTLA 1EIGA 3WOEA 2K14A 4K8IA 3C1EA 3AMUA 4DUYH 2GA4B 5CMDA 5I9OA 1CQFA 4A3EG 2F3WA 1LV9A 3S1MB 1GUSA 1LLRD 5BN5A 2FHTA 1Z7TA 2SDFA 1J5EL 1V1QA 3KF6B 3QG1A 4K6DA 1BDOA 1XYIA 2HIXA 2KHJA 4HMIA 1Y69U 5EKIA 4EQOA 2LTLA 1X55A 2K5VA 5IWAH 1XTCD 4HJ7A 1F9RA 3SEBA 2Z1CA 3D4DA 2N8NA 3MFGA 2UXBH 2DUDA 1EY5A 1GXDC 3R2IA 3PUZA 5IYCG 4XDXA 2EJGC 4DR2L 3PO2H 5IGGA 3H0GG 5FO9B 2LKVA 1PYWD 3NK9A 2ZM6Q 4C56C 1M90C 2FMCA 1SE3A 1LTSD 1DYQA 1JE5A 4DNTB 3HOXB 5K36H 5JAVA 2JA6B 3P75A 3GTPH 4ALPA 2A68D 1XMQL 2GN5A 5JEAH 4HJ8A 5IGCA 3OW7A 4A3IB 1X3QA 4DAYB 4YCWA 1B8AA 2K4KA 4BY1G 3DUZA 1ASZA 2ZXOA 4IFDI 1QILA 1QJOA 3IFTA 2IX0A 4YY3L 2R61A 1DOMA 4HAEA 2JA7H 2F0EA 1C0AA 1U4RA 4LF5L 3VKEA 4ME5A 4KMUC 4X3UA 1AH9A 4BBRG 3JAMi 1LT5D 2R93H 4UDUC 2L12A 4JI5L 1TY2A 5AFWA 1R9TB 2X6LA 4C3JH 4ZLTF 1HTLD 3MXPA 4OIJA 2DY8A 2R7ZH 4LF5Q 1S72A 3MVVA 1E2ZA 2VL6A 1E1TA 2O5IC 4A3LH 1B70B 2JZXA 1VS0A 5T1GA 4B3MH 3N6RA 4KKSA 2K5HA 1K83H 3A8KE 2ZXRA 5ELDA 1W6JA 3C46A 1YEZA 5EJWA 1KHIA 3FRPB 4A3CH 1D2BA 1J4WA 5CBEE 1YVCA 3RUZA 3H09A 3J80E 5ELCA 1TUAA 2N3SA 1KLUD 2B2WA 1VQ6A 3EIVA 2CQOA 2BCOA 2KJXA 4UP9A 5IT9c 1SAPA 5KNBA 2A8VA 2YU9B 3PO2B 1ZTGA 1LYLA 2Q2TA 1KL9A 3KF6A 2I46A 2IHEA 4JCVE 4UP8A 1PH3A 3I4NG 2HT1A 2NWGA 2K5WA 4A3FH 4WJ4A 3KLRA 4P73A 3E6ZX 1HQMC 4BBSH 1EY9A 3J80L 4DR4L 4GNXA 1MBYA 5FLXc 2EXDA 4B3SQ 3G6JB 4X62L 2MJ8A 3NUCA 2ZTCA 4WRDA 1B44D 2PMZE 1QVCA 4FYDA 4E6IA 4X65H 2K33A 1V1PB 2JA7B 1N36Q 3J7AV 3W2DA 2ZTEA 3I7FA 4A3GG 2IY5B 1VF7A 2F4IA 3AQQA 4FNFA 1CT1D 4LF6L 3OWFA 1PFBA 2R93B 1GHKA 2K28A 1C7YA 4DAYA 3U4ZA 5I6WA 3P1HA 2CTLA 1B3AA 2BE5C 3HGBA 3OYYA 4C3JB 1NAPA 1TVXA 4DV0Q 1JMCA 1II3A 4GLVB 4LF8L 3J80W 2XNAC 3GD7A 3DLLA 4U673 3L9AX 2PI2E 2ICEC 1AN7A 1LABA 1PH1A 2L55A 4HIMA 3ERSX 3BZCA 4PZ8A 4XQQA 4DV2H 1WTRA 2EYPA 2IW3A 2WKCA 1H9RA 2NZHA 3Q24A 4JI4Q 4KKTA 2CHBD 3SE0A 2HCCA 3X3NA 2MQHA 2UU9H 3RR5A 3OIQA 1N9WA 3A5UA 1CHQD 1WTPA 1C4QA 4DV1Q 2Q8RE 1X9NA 4JI2L 3CRLC 2LMCB 4K6LA 1C8CA 2VQFL 1A2TA 2CTFA 4JI1H 5C3EH 2O4XA 1WJJA 2PQUA 5M9OA 3NPPA 5HGTA 1QE6A 1BQQT 4FP5D 1Y8NB 1EU3A 1N33L 3B6YA 4LF7Q 4A3FB 4ME3A 4DK6C 4JI7L 4B9WA 2VQFQ 5M5YH 4FVMA 1RF2D 3Q6SA 1AZQA 3MEHA 1PH6A 4QJFA 4LF4Q 2L0CA 1N33Q 3R3OA 4RKBA 1PZJD 3KLWA 3DWPA 4GN5A 3MHBA 1MI2A 1Y8OB 2NBFA 4OX9L 1ZEQX 4FF1A 1XNRQ 2KQ3A 1F9SA 1STGA 1SYFA 1SNDA 2F0QA 1LO5D 1SYGA 4KJOA 5BR8Q 1VQMA 3J81E 1K0RA 1A3TA 4JI3L 4X3KA 1LTTD 1V1PA 5A2QE 1F2MA 2WAQB 5EPJA 1GOZA 3J80i 3AFQA 3QD7X 1EY4A 4KHPH 4KN7C 4KY7A 5T1IA 1VF5C 4LFBL 4ODGA 1K0SA 1PQXA 1SEIA 3H6MA 5IWAL 2EIFA 3NEMA 3OOCA 4IUNA 4L5QA 2JA5B 1DT4A 1FJGH 1QUQB 4DV3L 1BR9A 2VUMG 1O7ZA 3GTGB 4KN4C 1CA6A 2C35B 4B8TA 1XNQH 1K3BC 1YHBA 2GVBA 3J81L 4NB3A 3DHQA 1QB5D 1HZ9A 1EEID 1U4MA 5IWAQ 5A2QL 2B2WC 3PIP3 4R8NA 3L2PA 3FKIB 2F1MA 3ZJYC 2UXBQ 3T16A 2A69D 3CMAA 4GN3B 4KY5A 2B2VC 4YWKA 1Q12A 1RJTA 2XTIA 2N78A 5KIXA 3KF8B 2JQOA 3F2CA 4ZRZA 2AWOA 3UOEA
chains in the Genus database with same CATH topology
5M5YB 5TSSA 4C1NK 4AH6A 3KBGA 3E0JA 3A7AB 4L5TA 1PZKD 2WV6D 3D4RA 1EU4A 2JXMB 1EUJA 1IKLA 4IFDH 2NVTH 5E3FA 1LTGD 1JJGA 3DWAA 1F2LA 1I5FA 5IYDG 2KBNA 4X3TA 1BUVT 1BCPB 2ZJQA 5JPNC 2M2LA 3SVMA 4HJAA 1QZHA 3LX0A 1IW7C 2UUBL 1SNOA 4WORA 3RMHA 4G7OC 2K50A 3SR1A 4DXGA 3K5MA 1KABA 4B9XA 3MAQA 2R92G 1Z9FA 1EZ6A 4B3MQ 2UUBQ 2R3ZA 1RKNA 5I9PA 4FF2A 3KJPA 2EYLA 1SYEA 2F0WA 4WALA 1A62A 3VYUA 3KLSA 5C3WA 1I6VC 3QOLA 2LXJA 4APVA 1QNKA 4P71A 3GTQH 3U1KA 3PO3B 3HOYH 4CHTB 1BBXC 2I07B 2JEBI 1SXTA 5KNDA 5IODA 2A6HD 4DK3C 1JWUD 2HDLA 3J7YW 3KJOA 1QUQA 1AEXA 2CW0D 1HNZL 1STEA 1L0XB 3HOZH 1W6KA 2G9HD 2PZWA 4C3IB 1A6XA 1UUPA 3QWNA 1SDFA 3HG9A 3GTMB 2WB1B 3ITPA 5FJ8G 1UEAB 3BVMA 2OCEA 1BF4A 2OF1A 1X54A 4CJ0B 2F0GA 1KRSA 1PFMA 3J81i 3KF8A 4X65Q 2NVTB 1QVFA 1G6PA 3GTJH 1LT4D 2VXWA 4XQJA 1ONLA 1ZZIA 1X3PA 1GUWA 3TN2A 2VB3X 2KECA 1VQGA 1K73C 5J39A 4K14A 3M7NA 1LM0A 5ELEA 4QMFB 1UNSA 1D1IA 4RGTA 3SHLA 1TU2B 5IYBH 3W1BA 1Y1VG 5M3MH 1TS4A 4QL5A 3D0FA 1I4HA 4DAPA 1AE2A 3K7AH 4MTNA 4LUZA 4OO1I 1ML0D 4DV2Q 3MFYA 3OMCA 4S3SA 3RLNA 2XVSA 1SNPA 3A56A 3RNUA 4HIOA 4DV6L 4LFCL 3HOYB 4IPGA 2UU9Q 1IBML 4A3DG 3RZOH 5LMUL 2IT1A 1FGBD 4DFAA 2F0FA 1W3SA 3F8TA 3TP5A 1NBWA 3AEVA 4X66L 4DV6Q 1H95A 4DU9A 1CZGA 1MSHA 3HOZB 2PY9A 4DNRB 1BBUA 1SBBB 5J3BA 3SK6A 4QUCA 3K5OA 1H9SA 3CXCA 4ILWA 2XRQD 3P20A 2F3VA 4J15A 1LACA 5CV5A 1PXUA 1NCVA 5CV9A 3E9HA 3HOUB 4A93B 4A3BH 3MXUA 4RGOS 1HNXL 4JBKA 2SEBD 1Y1WG 3K81C 1JR0D 2TMPA 3TZUA 1HZAA 3N52A 5EBCA 3VYTA 1EYGA 1WFQA 4A3MH 2ZJPA 1U4LA 3SK4A 1HNXQ 3QOJA 4FXDA 3TS2A 2D0PA 4RGMA 3KUPA 4HSVA 2XRSD 1KC8C 3J80c 4KV6A 4Y52H 1PRTB 5CORA 3M3YH 1NE3A 4X3SA 2F52A 5M3MB 2QGQA 2NVQB 4KHPQ 4K5WA 3K7AB 4H0LC 3MC0B 1PA6A 2KEEA 4DGZA 4J6HA 1FJGQ 1KIXA 2KOLA 3TZDA 2MO1A 2K6AA 1XNQQ 1RDPD 1RIPA 1V9PA 4DR7L 1SYBA 4NMZA 3JAME 3BDCA 3RZOB 5G3LD 4RHSA 3S24A 1KXLA 4LK1C 3S1NH 4QIWB 3HZXA 4DV4L 4DR7Q 2EYHA 1SROA 1BCPF 2YQRA 3P7JA 2EQSA 2OXPA 1A15A 1V8QA 1DOKA 2PCFB 3AU7A 4V190 4DV4Q 1LT6D 2ZT9C 5D14A 1RCVD 1AN8A 3NENA 4IOCA 3OSOA 1PYBA 3I3CA 2QCPX 1GD7A 5KNCA 1VMPA 2A1AA 1SE2A 1JB7A 1H9JA 3AFPA 1VDZA 4JV5Q 4DV5L 2JA6H 1K9MC 1VQDA 4HIDA 2PQAB 4A3MB 1SLJA 3I4MG 2X6GA 3KDFB 4A3IH 3VR2A 1VCIA 1EQTA 3QO2A 1HZCA 1S5DD 4C2MB 2WP8J 3GTOB 1F2YA 3AB9A 3HOXG 4POGA 2RSOA 5DNFA 5IGFA 2MP1A 3I91A 4YCVA 1J9OA 3MWYW 2O5JC 3GTLH 1BCPC 1NSNS 4YHHQ 2MFIA 1R9TH 4YCUA 3HOVG 1SJED 2RA4A 2K04A 4BY7G 2NN6I 3H15A 4YWMA 4HIKA 1NY4A 4R4TA 4HR7B 5KEEA 1AE3A 5I6YA 3NBHA 2Y0SG 4X64Q 5C44G 4R4CA 4QGUA 5GAHC 2MPMA 3S1NB 3UDXA 1YNJC 1EZ8A 1PFSA 3MXNB 1EOVA 3K5LA 5ELNA 1Q7YC 2F0PA 3I90A 4BS9A 1WCMG 1JOKA 5NUCA 2ZM6L 2SNMA 1ET9A 2A19A 4EQNA 2ATWA 3J81c 3CKIB 4RCOA 1TS5A 5C4HA 3F2UA 3ND9A 2DY7A 3UDFA 4A4IA 3CMEA 2YU9H 2IPKD 1DJRD 2ENBA 3S9WA 2HHHQ 3H94A 1ICWA 2PMZB 3M7GA 2XN9C 5C4ZA 3CCUA 1EY6A 2NB0A 4FXGC 2JK8A 3V96A 3S2HB 4A3JH 2ANNA 1T5EA 3HFZB 3TP6A 3PO2G 4RG1A 1CA5A 1JOOA 1PH2A 4BXXH 3BJUA 3QB3A 4JBWA 3SDZA 2AQ1B 2SOBA 3UE0A 4QCLA 1STAA 3G4SA 5IP7H 4ID6A 2QA4A 5JEAG 2QDBA 3GTLB 1L0WA 3V05A 4OO1H 1X32A 2JSOA 4CBVA 2DGRA 3SGIA 2NVYH 4OWTB 3MEFA 1L1OB 1TWCB 2BE5D 1SE8A 4GZYC 3RLFA 1F9QA 1SNQA 3TS0A 5C0XG 4LNQA 2A73B 5M3FH 2R93G 3PGZA 4R4IA 4L5SA 1K8MA 1U0LA 3M4OH 5LMNL 4C3JG 2IJ0A 4R1JA 2R7ZG 4CKBA 3ULPA 2L15A 1JB3A 4PNYA 1ASYA 4IOAA 3BDLA 1K8OA 2EXZA 3STBC 5LMNQ 2KCTA 2L9HA 1PRTF 1G291 2B2VA 2IWHA 5FKAC 4IN3A 5CV8A 4B3SL 2BOSA 5C4XG 1ZYRC 4G57A 3FMCA 2LS01 3H0GB 4JOIC 2RCNA 2QF7A 1LTBD 3I4NH 4K0KQ 1VQOA 1QZGA 2B39A 2CWAA 4GOPB 1N36L 1XX8A 3S2DH 5EKKA 5FLMH 3NXWA 4A3JB 3U58A 1ENCA 3VR3A 1I94L 1HHVA 4ZKBB 2B2TA 4WJ3M 4IUUA 1CUKA 4BY1B 3OMGA 2XSCA 1MGSA 3KK7A 4DV0L 3CCEA 4BBSG 1R4QB 4IZ8A 3CW2C 2F0KA 3T51B 5J22A 4ABNA 4AYBG 1QVGA 2D5DA 4TQUS 1XPRA 1I94Q 2HCIA 4BBRB 1YJ9A 1S5CD 4DUZL 4DPGA 1SJHD 3NQIA 4POFA 2ASBA 2NVYB 1STBA 4DK0A 5C6AA 4O42A 4DA2A 3SK5A 1GUGA 3I73A 3AYHB 2JP1A 5E1FA 1H9MA 2F0OA 1PRTC 4JI4L 5CYUA 1E24A 4DUZQ 2Z4IA 2B63G 4AIMA 5M3FB 1I4XA 4LF9Q 3VR6A 1E1OA 1SNCA 4J8QA 2JA5H 4DV1L 3M4OB 4OONA 1D6EC 5EBDA 1L1OA 3OWEB 3GTGH 4KK7A 4PMWA 4PZ7A 3PCOB 2WAQG 2ES2A 2HQLA 4A76A 1JQYD 2PNHA 2Y0SE 1KLGD 4LF7L 3PIOA 1YHAA 3FKIH 1V43A 4P74A 4OHJA 1U5KA 3K7UC 3CCSA 1EY7A 4LF4L 3URYA 1IBKQ 3HKSA 3EROA 3I4NB 1SFOH 2LFNA 3U9SA 4X6AH 1MSGA 4KTAA 2RSNA 1CKNB 2YTYA 1GO3E 3EJIA 2K5NA 1XNRL 3S2DB 2RHSB 5C3EG 1EFID 3T53B 3NSWA 3BZDB 5BR8L 1DCZA 4C3HH 1FR3A 3FDTA 1NJIC 1JICA 3G71A 4IURA 1CTMA 2G9DA 2Q8IB 1PTOH 4A3GB 2RF4A 2VZAA 1EWCA 4DUYL 1O80A 1F2ZA 4OWWB 3E9IA 1G91A 3MTSA 3CCJA 1MJCA 2QNDA 2AQ2B 2NN6H 4RAUC 4MZ9A 2Z0SA 3UE1A 1B7YB 3PSIA 1NMFA 4DUYQ 2IX3A 2IX1A 2TSSA 5GAEC 2V4DA 4CJ2C 1IZ6A 2VQEL 1K8GA 1X3EA 5IGBA 3D3RA 3A7LA 5EQ0A 2UXBL 2CPQA 2OTJA 1F77A 3PO3H 2BH2A 4V0BA 4G7ZC 2FFKB 1SRUA 2E8GA 2VQEQ 3K58A 2HQEA 3BG3A 1KDBA 1KQSA 4XYOA 2HH3A 4GS3A 3W3AA 1H9KA 1E2VA 1Q8IA 5IY0A 2E2IH 2L5TA 2DNEA 4C3IH 2Q2IA 3F1ZA 3J81j 1J5KA 3DEPA 4DAMA 1S4ZA 1SFOB 3GTMH 4B3RQ 3S1RB 1GJXA 1TQOA 1VQCA 1BKBA 2ID0A 2ALYB 5CGKA 2I5LX 2PW7A 3X3MA 2R7DA 4TRDA 2WACA 1XMOQ 3NTIA 4C3HB 1VQ7A 2B2TC 3JAMc 3LNNA 4JI0Q 4KLKA 2WB1G 1N32L 1CKNA 2WKDA 1KNAA 2M9VA 2E75C 3HKZG 1PTOB 2NZ1D 1HTPA 4IALA 3MZ5A 1NUCA 4HEDA 4B3ML 1Q1BA 1Q86C 1PYSB 2L11A 1HA5A 5D3DA 4FDBA 3T1YQ 1N32Q 1SE4A 4LIJA 1HRJA 4IFDG 1DM0B 1I4RA 5JPMC 3TREA 1UE6A 2JEAI 2F0TA 4AYBE 3TMEA 1VQHA 1V1OA 4QY7A 2DGYA 2R92H 4DR6L 2F0HA 4GKJQ 1O7LA 1I6HB 3K0YA 1W2BA 5C5MA 3PF4A 1XWEA 1GKHA 1STNA 2PYKA 1AZPA 4GN4B 1VQKA 4AQYQ 1L1OC 4DR6Q 4J1MA 1PVOA 1EY8A 1IYUA 2L1BA 1KDAA 4XYQA 2RQXA 1ZXTA 1Z6HA 2E2IB 4LAAA 2J7ZA 2WAQE 4PMBA 3HOYG 5IT9L 3ONAB 1CFMA 4X65L 1BO0A 4ZAIA 1K8AC 2LSSA 1HZBA 2RKSA 3NTHA 5FJ8H 3I55A 4KHVA 3LWUA 4NPSA 4DR1L 3HOUH 1PH8A 4A93H 2E5LQ 1OXXK 3NTKA 4DR3L 5FLXL 2F0IA 4TKOB 4IUVA 4A3KH 4ZKCB 3CC4A 2HH2A 1HFNA 1QOHA 1ILPA 4IJLA 1TWGB 1YZ6A 5IP9H 4DR1Q 2CWPA 1SR3A 1JC7A 1A2UA 3GP7A 1EYDA 2N55A 4GOPC 4DR3Q 4HMJA 2EE1A 1ESRA 2CTKA 2Z6KA 2H4OA 2F0LA 5JJIA 2C5CA 3R8BA 4XIGS 1DD2A 4DV2L 2K52A 1TS3A 2L4NA 1CQVA 3CC2A 5DM63 3DWQA 3GDEA 1DZ1A 2NVQH 4RHRA 5GAGC 2UU9L 3KYHC 2I5HA 3CPFA 4P72A 2R92B 2NVXH 5E4WC 4LUVA 2B29A 5CV6A 4RMFA 4JI1L 3ULLA 1YNNC 5IGEA 2YTVA 4U68A 1QWYA 2C9OA 2DNCA 1GHJA 1EQQA 3TBIB 4JI6Q 1FNWA 4P2CB 2HIVA 2K7VA 2Z8LA 3EFXD 2EVBA 3BVZA 3EA6A 5HURA 4JI1Q 2EYMA 2E3UA 1O7IA 1HCZA 4FXKC 5C3XA 1U9RA 1IBLQ 1B4OA 5FO8B 2FJ2A 4G7HC 1L0YB 2B8GA 4IPCA 1PZID 2NTTA 3D6WA 2PQEA 2PNRC 1KHMA 4IQZA 5GQOA 1G2TA 4DR5Q 4PV1C 1WTOA 1OXVA 4RH6A 3V69A 5C5LA 1SMYC 4KD3A 4R9WA 1GUOA 1KAAA 3BU2A 3TQYA 4QMGA 2JA8H 3S14H 4A3KB 1WOCA 1QNUA 2A6ED 4XTCS 5CV4A 1MIUA 1XPOA 4NBQA 1KTKA 1Q1EA 1RL2A 4K2KA 1IHZA 4RKLA 1TT2A 4K5XA 1TXYA 4CJ1B 5LL6X 2KCNA 4EGVA 4KHPL 1JJ2A 4PG3A 3QJYA 4A3BG 2EZVA 3NWTA 1IYVA 1L2FA 2OEOA 2K5DA 3T1HL 1FJGL 4UAIA 4C2MH 1Q81C 3GTOH 2A5HA 2B3GA 3ERQA 3FHWA 2WB1E 1XNQL 1WTXA 1YHQA 3T56B 1IL2A 1I50H 2QEXA 1Y1VB 2MUYA 3HKZE 1YI2A 4BWGB 5DAUA 1IXRA 2CVRA 1Q8KA 2NVXB 1JJCB 2Z4HA 2EY1A 2JYOA 3T1HQ 4DNIA 4HTHA 2BL5A 1X6OA 1QCBD 2ANRA 1BCPD 1HR0Q 1FYCA 5I2YA 4HJ9A 4R8IA 1Q46A 5KYIA 3C1FA 4OXPA 5LHY1 1S5BD 2PZUA 4H44C 3NQTA 1E2WA 2XIWA 1PTOF 3CU7A 4DN4M 2IHFA 2D2CC 4UP7A 5ELOA 1YITA 1VQ9A 3OIPA 4JVYA 4HCEA 2I5MX 1HPCA 2K01A 4CKEA 4JV5L 5CR3A 2UUAQ 4A75A 2Q2HA 4JOIA 3TEHB 4CKCA 2QILA 5BN3A 2EY5A 2KCMA 4HJ5A 1Y14B 2JA8B 3S14B 1OXSC 5KRUA 2F0DA 1Y1WB 2E2DC 2J0TD 5J1ZA 4K2LA 2HDMA 3S2HH 1CSPA 4RGNA 1TWAH 3BZKA 2GVAA 2KEDA 3CP0A 4MHEA 1B1ZA 4YHHL 3I4LA 1KAWA 2Z6KC 2MJHA 1C48A 1G51A 3NELA 1T9HA 4GKKL 2JA6G 2HUGA 1I50B 3CCRA 3HOWH 2UXCQ 3PUVA 3CCQA 3R2TA 5JJKA 3BS1A 3TP7A 1GUTA 2CTEA 4A3IG 2F3IA 1PTOC 5IGDA 4X64L 2LXKA 2D9UA 4GKKQ 4L6TB 2UUCQ 1TWCH 5K5PA 2EPBA 2IL8A 4CGYB 3H3VH 4KI0A 1X65A 4LUOA 4KKUA 1RTOA 1IKMA 1C9OA 2PO4A 4A3EH 5HGQA 1X3GA 4WANA 4N9TA 1JORA 2DN8A 1D8LA 5AJ3Q 2RHQB 2HHHL 1E0BA 3VR5A 3M4QA 1WCMH 1GM5A 1CK1A 4OIKA 1EL0A 4JI8Q 5FOBB 2OQKA 1CSQA 1EEFD 1P16A 3DXJC 2WFWA 2OQ0A 4H13C 3GTKH 5IYCH 4XT3B 2Q2UA 3STBD 3F2BA 2RVLA 1JOQA 3H0GH 3S1QH 1G2SA 4YIJA 1XTDA 3CF5A 1MD2D 2F0MA 4QUFA 4ZUJA 1ZYRD 1RD9D 3M9BA 4NP5A 2MHVA 3BYTB 4GNXB 3PUXA 4QIWE 2R7FA 1J5EQ 3I4MB 1TWAB 1STHA 2JA9A 2F0SA 1DXMA 3T13A 4Y7NH 1BOSA 4BY1H 1ENAA 2O2LD 5K36G 4QB4A 4LFAL 2EYFA 4DV7L 4F7XA 2PQAA 3HOWB 3LWEA 3KDFA 3IRBA 3CCLA 2QEJC 4DR2Q 1EYAA 4BBRH 2CQAA 3Q0AA 2EOTA 4LW1A 5HY6A 4A3JG 4L5RC 3V2TA 3J7ZC 1TY0A 1J8IA 2LY7A 1M1KC 3HOVB 3FPPA 3IL8A 4LFAQ 4DV7Q 1MJEA 5ELFA 2EJMA 5FO7B 3IAYA 4BXXG 2JA7G 1STYA 1X3FA 4BY7B 1WVLA 1XMQQ 5IP7G 4IUTA 1BVSA 3T4AC 5C0XH 2Y0SB 5ELBA 5M5XH 3RD4A 5C44B 4OO1G 1PRTD 1SNMA 1BBWA 4A3EB 1YBYA 4EQ5A 5M5WH 3PIO3 4YY3Q 3A74A 1CZWA 2YV5A 4A3LG 2AMCB 1SEBD 3PV0A 1EOTA 2CFMA 4MIUA 5EPLA 3EQLC 1WCMB 3VYRA 4JI5Q 1VMCA 5M3FG 1ILQA 4NXNL 4K0KL 1EIHA 1HUNA 3S16H 1TWFH 2RDHA 3MXNA 3GTKB 4A3CG 1ZKOA 1SMXA 3S1QB 5C4XH 1A0IA 1AP0A 3OTOL 1WTQA 4PMCA 2KHSA 4NXNQ 2P2RA 1B2TA 5LMNW 1A3VA 3G7LA 4R4QA 5JOBA 4EQPA 4F88A 1CI3M 1ET6A 1OO9B 3OTOQ 1KD1C 1E7ZA 4N9PA 4Y7NB 4ZK9B 1QG7A 4A3FG 3DEOA 2A68C 1OTCA 1HA6A 5JJLA 1P8LA 4JVHA 3FVQA 1HQRD 4A3GH 2XWJB 3NP8A 2AWNA 3GTPB 1VIGA 4DXFA 2ICIA 5FLMG 2K5QA 3Q23A 1SYCA 4LF9L 4NXML 3EBEA 3PUWA 1GUNA 2OPVA 1I4QA 4LWCA 3GV6A 1S5ED 3SXHA 4DR4Q 1B9MA 3ND8A 1EFWA 1VQLA 3D4WA 2AXYA 1OXUA 2PI2A 1LTID 4H02A 5I4DA 4X62Q 4FO2A 3KBXA 5M5XB 1TR5A 2EY6A 4NXMQ 2EY2A 2B63H 2E2HH 5M5WB 4NKLA 2XWBB 1FGUA 3G48A 2F0JA 1EWHA 1NTGA 2R7ZB 5F2DA 2AQ3B 1DONA 5A35A 4R4OA 3K59A 3PUYA 1IBKL 3HS0C 3U9OA 4LF6Q 1X56A 1VQBA 3TRZA 4UY8C 3K5NA 3S16B 1K1GA 1TWFB 2NZOA 1K83B 2JA5G 4MNOA 4LMQD 3RZDH 4LF8Q 3WDNA 3FPUB 3QIAA 2MO0A 1EIFA 3VA7A 4TVAB 3OW2A 5C4XB 5JEAJ 1UAPA 3UDGA 1WTVA 2Q8TA 3S1RH 3M4YA 4HN7A 2VW9A 3FKIG 3K80C 4I65A 3F2DA 3NHHA 2EYJA 2K1BA 5C0XJ 3A0JA 3IFDA 1SYDA 3E0EA 3K57A 1PMRA 3U4VA 5GADC 4K5VA 1VQ8A 3I8ZA 2ZJRA 1WD1A 4JI2Q 3VR4A 4GOPA 4BBSB 1CHPD 4AYBB 4Q5VA 1KDCA 3A55A 4O2DA 1I4PA 1M8AA 5IOCA 3HRZC 4C3HG 1HJPA 1JE4A 3MA2B 2RBMA 4I7ZC 3VDYA 4JI7Q 1S40A 4B08A 4ZYSA 1UE1A 1IW7D 3DMUA 3RN5A 1VQAA 1EIYB 1BXTA 3SK8A 1Y8PB 3C3LA 2B63B 1I6HH 5C4JH 3S17H 1UEBA 2E2HB 5CC4A 4OX9Q 2VUMH 1TS2A 3GO5A 2NN6G 4IO9A 5D3IB 2D0OA 4Z9CB 1M4VA 3GQBA 4HSPA 4DK1A 4UPAA 4L8JA 2K75A 4B3RL 4PQXA 3L3OC 2B2UA 3KLSX 3RZDB 4JI3Q 5DEHA 3K6OA 3CCMA 3PO3G 5E4XA 1XMOL 3ZYYX 1Q3LA 3D6CA 2JJQA 4LFBQ 3CCVA 1EYCA 3CQZH 2BA0A 4JI0L 5KGUA 4DV3Q 4NW2A 1Q90A 1WTWA 5JJZA 1T5XD 1KNEA 5C3EB 4FF3A 1TIID 2RDFA 1DOLA 2M00A 3VYSA 1J6QA 4TSSA 4C3IG 1PH7A 4ZQ3A 3T1YL 5CBAE 4IUPA 1TWGH 1HFGA 1WYDA 2JVZA 3G6EA 1N34L 5IYDH 2B2YA 3K0XA 2OPUA 4XQNA 2E74C 2EJFC 4Q0FA 4GNXC 1RTNA 2KA7A 1PH9A 1JWSD 4GKJL 4H7BA 1Z47A 2J4XA 1TWHH 1B50A 1ESFA 1ZZKA 2N88A 1AFPA 2KHIA 1N34Q 3BDOA 2BDOA 1R4PB 4JK1C 4AQYL 4F8MA 2PW5A 2AKWB 2KVMA 1CKOA 1YIJA 5C4JB 3S17B 2BA1A 3U50C 2A74C 5IT9E 1EQRA 2X69A 1VQFA 2VUMB 3CD6A 1EC6A 1XJVA 4WJWA 3ICEA 4PZ6A 2MNAA 2AHOB 1SN8A 1VIHA 2BDNA 1X4MA 1CM9A 4MN3A 3H3VI 2CTMA 1DGSA 1I3QH 5EKLA 1YNND 3D8GA 1FVIA 3J7AF 3H3VC 2WINB 5FLXE 5GROA 1FNVA 4F87A 2VB2X 1FD7D 2B8FA 3BYYB 4JG2A 2OWOA 3AEVB 4RCNA 4BA1I 3ER0A 1WVNA 1I4GA 1WD0A 3DM3A 2QKIC 2YYZA 3LGJA 3I56A 2E5LL 5IIFA 1HXYD 1B53A 2A69C 2E2JH 3CQZB 3VA5A 2I0QA 5D65A 1PH5A 1H9SB 4EX5A 3Q8DA 1XPUA 1LT3D 3HOZG 3PIPA 4IPHA 1O7YA 4OL7A 3RN2A 1N8RC 2H1EA 1YJNA 2EYOA 3CHBD 4QF4A 4RFBA 1D5XC 1SMYD 1XXGA 2F0VA 4ZUIA 2RDGA 3I70A 2V1CC 1OXTA 1HNZQ 2NUCA 3HKZB 3D31A 3E5SA 4P75A 5JVG3 3HOUG 4A93G 1NR2A 4GLXA 1TWHB 4DF7A 1VQ5A 1YNXA 1JCKB 3C2PA 1X4NA 4A3KG 4DAVA 3TP8A 2K05A 4OWXB 5IP9G 2F4VL 2D62A 1PH4A 2WIIB 3HEJA 1Y1VH 4QQBX 3CC7A 4JI6L 3W5OA 5ISRA 2CTJA 1RODA 2F0NA 1S3OA 1TKWB 3MXGA 1CKMA 5COYA 1JT8A 4FF4A 3ULJA 4KHZA 2F4VQ 5IYBG 3OHXC 3FP9A 4M1UB 1IBLL 5M3MG 5C0XI 4A3DH 1I3QB 1D5ZC 5IE8A 3H91A 1E22A 3RLOA 1UWVA 4B3TL 4IPDA 4RWSC 1VQIA 1PFNA 2NYZD 2VNUD 4DR5L 4ULLA 2B2UC 4XXEA 2BH8A 3I4OA 3CRKC 4GLAC 5EAYA 5DM73 3NE5B 3KOJA 2A6HC 3GTQB 3WWVA 3PMFA 4G4KA 2E2JB 4B3TQ 2CW0C 3GV3A 1MKHA 5EPKA 4IFDJ 3Q22A 1IL8A 1O78A 5E7NA 2CCZA 2KCCA 4JBJA 4EVOA 1GVPA 3DM1A 4C1NI 1EWIA 2ZXPA 4LFCQ 4NDXA 1IBMQ 3FEWX 5LMUQ 1D1KA 4IUQA 1Y1WH 1HH2P 4RA8A 3L7ZC 1FL0A 3R93A 4X66Q 1PV4A 3I2ZA 2B2YC 2FMRA 3WOFA 5EGTA 3OPOA 2VS1A 2JA8G 1KRTA 1VQ4A 2R6GA 3GTJB 1VQJA 3M85A 2CKZB 3A8JE 1HR0L 4HCSA 1A63A 4LJZC 3EVQA 4A3MG 4O0AA 1PLFA 3PF5A 1IYJB 1LTRD 3KFUA 3S15H 1JWMD 2VY3A 2F0UA 4AM3A 2AUKA 1NR4A 4BA2I 2K32A 1PTOD 3M4PA 1FNUA 4L63B 4A3DB 1EY0A 2KUMA 2SNSA 3NBHB 1DTJA 3CAMA 2EDGA 2FINB 3I72A 2UXDL 5FK9C 2UUAL 1NMGA 1G8ZD 4KD4A 1HR0W 3CPWA 3BVGA 4JBMA 1YNJD 1SSOA 1PHJA 3O13A 3UDIA 2FMMA 4K8JA 2UXDQ 5JVH3 4O1NA 3IKJA 3J7A5 1VQPA 1WE8A 2H5XA 5H1SE 2OTLA 3S1MH 2E76C 1UE7A 2PZTA 1VQNA 1HUMA 4KJNA 1G6ZA 1A3UA 2F03A 1BNZA 3JC66 1VQEA 2MGSA 5G3LF 3EN2A 5BN4A 1D5MC 1UE5A 1EQVA 1ZZJA 2OT2A 2PPBC 2XGTA 4XT1B 3JAML 3I4MH 2UXCL 3NWSA 5I2XA 4JYAL 2A6EC 4KY6A 4A3BB 3HP3A 1B9NA 1WI5A 3K8AA 2UUCL 3NBIA 3HOXH 1Q82C 2NTSA 5KYLA 3W1GA 3A8IE 4JC0A 4YWLA 4JYAQ 4WFN3 4OGQC 1U4PA 1F9PA 3A5ZB 3A54A 3S15B 2FXQA 4IJHA 1YJWA 3TSSA 4M8AA 1LTAD 2N49A 3HOVH 1D7QA 1HNWL 4DV5Q 4BY7H 4DKAC 1A8VA 3M3YB 1RHPA 2ZTDA 1E3PA 3HOWG 5AJ3L 5LL6S 5C44H 2KENA 5DLQE 2YTXA 1PDQA 4JI8L 1HNWQ 2AUJD 1LUZA 1S5FD 2JE6I 2K03A 3TDQA 3UI2A 1ENFA 1K3RA 1AW7A 5CV7A 3L0OA 1LTLA 1EIGA 3WOEA 2K14A 4K8IA 3C1EA 3AMUA 2GA4B 5CMDA 5I9OA 1CQFA 4A3EG 2F3WA 1LV9A 3S1MB 1GUSA 1LLRD 5BN5A 2FHTA 1Z7TA 2SDFA 1J5EL 1V1QA 3QG1A 3KF6B 4K6DA 1BDOA 1XYIA 2HIXA 2KHJA 4HMIA 1Y69U 5EKIA 4EQOA 1X55A 2K5VA 1XTCD 4HJ7A 1F9RA 3SEBA 2Z1CA 3D4DA 2N8NA 3MFGA 2DUDA 1EY5A 1GXDC 3R2IA 3PUZA 5IYCG 4XDXA 2EJGC 4DR2L 3PO2H 5IGGA 3H0GG 5FO9B 2LKVA 1PYWD 3NK9A 2ZM6Q 4C56C 1M90C 2FMCA 1SE3A 1LTSD 1DYQA 4DNTB 3HOXB 5K36H 1JE5A 5JAVA 2JA6B 3P75A 3GTPH 4ALPA 2A68D 1XMQL 2GN5A 5JEAH 4HJ8A 5IGCA 3OW7A 4A3IB 1X3QA 4DAYB 4YCWA 1B8AA 2K4KA 4BY1G 3DUZA 1ASZA 2ZXOA 4IFDI 1QILA 1QJOA 3IFTA 2IX0A 4YY3L 2R61A 1DOMA 4HAEA 2JA7H 2F0EA 1C0AA 1U4RA 4LF5L 3VKEA 4ME5A 4KMUC 4X3UA 1AH9A 4BBRG 3JAMi 1LT5D 2R93H 4UDUC 2L12A 4JI5L 1TY2A 5AFWA 1R9TB 2X6LA 4ZLTF 4C3JH 1HTLD 3MXPA 4OIJA 2DY8A 2R7ZH 4LF5Q 1S72A 3MVVA 1E2ZA 2VL6A 2O5IC 1E1TA 4A3LH 1B70B 2JZXA 1VS0A 5T1GA 3N6RA 4KKSA 2K5HA 3A8KE 1K83H 2ZXRA 5ELDA 1W6JA 3C46A 1YEZA 5EJWA 1KHIA 3FRPB 4A3CH 1D2BA 1J4WA 5CBEE 1YVCA 3RUZA 3H09A