5K36G

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
236
structure length
232
Chain Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAGVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 45
structure length 232
sequence length 236
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5k36G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5k36G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5k36G03
2V1CC 4YWLA 3D4RA 4R4IA 1X56A 2D5DA 4HIKA 3CCSA 4A76A 2DNEA 3S15H 4L8JA 1A8VA 1RIPA 1S72A 5BN3A 4LF6L 1OXVA 4K0KL 3UDIA 3KJOA 5C0XI 1K73C 3A8IE 3FPPA 4IOAA 2D0OA 1Q1EA 1KL9A 2R7ZH 2DN8A 3BDOA 1X54A 3HOXG 1QJOA 2E76C 1B70B 1JJ2A 1B9NA 4DV7Q 3I55A 2K5NA 1PMRA 4A3KH 2F3IA 4JC0A 4LNQA 1Q7YC 1GUSA 5KNBA 1YNNC 1Y1VH 4X64L 3S1NH 2OWOA 1K1GA 1CUKA 4IPHA 1L1OC 1HNZQ 5M5XH 1G6PA 3CPWA 4O2DA 3B6YA 2B63G 2B3GA 3A5ZB 1YHQA 4G7OC 1QVCA 3J7ZC 3OYYA 3G71A 2IX1A 1XNRL 4POGA 2B8FA 2N49A 4JVYA 4JV5Q 5JEAJ 4B3SL 3A0JA 3OOCA 2BA0A 5K36G 3AFPA 3AEVB 1UE6A 3M85A 1K8MA 3TS2A 4JI0Q 2MFIA 5IP7G 1EIFA 1IBLL 4YY3Q 1VQCA 2KHJA 1SROA 5K36H 1XPOA 2NVXH 3PUWA 2DNCA 4JV5L 1C0AA 2AXYA 3HOWG 1TWFH 1IBLQ 2K52A 1WJJA 4JI4Q 4LFCQ 4JI8L 3MEFA 2JE6I 3ULJA 5IP7H 1GHKA 1VQAA 2FXQA 3SE0A 1X3GA 3HOVG 1TWGH 2R93H 2B29A 2HIVA 4JI4L 1QUQB 3CMAA 2RHQB 1SFOH 3GTKH 4NBQA 4BA1I 4JI3Q 2NVYH 1KRSA 1EIYB 2MO0A 2ZM6Q 1YZ6A 3CRKC 2NN6H 4G7ZC 4A3CH 5JJIA 4GN3B 4XIGS 2R7FA 4AIMA 1XMOQ 2NVTH 2YQRA 3I72A 1SMXA 1HNZL 2BDOA 4DNRB 4JBJA 4LF7Q 1T9HA 1Q81C 3WDNA 5IWAL 5GADC 1NJIC 1JMCA 4A3LG 3HOXH 5IYDH 3U58A 3ULPA 1PH1A 4JI2L 3V69A 3G48A 5GROA 2O5JC 4X64Q 3TS0A 2A19A 2K5HA 2EJFC 3AQQA 2H5XA 5DLQE 5C4XH 1PH6A 3HGBA 2EJGC 1JE5A 1VCIA 4DV7L 4AQYQ 5KNDA 1XNRQ 1Y1WG 1IL2A 1IZ6A 2L15A 2OQKA 4O0AA 3PO3H 3RN2A 4GKKQ 2NVQH 3D0FA 1VQOA 1QVGA 4DR3Q 2E8GA 1VQ7A 1MKHA 2XGTA 2O5IC 2VS1A 4LUVA 3JAMi 2VQEL 1FJGL 2BE5D 4JBWA 2PMZE 4DR7Q 1ZZIA 2KCCA 3KDFA 3M4PA 4P74A 3DM3A 3HOYH 2ALYB 2PNHA 3UE1A 3S17H 2HHHL 4YHHQ 2BL5A 1P8LA 3TEHB 3CQZH 1YITA 4DAMA 1M1KC 3HOWH 4KHPL 2PY9A 1GUTA 1OXSC 4LFAQ 4JG2A 1V43A 2E2JH 3CCUA 1A0IA 1GHJA 3KLWA 5IP9G 1W2BA 3KFUA 2R93G 4DR2L 2QGQA 3VR6A 4NB3A 4L5TA 4DV3L 2JEAI 3L2PA 2AUJD 2QEXA 4GNXA 1MIUA 1DD2A 1E1TA 4PMWA 4EQ5A 2AKWB 4A3BG 4LFAL 2CPQA 4JCVE 3RZDH 1K8GA 2HQLA 4QY7A 2QNDA 4B3RQ 5LMUL 3Q8DA 4JOIC 2BE5C 4AQYL 1Z9FA 3ZJYC 4LF5L 2LXKA 3U50C 4B3ML 2BH8A 1Y8OB 4B3RL 4WJ3M 1XJVA 2UUBQ 4B3TQ 2A1AA 4DR6Q 4MTNA 4H44C 1SR3A 3W1BA 1X9NA 1I94L 3AFQA 4A3GH 1MJCA 1Z47A 1Y69U 4IJLA 5M5WH 5M3FH 1DT4A 3HKSA 4A3LH 1B8AA 1U0LA 3AB9A 1ZZKA 3EQLC 1KXLA 4XTCS 3RNUA 1VQHA 4QQBX 2A69C 1K3RA 2BA1A 4A3EG 3CC2A 1A6XA 4G7HC 4YWKA 4JI7L 1B9MA 1UE1A 2E3UA 1EYGA 3HOUH 4YHHL 2Y0SE 3RZOH 1ONLA 3W1GA 4R1JA 4I7ZC 4QGUA 2ZM6L 4AYBE 1N33L 5LMNQ 3M4OH 1X4MA 3GTOH 1Y8PB 4LWCA 2VQEQ 1VQDA 4DR7L 5M3MG 1DXMA 3A7LA 1NMGA 4YCWA 5C4JH 3S1MH 4DR3L 2BH2A 2VQFQ 1G291 2JVZA 3K80C 3G4SA 4LF9Q 1LM0A 5FJ8G 3HKZG 5HY6A 3RLOA 5BR8Q 4NXMQ 1WE8A 4AM3A 1Q1BA 1N34Q 1X65A 1YNJC 4GLAC 5GQOA 4LFCL 2Q2TA 1NBWA 4A93H 2VY3A 1E22A 2Q2IA 3MFYA 2Z6KC 3S1RH 4OWTB 1CI3M 1LACA 4KN7C 3A5UA 2A69D 5C0XG 1YEZA 3NBHB 3GTJH 4UP8A 1XMOL 3UE0A 3VR4A 5J3BA 4DR5Q 1EWIA 3RR5A 5FLMG 5IWAQ 3J81j 2UUCQ 4KN4C 1IXRA 1K83H 4LUOA 3GQBA 2ID0A 3OTOQ 1XNQQ 3J7A5 1HNWQ 2CTLA 4OO1I 1QZHA 1YIJA 1SE8A 2MJHA 5IYBH 1N32L 5FLMH 1GO3E 1J5KA 4JI5L 2DUDA 3PSIA 3IRBA 2JA8H 3NENA 3K7AH 2K32A 3GO5A 3KF6A 3U9SA 2JA9A 3PUYA 3LGJA 1HZCA 3TQYA 3CXCA 4HJ8A 4A3JG 1Q90A 1PH4A 4R4CA 5IYCH 3OPOA 1JB7A 4YY3L 1W3SA 3N6RA 3PV0A 4PV1C 3CCVA 5LMNL 3HOZH 4LF4L 2LMCB 1QZGA 2F4VQ 1X3EA 5ELNA 1VQGA 1PHJA 1GUOA 3I4MG 3F8TA 4IJHA 4K0KQ 3M7NA 2VQFL 1E2WA 1PH9A 4QMFB 2QF7A 2B8GA 4B3SQ 3CMEA 3RN5A 3J81c 1SLJA 3NELA 4GOPA 3EBEA 1Y14B 4DV0L 1EFWA 2ZTDA 2F1MA 5C0XJ 2C35B 2Q8IB 1V9PA 3H0GG 4ALPA 1GM5A 3D31A 2R92G 1KQSA 4R4OA 3A8KE 4JI7Q 4P71A 2UU9L 4DNIA 5LMNW 4NXNL 4A3EH 3W3AA 1SRUA 5IY0A 4IO9A 3T1YL 1HR0L 4JYAL 2UXCQ 4R4QA 4DR4L 1FVIA 5GAGC 1JJCB 1E1OA 3UDXA 1UEBA 3ND8A 4IPDA 4DUZL 3S2HH 1VQLA 1TUAA 4IQZA 1YHAA 1QVFA 3A8JE 1CSPA 4TQUS 5A35A 1E3PA 4BBRG 4B3MQ 5HGQA 4OO1H 4BY1H 1U5KA 1K0RA 2WAQG 5FLXc 2ZTCA 4RCNA 2DGYA 1ASYA 4RG1A 1I6HH 2CW0C 3CAMA 2XTIA 3EN2A 1H9KA 4L5QA 1GUGA 4TVAB 3T1HL 3L7ZC 4Y52H 4LF5Q 2K7VA 2FMRA 2AMCB 2EIFA 2R7DA 2ZT9C 4KI0A 3U4VA 3CC4A 2NN6I 4DV6L 4H0LC 2A6ED 1I94Q 2OPVA 4X62Q 4DV1Q 4TKOB 2K14A 2JZXA 1X3FA 3QJYA 1GKHA 4LK1C 5M3MH 1XMQQ 4C3HH 4P72A 1WCMH 1TXYA 1PH7A 3BZCA 1O78A 2A68C 1KHMA 1VQJA 2EJMA 1XTDA 1N8RC 3J80i 3T1YQ 4A3BH 5JJKA 3A7AB 3S16H 4BBSH 1Y8NB 3CPFA 1LTLA 2B63H 1YJNA 2NZHA 1UE5A 5AJ3L 1D8LA 1I6VC 1Z7TA 4FDBA 4OX9Q 3KF8B 3S14H 1HPCA 3ERSX 2UXDQ 3VKEA 1VQ6A 1ASZA 3CRLC 5GAEC 4DUYL 4OXPA 4IFDI 3K0XA 1DCZA 1N36Q 1IBKL 2KCTA 2VL6A 3CCEA 3ULLA 1O7LA 1MJEA 1IYUA 1Q86C 1V1QA 4LF8Q 4GKKL 3HOYG 4HR7B 2JA7H 4IPCA 4JVHA 4POFA 1G51A 2ZJQA 1XPRA 2JA5G 4GKJL 4A3CG 1FR3A 4C3JH 2WB1E 5IYBG 4DKAC 2ZTEA 5C3EG 4APVA 1HR0Q 1WVNA 1L1OB 5M5YH 3FKIG 1ZTGA 1V8QA 2KCMA 1YVCA 1VQNA 2HIXA 3PUXA 3UDGA 3I4OA 2A6EC 1R9TH 4BY1G 1H9SA 2Q2UA 2CTMA 1A63A 5BN5A 1VS0A 2D62A 3E0EA 1VDZA 1KHIA 5C44H 4LIJA 3FKIH 4HIOA 5IP9H 4C2MH 1HZ9A 4B8TA 1IW7C 1O7IA 3PIOA 4QJFA 3L0OA 2JA5H 5IT9c 2UU9Q 1VQ4A 4IFDH 1VQIA 5BN4A 5EAYA 1E2VA 1CKMA 4QL5A 1CKNB 4DV5L 3P20A 3CW2C 1AH9A 3I4NH 3KOJA 4HIDA 1PFSA 4IPGA 4DV2L 4JI3L 2CTJA 2DGRA 3OTOL 5KNCA 1TWHH 3T51B 4JI1L 4WJ4A 1Z6HA 1E24A 4UY8C 1KC8C 4A75A 2CFMA 3SDZA 1Q8KA 2I0QA 4H02A 4YCVA 3J80c 3GTQH 1Y1WH 3S1QH 3OW2A 2CCZA 4AH6A 3JC66 3CCMA 2JEBI 1H95A 3AYHB 2F52A 4GOPB 1XNQL 2HH2A 3STBC 3PO2H 2Q2HA 4Y7NH 3VDYA 3I4NG 4GKJQ 2D0PA 2JK8A 4HIMA 1N34L 4JI5Q 1RL2A 4OO1G 1VQFA 1WI5A 4DR1Q 4JI8Q 1XPUA 3PIPA 4GN5A 3WWVA 1HNWL 2CKZB 2IT1A 4A3FG 3AEVA 3PUZA 3U1KA 3DLLA 1PH2A 3H94A 4IOCA 4JI6L 3M4QA 4A3DG 3TRZA 4A93G 4DR5L 1PH5A 4UPAA 1I5FA 4JBMA 2CTEA 1PV4A 1EOVA 4LF9L 1VF5C 3MXNB 5IE8A 2JJQA 2YTYA 4HJ7A 2ANRA 4JBKA 3G6EA 4OGQC 1DGSA 3E9HA 3TZUA 1IYJB 4IFDJ 4DK3C 1M90C 3FP9A 2YYZA 2RF4A 2VW9A 1C7YA 1XMQL 2YU9H 2P2RA 2OPUA 2E74C 1I50H 1T5EA 1OXTA 2V4DA 5C0XH 3PUVA 1E7ZA 4GOPC 1HNXQ 2UUAL 4A3KG 2UUBL 4B3TL 4DV6Q 3GTGH 1H9RA 1BKBA 2YTVA 3CP0A 4BBSG 1BDOA 1H9JA 1YHBA 3SGIA 1AE2A 2R92H 2NN6G 3M3YH 3HOVH 3GTLH 4A3MH 4BY7H 2I5HA 2CQOA 1VQBA 2Z6KA 3VR5A 3F2CA 1HZAA 1NTGA 1E2ZA 2AHOB 4DV4Q 4HJ5A 4A3IH 1GJXA 1QUQA 1UE7A 3PF5A 1PYSB 3ICEA 4DNTB 4ME3A 1N36L 3ND9A 1IBKQ 2JQOA 1HZBA 3F2BA 1J4WA 1GVPA 2OTLA 3I4MH 4A3MG 4BY7G 1EWHA 1TKWB 1WFQA 2CWAA 4UP7A 4DR2Q 3PO3G 2UXDL 4X66Q 5ELOA 5IYCG 4J15A 2KA7A 1VIHA 3LNNA 4OWXB 4X62L 4DV1L 2VUMH 2ANNA 1TWCH 3CC7A 2JA6G 1VQPA 4WANA 2UXBL 2Y0SG 1OXXK 4A3JH 3I4LA 2ZJPA 2WFWA 5E7NA 2L5TA 3NE5B 3OW7A 3T1HQ 2R7ZG 2UXBQ 1FL0A 2MQHA 2UUAQ 3H3VH 4JK1C 4JI2Q 2E2HH 4DPGA 4KHPQ 4GLXA 4DV4L 4X66L 2EDGA 1D7QA 2K50A 3LWUA 4LW1A 4JI6Q 1VF7A 3MXUA 3PGZA 2PQAA 4YCUA 5GAHC 1CKOA 4DR4Q 1AE3A 1H9SB 3BJUA 3K8AA 1SMYC 4A3FH 4P75A 1Y1VG 2WP8J 1LYLA 4PZ7A 4H13C 4GN4B 4DK0A 1YI2A 3T56B 1NE3A 1L0WA 1Q46A 3EIVA 4KKSA 2QA4A 4QIWE 3KDFB 4DUZQ 4GLVB 2MNAA 1FJGQ 2I5MX 2F4VL 1B7YB 2MO1A 2HH3A 2A6HD 2Z0SA 4HJ9A 1GD7A 3TREA 1KIXA 3PF4A 1FGUA 1HNXL 1CKNA 2GVAA 4OWWB 2K5VA 1VQMA 1EQQA 4GS3A 4R4TA 2PI2A 3IKJA 2IX0A 3J81i 4DR1L 3GD7A 5H1SE 2E5LQ 4LF4Q 1WYDA 1C9OA 1KAWA 2ASBA 3H3VI 5C4XG 3HOZG 4LFBQ 4GNXB 5JJLA 2KENA 1P16A 1PH3A 1K9MC 4JYAQ 2UXCL 3UDFA 4MNOA 4LF7L 1WOCA 1EUJA 3F2DA 1UWVA 2N8NA 1OXUA 1NMFA 2OCEA 4YWMA 1PA6A 4JI0L 2E75C 4A3DH 1Q82C 2D2CC 1N9WA 2VZAA 1HQMC 4IFDG 4AYBG 3HFZB 2N78A 2JA6H 4A3GG 4JI1Q 4BXXH 4P73A 2AUKA 2KHIA 4KKUA 3I73A 2RHSB 2JA8G 5C44G 3HKZE 1TU2B 4DV5Q 3CCLA 3QIAA 3VA7A 1VQEA 1HTPA 3GDEA 2IHFA 3I7FA 4KLKA 3JAMc 1BVSA 2RCNA 3FMCA 1OTCA 1N32Q 1SN8A 3QG1A 4X65Q 4KMUC 3K7UC 4A4IA 5FJ8H 4DK6C 3I56A 3KJPA 4HJAA 2VUMG 4BXXG 1PVOA 3F1ZA 3CCRA 1BBUA 1HJPA 1H9MA 1HCZA 1LUZA 4X65L 4DV0Q 4DV2Q 3BG3A 2E2IH 1N33Q 1Q12A 1BBWA 1S40A 2E5LL 2IY5B 1TWAH 2GVBA 2OQ0A 2ATWA 1JJGA 2PCFB 4OONA 3PO2G 1J6QA 2N3SA 4DUYQ 1K8AC 2UUCL 3GTMH 3IFTA 1YJ9A 3M9BA 1JT8A 2ZJRA 3S2DH 2LXJA 1IYVA 4PZ6A 1DTJA 2CTFA 3VR2A 2WAQE 4WALA 1WCMG 5BR8L 2KBNA 5M3FG 3T53B 4LF8L 1PYBA 1CFMA 2VNUD 3A74A 2PQUA 3KLRA 1FYCA 1ZKOA 4DK1A 2JXMB 2PPBC 1HH2P 3BZKA 3RLNA 3U4ZA 1IBML 4L5SA 1NY4A 1VQKA 4LFBL 1X4NA 4MZ9A 2HT1A 2CWPA 1VQ9A 4L5RC 1K8OA 1X6OA 1EQRA 2K75A 1J5EQ 1YNXA 4NXML 2EVBA 1IW7D 4NPSA 3NEMA 4UP9A 1KRTA 2A6HC 2K33A 4GNXC 4DR6L 2IHEA 1VQ5A 5JEAG 2A8VA 4DV3Q 2GN5A 2A68D 4GZYC 3CCQA 3HOUG 5LMUQ 1PH8A 4RMFA 4JOIA 4PG3A 1L1OA 4BBRH 5AJ3Q 4OX9L 1VIGA 3ER0A 1A62A 1X55A 3KF6B 5C3EH 4LF6Q 3CD6A 1EC6A 3H15A 5IYDG 2EQSA 3RLFA 1HR0W 4A3IG 3FHWA 4LJZC 4DAYB 1CTMA 3DXJC 2PI2E 3W5OA 3M4YA 1LABA 2R6GA 2LSSA 4EX5A 2NZOA 2K4KA 1KD1C 1GUNA 2JA7G 5JEAH 3S24A 3GTPH 1YJWA 4KHZA 3BU2A 1ZYRC 3E9IA 2EXDA 2AWOA 2I5LX 3STBD 1J5EL 2PQAB 1ZZJA 3CF5A 1CSQA 2YV5A 4X6AH 3H0GH 4LUZA 1YBYA 4BA2I 2AWNA 2WB1G 3K81C 4PZ8A 1IBMQ 2ES2A 3PCOB 4KKTA 4NXNQ 2OTJA 4C3IH 3CCJA 3VR3A 3KYHC 1I3QH 2YTXA 2PNRC 3I2ZA 1VQ8A 2CTKA 2HHHQ 1S3OA 1L2FA
chains in the Genus database with same CATH superfamily
4YWLA 2G9HD 4HIKA 1F9RA 1OXVA 2X6GA 3A8IE 2ZXPA 4C3JG 1Q1EA 1QJOA 2E76C 2B63H 4PMCA 3TN2A 4K6LA 1K1GA 1YNNC 4X64L 1HNZQ 5M5XH 2B63G 1D1KA 2B3GA 1YHQA 3J7ZC 3OYYA 3HOUB 4POGA 2B8FA 1EY9A 4JVYA 4JVZA 4B3SL 4K5WA 1LO5D 5DEHA 5K36G 3AFPA 3OSOA 1K8MA 1XNQH 2F0TA 4XYOA 2NTSA 1Z2IA 4YY3Q 1U4MA 4DR4H 1VQCA 2KHJA 3D6CA 1XPOA 4IUNA 5C5LA 2NVXH 1CQFA 4NXNH 1C0AA 4QB4A 3EA6A 3QO2A 1MGSA 1GUWA 2FXQA 3KF8A 3SE0A 2K03A 2B29A 4NBQA 1JWSD 2DY7A 2NVYH 1EIYB 4K8JA 4XQNA 1K28A 1YZ6A 2NN6H 4G7ZC 1I4RA 2NVTH 2R7FA 4AIMA 1XMOQ 1HA6A 4M1UB 1U9RA 3T13A 1HNZL 4LF7Q 4PDBA 4DA2A 4CKBA 3I4NB 3WDNA 5IWAL 1JMCA 5LMUH 2FPHX 2LKVA 4XYQA 3DHQA 3G48A 4U68A 4BBSB 2O5JC 3TS0A 3FKIB 2K5HA 3AQQA 5C4XH 1JE5A 5KNDA 4N9PA 4O0AA 5M3MB 1QVGA 5L37A 2KOLA 1KLUD 2VQEL 3JAMi 1KLGD 4P74A 3S17H 1A2TA 2HHHL 3C3LA 1HRJA 4DR1H 3TSSA 1FJGH 3CQZH 1YITA 1M1KC 5C4ZA 1OXSC 2JSOA 1S5CD 3D4WA 3KLWA 4IUVA 2R93G 4R8IA 4GNXA 2ICIA 2JEAI 4YHHH 3I3CA 4DGZA 5J39A 3D4DA 4QY7A 3HP3A 5IODA 4B3RQ 3T1HH 4JOIC 1Z9FA 3H09A 2LXKA 5CV6A 1XJVA 2F0GA 1SR3A 4H44C 5ISRA 1MJCA 1Z47A 1STEA 3HKSA 1U0LA 5CC4A 3AB9A 1ZZKA 4HSVA 4EQNA 2F0LA 5I6YA 3RNUA 1F2YA 3PO2B 3GABA 2A69C 1K3RA 2DY8A 3EJIA 3ERQA 3CC2A 4G7HC 1MSZA 1MSHA 4DUZH 2E3UA 1EYGA 3NHHA 3BVZA 4QGUA 1XYIA 1X4MA 5LMNQ 3M4OH 2X06A 5M3MG 1DXMA 1EY7A 1S4ZA 1Y1VB 2JVZA 1JOKA 3HKZG 1BUVT 1N34Q 2Q2TA 1YNJC 3HZXA 4GLAC 5I9OA 4A93H 1SE3A 1V8CA 3S1RH 1YEZA 3NBHB 3R8BA 3TMEA 1XMOL 5EPKA 3TP7A 1KDAA 2LFNA 1DYQA 1K83H 2CTLA 1QZHA 4KD3A 1HA5A 1FKAH 2MJHA 1N32L 4KD4A 1S5BD 1J5KA 4XXEA 4J1MA 3HG9A 2QKIC 4JI0H 1IBKH 1EIHA 4YY3L 1V1PA 3HOZH 3BVGA 1PRTF 1X3EA 4K0KQ 1VQGA 3S14B 3MHBA 1A2UA 4QMFB 2M8WA 4B3SQ 1F9SA 1RJTA 3CMEA 3J81W 3J81c 1TR5A 1V1OA 3TBIB 1EFWA 2ZTDA 5C0XJ 2Q8IB 2TMPA 4JI8H 4R4OA 4JI7Q 4A3GB 3W3AA 4IO9A 1KABA 4JYAL 3A55A 3UDXA 4DUZL 2JN4A 2OF1A 4L63B 1YHAA 5A35A 1E3PA 1D5MC 1O80A 2PW7A 5HGQA 1LT4D 1U5KA 1K0RA 1BQQT 3EN2A 1JOQA 3IAYA 1H9KA 3T1HL 4Y52H 4RH6A 1HTLD 5FK9C 4TSSA 2R7DA 2ZT9C 4ZKBB 4H0LC 2A6ED 4C2MB 3DUZA 1LTSD 5EKKA 1QE6A 3LX0A 2A68C 1KHMA 5JAVA 1N8RC 3T1YQ 4A3BH 1Y8NB 2B2YA 3U9OA 3CRLC 4XT1B 2PO4A 3K0XA 5HGTA 3CCEA 3ULLA 1O7LA 1FNUA 1MJEA 4H8AA 1WTOA 3HOYG 3F2UA 4HR7B 4JVHA 1AZQA 1G51A 2ZJQA 3QOLA 1TS2A 1FR3A 2ZTEA 5C3EG 2H4OA 1HR0Q 1G2TA 3D3RA 1JORA 3FKIG 4OL7A 1ZTGA 3PUXA 2A6EC 2K5QA 2RDHA 1O7YA 2Q2UA 1VS0A 3E0EA 1DJRD 4B08A 1EL0A 1CHPD 4QF4A 2SNMA 3NSWA 3GKUA 5C6AA 4IALA 1VQ4A 1AH9A 2HCCA 3KOJA 1PFSA 3SB1A 4JI3L 4Q5VA 3L9AX 5KNCA 5I2YA 3SDZA 5IIFA 1QNKA 3Q0AA 2Z1CA 1H95A 4GOPB 2F52A 1CZGA 4Y7NH 2CH4W 2JK8A 1BO0A 1N34L 2B63B 1F9PA 2H1EA 2O4XA 5LMNH 5I6WA 1HNWL 2IT1A 2EE1A 1GXDC 4DR5L 1KAAA 2RQXA 3DM1A 1DGSA 4CJ0B 5T1IA 4DK3C 4A3DB 4EQPA 2VW9A 1XMQL 1I50H 5CV9A 1T5EA 2UUAL 4BBSG 1BKBA 2YTVA 1BDOA 2R92H 3M3YH 1AE2A 3VR5A 3F2CA 4DV4Q 4ZYSA 2QILA 3PF5A 2B2TA 5C3EB 3PIP3 1N36L 1HZBA 1PTOF 2RDGA 2OTLA 4O42A 3I4MH 4A3MG 2HD3A 4BY7G 2CWAA 1NSNS 2F4VH 2OXPA 4X66Q 1K3BC 2KA7A 4OWXB 1TWCH 1SNMA 1ZEQX 4LF9H 4HTHA 4A3JH 3I4LA 1G2SA 2RKSA 4HCEA 2F0IA 2HUGA 5KIXA 3HOZB 3OW7A 3T1HQ 1I4QA 2R7ZG 1BF4A 2F0DA 3H3VH 1SYFA 2FINB 4B3MH 3PGZA 1AE3A 2KECA 3C46A 3BJUA 1SMYC 4PZ7A 1LYLA 4B9WA 4H13C 1A3UA 1RF2D 5IGBA 4G57A 2F0KA 4DK0A 5C44B 4JYAH 4RAUC 2F3VA 3T56B 1L0WA 2UU9H 2F4VL 4DUZQ 4QIWE 1X32A 2F0NA 3R2IA 3TREA 1AW7A 4FJUA 2IX0A 3IKJA 5H1SE 3H3VI 1SYDA 1HQRD 4UHVA 4ZLTF 3M3YB 5C4XG 2KENA 1SMYD 4MNOA 1SYCA 3MXPA 1EUJA 4DFAA 1UWVA 3OSSD 1MHWC 4HAEA 1NMFA 1PA6A 4JI0L 4A3DH 2CWFA 5CORA 2XNAC 4A3GG 3H3VC 3CHBD 2JA8G 3HKZE 4DV5Q 2ZJPA 3JAMc 4A3JG 2IHFA 3I7FA 1N32Q 4DV0L 3QG1A 3K7UC 4BXXG 1PVOA 3KJPA 1A3VA 3E6ZX 3OWEB 3CCRA 4DV0Q 1H9MA 1HCZA 5EPLA 1STNA 1N33Q 1Q12A 4J6HA 1TWAH 2OQ0A 1N34H 1PRTC 1CZWA 2PCFB 3PO2G 3NUCA 1K8AC 1JT8A 1JWUD 3IFTA 2ZJRA 5LL6X 3HS0C 2WAQE 2VNUD 2ZM6H 3KLRA 3U4ZA 4L5SA 3GTPB 4JI3H 5CMDA 2HT1A 2CWPA 2K75A 1X6OA 3ZYYX 4NXML 4NPSA 1SXTA 1KRTA 2IPKD 2K33A 4DR6L 2A8VA 3Q22A 4HSPA 1EYAA 3T4AC 4GZYC 1I94H 4NDXA 1PH8A 3TP6A 3Q6SA 4RMFA 1ET9A 3KLSX 4OX9L 4B3RH 1X55A 3KF6B 5A2QE 4LF6Q 1B4OA 3H15A 5IYDG 3FHWA 3HOXB 2EPBA 4R8NA 2PI2E 3M4YA 1IBMH 1GUNA 1IKLA 1YJWA 5I4DA 4KHZA 3STBD 3E9IA 5CV8A 5C4JB 4DR2H 3QB3A 4RHRA 1CSQA 2QCPX 4X6AH 2WB1G 4PZ8A 5CYUA 1IBMQ 3NQTA 2Z9HA 4KKTA 4CHTB 3Q23A 4C3IH 3S16B 1U4LA 1CQVA 2PNRC 2HHHQ 2E5LH 1L2FA 1PV4A 2LRRA 4WJWA 3G7LA 2D5DA 3CCSA 4L8JA 4ZCKA 4KJNA 1DOMA 2CQAA 1EFID 4K0KL 3BDOA 3HOXG 1JJ2A 1EEFD 4P2CB 5KNBA 1Y1VH 4KY7A 2OWOA 1WTWA 1G6PA 1CT1D 1XNRL 2CPMA 3SK8A 1ENFA 3GR5A 2NYZD 3HOWB 3CQZB 3M85A 5E4WC 2J0TD 1IBLL 5IGDA 1A3TA 2F0WA 3PUWA 2DNCA 2M6QA 4KK7A 3AU7A 2KUMA 3MEFA 1AFPA 3ULJA 5IP7H 1VQAA 1GHKA 1TQOA 1X3GA 1TWGH 4X3SA 3NBIA 2R93H 1RD9D 4F88A 4CJ1B 1PDQA 3CMAA 4X3KA 2PMZB 3CRKC 4FF3A 4GN3B 1EY8A 1XNRH 1G91A 1WTVA 2YQRA 3I72A 2K1HA 2Z4HA 1T9HA 1EU3A 5GADC 1NJIC 3G6JB 4A3LG 1HXYD 4IUPA 4RA8A 4K8IA 1PFMA 4CKEA 4JI2L 3V69A 4FYDA 4RKBA 4ULLA 4X64Q 2A19A 2EJFC 5C5MA 1PH6A 2EJGC 4AYBB 3ONAB 1IZ6A 3KDKA 2OQKA 2MP1A 4GKKQ 3FRPB 1XTCD 4KHPH 1MKHA 4DR7Q 4A3MB 4BY7B 3M4PA 3UE1A 2B39A 4YHHQ 3JAME 1UEAB 2BL5A 4KHPL 4RGTA 5D65A 1GHJA 2EYPA 5DT9A 2QGQA 1N33H 2QDLA 3L2PA 2AUJD 1MIUA 4HN7A 3W2DA 1DD2A 3OIQA 2CPQA 2QNDA 3RZDH 2HQLA 3S1NB 4HMJA 1SJED 1WCMB 1Q3LA 3I70A 4NZTM 4WJ3M 2A1AA 1X9NA 4NKLA 4A3EB 3AFQA 1Y69U 1PRTB 2FFMA 1B8AA 1PZID 3EQLC 3NWTA 4YWKA 4JI7L 4CJ2C 1A6XA 2EY2A 1JCKB 1SBBB 4YHHL 4LFBH 1N33L 5LL6S 3R93A 4LWCA 4DR7L 4FF2A 4LMQD 4X3TA 4YCWA 5C4JH 3S1MH 1F2MA 3K80C 3G4SA 4LF9Q 1F77A 1LM0A 5BR8Q 5FJ8G 4AM3A 1Q1BA 2Q2IA 1RHPA 4KN7C 5IGEA 4X65H 4DU9A 5J3BA 2X69A 1STHA 1EWIA 3RR5A 3J81j 1J8IA 3H6MA 4KN4C 4LUOA 2CH4A 1N32H 1JC7A 5FLMH 2B2WC 1ET6A 3PSIA 3GTLB 3FAUA 2JA8H 3J7AV 1ESFA 3GO5A 3HRZC 3LGJA 3KK7A 3PUYA 3U9SA 5K5PA 2ZQEA 4ZAIA 4R4CA 1HFGA 2FHTA 1HNZH 1PZJD 2F4VQ 1TY2A 1GUOA 1MBYA 3F8TA 4IJHA 2FJ2A 2B8GA 1BR9A 3RN5A 1V9NA 4G4KA 2NWGA 3NELA 4DR3H 2MHVA 3EBEA 1B1ZA 2OEOA 3GP7A 2C35B 1SDFA 4ALPA 3H0GG 1EY6A 1PYWD 3QD7X 1KQSA 2UU9L 1LTAD 5LMNW 4NXNL 1SRUA 1LTGD 5IY0A 2UXCQ 4KJOA 5DNFA 5GAGC 1JJCB 2PT7G 1VQLA 2F0OA 1IKMA 1QVFA 4OCHA 1EQTA 4E9JA 2XRQD 3A8JE 1CSPA 4N9TA 4BBRG 2AQ1B 4OO1H 1KDCA 3J80E 2WAQG 2DGYA 4RCNA 4DR6H 4RG1A 3CAMA 1PLFA 4KY5A 5HURA 4L5QA 4TVAB 3L7ZC 4LF5Q 4RHSA 5I9PA 2EXZA 3DEPA 4DV3H 2UXDH 3T1YH 1GOZA 3OIPA 2K14A 2JZXA 3C1FA 3QJYA 4LK1C 1XMQQ 2F0EA 4C3HH 1BCPB 3BDCA 1WCMH 1PH7A 2J4XA 2NB0A 3BZCA 2EJMA 3J80i 3MXGA 3A7AB 1LV9A 5COYA 3CPFA 1YJNA 2B2WA 2L11A 5AJ3L 4FDBA 1I6VC 1SE4A 3SK6A 3S14H 4RFBA 2A5HA 3ERSX 5GAEC 4DUYL 2E2JB 1DCZA 2KEDA 1V1QA 1SSOA 2F0HA 2JA7H 4HEDA 1XPRA 2NZ1D 1RCVD 4DKAC 1WVNA 1DONA 5M5YH 5EJWA 1R9TH 2XRSD 4BY1G 3OWFA 1W6KA 5BN5A 2D62A 1QNUA 1VDZA 4I7AA 5C44H 5IP9H 4C3IG 1F0XA 1O7IA 3L0OA 4PNYA 2EY5A 4IFDH 2Z4IA 4FP5D 3K58A 1CKNB 4DV5L 3P20A 4IPGA 2KQ3A 3OTOL 1TWHH 2RCFA 4RCOA 2G5DA 3FVQA 3GTOB 4O1NA 4JI1H 2CFMA 1Q8KA 2EYMA 1JICA 2IJ0A 2WINB 4YCVA 3J80c 1LTID 3VYRA 1Y1WH 2CCZA 3OTOH 3CCMA 1TIID 5CBEE 1YNND 3KDGA 2VQFH 1VMPA 4HIMA 4JI5Q 2R7ZB 1WI5A 3DWQA 2K6AA 4GN5A 1CA6A 4A3FG 5NUCA 4IOCA 1PH5A 4JBMA 2CTEA 4X64H 4LF9L 5IE8A 1NAPA 4JBKA 4OGQC 3TZUA 3GTQB 4IFDJ 1RKNA 1KTKA 2P2RA 2OPUA 4C3HG 1E7ZA 1OXTA 2M00A 2N55A 4A3KG 4B3TL 3GTGH 4ZQ3A 1H9RA 3NCVA 1CK1A 3HOVH 4NW2A 2Z6KA 1VQBA 3FPUB 1CHQD 5T1GA 4HJ5A 3ICEA 4DNTB 4ME3A 4DAVA 1SJHD 2EYFA 1PRTD 1SEBD 2A73B 4K2LA 2PYKA 4DR2Q 4ZK9B 4NMZA 5ELOA 2CW0D 4OIJA 5IYCG 4J15A 1WTRA 1G6ZA 4X62L 1U4RA 1J9OA 1OXXK 1CM9A 3NPPA 1WVLA 2MQHA 2QEJC 2UUAQ 1Q8IA 3I0PA 4JI2Q 4DPGA 4KHPQ 3A54A 5CV7A 4X66L 1STBA 1D7QA 3SXHA 2K50A 3BVMA 3SHLA 4JI6Q 3MXUA 4DR4Q 5JOBA 1CKOA 4QCLA 1H9SB 4P75A 1Y1VG 1YI2A 1NE3A 1Q46A 3EIVA 1HR0H 3K57A 3TP8A 1HHVA 3QR8A 5M5YB 5D3DA 2GVAA 1VQMA 3VA5A 1EQQA 1BCPC 3GD7A 1JOOA 4HMIA 4LF4Q 4GNXB 5IOCA 2UXCL 1BOSA 1WOCA 4YY3H 3RD4A 3MA2B 2VB2X 1AN7A 5IT9E 1XMQH 1HQMC 1ZYRD 2QDBA 2N78A 3CCLA 3VYUA 3VA7A 3GDEA 3S17B 5M5WB 4QIWB 1BVSA 1JB3A 3CKIB 4KMUC 4Q0FA 5FJ8H 3S15B 1BBUA 1LUZA 5FO7B 4X65L 4DV2Q 3NWSA 3DEOA 2E5LL 2IY5B 5KRUA 1JJGA 2F0MA 3DWAA 4PZ6A 2IX3A 2VB3X 1CFMA 4ZRZA 3A74A 3Q24A 1FYCA 2HDMA 1IBML 1X0AA 2ZXRA 4C1NK 3NTIA 4K5XA 2LTMA 3SK5A 1VQ9A 4A3JB 1K8OA 2RA4A 2NVYB 3NEMA 3MZ5A 4UP9A 1TVXA 3D8GA 1T5XD 3MC0B 5LMUQ 1B44D 3J81E 1CA5A 1WTPA 5IT9W 3ER0A 1A62A 5C3EH 4LF5H 4XDXA 1EC6A 2EQSA 3P1HA 4DAYB 1CTMA 3W5OA 2D9IA 4EX5A 1LABA 2LSSA 4DV1H 1KD1C 1QG7A 4L6TB 2JA7G 3GTPH 3S24A 4PQXA 2K1BA 2MUYA 1LT5D 2PQAB 3J81L 3CF5A 2YV5A 4LUZA 3S2DB 4UDUC 1YBYA 2ES2A 2O4CA 3PCOB 2LF0A 1EU4A 1WTJA 2CTKA 5EKLA 4OD6A 3JAMW 1X65A 4EQOA 1AZPA 2V1CC 4C3HB 1X56A 2I07B 3V2TA 3S15H 4HCSA 5LL6b 1RIPA 1TS4A 5DAUA 1RODA 5BN3A 3UDIA 1K73C 5C0XI 4IOAA 1KL9A 1X54A 2DN8A 1RTNA 1VQ5A 1D6EC 3HOVB 4DV7Q 3I55A 2K5NA 4A3KH 4JC0A 3S1MB 1PTOC 1CUKA 4IPHA 1L1OC 1X3QA 3KUPA 3CPWA 1SYBA 2X6LA 3B6YA 3A5ZB 1QVCA 3G71A 4G7OC 1C48A 1EWCA 3A0JA 2BA0A 3TS2A 4JI0Q 2MFIA 1SNQA 5IP7G 1I6HB 1EY4A 5KEEA 3KBXA 2AXYA 2EYLA 2K52A 4JI8L 1F9QA 2KVMA 1B2TA 3OHXC 3HOVG 2HIVA 4JI4L 5G3LF 4IUTA 1R9TB 5EGTA 1VMCA 4DNRB 1VBIA 2SOBA 1M8AA 1Q81C 2PW5A 2EYHA 3HOXH 5IYDH 3ULPA 2F03A 2WB1B 3JAML 5JVH3 2JYOA 1TT2A 1QWYA 4U673 2H5XA 1XNRQ 3HGBA 1QB5D 1VCIA 4KV6A 4AQYQ 1Y1WG 2L15A 3WOFA 2RSNA 2NVQH 2WIIB 2K5WA 2E8GA 1VQ7A 2XGTA 1FJGL 1ZZIA 1LTBD 2PMZE 2F0QA 2B2YC 2ALYB 2PNHA 1P8LA 5KGUA 2PY9A 4DAMA 3HEJA 3HOWH 2XIWA 1A0IA 5IP9G 1W2BA 1G8ZD 2L12A 1WD0A 1EEID 4J8QA 2QEXA 4ME5A 4JCVE 3ITPA 1TWGB 2R93B 3DMUA 1D5XC 5LMUL 4PMBA 3Q8DA 2BE5C 5IWAH 4LF5L 3U50C 4B3ML 4FNFA 2BH8A 3RUZA 4B3RL 4IUUA 2NVXB 2UUBQ 1HNWH 4MTNA 3C1EA 3MTSA 2M2LA 4WORA 2N88A 4IJLA 1SE2A 5EKIA 4QQBX 1B3AA 2BA1A 4A3EG 1UE1A 3HOUH 2F0VA 3RZOH 1DOLA 4I7ZC 2ZM6L 4AYBE 2A1SA 3WOEA 3GTOH 5BR8H 1Y8PB 2VQEQ 1VQDA 1X3PA 2PZUA 1N36H 1B50A 4ILWA 3K7AB 4B9XA 4NXMQ 4R9WA 4LFCL 1NBWA 2VY3A 1E22A 4I65A 2Z6KC 2VXWA 3MFYA 3EFXD 4OWTB 1CI3M 1LACA 1NXUA 2UUAH 2A69D 2CVRA 4BBRB 5C0XG 3UE0A 5IWAQ 4F7XA 4IURA 4JI5H 3J7A5 2HQEA 4A93B 5EPJA 3OMCA 5FLXW 1GO3E 3K5NA 4JI5L 2DUDA 3IRBA 1TY0A 3NENA 3KF6A 3TQYA 1PH4A 1HZCA 1SYGA 5IYCH 1W3SA 3N6RA 3PV0A 3CCVA 4CDCC 2Q8TA 4LF4L 1S5FD 1QZGA 5A2QW 4LFCH 2VQFL 2L0CA 1PH9A 2VUMB 1SLJA 5D14A 4GOPA 4RGNA 1OO9B 4G08A 2MJ8A 2F1MA 1GM5A 1V9PA 1TWFB 1I4HA 2Z6BA 4P71A 4DNIA 4A3EH 3DWPA 5TSSA 3T1YL 1HR0L 2WKCA 4JV5H 4DR4L 2FFKB 3MWYW 1E1OA 3GTMB 4IPDA 3S2HH 4IQZA 1SNDA 2K04A 5FLXL 2J7ZA 4Y7NB 3GTGB 1S5ED 3MXNA 3TP5A 4TQUS 3RZOB 2G8YA 2CW0C 2EYJA 3I8ZA 4RWSC 2E2IB 2EIFA 3U4VA 4CDFC 1I94Q 2OPVA 4DV1Q 4QUFA 1X3FA 1GKHA 3P75A 4FXGC 1TXYA 2ZXOA 1O78A 1WTXA 4C3IB 3S16H 4BBSH 2F0UA 1LTLA 4JW0A 1D8LA 4C3JB 1Y1WB 3KF8B 1HPCA 2JP1A 2LS01 2F4IA 1ASZA 1DM0B 1N36Q 2KCTA 4DAPA 1IYUA 1Q86C 4GKKL 3T16A 4IPCA 4POFA 4GKJL 4A3CG 4C3JH 2L1BA 1L1OB 1V8QA 1VQNA 1YVCA 2HIXA 3UDGA 2NVQB 1KNAA 1H9SA 2CTMA 1XMOH 3QOJA 1KHIA 4LIJA 3FKIH 4LF7H 1HZ9A 2P5ZX 1I4PA 1IW7C 2UU9Q 2PQEA 2EOTA 4CKCA 5EAYA 1CKMA 4M8AA 3I4NH 4HIDA 4DV2L 2DGRA 4C56C 4WJ4A 1Z6HA 4UY8C 5FO8B 1TS5A 1KC8C 1WTHA 3M4OB 2I0QA 4H02A 1LT6D 4DF7A 3S1QH 3N52A 3JC66 1ENAA 2JEBI 2RBMA 3AYHB 3PO2H 2Q8RE 2D0PA 3PQIA 1VQFA 1XPUA 4OO1G 2B2VC 3GV6A 2FMMA 4N8FA 2KJXA 3WWVA 3J7AF 2CKZB 3AEVA 3PUZA 3DLLA 3H94A 1UAPA 3M4QA 1ENCA 1C4QA 4A3DG 1I5FA 2KCNA 1EOVA 3I91A 1F2LA 1VF5C 3MXNB 5CBAE 4QUCA 1WTQA 2JJQA 4HJ7A 3BYYB 2CWHA 3E9HA 1STYA 1IYJB 2YU9B 3KLSA 3FP9A 2YYZA 2RF4A 2YU9H 2XWJB 5M5XB 5F2DA 2V4DA 5C0XH 2PZTA 1HNXQ 4GOPC 4DUYH 4B8TA 2UUBL 2B2TC 4DV6Q 3CP0A 5J1ZA 3BS1A 1H9JA 1YHBA 1HUMA 2F0FA 2NN6G 3HOYB 3NTHA 3GTMH 2CQOA 1HZAA 1NTGA 1E2ZA 1KDBA 2JA5B 2UUBH 4A3IH 4BS9A 3F2BA 1EWHA 1TKWB 2AQ3B 4N8X1 1KNEA 3K5OA 1SNCA 2EYOA 2F0JA 3V96A 2ANNA 4DV1L 2VUMH 1ODHA 3CC7A 1VQPA 2Y0SG 2EZVA 3H0GB 1AEXA 2WFWA 4ZUIA 5E7NA 2L5TA 4CDDC 4MTKA 1WD1A 2UXBQ 3RF2A 4B8CD 1TWHB 1PTOB 2Z8LA 1QOHA 2L9HA 2QW7A 2E2HH 1STAA 3MFGA 3K6OA 1NCVA 3K8AA 4A3FH 3NQIA 1SFOB 3GTKB 2WP8J 1DOKA 5LHY1 4GN4B 1E0BA 1PFBA 1BBXC 4KKSA 2C9OA 3K0YA 4MHEA 1K0SA 4GLVB 3GTJB 2BDNA 2HH3A 2Z0SA 4HJ9A 3PF4A 5JPMC 4A3IB 4OWWB 1CKNA 2KHSA 1L0YB 4GS3A 4R4TA 5CGKA 3J81i 4DR1L 2XWBB 2JA7B 1EQVA 1PXUA 1C9OA 1KAWA 3HOZG 4LFBQ 4EC5A 4JYAQ 1K9MC 2XN9C 3UDFA 5IGCA 4LF7L 1ICFB 3F2DA 1IHZA 2CHBD 1OXUA 2OCEA 4JPBW 4YWMA 1Q82C 1I4GA 1EY0A 1N9WA 2D2CC 2VZAA 4AYBG 4IFDG 1JWMD 2JA6H 4F87A 1UNSA 4JI1Q 5IGGA 3TZDA 4P73A 4A3BB 2RVLA 2KHIA 2RHSB 3I73A 4GKJH 5C44G 3QIAA 3PO3H 1HTPA 1W6JA 4KLKA 2GA4B 2RCNA 3AEVB 4GKKH 3FDTA 1SN8A 4DK6C 4A4IA 3I56A 2VUMG 3F1ZA 1HJPA 4MN3A 4A93G 3BG3A 1BBWA 2C5CA 2LY7A 2MPMA 1S40A 1S20A 1R4PB 5C4XB 1I3QB 3RZDB 1EZ8A 3E0JA 3L3OC 3NXWA 1YJ9A 2B2UA 1RTOA 3M9BA 1DTJA 2LXJA 1R4QB 3VR2A 1J5EH 1WCMG 2KBNA 4DN4M 4LF8L 4DR7H 2E2HB 1PTOH 1ZKOA 2PPBC 1HH2P 1U4PA 3NP8A 3RLNA 1STGA 1NY4A 1VQKA 3NBHA 2JA8B 4LFBL 4MZ9A 3HKZB 3OETA 1J5EQ 4Z9CB 4OX9H 2IHEA 5JEAG 4DV3Q 2GN5A 3BZDB 1DZ1A 1MI2A 1LTTD 2G9DA 3BYTB 4PG3A 4BBRH 1L1OA 5AJ3Q 3CD6A 1JE4A 3RLFA 4A3IG 4LJZC 4ODGA 4X62H 2NZOA 2R92B 5JEAH 3PIO3 3BU2A 1ZYRC 3SR1A 2I5LX 1XX8A 3GV3A 1X9ZA 1ZZJA 2NBFA 3IFDA 4V0BA 3H0GH 1ZXTA 2AWNA 2IL8A 3K81C 5CV5A 3KBGA 3CCJA 3KYHC 4OHJA 1I3QH 2YTXA 1VQ8A 3J80W 3D4RA 4R4IA 5ELDA 4A76A 1AN8A 2DNEA 1A8VA 1S72A 4DV7H 4LF6L 2AQ2B 3KJOA 3FPPA 2D0OA 2I46A 2R7ZH 4WFN3 1B70B 2K28A 1B9NA 4LNQA 1PMRA 2F3IA 3S1NH 1Q7YC 1GUSA 4O2DA 1L0XB 4MIUA 5E3FA 1QCBD 5DM73 2FMCA 2N49A 4JV5Q 4KY6A 5JEAJ 2Y3MA 3OOCA 1FNWA 1UE6A 1SAPA 1EIFA 3P7JA 4FXKC 1SROA 3O13A 4JV5L 5K36H 2HDLA 2IW3A 1TWFH 1IBLQ 3HOWG 1WJJA 4JI4Q 4LFCQ 4IN3A 3J80L 2JE6I 3RMHA 1QUQB 4DV2H 2UUCH 2RHQB 4A3FB 1SFOH 3GTKH 4DV5H 4BA1I 4JI3Q 1KRSA 2MO0A 2ZM6Q 4A3CH 5JJIA 4DV4H 1SNOA 4XIGS 4LF4H 1SMXA 1QILA 2BDOA 4JBJA 1XWEA 4AQYH 3K5MA 4BWGB 3U58A 1PH1A 5GROA 1NNXA 5FLXE 3EROA 5DLQE 4DV7L 1BCPD 4OIKA 1IL2A 4FF4A 4X3UA 3RN2A 4LAAA 3D0FA 1VQOA 4DR3Q 4UAIA 4LUVA 2VS1A 2O5IC 1RDPD 2BE5D 4JBWA 1AP0A 2NUCA 2KCCA 3KDFA 3HOYH 3DM3A 4XT3B 3PO3B 3TEHB 5IGFA 1GUTA 4LFAQ 4JG2A 1V43A 2E2JH 2JA6B 3CCUA 3KFUA 4DR2L 5CR3A 4NB3A 3VR6A 4L5TA 4DV3L 4E6IA 1FJGQ 4PMWA 1E1TA 4EQ5A 2AKWB 4A3BG 3FEWX 4LFAL 2MGSA 1S03G 1K8GA 1EZ6A 1C8CA 3S9WA 5JPNC 4AQYL 3ZJYC 1Y8OB 5AFWA 5FO9B 4B3TQ 3QWNA 4DR6Q 4C1NI 3W1BA 4A3GH 1I94L 1ESRA 5M5WH 5M3FH 1DT4A 4A3LH 3CU7A 1KXLA 4XTCS 3LWEA 1VQHA 5C4HA 3PMFA 1B9MA 1D1IA 2Y0SE 1ONLA 3W1GA 4R1JA 4LF8H 3J7YW 4V190 3A7LA 1NMGA 3IL8A 5CV4A 4ZUJA 4DR3L 2BH2A 2VQFQ 1G291 5EQ0A 5HY6A 3RLOA 4OEMB 1FGBD 3X3NA 5GQOA 4FVMA 1SNPA 3A56A 1PQXA 3MVVA 3A5UA 4ID6A 3K5LA 3GTJH 1EIGA 4UP8A 5KYIA 3VR4A 1EY5A 1JQYD 4DR5Q 2XSCA 5FLMG 1D5ZC 4CGYB 1I6UA 2UUCQ 1XRHA 1IXRA 3GQBA 2ID0A 3OTOQ 1XNQQ 1HNWQ 4OO1I 1LLRD 1YIJA 1SE8A 5IYBH 4DR5H 4K5VA 2VKCA 3C2PA 3K7AH 2K32A 4ABNA 2JA9A 4HJ8A 3CXCA 1JB7A 1Q90A 3OPOA 2SEBD 4PV1C 5LMNL 4DAYA 2NVTB 2LMCB 5ELNA 1PHJA 3I4MG 4WRDA 4IUQA 5G3LD 3M7NA 2B2VA 1E2WA 2QF7A 1Y14B 2E2DC 3I4MB 2R92G 3D31A 1A15A 3A8KE 3S1RB 5JVG3 1NUCA 3X3MA 1UG8A 4XQJA 4R4QA 4NZRM 1FVIA 4IZ8A 1UEBA 3ND8A 4JI7H 4S3SA 1TUAA 3OMGA 3NTKA 1HFNA 4EGVA 3K59A 4RGMA 2HCIA 2A74C 4B3MQ 3R3OA 1IL8A 2NTTA 3SVMA 4BY1H 5FLXc 2ZTCA 1ASYA 2L55A 2XTIA 1GUGA 3EZJA 5E1FA 2FMRA 2K7VA 1M4VA 2ENBA 2AMCB 4KI0A 2WAQB 3CC4A 1NR2A 2NN6I 3R2TA 4DV6L 1FD7D 1TS3A 4X62Q 4K2KA 4TKOB 5M3MH 4P72A 5EBCA 1ICWA 1VQJA 2RDFA 1XTDA 5JJKA 1MD2D 2TSSA 2VQEH 2ICEC 1UE5A 2NZHA 4OX9Q 1Z7TA 3S1QB 3VKEA 2UXDQ 3EVQA 1VQ6A 4OXPA 4IFDI 2K5DA 2DJFC 1IBKL 2VL6A 3E3XA 3V05A 4LF8Q 4RKLA 1EYCA 2JA5G 2WB1E 5IYBG 2R61A 4JI2H 4APVA 1TWCB 2KCMA 5E4XA 3I4OA 3URYA 4JI6H 1A63A 1D2BA 4ZKCB 5IT9L 5DM63 2BOSA 4HIOA 4C2MH 2EY6A 1F2ZA 4RGOS 4FXDA 3PIOA 4QJFA 2JA5H 5IT9c 1PZKD 1VQIA 5BN4A 1E2VA 4QL5A 4CBVA 3CW2C 2CTJA 4JI4H 2WV6D 5D3IB 4YIJA 4JI1L 1E24A 3T51B 1MSGA 4A75A 3GTQH 1IBLH 3OW2A 4AH6A 3SEBA 3TDQA 1XNQL 2HH2A 3STBC 2Q2HA 4KHVA 3VDYA 3I4NG 4GKJQ 1RL2A 4DXGA 4DR1Q 4JI8Q 2XVSA 1PFNA 3I90A 3PIPA 3U1KA 1PH2A 4JI6L 3TRZA 3J7AK 2R3ZA 4UPAA 2B2UC 1JR0D 3SK4A 4K0KH 2ANRA 2YTYA 3G6EA 2Y0SB 4BY1B 1M90C 4DXFA 1EYDA 1C7YA 4TRDA 2D9UA 2E74C 3D6WA 3PUVA 1PTOD 5M9OA 3SGIA 1II3A 4FO2A 3GTLH 1BXTA 4A3MH 4BY7H 2I5HA 4EVOA 1WE8A 2IX1A 2AHOB 4B3TH 1SEIA 1QUQA 1UE7A 1GJXA 1PYSB 1B53A 1IBKQ 3ND9A 1J4WA 2JQOA 1GVPA 1WFQA 4UP7A 3PO3G 2UXDL 4FF1A 4DV6H 4CDEC 1VIHA 5ELBA 3LNNA 1ML0D 3UOEA 2JA6G 1YNJD 4OELB 2UXBL 4WANA 1SYEA 1O7ZA 3NE5B 1FL0A 4X66H 2M9VA 5KYLA 3M7GA 2F0SA 4JK1C 3UI2A 4GLXA 4DV4L 2EDGA 2O2LD 5J22A 3LWUA 4LW1A 1VF7A 4FJSA 2WKDA 2L4NA 4QMGA 2PQAA 4YCUA 5GAHC 4NXMH 1K83B 3VYSA 4LFAH 1V1PB 2F3WA 2QA4A 1B3QA 1EOTA 3KDFB 5M3FB 2MNAA 2I5MX 1B7YB 2MO1A 2K01A 2A6HD 1GD7A 1KIXA 1FGUA 1HNXL 5I2XA 2K5VA 1I6HH 2PI2A 5ELFA 2E5LQ 3H91A 2HHHH 1WYDA 2ASBA 1ILPA 2EY1A 5JJLA 1PH3A 1P16A 5C3WA 4B3SH 1LT3D 3NK9A 1BCPF 2BCOA 2N8NA 2E75C 4DV0H 2K05A 3HFZB 4BXXH 2AUKA 4KKUA 4A3KB 1FNVA 1NR4A 1TWAB 1TU2B 1VQEA 4F8MA 1OTCA 2PZWA 3FMCA 4X65Q 4LF6H 4HJAA 1I4XA 2DJGC 1S3OA 1WHRA 4KTAA 2E2IH 2GVBA 5FKAC 2ATWA 2UXCH 3BDLA 4OONA 1HUNA 1ILQA 1J6QA 2N3SA 4DUYQ 5C3XA 2UUCL 1HNXH 2CTFA 4WALA 3S2DH 5ELEA 2IWHA 1IYVA 5BR8L 5M3FG 3T53B 1PYBA 2KEEA 4XQQA 2PQUA 1LTRD 4DK1A 3BZKA 2LTLA 2JXMB 3S2HB 1X4NA 1BNZA 5ELCA 4L5RC 5JJZA 1EQRA 4K14A 1YNXA 2EVBA 1IW7D 5EBDA 2A6HC 4GNXC 1XXGA 2A68D 3CCQA 3HOUG 3MEHA 4JOIA 1VIGA 3AMUA 5FOBB 2UXBH 1S5DD 1HR0W 3VYTA 2SDFA 3MAQA 3DXJC 3E5SA 2R6GA 2K4KA 2RSOA 4H7BA 2F0PA 2OT2A 2EXDA 2AWOA 1J5EL 1I50B 4NP5A 1UUPA 4BA2I 5A2QL 4K6DA 4NXNQ 2OTJA 2SNSA 3VR3A 3I2ZA 2WACA
chains in the Genus database with same CATH topology
4YWLA 2G9HD 4HIKA 1F9RA 1OXVA 2X6GA 3A8IE 2ZXPA 4C3JG 1Q1EA 1QJOA 2E76C 2B63H 4PMCA 3TN2A 4K6LA 1K1GA 1YNNC 4X64L 1HNZQ 5M5XH 2B63G 1D1KA 2B3GA 1YHQA 3HOUB 3OYYA 3J7ZC 4POGA 2B8FA 1EY9A 4JVYA 4B3SL 4K5WA 1LO5D 5DEHA 5K36G 3OSOA 3AFPA 1K8MA 2F0TA 4XYOA 2NTSA 4YY3Q 1U4MA 1VQCA 2KHJA 3D6CA 1XPOA 4IUNA 5C5LA 2NVXH 1CQFA 1C0AA 4QB4A 3EA6A 3QO2A 1MGSA 1GUWA 3KF8A 2FXQA 3SE0A 2K03A 2B29A 4NBQA 1JWSD 2DY7A 2NVYH 1EIYB 4K8JA 4XQNA 1YZ6A 2NN6H 4G7ZC 1I4RA 2NVTH 1HA6A 2R7FA 4AIMA 1XMOQ 4M1UB 1U9RA 3T13A 1HNZL 4LF7Q 4DA2A 4CKBA 3I4NB 3WDNA 5IWAL 1JMCA 2LKVA 4XYQA 3DHQA 3G48A 4U68A 4BBSB 2O5JC 3TS0A 3FKIB 2K5HA 3AQQA 5C4XH 1JE5A 5KNDA 4N9PA 4O0AA 5M3MB 1QVGA 2KOLA 1KLUD 2VQEL 3JAMi 1KLGD 4P74A 3S17H 1A2TA 2HHHL 3C3LA 1HRJA 3TSSA 3CQZH 1YITA 1M1KC 5C4ZA 1OXSC 2JSOA 1S5CD 3D4WA 3KLWA 4IUVA 2R93G 4R8IA 4GNXA 2ICIA 2JEAI 3I3CA 4DGZA 5J39A 3D4DA 4QY7A 3HP3A 5IODA 4B3RQ 4JOIC 1Z9FA 3H09A 2LXKA 5CV6A 1XJVA 2F0GA 4H44C 1SR3A 5ISRA 1MJCA 1Z47A 1STEA 3HKSA 1U0LA 5CC4A 3AB9A 1ZZKA 4HSVA 4EQNA 2F0LA 5I6YA 3PO2B 1F2YA 3RNUA 2A69C 2DY8A 3EJIA 3ERQA 1K3RA 3CC2A 4G7HC 1MSHA 2E3UA 1EYGA 3NHHA 3BVZA 4QGUA 1XYIA 1X4MA 5LMNQ 3M4OH 5M3MG 1DXMA 1EY7A 1S4ZA 1Y1VB 2JVZA 1JOKA 3HKZG 1BUVT 1N34Q 2Q2TA 1YNJC 3HZXA 4GLAC 5I9OA 4A93H 1SE3A 3S1RH 1YEZA 3NBHB 3R8BA 3TMEA 1XMOL 5EPKA 3TP7A 1KDAA 2LFNA 1DYQA 1K83H 2CTLA 1QZHA 4KD3A 1HA5A 2MJHA 1N32L 4KD4A 1S5BD 1J5KA 4XXEA 4J1MA 3HG9A 2QKIC 1EIHA 4YY3L 1V1PA 3HOZH 3BVGA 1PRTF 1X3EA 4K0KQ 1VQGA 3S14B 3MHBA 1A2UA 4QMFB 4B3SQ 1F9SA 1RJTA 3CMEA 3J81c 1TR5A 1V1OA 3TBIB 1EFWA 5C0XJ 2ZTDA 2Q8IB 2TMPA 4R4OA 4JI7Q 4A3GB 3W3AA 4IO9A 1KABA 4JYAL 3A55A 3UDXA 4DUZL 2OF1A 4L63B 1YHAA 5A35A 1E3PA 1D5MC 1O80A 2PW7A 5HGQA 1LT4D 1U5KA 1K0RA 1BQQT 1JOQA 3EN2A 3IAYA 1H9KA 3T1HL 4Y52H 4RH6A 1HTLD 5FK9C 4TSSA 2R7DA 2ZT9C 4ZKBB 4H0LC 2A6ED 4C2MB 3DUZA 1LTSD 5EKKA 1QE6A 3LX0A 2A68C 1KHMA 5JAVA 1N8RC 3T1YQ 4A3BH 1Y8NB 2B2YA 3U9OA 3CRLC 4XT1B 2PO4A 3K0XA 5HGTA 3CCEA 3ULLA 1O7LA 1FNUA 1MJEA 1WTOA 3HOYG 3F2UA 4HR7B 4JVHA 1AZQA 1G51A 2ZJQA 3QOLA 1TS2A 1FR3A 2ZTEA 1G2TA 2H4OA 5C3EG 1HR0Q 3D3RA 1JORA 4OL7A 3FKIG 1ZTGA 3PUXA 2A6EC 2K5QA 2RDHA 1O7YA 2Q2UA 1VS0A 3E0EA 1DJRD 4B08A 1EL0A 1CHPD 4QF4A 2SNMA 3NSWA 5C6AA 4IALA 1VQ4A 1AH9A 2HCCA 3KOJA 1PFSA 4JI3L 4Q5VA 3L9AX 5KNCA 5I2YA 3SDZA 5IIFA 1QNKA 3Q0AA 2Z1CA 1H95A 4GOPB 2F52A 1CZGA 4Y7NH 2JK8A 1BO0A 1N34L 2B63B 1F9PA 2H1EA 2O4XA 5I6WA 1HNWL 2IT1A 2EE1A 1GXDC 4DR5L 1KAAA 2RQXA 3DM1A 1DGSA 4CJ0B 5T1IA 4A3DB 4DK3C 4EQPA 2VW9A 1XMQL 1I50H 5CV9A 1T5EA 2UUAL 4BBSG 1BKBA 2YTVA 1BDOA 2R92H 3M3YH 1AE2A 3VR5A 3F2CA 4DV4Q 4ZYSA 2QILA 3PF5A 2B2TA 5C3EB 3PIP3 1N36L 1HZBA 1PTOF 2RDGA 2OTLA 4O42A 3I4MH 4A3MG 4BY7G 2CWAA 1NSNS 2OXPA 4X66Q 2KA7A 4OWXB 1TWCH 1SNMA 1ZEQX 4HTHA 4A3JH 3I4LA 1G2SA 4HCEA 2RKSA 2F0IA 3HOZB 2HUGA 5KIXA 3OW7A 3T1HQ 1I4QA 2R7ZG 1BF4A 2F0DA 3H3VH 1SYFA 2FINB 3PGZA 2KECA 1AE3A 3C46A 3BJUA 1SMYC 4PZ7A 1LYLA 4B9WA 1A3UA 5IGBA 1RF2D 4H13C 4G57A 2F0KA 4DK0A 5C44B 4RAUC 2F3VA 3T56B 1L0WA 2F4VL 4DUZQ 4QIWE 1X32A 2F0NA 3R2IA 3TREA 1AW7A 2IX0A 3IKJA 5H1SE 3H3VI 1SYDA 1HQRD 5C4XG 4ZLTF 3M3YB 2KENA 1SMYD 4MNOA 1SYCA 3MXPA 1EUJA 4DFAA 1UWVA 4HAEA 1NMFA 1PA6A 4JI0L 4A3DH 5CORA 2XNAC 4A3GG 3H3VC 3CHBD 2JA8G 3HKZE 4DV5Q 2ZJPA 3JAMc 4A3JG 2IHFA 3I7FA 1N32Q 4DV0L 3QG1A 3K7UC 4BXXG 1PVOA 3KJPA 1A3VA 3E6ZX 3OWEB 3CCRA 4DV0Q 1H9MA 1HCZA 5EPLA 1STNA 1N33Q 1Q12A 4J6HA 1TWAH 2OQ0A 1PRTC 1CZWA 2PCFB 3PO2G 3NUCA 1K8AC 1JT8A 1JWUD 3IFTA 2ZJRA 5LL6X 3HS0C 2WAQE 2VNUD 3KLRA 3U4ZA 3GTPB 4L5SA 5CMDA 2HT1A 2CWPA 2K75A 1X6OA 3ZYYX 4NXML 4NPSA 1SXTA 1KRTA 2IPKD 2K33A 4DR6L 2A8VA 3Q22A 4HSPA 1EYAA 3T4AC 4GZYC 4NDXA 1PH8A 3TP6A 3Q6SA 4RMFA 1ET9A 3KLSX 4OX9L 1X55A 5A2QE 3KF6B 4LF6Q 1B4OA 3H15A 5IYDG 3FHWA 3HOXB 2EPBA 4R8NA 2PI2E 3M4YA 1GUNA 1IKLA 1YJWA 5I4DA 4KHZA 5C4JB 3E9IA 5CV8A 3STBD 3QB3A 4RHRA 1CSQA 2QCPX 4X6AH 2WB1G 5CYUA 4PZ8A 1IBMQ 3NQTA 4KKTA 4CHTB 3Q23A 3S16B 4C3IH 1U4LA 1CQVA 2PNRC 2HHHQ 1L2FA 1PV4A 4WJWA 3G7LA 2D5DA 3CCSA 4L8JA 4KJNA 1DOMA 2CQAA 1EFID 4K0KL 3BDOA 3HOXG 1JJ2A 1EEFD 4P2CB 5KNBA 4KY7A 1Y1VH 2OWOA 1WTWA 1G6PA 1CT1D 1XNRL 3SK8A 1ENFA 2NYZD 3HOWB 3CQZB 3M85A 5E4WC 2J0TD 1IBLL 5IGDA 1A3TA 2F0WA 3PUWA 2DNCA 4KK7A 3AU7A 2KUMA 1AFPA 3MEFA 3ULJA 5IP7H 1GHKA 1VQAA 1TQOA 1X3GA 4X3SA 1TWGH 3NBIA 2R93H 1RD9D 4F88A 4CJ1B 1PDQA 3CMAA 4X3KA 2PMZB 3CRKC 4FF3A 4GN3B 1EY8A 1G91A 1WTVA 2YQRA 3I72A 2Z4HA 1T9HA 1EU3A 5GADC 1NJIC 3G6JB 4A3LG 1HXYD 4IUPA 4RA8A 4K8IA 1PFMA 4CKEA 4JI2L 3V69A 4FYDA 4RKBA 4ULLA 4X64Q 2A19A 2EJFC 5C5MA 1PH6A 2EJGC 4AYBB 3ONAB 1IZ6A 2OQKA 2MP1A 4GKKQ 3FRPB 1XTCD 1MKHA 4DR7Q 4A3MB 4BY7B 3M4PA 3UE1A 2B39A 4YHHQ 3JAME 1UEAB 2BL5A 4KHPL 4RGTA 5D65A 1GHJA 2EYPA 2QGQA 3L2PA 2AUJD 4HN7A 3W2DA 1DD2A 1MIUA 3OIQA 2CPQA 2QNDA 3RZDH 2HQLA 3S1NB 4HMJA 1SJED 1WCMB 1Q3LA 3I70A 4WJ3M 2A1AA 1X9NA 4NKLA 4A3EB 3AFQA 1Y69U 1PRTB 1B8AA 1PZID 3EQLC 3NWTA 1A6XA 4YWKA 4CJ2C 4JI7L 2EY2A 1JCKB 1SBBB 4YHHL 1N33L 5LL6S 3R93A 4LWCA 4DR7L 4FF2A 4LMQD 4X3TA 4YCWA 5C4JH 3S1MH 1F2MA 3K80C 3G4SA 4LF9Q 1F77A 1LM0A 5BR8Q 5FJ8G 4AM3A 1Q1BA 2Q2IA 1RHPA 4KN7C 5IGEA 4DU9A 5J3BA 2X69A 1STHA 1EWIA 3RR5A 3J81j 1J8IA 3H6MA 4KN4C 4LUOA 1JC7A 5FLMH 2B2WC 1ET6A 3GTLB 3PSIA 2JA8H 3J7AV 1ESFA 3GO5A 3HRZC 3U9SA 3KK7A 3PUYA 5K5PA 3LGJA 4ZAIA 4R4CA 1HFGA 2FHTA 1PZJD 2F4VQ 1TY2A 1GUOA 1MBYA 3F8TA 4IJHA 2FJ2A 2B8GA 1BR9A 3RN5A 4G4KA 2NWGA 3NELA 2MHVA 3EBEA 1B1ZA 2OEOA 3GP7A 2C35B 1SDFA 4ALPA 3H0GG 1EY6A 1PYWD 1KQSA 2UU9L 1LTAD 5LMNW 4NXNL 1SRUA 1LTGD 5IY0A 2UXCQ 4KJOA 5DNFA 5GAGC 1JJCB 1VQLA 2F0OA 1IKMA 1QVFA 1EQTA 2XRQD 3A8JE 1CSPA 4N9TA 4BBRG 2AQ1B 4OO1H 1KDCA 3J80E 2WAQG 4RCNA 2DGYA 4RG1A 3CAMA 1PLFA 4KY5A 5HURA 4L5QA 4TVAB 3L7ZC 4LF5Q 4RHSA 5I9PA 2EXZA 3DEPA 1GOZA 3OIPA 2K14A 2JZXA 3C1FA 3QJYA 4LK1C 1XMQQ 2F0EA 4C3HH 1BCPB 3BDCA 1WCMH 1PH7A 2J4XA 2NB0A 3BZCA 2EJMA 3J80i 3MXGA 3A7AB 1LV9A 5COYA 3CPFA 1YJNA 2B2WA 2L11A 5AJ3L 3SK6A 1I6VC 1SE4A 4FDBA 3S14H 4RFBA 2A5HA 3ERSX 5GAEC 4DUYL 2E2JB 1DCZA 2KEDA 1V1QA 1SSOA 2F0HA 2JA7H 4HEDA 1XPRA 2NZ1D 1RCVD 4DKAC 1WVNA 1DONA 5M5YH 5EJWA 1R9TH 2XRSD 4BY1G 3OWFA 1W6KA 5BN5A 2D62A 1QNUA 1VDZA 5C44H 5IP9H 4C3IG 1O7IA 3L0OA 4PNYA 2EY5A 4IFDH 2Z4IA 4FP5D 3K58A 1CKNB 4DV5L 3P20A 4IPGA 2KQ3A 3OTOL 1TWHH 4RCOA 3FVQA 3GTOB 4O1NA 2CFMA 1Q8KA 2EYMA 1JICA 2IJ0A 2WINB 4YCVA 3J80c 1LTID 3VYRA 1Y1WH 2CCZA 3CCMA 1TIID 5CBEE 1YNND 1VMPA 4HIMA 4JI5Q 2R7ZB 1WI5A 3DWQA 2K6AA 4GN5A 1CA6A 4A3FG 5NUCA 4IOCA 1PH5A 4JBMA 2CTEA 4LF9L 5IE8A 1NAPA 4JBKA 4OGQC 3TZUA 3GTQB 4IFDJ 1RKNA 1KTKA 2P2RA 2OPUA 4C3HG 1E7ZA 1OXTA 2M00A 2N55A 4A3KG 4B3TL 3GTGH 4ZQ3A 1H9RA 1CK1A 3HOVH 4NW2A 2Z6KA 3FPUB 1VQBA 1CHQD 5T1GA 4HJ5A 3ICEA 4DNTB 4ME3A 4DAVA 1SJHD 2EYFA 1PRTD 1SEBD 2A73B 4K2LA 2PYKA 4DR2Q 4ZK9B 4NMZA 1G6ZA 2CW0D 4OIJA 1WTRA 4J15A 5ELOA 5IYCG 4X62L 1U4RA 1J9OA 1OXXK 1CM9A 3NPPA 1WVLA 2MQHA 2QEJC 2UUAQ 1Q8IA 4JI2Q 4DPGA 4KHPQ 3A54A 5CV7A 4X66L 1STBA 1D7QA 3SXHA 2K50A 3BVMA 3SHLA 4JI6Q 3MXUA 4DR4Q 5JOBA 1CKOA 4QCLA 1H9SB 4P75A 1Y1VG 1YI2A 1NE3A 1Q46A 3EIVA 3K57A 3TP8A 1HHVA 5M5YB 5D3DA 2GVAA 1VQMA 3VA5A 1EQQA 1BCPC 3GD7A 1JOOA 4HMIA 4LF4Q 4GNXB 5IOCA 2UXCL 1BOSA 1WOCA 3RD4A 3MA2B 2VB2X 5IT9E 1HQMC 1ZYRD 2QDBA 2N78A 3CCLA 3VYUA 3VA7A 3GDEA 3S17B 5M5WB 4QIWB 1BVSA 1JB3A 3CKIB 4KMUC 4Q0FA 5FJ8H 3S15B 1BBUA 5FO7B 1LUZA 4X65L 4DV2Q 3NWSA 3DEOA 2E5LL 2IY5B 5KRUA 1JJGA 2F0MA 3DWAA 4PZ6A 2IX3A 2VB3X 1CFMA 4ZRZA 3A74A 3Q24A 1FYCA 2HDMA 1IBML 2ZXRA 4C1NK 3NTIA 4K5XA 3SK5A 1VQ9A 4A3JB 1K8OA 2RA4A 2NVYB 3NEMA 3MZ5A 4UP9A 1TVXA 3D8GA 1T5XD 3MC0B 5LMUQ 1B44D 3J81E 1CA5A 1WTPA 3ER0A 1A62A 5C3EH 4XDXA 1EC6A 2EQSA 3P1HA 4DAYB 1CTMA 3W5OA 4EX5A 1LABA 2LSSA 1KD1C 1QG7A 4L6TB 2JA7G 3GTPH 3S24A 4PQXA 2K1BA 2MUYA 1LT5D 2PQAB 3J81L 3CF5A 2YV5A 4LUZA 3S2DB 4UDUC 1YBYA 2ES2A 3PCOB 1EU4A 2CTKA 5EKLA 1X65A 4EQOA 1AZPA 2V1CC 4C3HB 1X56A 2I07B 3V2TA 3S15H 4HCSA 1RIPA 1TS4A 5DAUA 1RODA 5BN3A 3UDIA 1K73C 5C0XI 4IOAA 1KL9A 2DN8A 1X54A 1RTNA 3HOVB 1D6EC 1VQ5A 4DV7Q 3I55A 2K5NA 4A3KH 4JC0A 3S1MB 1PTOC 1CUKA 4IPHA 1L1OC 1X3QA 3KUPA 3CPWA 1SYBA 2X6LA 3B6YA 3A5ZB 4G7OC 1QVCA 3G71A 1C48A 1EWCA 3A0JA 2BA0A 3TS2A 4JI0Q 2MFIA 1SNQA 5IP7G 1I6HB 1EY4A 5KEEA 3KBXA 2AXYA 2EYLA 2K52A 4JI8L 1F9QA 2KVMA 1B2TA 3OHXC 3HOVG 2HIVA 4JI4L 5G3LF 4IUTA 1R9TB 5EGTA 1VMCA 4DNRB 2SOBA 1M8AA 1Q81C 2PW5A 2EYHA 3HOXH 5IYDH 3ULPA 2F03A 2WB1B 3JAML 5JVH3 2JYOA 1TT2A 1QWYA 4U673 2H5XA 1XNRQ 3HGBA 1QB5D 1VCIA 4KV6A 4AQYQ 1Y1WG 3WOFA 2L15A 2RSNA 2NVQH 2WIIB 2K5WA 2E8GA 1VQ7A 2XGTA 1FJGL 1ZZIA 1LTBD 2PMZE 2F0QA 2B2YC 2ALYB 2PNHA 5KGUA 1P8LA 2PY9A 4DAMA 3HEJA 3HOWH 2XIWA 1A0IA 5IP9G 1W2BA 1G8ZD 2L12A 1WD0A 1EEID 4J8QA 2QEXA 4ME5A 4JCVE 3ITPA 1TWGB 2R93B 3DMUA 1D5XC 5LMUL 4PMBA 3Q8DA 2BE5C 4LF5L 3U50C 4B3ML 4FNFA 3RUZA 2BH8A 4B3RL 4IUUA 2NVXB 2UUBQ 4MTNA 3C1EA 3MTSA 2M2LA 4WORA 2N88A 4IJLA 1SE2A 5EKIA 4QQBX 1B3AA 2BA1A 4A3EG 1UE1A 3HOUH 2F0VA 3RZOH 1DOLA 4I7ZC 2ZM6L 4AYBE 3WOEA 3GTOH 1Y8PB 2VQEQ 1VQDA 1X3PA 2PZUA 1B50A 4ILWA 3K7AB 4B9XA 4NXMQ 4R9WA 4LFCL 1NBWA 2VY3A 1E22A 4I65A 3MFYA 2VXWA 2Z6KC 3EFXD 4OWTB 1CI3M 1LACA 2A69D 2CVRA 4BBRB 5C0XG 3UE0A 5IWAQ 4F7XA 4IURA 3J7A5 2HQEA 4A93B 5EPJA 3OMCA 1GO3E 3K5NA 4JI5L 2DUDA 3IRBA 1TY0A 3NENA 3KF6A 3TQYA 1PH4A 1HZCA 1SYGA 5IYCH 1W3SA 3N6RA 3PV0A 3CCVA 2Q8TA 4LF4L 1S5FD 1QZGA 2VQFL 2L0CA 1PH9A 2VUMB 1SLJA 5D14A 4GOPA 4RGNA 1OO9B 2MJ8A 2F1MA 1GM5A 1V9PA 1TWFB 1I4HA 4P71A 4DNIA 4A3EH 3DWPA 5TSSA 3T1YL 1HR0L 2WKCA 4DR4L 2FFKB 3MWYW 3GTMB 1E1OA 4IPDA 3S2HH 4IQZA 1SNDA 2K04A 5FLXL 2J7ZA 4Y7NB 3GTGB 1S5ED 3MXNA 3TP5A 4TQUS 3RZOB 2CW0C 2EYJA 3I8ZA 4RWSC 2E2IB 2EIFA 3U4VA 1I94Q 2OPVA 4DV1Q 4QUFA 1X3FA 1GKHA 3P75A 4FXGC 1TXYA 2ZXOA 1O78A 1WTXA 4C3IB 3S16H 4BBSH 2F0UA 1LTLA 1D8LA 4C3JB 1Y1WB 3KF8B 1HPCA 2JP1A 2LS01 2F4IA 1ASZA 1DM0B 1N36Q 2KCTA 4DAPA 1IYUA 1Q86C 4GKKL 3T16A 4IPCA 4POFA 4GKJL 4A3CG 4C3JH 2L1BA 1L1OB 1V8QA 1VQNA 1YVCA 2HIXA 2NVQB 3UDGA 1KNAA 1H9SA 2CTMA 3QOJA 1KHIA 4LIJA 3FKIH 1HZ9A 1I4PA 1IW7C 2UU9Q 2PQEA 2EOTA 4CKCA 5EAYA 1CKMA 4M8AA 3I4NH 4HIDA 4DV2L 2DGRA 4C56C 4WJ4A 1Z6HA 4UY8C 5FO8B 1TS5A 1KC8C 3M4OB 2I0QA 4H02A 1LT6D 4DF7A 3S1QH 3N52A 3JC66 1ENAA 2JEBI 2RBMA 3AYHB 3PO2H 2Q8RE 2D0PA 1VQFA 4OO1G 1XPUA 2B2VC 3GV6A 2FMMA 2KJXA 3WWVA 3J7AF 2CKZB 3AEVA 3PUZA 3DLLA 3H94A 1UAPA 3M4QA 1ENCA 1C4QA 4A3DG 1I5FA 2KCNA 3I91A 1EOVA 1F2LA 1VF5C 5CBAE 3MXNB 4QUCA 1WTQA 2JJQA 4HJ7A 3BYYB 3E9HA 1STYA 2YU9B 1IYJB 3KLSA 3FP9A 2YYZA 2RF4A 2YU9H 2XWJB 5M5XB 5F2DA 2V4DA 5C0XH 2PZTA 1HNXQ 4GOPC 4B8TA 2UUBL 2B2TC 4DV6Q 3CP0A 5J1ZA 3BS1A 1H9JA 1YHBA 1HUMA 2F0FA 2NN6G 3HOYB 3NTHA 3GTMH 2CQOA 1HZAA 2JA5B 1E2ZA 1KDBA 1NTGA 4A3IH 4BS9A 3F2BA 1EWHA 1TKWB 2AQ3B 1KNEA 3K5OA 1SNCA 2EYOA 2F0JA 3V96A 2ANNA 4DV1L 2VUMH 3CC7A 1VQPA 2Y0SG 2EZVA 3H0GB 1AEXA 2WFWA 4ZUIA 5E7NA 1WD1A 2L5TA 2UXBQ 1TWHB 1PTOB 2Z8LA 1QOHA 2L9HA 2E2HH 1STAA 3MFGA 3K6OA 1NCVA 3K8AA 1SFOB 3NQIA 3GTKB 4A3FH 2WP8J 1DOKA 5LHY1 4GN4B 1E0BA 1PFBA 1BBXC 4KKSA 2C9OA 3K0YA 4MHEA 4GLVB 3GTJB 2BDNA 2HH3A 2Z0SA 4HJ9A 3PF4A 5JPMC 4A3IB 4OWWB 2KHSA 1CKNA 1L0YB 4GS3A 5CGKA 4R4TA 3J81i 4DR1L 2XWBB 2JA7B 1EQVA 1PXUA 1C9OA 1KAWA 3HOZG 4LFBQ 4JYAQ 1K9MC 2XN9C 3UDFA 5IGCA 4LF7L 3F2DA 1IHZA 2CHBD 1OXUA 2OCEA 4YWMA 1Q82C 1I4GA 1EY0A 2D2CC 1N9WA 4IFDG 2VZAA 4AYBG 1JWMD 2JA6H 4F87A 1UNSA 4JI1Q 5IGGA 3TZDA 4A3BB 4P73A 2RVLA 2KHIA 2RHSB 3I73A 5C44G 3QIAA 3PO3H 1HTPA 1W6JA 2GA4B 4KLKA 2RCNA 3AEVB 3FDTA 1SN8A 4DK6C 4A4IA 3I56A 2VUMG 3F1ZA 1HJPA 4MN3A 4A93G 3BG3A 2MPMA 2C5CA 2LY7A 1BBWA 1S40A 1R4PB 5C4XB 1I3QB 3RZDB 1EZ8A 3E0JA 3L3OC 3NXWA 1YJ9A 2B2UA 1RTOA 3M9BA 1DTJA 2LXJA 1R4QB 3VR2A 1WCMG 4DN4M 2KBNA 4LF8L 2E2HB 1PTOH 1ZKOA 2PPBC 1HH2P 1U4PA 3NP8A 3RLNA 1STGA 1NY4A 2JA8B 3NBHA 1VQKA 4LFBL 4MZ9A 3HKZB 1J5EQ 4Z9CB 2IHEA 5JEAG 4DV3Q 3BZDB 1DZ1A 2GN5A 1MI2A 1LTTD 2G9DA 3BYTB 4PG3A 4BBRH 1L1OA 5AJ3Q 3CD6A 1JE4A 3RLFA 4A3IG 4LJZC 4ODGA 2R92B 2NZOA 5JEAH 3PIO3 3BU2A 1ZYRC 3SR1A 2I5LX 1XX8A 3GV3A 1ZZJA 2NBFA 3IFDA 4V0BA 3H0GH 1ZXTA 2AWNA 2IL8A 3K81C 5CV5A 3KBGA 3CCJA 3KYHC 4OHJA 1I3QH 2YTXA 1VQ8A 3D4RA 4R4IA 5ELDA 4A76A 1AN8A 2DNEA 1A8VA 1S72A 4LF6L 2AQ2B 3KJOA 3FPPA 2D0OA 2I46A 2R7ZH 4WFN3 2K28A 1B70B 1B9NA 4LNQA 1PMRA 2F3IA 3S1NH 1Q7YC 1GUSA 4O2DA 1L0XB 4MIUA 5E3FA 1QCBD 5DM73 2FMCA 2N49A 4JV5Q 4KY6A 5JEAJ 3OOCA 1FNWA 1UE6A 1SAPA 3P7JA 1EIFA 4FXKC 1SROA 3O13A 5K36H 4JV5L 2HDLA 2IW3A 1TWFH 1IBLQ 3HOWG 1WJJA 4JI4Q 4LFCQ 4IN3A 3J80L 2JE6I 3RMHA 1QUQB 2RHQB 4A3FB 1SFOH 3GTKH 4BA1I 4JI3Q 1KRSA 2MO0A 2ZM6Q 4A3CH 5JJIA 1SNOA 4XIGS 1SMXA 1QILA 2BDOA 4JBJA 1XWEA 3K5MA 4BWGB 3U58A 1PH1A 5GROA 5FLXE 3EROA 5DLQE 4DV7L 1BCPD 4OIKA 1IL2A 4FF4A 4X3UA 3RN2A 4LAAA 3D0FA 1VQOA 4DR3Q 4UAIA 2O5IC 2VS1A 4LUVA 1RDPD 2BE5D 4JBWA 1AP0A 2NUCA 2KCCA 3KDFA 3HOYH 4XT3B 3DM3A 3PO3B 3TEHB 5IGFA 1GUTA 4LFAQ 4JG2A 1V43A 2E2JH 2JA6B 3CCUA 3KFUA 4DR2L 5CR3A 3VR6A 4NB3A 4L5TA 4DV3L 4E6IA 1FJGQ 4PMWA 1E1TA 4EQ5A 2AKWB 4A3BG 3FEWX 4LFAL 2MGSA 1K8GA 1EZ6A 1C8CA 3S9WA 5JPNC 4AQYL 3ZJYC 1Y8OB 5AFWA 5FO9B 4B3TQ 3QWNA 4DR6Q 4C1NI 3W1BA 4A3GH 1I94L 1ESRA 5M5WH 5M3FH 1DT4A 4A3LH 3CU7A 1KXLA 4XTCS 3LWEA 1VQHA 5C4HA 3PMFA 1B9MA 1D1IA 2Y0SE 1ONLA 3W1GA 4R1JA 3J7YW 4V190 3A7LA 1NMGA 3IL8A 5CV4A 4ZUJA 4DR3L 2BH2A 2VQFQ 1G291 5EQ0A 5HY6A 3RLOA 1FGBD 3X3NA 5GQOA 4FVMA 1SNPA 3A56A 3MVVA 3A5UA 4ID6A 3K5LA 3GTJH 1EIGA 4UP8A 5KYIA 3VR4A 1EY5A 1JQYD 4DR5Q 2XSCA 5FLMG 1D5ZC 4CGYB 2UUCQ 1IXRA 3GQBA 2ID0A 3OTOQ 1XNQQ 1HNWQ 4OO1I 1LLRD 1YIJA 1SE8A 5IYBH 4K5VA 3C2PA 3K7AH 2K32A 4ABNA 2JA9A 4HJ8A 3CXCA 1JB7A 1Q90A 3OPOA 4PV1C 2SEBD 5LMNL 4DAYA 2NVTB 2LMCB 5ELNA 1PHJA 3I4MG 4WRDA 4IUQA 5G3LD 3M7NA 2B2VA 1E2WA 2QF7A 1Y14B 2E2DC 3I4MB 2R92G 3D31A 1A15A 3A8KE 3S1RB 5JVG3 1NUCA 3X3MA 4XQJA 4R4QA 1FVIA 4IZ8A 1UEBA 3ND8A 4S3SA 1TUAA 3OMGA 3NTKA 1HFNA 4EGVA 3K59A 4RGMA 2HCIA 2A74C 4B3MQ 3R3OA 1IL8A 2NTTA 3SVMA 4BY1H 5FLXc 2ZTCA 1ASYA 2L55A 2XTIA 1GUGA 5E1FA 2FMRA 2K7VA 1M4VA 2ENBA 2AMCB 4KI0A 2WAQB 3CC4A 1NR2A 2NN6I 3R2TA 4DV6L 1FD7D 1TS3A 4X62Q 4K2KA 4TKOB 5M3MH 4P72A 5EBCA 1ICWA 1VQJA 2RDFA 1XTDA 5JJKA 1MD2D 2TSSA 2ICEC 1UE5A 2NZHA 4OX9Q 1Z7TA 3S1QB 3VKEA 2UXDQ 3EVQA 1VQ6A 4IFDI 4OXPA 2K5DA 1IBKL 2VL6A 3V05A 4LF8Q 4RKLA 1EYCA 2JA5G 2WB1E 5IYBG 2R61A 4APVA 1TWCB 5E4XA 2KCMA 3I4OA 3URYA 1A63A