2YQRA

Solution structure of the kh domain in kiaa0907 protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
GSSGSSGGMHYVQDKLFVGLEHAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHPKPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the KH domain in KIAA0907 protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords KIAA0907 protein
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2yqrA01
1ZZJA 1ZTGA 2CPQA 2DGRA 1KHMA 2JVZA 2JEAI 2JZXA 4OO1G 4LIJA 1DTJA 1J4WA 2MJHA 5C0XG 5K36G 2HH3A 2FMRA 2JE6I 1J5KA 2PQUA 1TUAA 1VIGA 2JA9A 1X4MA 3V69A 1DT4A 4AM3A 1ZZKA 2CTMA 2CTEA 2P2RA 3VKEA 1VIHA 2OPUA 4NBQA 4JVYA 2CTFA 2ANRA 5JEAG 2CTLA 2E3UA 1ZZIA 4BA2I 2CTKA 1X4NA 2BL5A 2CTJA 3L7ZC 2OPVA 4JVHA 1WVNA 3U1KA 2PY9A 2JEBI 2Z0SA 1K1GA 2HH2A 2YQRA 2BA0A 4AIMA 4IFDG 2AXYA 2NN6G 4QMFB 2ANNA 3AEVB 1EC6A 4WALA 4WANA 4B8TA 4BA1I 2QNDA 1WE8A
chains in the Genus database with same CATH superfamily
2FPHX 4JI1H 5A2QW 1NXUA 2LRRA 1DTJA 3KDKA 4LFBH 1WHRA 5K36G 2CPMA 2FMRA 4FJUA 3QD7X 4LF5H 1HNZH 4KHPH 3NCVA 4JYAH 4G08A 2CTEA 2P2RA 4NXMH 1N32H 1N33H 4NZTM 5DT9A 4DV6H 4JVYA 4DR3H 2UXDH 4LFCH 2O4CA 4B3SH 5JEAG 4JI8H 1MSZA 2OPVA 5BR8H 1F0XA 3OETA 4X65H 4X66H 4B3TH 4IFDG 1HR0H 4GKJH 4AQYH 4QMFB 5LL6b 4LF9H 2ANNA 3AEVB 4JI6H 2QNDA 1ODHA 1N34H 1HNWH 2LTMA 2CPQA 3J81W 2DGRA 1IBKH 2HHHH 2JVZA 4PDBA 4OO1G 4JI2H 4LIJA 2M8WA 2Y3MA 2JE6I 2PQUA 4DR5H 1TUAA 1VIGA 4JI7H 1HNXH 1X4MA 4FJSA 1J5EH 1S20A 4OD6A 4GKKH 1XMOH 3T1HH 1X9ZA 4DV4H 4B8CD 2ANRA 2UUBH 4DR6H 5IT9W 3OTOH 4BA2I 2CTKA 3FAUA 4YHHH 4LF8H 2CTJA 4JVHA 2FFMA 2JEBI 3RF2A 2HH2A 2YQRA 4AIMA 3J80W 3GKUA 4DUZH 4DR1H 2AXYA 3OSSD 1FKAH 2UXCH 1Z2IA 4JI5H 4WANA 4BA1I 2ZQEA 1KHMA 1AN7A 4JI4H 2LTLA 4LF6H 4LF4H 1WTJA 1ZTGA 3T1YH 2UU9H 2JEAI 2D9IA 1XNRH 1I94H 2JZXA 1J4WA 2VQFH 2HH3A 1XMQH 4NXNH 4LFAH 1J5KA 4DUYH 1I6UA 1DT4A 4B3MH 1ZZKA 2CTMA 1N36H 3JAMW 4YY3H 4DV5H 3VKEA 1XNQH 1VIHA 5FLXW 4E9JA 1VBIA 1IBMH 2E5LH 4OX9H 3J7AK 2PT7G 4B3RH 2CTFA 2A1SA 1ZZIA 1PQXA 2E3UA 2K1HA 1IBLH 3EZJA 1SEIA 3L7ZC 1WVNA 2PY9A 4NZRM 5LMUH 1K1GA 4DR4H 2BA0A 5LMNH 4K0KH 2NN6G 2CWHA 2CWFA 3GABA 3I0PA 3SB1A 4WALA 4DV1H 2MJHA 1WE8A 4DR7H 1ZZJA 4JI0H 4LF7H 1XRHA 4DV2H 4EC5A 3GR5A 2X06A 1X0AA 2ZM6H 4DV3H 4DV0H 2UUCH 4JI3H 5C0XG 4DR2H 3KDGA 2JA9A 3V69A 2UUAH 4AM3A 4X62H 4OCHA 2OPUA 4NBQA 4H8AA 3UOEA 4X64H 2CTLA 1FJGH 1V9NA 1X4NA 2BL5A 2LF0A 2VQEH 2UXBH 3U1KA 4JV5H 5IWAH 2Z0SA 2M6QA 4DV7H 2G8YA 2VKCA 1UG8A 2F4VH 1EC6A 1S03G 4B8TA 1V8CA
chains in the Genus database with same CATH topology
1ZZJA 1ZTGA 2CPQA 2DGRA 1KHMA 2JVZA 2JEAI 2JZXA 4OO1G 4LIJA 1DTJA 1J4WA 2MJHA 5C0XG 5K36G 2HH3A 2FMRA 2JE6I 1J5KA 2PQUA 1TUAA 1VIGA 2JA9A 1X4MA 3V69A 1DT4A 4AM3A 1ZZKA 2CTMA 2CTEA 2P2RA 3VKEA 1VIHA 2OPUA 4NBQA 4JVYA 2CTFA 2ANRA 5JEAG 2CTLA 2E3UA 1ZZIA 4BA2I 2CTKA 1X4NA 2BL5A 2CTJA 3L7ZC 2OPVA 4JVHA 1WVNA 3U1KA 2PY9A 2JEBI 2Z0SA 1K1GA 2HH2A 2YQRA 2BA0A 4AIMA 4IFDG 2AXYA 2NN6G 4QMFB 2ANNA 3AEVB 1EC6A 4WALA 4WANA 4B8TA 4BA1I 2QNDA 1WE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZJ A;  1ZTG A;  2CPQ A;  2DGR A;  1KHM A;  2JVZ A;  2JEA I;  2JZX A;  4OO1 G;  4LIJ A;  1DTJ A;  1J4W A;  2MJH A;  5C0X G;  5K36 G;  2HH3 A;  2FMR A;  2JE6 I;  1J5K A;  2PQU A;  1TUA A;  1VIG A;  2JA9 A;  1X4M A;  3V69 A;  1DT4 A;  4AM3 A;  1ZZK A;  2CTM A;  2CTE A;  2P2R A;  3VKE A;  1VIH A;  2OPU A;  4NBQ A;  4JVY A;  2CTF A;  2ANR A;  5JEA G;  2CTL A;  2E3U A;  1ZZI A;  4BA2 I;  2CTK A;  1X4N A;  2BL5 A;  2CTJ A;  3L7Z C;  2OPV A;  4JVH A;  1WVN A;  3U1K A;  2PY9 A;  2JEB I;  2Z0S A;  1K1G A;  2HH2 A;  2YQR A;  2BA0 A;  4AIM A;  4IFD G;  2AXY A;  2NN6 G;  4QMF B;  2ANN A;  3AEV B;  1EC6 A;  4WAL A;  4WAN A;  4B8T A;  4BA1 I;  2QND A;  1WE8 A; 
#chains in the Genus database with same CATH topology
 2FPH X;  4JI1 H;  5A2Q W;  1NXU A;  2LRR A;  1DTJ A;  3KDK A;  4LFB H;  1WHR A;  5K36 G;  2CPM A;  2FMR A;  4FJU A;  3QD7 X;  4LF5 H;  1HNZ H;  4KHP H;  3NCV A;  4JYA H;  4G08 A;  2CTE A;  2P2R A;  4NXM H;  1N32 H;  1N33 H;  4NZT M;  5DT9 A;  4DV6 H;  4JVY A;  4DR3 H;  2UXD H;  4LFC H;  2O4C A;  4B3S H;  5JEA G;  4JI8 H;  1MSZ A;  2OPV A;  5BR8 H;  1F0X A;  3OET A;  4X65 H;  4X66 H;  4B3T H;  4IFD G;  1HR0 H;  4GKJ H;  4AQY H;  4QMF B;  5LL6 b;  4LF9 H;  2ANN A;  3AEV B;  4JI6 H;  2QND A;  1ODH A;  1N34 H;  1HNW H;  2LTM A;  2CPQ A;  3J81 W;  2DGR A;  1IBK H;  2HHH H;  2JVZ A;  4PDB A;  4OO1 G;  4JI2 H;  4LIJ A;  2M8W A;  2Y3M A;  2JE6 I;  2PQU A;  4DR5 H;  1TUA A;  1VIG A;  4JI7 H;  1HNX H;  1X4M A;  4FJS A;  1J5E H;  1S20 A;  4OD6 A;  4GKK H;  1XMO H;  3T1H H;  1X9Z A;  4DV4 H;  4B8C D;  2ANR A;  2UUB H;  4DR6 H;  5IT9 W;  3OTO H;  4BA2 I;  2CTK A;  3FAU A;  4YHH H;  4LF8 H;  2CTJ A;  4JVH A;  2FFM A;  2JEB I;  3RF2 A;  2HH2 A;  2YQR A;  4AIM A;  3J80 W;  3GKU A;  4DUZ H;  4DR1 H;  2AXY A;  3OSS D;  1FKA H;  2UXC H;  1Z2I A;  4JI5 H;  4WAN A;  4BA1 I;  2ZQE A;  1KHM A;  1AN7 A;  4JI4 H;  2LTL A;  4LF6 H;  4LF4 H;  1WTJ A;  1ZTG A;  3T1Y H;  2UU9 H;  2JEA I;  2D9I A;  1XNR H;  1I94 H;  2JZX A;  1J4W A;  2VQF H;  2HH3 A;  1XMQ H;  4NXN H;  4LFA H;  1J5K A;  4DUY H;  1I6U A;  1DT4 A;  4B3M H;  1ZZK A;  2CTM A;  1N36 H;  3JAM W;  4YY3 H;  4DV5 H;  3VKE A;  1XNQ H;  1VIH A;  5FLX W;  4E9J A;  1VBI A;  1IBM H;  2E5L H;  4OX9 H;  3J7A K;  2PT7 G;  4B3R H;  2CTF A;  2A1S A;  1ZZI A;  1PQX A;  2E3U A;  2K1H A;  1IBL H;  3EZJ A;  1SEI A;  3L7Z C;  1WVN A;  2PY9 A;  4NZR M;  5LMU H;  1K1G A;  4DR4 H;  2BA0 A;  5LMN H;  4K0K H;  2NN6 G;  2CWH A;  2CWF A;  3GAB A;  3I0P A;  3SB1 A;  4WAL A;  4DV1 H;  2MJH A;  1WE8 A;  4DR7 H;  1ZZJ A;  4JI0 H;  4LF7 H;  1XRH A;  4DV2 H;  4EC5 A;  3GR5 A;  2X06 A;  1X0A A;  2ZM6 H;  4DV3 H;  4DV0 H;  2UUC H;  4JI3 H;  5C0X G;  4DR2 H;  3KDG A;  2JA9 A;  3V69 A;  2UUA H;  4AM3 A;  4X62 H;  4OCH A;  2OPU A;  4NBQ A;  4H8A A;  3UOE A;  4X64 H;  2CTL A;  1FJG H;  1V9N A;  1X4N A;  2BL5 A;  2LF0 A;  2VQE H;  2UXB H;  3U1K A;  4JV5 H;  5IWA H;  2Z0S A;  2M6Q A;  4DV7 H;  2G8Y A;  2VKC A;  1UG8 A;  2F4V H;  1EC6 A;  1S03 G;  4B8T A;  1V8C A; 
#chains in the Genus database with same CATH homology
 1ZZJ A;  1ZTG A;  2CPQ A;  2DGR A;  1KHM A;  2JVZ A;  2JEA I;  2JZX A;  4OO1 G;  4LIJ A;  1DTJ A;  1J4W A;  2MJH A;  5C0X G;  5K36 G;  2HH3 A;  2FMR A;  2JE6 I;  1J5K A;  2PQU A;  1TUA A;  1VIG A;  2JA9 A;  1X4M A;  3V69 A;  1DT4 A;  4AM3 A;  1ZZK A;  2CTM A;  2CTE A;  2P2R A;  3VKE A;  1VIH A;  2OPU A;  4NBQ A;  4JVY A;  2CTF A;  2ANR A;  5JEA G;  2CTL A;  2E3U A;  1ZZI A;  4BA2 I;  2CTK A;  1X4N A;  2BL5 A;  2CTJ A;  3L7Z C;  2OPV A;  4JVH A;  1WVN A;  3U1K A;  2PY9 A;  2JEB I;  2Z0S A;  1K1G A;  2HH2 A;  2YQR A;  2BA0 A;  4AIM A;  4IFD G;  2AXY A;  2NN6 G;  4QMF B;  2ANN A;  3AEV B;  1EC6 A;  4WAL A;  4WAN A;  4B8T A;  4BA1 I;  2QND A;  1WE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...