2YQRA

Solution structure of the kh domain in kiaa0907 protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
b'GSSGSSGGMHYVQDKLFVGLEHAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHPKPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0907 protein
publication title Solution structure of the KH domain in KIAA0907 protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2yqrA01
2FMRA 4JVYA 2JZXA 2CPQA 2OPVA 2JEAI 2P2RA 2PQUA 4LIJA 1J4WA 2PY9A 4AM3A 1DTJA 2CTKA 2CTEA 2DGRA 3VKEA 3AEVB 4OO1G 1VIHA 3V69A 2YQRA 2HH3A 2OPUA 4B8TA 2CTJA 2HH2A 2MJHA 4BA2I 3L7ZC 2AXYA 4IFDG 1ZTGA 4JVHA 5K36G 5JEAG 4BA1I 2NN6G 1ZZIA 2BL5A 1X4MA 1WE8A 2E3UA 1K1GA 2JVZA 2CTMA 5C0XG 1DT4A 1X4NA 1EC6A 4WALA 1VIGA 1TUAA 1ZZKA 1WVNA 2CTFA 4WANA 2CTLA 2QNDA 4NBQA 1ZZJA 2ANRA 2Z0SA 2JE6I 1J5KA 2BA0A 4AIMA 1KHMA 3U1KA 2JA9A 2ANNA 4QMFB 2JEBI
chains in the Genus database with same CATH superfamily
3RF2A 1S03G 3J81W 2UXCH 2JEAI 1S20A 2PQUA 1V9NA 2X06A 4LIJA 4EC5A 1WHRA 2CTEA 4X62H 2M6QA 4OO1G 1VIHA 2M8WA 1N32H 2YQRA 4B8TA 1XRHA 5LMNH 4AQYH 2MJHA 4DR1H 4BA2I 5K36G 1ZTGA 4DV7H 3GKUA 2PT7G 4JI3H 5IT9W 1WE8A 4NZTM 1HNWH 4DV0H 2CTMA 1EC6A 4KHPH 1VIGA 2FFMA 4B8CD 1WVNA 4DUZH 4NBQA 1AN7A 4DR4H 4DV4H 2UUAH 4LFCH 1ODHA 2CWFA 4YY3H 4FJUA 4X65H 1N33H 2JEBI 2LF0A 2FMRA 1XMQH 3KDGA 4H8AA 3UOEA 2LTLA 5BR8H 4AM3A 2CTKA 3AEVB 1FJGH 2G8YA 3JAMW 3OTOH 5LMUH 2HHHH 2HH2A 4DR5H 4YHHH 2AXYA 4JVHA 1IBKH 4IFDG 3EZJA 3NCVA 4BA1I 4DV1H 1ZZIA 4LF5H 3SB1A 2JVZA 4LFAH 3I0PA 1DT4A 1X4NA 4DR2H 1FKAH 4NXNH 5DT9A 4DV2H 4DR7H 1N36H 4LF6H 1UG8A 1WTJA 2JE6I 2VKCA 2Z0SA 2VQFH 4JI7H 4E9JA 2UXDH 2JA9A 4K0KH 4PDBA 4JVYA 2JZXA 4JI1H 1IBMH 2CPMA 3OSSD 1J4WA 1DTJA 2DGRA 2LRRA 1V8CA 4G08A 2ZM6H 4JI4H 2HH3A 2OPUA 2VQEH 4JYAH 4JI6H 4OD6A 5JEAG 3T1YH 1F0XA 2NN6G 3OETA 3FAUA 2BL5A 4DUYH 2UU9H 4OX9H 1XNQH 1I6UA 4JI5H 1SEIA 2Y3MA 2UXBH 1VBIA 4WALA 1TUAA 4JI8H 1XNRH 2QNDA 4GKJH 4LFBH 2BA0A 4AIMA 1MSZA 2A1SA 2UUCH 4LF8H 1KHMA 4DR6H 2F4VH 3U1KA 2ANNA 3GABA 4DV5H 4DV3H 4JI2H 2FPHX 2CWHA 4X66H 2O4CA 4FJSA 2CPQA 1X9ZA 2OPVA 2P2RA 1HNZH 3GR5A 5FLXW 4DR3H 5IWAH 3VKEA 2PY9A 1NXUA 3QD7X 3V69A 1N34H 1HNXH 4GKKH 1XMOH 2CTJA 1IBLH 3J7AK 2ZQEA 1X0AA 3L7ZC 1HR0H 4B3RH 3T1HH 1Z2IA 5A2QW 4DV6H 4NXMH 2E5LH 5LL6b 1X4MA 2E3UA 3KDKA 2UUBH 4JV5H 1K1GA 4B3TH 4B3SH 5C0XG 4JI0H 4B3MH 1ZZKA 2CTFA 4WANA 2CTLA 1ZZJA 2ANRA 1J5EH 1J5KA 4LF9H 4LF7H 3J80W 2LTMA 4OCHA 4NZRM 4LF4H 1PQXA 2D9IA 2K1HA 4QMFB 4X64H 1I94H
chains in the Genus database with same CATH topology
2FMRA 4JVYA 2JZXA 2CPQA 2OPVA 2JEAI 2P2RA 2PQUA 4LIJA 1J4WA 2PY9A 4AM3A 1DTJA 2CTKA 2CTEA 2DGRA 3VKEA 3AEVB 4OO1G 1VIHA 3V69A 2YQRA 2HH3A 2OPUA 4B8TA 2CTJA 2HH2A 2MJHA 4BA2I 3L7ZC 2AXYA 4IFDG 1ZTGA 4JVHA 5K36G 5JEAG 4BA1I 2NN6G 1ZZIA 2BL5A 1X4MA 1WE8A 2E3UA 1K1GA 2JVZA 2CTMA 5C0XG 1DT4A 1X4NA 1EC6A 4WALA 1VIGA 1TUAA 1ZZKA 1WVNA 2CTFA 4WANA 2CTLA 2QNDA 4NBQA 1ZZJA 2ANRA 2Z0SA 2JE6I 1J5KA 2BA0A 4AIMA 1KHMA 3U1KA 2JA9A 2ANNA 4QMFB 2JEBI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FMR A;  4JVY A;  2JZX A;  2CPQ A;  2OPV A;  2JEA I;  2P2R A;  2PQU A;  4LIJ A;  1J4W A;  2PY9 A;  4AM3 A;  1DTJ A;  2CTK A;  2CTE A;  2DGR A;  3VKE A;  3AEV B;  4OO1 G;  1VIH A;  3V69 A;  2YQR A;  2HH3 A;  2OPU A;  4B8T A;  2CTJ A;  2HH2 A;  2MJH A;  4BA2 I;  3L7Z C;  2AXY A;  4IFD G;  1ZTG A;  4JVH A;  5K36 G;  5JEA G;  4BA1 I;  2NN6 G;  1ZZI A;  2BL5 A;  1X4M A;  1WE8 A;  2E3U A;  1K1G A;  2JVZ A;  2CTM A;  5C0X G;  1DT4 A;  1X4N A;  1EC6 A;  4WAL A;  1VIG A;  1TUA A;  1ZZK A;  1WVN A;  2CTF A;  4WAN A;  2CTL A;  2QND A;  4NBQ A;  1ZZJ A;  2ANR A;  2Z0S A;  2JE6 I;  1J5K A;  2BA0 A;  4AIM A;  1KHM A;  3U1K A;  2JA9 A;  2ANN A;  4QMF B;  2JEB I; 
#chains in the Genus database with same CATH topology
 3RF2 A;  1S03 G;  3J81 W;  2UXC H;  2JEA I;  1S20 A;  2PQU A;  1V9N A;  2X06 A;  4LIJ A;  4EC5 A;  1WHR A;  2CTE A;  4X62 H;  2M6Q A;  4OO1 G;  1VIH A;  2M8W A;  1N32 H;  2YQR A;  4B8T A;  1XRH A;  5LMN H;  4AQY H;  2MJH A;  4DR1 H;  4BA2 I;  5K36 G;  1ZTG A;  4DV7 H;  3GKU A;  2PT7 G;  4JI3 H;  5IT9 W;  1WE8 A;  4NZT M;  1HNW H;  4DV0 H;  2CTM A;  1EC6 A;  4KHP H;  1VIG A;  2FFM A;  4B8C D;  1WVN A;  4DUZ H;  4NBQ A;  1AN7 A;  4DR4 H;  4DV4 H;  2UUA H;  4LFC H;  1ODH A;  2CWF A;  4YY3 H;  4FJU A;  4X65 H;  1N33 H;  2JEB I;  2LF0 A;  2FMR A;  1XMQ H;  3KDG A;  4H8A A;  3UOE A;  2LTL A;  5BR8 H;  4AM3 A;  2CTK A;  3AEV B;  1FJG H;  2G8Y A;  3JAM W;  3OTO H;  5LMU H;  2HHH H;  2HH2 A;  4DR5 H;  4YHH H;  2AXY A;  4JVH A;  1IBK H;  4IFD G;  3EZJ A;  3NCV A;  4BA1 I;  4DV1 H;  1ZZI A;  4LF5 H;  3SB1 A;  2JVZ A;  4LFA H;  3I0P A;  1DT4 A;  1X4N A;  4DR2 H;  1FKA H;  4NXN H;  5DT9 A;  4DV2 H;  4DR7 H;  1N36 H;  4LF6 H;  1UG8 A;  1WTJ A;  2JE6 I;  2VKC A;  2Z0S A;  2VQF H;  4JI7 H;  4E9J A;  2UXD H;  2JA9 A;  4K0K H;  4PDB A;  4JVY A;  2JZX A;  4JI1 H;  1IBM H;  2CPM A;  3OSS D;  1J4W A;  1DTJ A;  2DGR A;  2LRR A;  1V8C A;  4G08 A;  2ZM6 H;  4JI4 H;  2HH3 A;  2OPU A;  2VQE H;  4JYA H;  4JI6 H;  4OD6 A;  5JEA G;  3T1Y H;  1F0X A;  2NN6 G;  3OET A;  3FAU A;  2BL5 A;  4DUY H;  2UU9 H;  4OX9 H;  1XNQ H;  1I6U A;  4JI5 H;  1SEI A;  2Y3M A;  2UXB H;  1VBI A;  4WAL A;  1TUA A;  4JI8 H;  1XNR H;  2QND A;  4GKJ H;  4LFB H;  2BA0 A;  4AIM A;  1MSZ A;  2A1S A;  2UUC H;  4LF8 H;  1KHM A;  4DR6 H;  2F4V H;  3U1K A;  2ANN A;  3GAB A;  4DV5 H;  4DV3 H;  4JI2 H;  2FPH X;  2CWH A;  4X66 H;  2O4C A;  4FJS A;  2CPQ A;  1X9Z A;  2OPV A;  2P2R A;  1HNZ H;  3GR5 A;  5FLX W;  4DR3 H;  5IWA H;  3VKE A;  2PY9 A;  1NXU A;  3QD7 X;  3V69 A;  1N34 H;  1HNX H;  4GKK H;  1XMO H;  2CTJ A;  1IBL H;  3J7A K;  2ZQE A;  1X0A A;  3L7Z C;  1HR0 H;  4B3R H;  3T1H H;  1Z2I A;  5A2Q W;  4DV6 H;  4NXM H;  2E5L H;  5LL6 b;  1X4M A;  2E3U A;  3KDK A;  2UUB H;  4JV5 H;  1K1G A;  4B3T H;  4B3S H;  5C0X G;  4JI0 H;  4B3M H;  1ZZK A;  2CTF A;  4WAN A;  2CTL A;  1ZZJ A;  2ANR A;  1J5E H;  1J5K A;  4LF9 H;  4LF7 H;  3J80 W;  2LTM A;  4OCH A;  4NZR M;  4LF4 H;  1PQX A;  2D9I A;  2K1H A;  4QMF B;  4X64 H;  1I94 H; 
#chains in the Genus database with same CATH homology
 2FMR A;  4JVY A;  2JZX A;  2CPQ A;  2OPV A;  2JEA I;  2P2R A;  2PQU A;  4LIJ A;  1J4W A;  2PY9 A;  4AM3 A;  1DTJ A;  2CTK A;  2CTE A;  2DGR A;  3VKE A;  3AEV B;  4OO1 G;  1VIH A;  3V69 A;  2YQR A;  2HH3 A;  2OPU A;  4B8T A;  2CTJ A;  2HH2 A;  2MJH A;  4BA2 I;  3L7Z C;  2AXY A;  4IFD G;  1ZTG A;  4JVH A;  5K36 G;  5JEA G;  4BA1 I;  2NN6 G;  1ZZI A;  2BL5 A;  1X4M A;  1WE8 A;  2E3U A;  1K1G A;  2JVZ A;  2CTM A;  5C0X G;  1DT4 A;  1X4N A;  1EC6 A;  4WAL A;  1VIG A;  1TUA A;  1ZZK A;  1WVN A;  2CTF A;  4WAN A;  2CTL A;  2QND A;  4NBQ A;  1ZZJ A;  2ANR A;  2Z0S A;  2JE6 I;  1J5K A;  2BA0 A;  4AIM A;  1KHM A;  3U1K A;  2JA9 A;  2ANN A;  4QMF B;  2JEB I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...