2YQRA

Solution structure of the kh domain in kiaa0907 protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
b'GSSGSSGGMHYVQDKLFVGLEHAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHPKPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0907 protein
molecule tags Rna binding protein
source organism Homo sapiens
publication title Solution structure of the KH domain in KIAA0907 protein
rcsb
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2yqrA01
4WALA 2FMRA 2Z0SA 4JVHA 4BA2I 2JEBI 2QNDA 2ANNA 4AIMA 1X4NA 1ZZKA 2YQRA 1ZZJA 5C0XG 2P2RA 4WANA 2HH2A 2ANRA 2HH3A 2OPVA 1J4WA 1DTJA 4B8TA 2E3UA 2JA9A 1J5KA 4NBQA 1WE8A 1X4MA 3U1KA 2MJHA 2NN6G 2PQUA 5K36G 2CTJA 3VKEA 4IFDG 2CTKA 5JEAG 2BL5A 2AXYA 1K1GA 4BA1I 2PY9A 1DT4A 2JZXA 1KHMA 2CTLA 4QMFB 1TUAA 2DGRA 1ZTGA 4JVYA 2JVZA 2JE6I 1WVNA 2BA0A 1VIHA 3V69A 4LIJA 4AM3A 2CTEA 2CTMA 2JEAI 1EC6A 3L7ZC 1ZZIA 3AEVB 4OO1G 2OPUA 2CTFA 2CPQA 1VIGA
chains in the Genus database with same CATH superfamily
2UXCH 3GABA 4JI7H 4JYAH 1XNQH 1N32H 4DV5H 1VBIA 4JI3H 1IBLH 2UXBH 4DR4H 4DUYH 1NXUA 2HH3A 4JI4H 4H8AA 1DTJA 2ANNA 2JA9A 4FJSA 1WE8A 4B3TH 2VQEH 4JI0H 4B3RH 5FLXW 4GKKH 2UUCH 1I6UA 2BL5A 1K1GA 2Y3MA 4GKJH 1WHRA 1AN7A 3FAUA 1N34H 4OD6A 1FKAH 2DGRA 4DV4H 1SEIA 1WVNA 2VQFH 4AM3A 4LIJA 2CTEA 5LMNH 1XNRH 2JEAI 2UXDH 1IBMH 4NZTM 3J81W 3T1YH 5A2QW 1XMOH 2LTLA 3RF2A 1WTJA 2Z0SA 1HNZH 2QNDA 2CPMA 4AIMA 5IT9W 2YQRA 4PDBA 5C0XG 2LRRA 4WANA 5LMUH 4DR5H 2G8YA 3I0PA 2PQUA 2MJHA 1X4MA 4LF6H 5K36G 1X0AA 1N33H 4NXNH 4DR6H 3QD7X 2PY9A 4K0KH 4JI8H 2CWFA 3OTOH 4LFAH 4QMFB 3KDGA 1TUAA 3OETA 4JVYA 1FJGH 2M8WA 3V69A 2BA0A 2O4CA 5BR8H 1XRHA 1ZZIA 4DV3H 4B3SH 4JI6H 4OO1G 4DR1H 1HNXH 2CTFA 1VIGA 4DR3H 4X64H 1J5KA 1J5EH 1UG8A 4DUZH 2HHHH 2UUAH 4JVHA 2FFMA 3GR5A 4LF9H 1X4NA 1ZZKA 1V9NA 4EC5A 2PT7G 4DV7H 1HR0H 4LF7H 2E5LH 4DV2H 2ANRA 4B8TA 4YHHH 3U1KA 4OCHA 4KHPH 2UUBH 4NXMH 1Z2IA 1S03G 2D9IA 2LTMA 2CTJA 3NCVA 4FJUA 3JAMW 5LL6b 2FPHX 1XMQH 2X06A 2K1HA 4X62H 2AXYA 4LFCH 4X65H 4DR7H 1F0XA 4NZRM 2JZXA 4JV5H 1KHMA 2CTLA 4DV1H 2JVZA 3SB1A 1S20A 1HNWH 3J80W 2ZQEA 3KDKA 2ZM6H 4JI5H 4JI2H 2CTMA 4AQYH 1PQXA 4G08A 2LF0A 3GKUA 4JI1H 4LF8H 2OPUA 4OX9H 1MSZA 4YY3H 4E9JA 4WALA 2FMRA 2UU9H 2A1SA 2VKCA 4BA2I 2JEBI 4LFBH 3OSSD 1ZZJA 2P2RA 3T1HH 2HH2A 2CWHA 2OPVA 4X66H 3UOEA 1X9ZA 4DR2H 1J4WA 2E3UA 1N36H 1ODHA 4NBQA 3J7AK 2NN6G 4B3MH 4LF5H 3VKEA 4IFDG 1V8CA 2CTKA 5JEAG 4B8CD 4DV0H 2F4VH 4BA1I 1DT4A 3EZJA 1ZTGA 2JE6I 5DT9A 1VIHA 1EC6A 2M6QA 1I94H 3L7ZC 3AEVB 4LF4H 4DV6H 5IWAH 1IBKH 2CPQA
chains in the Genus database with same CATH topology
4WALA 2FMRA 2Z0SA 4JVHA 4BA2I 2JEBI 2QNDA 2ANNA 4AIMA 1X4NA 1ZZKA 2YQRA 1ZZJA 5C0XG 2P2RA 4WANA 2HH2A 2ANRA 2HH3A 2OPVA 1J4WA 1DTJA 4B8TA 2E3UA 2JA9A 1J5KA 4NBQA 1WE8A 1X4MA 3U1KA 2MJHA 2NN6G 2PQUA 5K36G 2CTJA 3VKEA 4IFDG 2CTKA 5JEAG 2BL5A 2AXYA 1K1GA 4BA1I 2PY9A 1DT4A 2JZXA 1KHMA 2CTLA 4QMFB 1TUAA 2DGRA 1ZTGA 4JVYA 2JVZA 2JE6I 1WVNA 2BA0A 1VIHA 3V69A 4LIJA 4AM3A 2CTEA 2CTMA 2JEAI 1EC6A 3L7ZC 1ZZIA 3AEVB 4OO1G 2OPUA 2CTFA 2CPQA 1VIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WAL A;  2FMR A;  2Z0S A;  4JVH A;  4BA2 I;  2JEB I;  2QND A;  2ANN A;  4AIM A;  1X4N A;  1ZZK A;  2YQR A;  1ZZJ A;  5C0X G;  2P2R A;  4WAN A;  2HH2 A;  2ANR A;  2HH3 A;  2OPV A;  1J4W A;  1DTJ A;  4B8T A;  2E3U A;  2JA9 A;  1J5K A;  4NBQ A;  1WE8 A;  1X4M A;  3U1K A;  2MJH A;  2NN6 G;  2PQU A;  5K36 G;  2CTJ A;  3VKE A;  4IFD G;  2CTK A;  5JEA G;  2BL5 A;  2AXY A;  1K1G A;  4BA1 I;  2PY9 A;  1DT4 A;  2JZX A;  1KHM A;  2CTL A;  4QMF B;  1TUA A;  2DGR A;  1ZTG A;  4JVY A;  2JVZ A;  2JE6 I;  1WVN A;  2BA0 A;  1VIH A;  3V69 A;  4LIJ A;  4AM3 A;  2CTE A;  2CTM A;  2JEA I;  1EC6 A;  3L7Z C;  1ZZI A;  3AEV B;  4OO1 G;  2OPU A;  2CTF A;  2CPQ A;  1VIG A; 
#chains in the Genus database with same CATH topology
 2UXC H;  3GAB A;  4JI7 H;  4JYA H;  1XNQ H;  1N32 H;  4DV5 H;  1VBI A;  4JI3 H;  1IBL H;  2UXB H;  4DR4 H;  4DUY H;  1NXU A;  2HH3 A;  4JI4 H;  4H8A A;  1DTJ A;  2ANN A;  2JA9 A;  4FJS A;  1WE8 A;  4B3T H;  2VQE H;  4JI0 H;  4B3R H;  5FLX W;  4GKK H;  2UUC H;  1I6U A;  2BL5 A;  1K1G A;  2Y3M A;  4GKJ H;  1WHR A;  1AN7 A;  3FAU A;  1N34 H;  4OD6 A;  1FKA H;  2DGR A;  4DV4 H;  1SEI A;  1WVN A;  2VQF H;  4AM3 A;  4LIJ A;  2CTE A;  5LMN H;  1XNR H;  2JEA I;  2UXD H;  1IBM H;  4NZT M;  3J81 W;  3T1Y H;  5A2Q W;  1XMO H;  2LTL A;  3RF2 A;  1WTJ A;  2Z0S A;  1HNZ H;  2QND A;  2CPM A;  4AIM A;  5IT9 W;  2YQR A;  4PDB A;  5C0X G;  2LRR A;  4WAN A;  5LMU H;  4DR5 H;  2G8Y A;  3I0P A;  2PQU A;  2MJH A;  1X4M A;  4LF6 H;  5K36 G;  1X0A A;  1N33 H;  4NXN H;  4DR6 H;  3QD7 X;  2PY9 A;  4K0K H;  4JI8 H;  2CWF A;  3OTO H;  4LFA H;  4QMF B;  3KDG A;  1TUA A;  3OET A;  4JVY A;  1FJG H;  2M8W A;  3V69 A;  2BA0 A;  2O4C A;  5BR8 H;  1XRH A;  1ZZI A;  4DV3 H;  4B3S H;  4JI6 H;  4OO1 G;  4DR1 H;  1HNX H;  2CTF A;  1VIG A;  4DR3 H;  4X64 H;  1J5K A;  1J5E H;  1UG8 A;  4DUZ H;  2HHH H;  2UUA H;  4JVH A;  2FFM A;  3GR5 A;  4LF9 H;  1X4N A;  1ZZK A;  1V9N A;  4EC5 A;  2PT7 G;  4DV7 H;  1HR0 H;  4LF7 H;  2E5L H;  4DV2 H;  2ANR A;  4B8T A;  4YHH H;  3U1K A;  4OCH A;  4KHP H;  2UUB H;  4NXM H;  1Z2I A;  1S03 G;  2D9I A;  2LTM A;  2CTJ A;  3NCV A;  4FJU A;  3JAM W;  5LL6 b;  2FPH X;  1XMQ H;  2X06 A;  2K1H A;  4X62 H;  2AXY A;  4LFC H;  4X65 H;  4DR7 H;  1F0X A;  4NZR M;  2JZX A;  4JV5 H;  1KHM A;  2CTL A;  4DV1 H;  2JVZ A;  3SB1 A;  1S20 A;  1HNW H;  3J80 W;  2ZQE A;  3KDK A;  2ZM6 H;  4JI5 H;  4JI2 H;  2CTM A;  4AQY H;  1PQX A;  4G08 A;  2LF0 A;  3GKU A;  4JI1 H;  4LF8 H;  2OPU A;  4OX9 H;  1MSZ A;  4YY3 H;  4E9J A;  4WAL A;  2FMR A;  2UU9 H;  2A1S A;  2VKC A;  4BA2 I;  2JEB I;  4LFB H;  3OSS D;  1ZZJ A;  2P2R A;  3T1H H;  2HH2 A;  2CWH A;  2OPV A;  4X66 H;  3UOE A;  1X9Z A;  4DR2 H;  1J4W A;  2E3U A;  1N36 H;  1ODH A;  4NBQ A;  3J7A K;  2NN6 G;  4B3M H;  4LF5 H;  3VKE A;  4IFD G;  1V8C A;  2CTK A;  5JEA G;  4B8C D;  4DV0 H;  2F4V H;  4BA1 I;  1DT4 A;  3EZJ A;  1ZTG A;  2JE6 I;  5DT9 A;  1VIH A;  1EC6 A;  2M6Q A;  1I94 H;  3L7Z C;  3AEV B;  4LF4 H;  4DV6 H;  5IWA H;  1IBK H;  2CPQ A; 
#chains in the Genus database with same CATH homology
 4WAL A;  2FMR A;  2Z0S A;  4JVH A;  4BA2 I;  2JEB I;  2QND A;  2ANN A;  4AIM A;  1X4N A;  1ZZK A;  2YQR A;  1ZZJ A;  5C0X G;  2P2R A;  4WAN A;  2HH2 A;  2ANR A;  2HH3 A;  2OPV A;  1J4W A;  1DTJ A;  4B8T A;  2E3U A;  2JA9 A;  1J5K A;  4NBQ A;  1WE8 A;  1X4M A;  3U1K A;  2MJH A;  2NN6 G;  2PQU A;  5K36 G;  2CTJ A;  3VKE A;  4IFD G;  2CTK A;  5JEA G;  2BL5 A;  2AXY A;  1K1G A;  4BA1 I;  2PY9 A;  1DT4 A;  2JZX A;  1KHM A;  2CTL A;  4QMF B;  1TUA A;  2DGR A;  1ZTG A;  4JVY A;  2JVZ A;  2JE6 I;  1WVN A;  2BA0 A;  1VIH A;  3V69 A;  4LIJ A;  4AM3 A;  2CTE A;  2CTM A;  2JEA I;  1EC6 A;  3L7Z C;  1ZZI A;  3AEV B;  4OO1 G;  2OPU A;  2CTF A;  2CPQ A;  1VIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...