2YQRA

Solution structure of the kh domain in kiaa0907 protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
GSSGSSGGMHYVQDKLFVGLEHAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHPKPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords KIAA0907 protein
publication title Solution structure of the KH domain in KIAA0907 protein
rcsb
source organism Homo sapiens
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2yqrA01
2JE6I 2NN6G 1EC6A 2CTFA 4QMFB 2CTLA 4B8TA 2CPQA 2HH3A 4NBQA 1J5KA 4WANA 2ANRA 2Z0SA 3V69A 3AEVB 2FMRA 2PQUA 4AIMA 4OO1G 5C0XG 1TUAA 2E3UA 3VKEA 2AXYA 2CTMA 2P2RA 1VIHA 2PY9A 4JVHA 2CTKA 1ZZJA 1WE8A 4WALA 4JVYA 1X4MA 3U1KA 5JEAG 1WVNA 2DGRA 1DT4A 2CTEA 2JA9A 2CTJA 3L7ZC 1J4WA 2MJHA 1X4NA 4IFDG 2YQRA 4LIJA 2JEAI 2OPVA 1DTJA 2BL5A 2OPUA 1ZTGA 2BA0A 2JZXA 4BA2I 5K36G 1VIGA 1KHMA 1ZZKA 4AM3A 2HH2A 2QNDA 2JVZA 1K1GA 2ANNA 4BA1I 1ZZIA 2JEBI
chains in the Genus database with same CATH superfamily
2JE6I 1EC6A 2G8YA 4DUZH 4DR5H 1PQXA 4B8TA 4YHHH 4NBQA 1J5KA 2CPMA 4WANA 4DR4H 4DV2H 3V69A 2A1SA 2K1HA 2PQUA 3QD7X 4LF8H 3NCVA 4H8AA 2E3UA 3VKEA 2CTMA 2O4CA 1HNWH 4B3MH 4LF9H 1WE8A 1X0AA 4LFAH 1XNQH 4JYAH 4LF6H 1J5EH 3GR5A 1WVNA 2ZQEA 1DT4A 2CTEA 4B3TH 2CTJA 4LF4H 4IFDG 2UU9H 1N33H 2VQEH 4LF7H 4DV0H 4B3SH 2HHHH 2BL5A 2OPUA 3SB1A 4B8CD 2BA0A 1XMQH 2LRRA 3OSSD 1ZZKA 4X66H 2HH2A 4LF5H 1S20A 3T1YH 1ZZIA 3J7AK 5IWAH 2VKCA 1FKAH 4OD6A 4QMFB 2ZM6H 1HNXH 2LTMA 4DV3H 3GKUA 3GABA 4DV1H 2CPQA 1AN7A 4DR3H 1HNZH 1IBMH 4JI3H 2ANRA 2Z0SA 5LL6b 5LMUH 4K0KH 4JI2H 4OCHA 2P2RA 5BR8H 4JVHA 1NXUA 2PY9A 1UG8A 4LFBH 1ZZJA 1N34H 4JI5H 2E5LH 4JI7H 2F4VH 2FPHX 4YY3H 1N32H 1WTJA 4X64H 3UOEA 4DV5H 2DGRA 1X9ZA 1FJGH 2JA9A 1J4WA 4JI4H 4FJSA 2FFMA 3T1HH 4DV6H 4JI1H 3KDKA 1IBLH 2ANNA 2X06A 2JEBI 4JV5H 1MSZA 5DT9A 4EC5A 2CTFA 5IT9W 2M6QA 3OETA 2UXDH 3AEVB 4G08A 4GKKH 2FMRA 4DR7H 2CWHA 2AXYA 4B3RH 2CTKA 4E9JA 1X4MA 3U1KA 1V9NA 5JEAG 1VBIA 1S03G 3L7ZC 2D9IA 4FJUA 2MJHA 2CWFA 1ODHA 4NXMH 3FAUA 4LIJA 2LF0A 3J81W 2OPVA 1DTJA 2JZXA 1IBKH 1KHMA 4PDBA 2JVZA 3RF2A 4BA1I 5FLXW 4DR2H 3JAMW 2NN6G 2CTLA 1I94H 3EZJA 5A2QW 2UXBH 1F0XA 1XRHA 3KDGA 2PT7G 2HH3A 4JI0H 4X62H 4OO1G 4AIMA 4X65H 2UXCH 5C0XG 2UUAH 1TUAA 2M8WA 3J80W 1VIHA 1Z2IA 4NZRM 1WHRA 3OTOH 4AQYH 2Y3MA 5LMNH 4WALA 4NXNH 4JVYA 4DV7H 4LFCH 1N36H 3I0PA 2VQFH 4DUYH 4KHPH 1I6UA 1SEIA 1HR0H 2LTLA 4GKJH 4DR1H 1X4NA 4JI8H 2YQRA 1XMOH 2JEAI 4NZTM 4OX9H 1XNRH 4DR6H 1ZTGA 2UUCH 4BA2I 5K36G 1VIGA 4AM3A 1V8CA 2QNDA 4DV4H 2UUBH 1K1GA 4JI6H
chains in the Genus database with same CATH topology
2JE6I 2NN6G 1EC6A 2CTFA 4QMFB 2CTLA 4B8TA 2CPQA 2HH3A 4NBQA 1J5KA 4WANA 2ANRA 2Z0SA 3V69A 3AEVB 2FMRA 2PQUA 4AIMA 4OO1G 5C0XG 1TUAA 2E3UA 3VKEA 2AXYA 2CTMA 2P2RA 1VIHA 2PY9A 4JVHA 2CTKA 1ZZJA 1WE8A 4WALA 4JVYA 1X4MA 3U1KA 5JEAG 1WVNA 2DGRA 1DT4A 2CTEA 2JA9A 2CTJA 3L7ZC 1J4WA 2MJHA 1X4NA 4IFDG 2YQRA 4LIJA 2JEAI 2OPVA 1DTJA 2BL5A 2OPUA 1ZTGA 2BA0A 2JZXA 4BA2I 5K36G 1VIGA 1KHMA 1ZZKA 4AM3A 2HH2A 2QNDA 2JVZA 1K1GA 2ANNA 4BA1I 1ZZIA 2JEBI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JE6 I;  2NN6 G;  1EC6 A;  2CTF A;  4QMF B;  2CTL A;  4B8T A;  2CPQ A;  2HH3 A;  4NBQ A;  1J5K A;  4WAN A;  2ANR A;  2Z0S A;  3V69 A;  3AEV B;  2FMR A;  2PQU A;  4AIM A;  4OO1 G;  5C0X G;  1TUA A;  2E3U A;  3VKE A;  2AXY A;  2CTM A;  2P2R A;  1VIH A;  2PY9 A;  4JVH A;  2CTK A;  1ZZJ A;  1WE8 A;  4WAL A;  4JVY A;  1X4M A;  3U1K A;  5JEA G;  1WVN A;  2DGR A;  1DT4 A;  2CTE A;  2JA9 A;  2CTJ A;  3L7Z C;  1J4W A;  2MJH A;  1X4N A;  4IFD G;  2YQR A;  4LIJ A;  2JEA I;  2OPV A;  1DTJ A;  2BL5 A;  2OPU A;  1ZTG A;  2BA0 A;  2JZX A;  4BA2 I;  5K36 G;  1VIG A;  1KHM A;  1ZZK A;  4AM3 A;  2HH2 A;  2QND A;  2JVZ A;  1K1G A;  2ANN A;  4BA1 I;  1ZZI A;  2JEB I; 
#chains in the Genus database with same CATH topology
 2JE6 I;  1EC6 A;  2G8Y A;  4DUZ H;  4DR5 H;  1PQX A;  4B8T A;  4YHH H;  4NBQ A;  1J5K A;  2CPM A;  4WAN A;  4DR4 H;  4DV2 H;  3V69 A;  2A1S A;  2K1H A;  2PQU A;  3QD7 X;  4LF8 H;  3NCV A;  4H8A A;  2E3U A;  3VKE A;  2CTM A;  2O4C A;  1HNW H;  4B3M H;  4LF9 H;  1WE8 A;  1X0A A;  4LFA H;  1XNQ H;  4JYA H;  4LF6 H;  1J5E H;  3GR5 A;  1WVN A;  2ZQE A;  1DT4 A;  2CTE A;  4B3T H;  2CTJ A;  4LF4 H;  4IFD G;  2UU9 H;  1N33 H;  2VQE H;  4LF7 H;  4DV0 H;  4B3S H;  2HHH H;  2BL5 A;  2OPU A;  3SB1 A;  4B8C D;  2BA0 A;  1XMQ H;  2LRR A;  3OSS D;  1ZZK A;  4X66 H;  2HH2 A;  4LF5 H;  1S20 A;  3T1Y H;  1ZZI A;  3J7A K;  5IWA H;  2VKC A;  1FKA H;  4OD6 A;  4QMF B;  2ZM6 H;  1HNX H;  2LTM A;  4DV3 H;  3GKU A;  3GAB A;  4DV1 H;  2CPQ A;  1AN7 A;  4DR3 H;  1HNZ H;  1IBM H;  4JI3 H;  2ANR A;  2Z0S A;  5LL6 b;  5LMU H;  4K0K H;  4JI2 H;  4OCH A;  2P2R A;  5BR8 H;  4JVH A;  1NXU A;  2PY9 A;  1UG8 A;  4LFB H;  1ZZJ A;  1N34 H;  4JI5 H;  2E5L H;  4JI7 H;  2F4V H;  2FPH X;  4YY3 H;  1N32 H;  1WTJ A;  4X64 H;  3UOE A;  4DV5 H;  2DGR A;  1X9Z A;  1FJG H;  2JA9 A;  1J4W A;  4JI4 H;  4FJS A;  2FFM A;  3T1H H;  4DV6 H;  4JI1 H;  3KDK A;  1IBL H;  2ANN A;  2X06 A;  2JEB I;  4JV5 H;  1MSZ A;  5DT9 A;  4EC5 A;  2CTF A;  5IT9 W;  2M6Q A;  3OET A;  2UXD H;  3AEV B;  4G08 A;  4GKK H;  2FMR A;  4DR7 H;  2CWH A;  2AXY A;  4B3R H;  2CTK A;  4E9J A;  1X4M A;  3U1K A;  1V9N A;  5JEA G;  1VBI A;  1S03 G;  3L7Z C;  2D9I A;  4FJU A;  2MJH A;  2CWF A;  1ODH A;  4NXM H;  3FAU A;  4LIJ A;  2LF0 A;  3J81 W;  2OPV A;  1DTJ A;  2JZX A;  1IBK H;  1KHM A;  4PDB A;  2JVZ A;  3RF2 A;  4BA1 I;  5FLX W;  4DR2 H;  3JAM W;  2NN6 G;  2CTL A;  1I94 H;  3EZJ A;  5A2Q W;  2UXB H;  1F0X A;  1XRH A;  3KDG A;  2PT7 G;  2HH3 A;  4JI0 H;  4X62 H;  4OO1 G;  4AIM A;  4X65 H;  2UXC H;  5C0X G;  2UUA H;  1TUA A;  2M8W A;  3J80 W;  1VIH A;  1Z2I A;  4NZR M;  1WHR A;  3OTO H;  4AQY H;  2Y3M A;  5LMN H;  4WAL A;  4NXN H;  4JVY A;  4DV7 H;  4LFC H;  1N36 H;  3I0P A;  2VQF H;  4DUY H;  4KHP H;  1I6U A;  1SEI A;  1HR0 H;  2LTL A;  4GKJ H;  4DR1 H;  1X4N A;  4JI8 H;  2YQR A;  1XMO H;  2JEA I;  4NZT M;  4OX9 H;  1XNR H;  4DR6 H;  1ZTG A;  2UUC H;  4BA2 I;  5K36 G;  1VIG A;  4AM3 A;  1V8C A;  2QND A;  4DV4 H;  2UUB H;  1K1G A;  4JI6 H; 
#chains in the Genus database with same CATH homology
 2JE6 I;  2NN6 G;  1EC6 A;  2CTF A;  4QMF B;  2CTL A;  4B8T A;  2CPQ A;  2HH3 A;  4NBQ A;  1J5K A;  4WAN A;  2ANR A;  2Z0S A;  3V69 A;  3AEV B;  2FMR A;  2PQU A;  4AIM A;  4OO1 G;  5C0X G;  1TUA A;  2E3U A;  3VKE A;  2AXY A;  2CTM A;  2P2R A;  1VIH A;  2PY9 A;  4JVH A;  2CTK A;  1ZZJ A;  1WE8 A;  4WAL A;  4JVY A;  1X4M A;  3U1K A;  5JEA G;  1WVN A;  2DGR A;  1DT4 A;  2CTE A;  2JA9 A;  2CTJ A;  3L7Z C;  1J4W A;  2MJH A;  1X4N A;  4IFD G;  2YQR A;  4LIJ A;  2JEA I;  2OPV A;  1DTJ A;  2BL5 A;  2OPU A;  1ZTG A;  2BA0 A;  2JZX A;  4BA2 I;  5K36 G;  1VIG A;  1KHM A;  1ZZK A;  4AM3 A;  2HH2 A;  2QND A;  2JVZ A;  1K1G A;  2ANN A;  4BA1 I;  1ZZI A;  2JEB I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...