4E9JA

Crystal structure of the n-terminal domain of the secretin xcpq from pseudomonas aeruginosa
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
233
structure length
217
Chain Sequence
AFVPAAHWTINLKDADIREFIDQISEITGETFVVDPRVKGQVSVVSKAQLSLSEVYQLFLSVMSTHGFTVVAQGDQARIVPNAAPDRLETRVIQVQQSPVSELIPLIRPLVPQYGHLAAVPSANALIISDRSANIARIEDVIRQLDQKGSHDYSVINLRYGWVMDAAEVLNNAMSRGQAKGAAGAQVIADARTNRLIILGPPQARAKLVQLAQSLDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General secretion pathway protein D
publication title New Insights into the Assembly of Bacterial Secretins: STRUCTURAL STUDIES OF THE PERIPLASMIC DOMAIN OF XcpQ FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein transport
total genus 59
structure length 217
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03958 Secretin_N Bacterial type II/III secretion system short domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4e9jA02
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4e9jA01
4EC5A 3OSSD 4E9JA 3GR5A 4G08A 2Y3MA 3EZJA
chains in the Genus database with same CATH superfamily
1FKAH 4B3RH 3SB1A 3I0PA 4PDBA 1XNQH 3V69A 1ZTGA 4OO1G 4LF6H 2F4VH 4DV6H 4FJUA 1XMOH 4GKKH 2AXYA 4OCHA 2JEBI 5LL6b 2O4CA 3UOEA 1V9NA 2UUCH 4YY3H 1WTJA 4YHHH 2CPMA 1X9ZA 4X65H 1V8CA 4JI5H 1XRHA 4KHPH 5IT9W 1X0AA 4DV0H 1DT4A 4BA1I 2ZQEA 2Z0SA 1XMQH 2A1SA 2G8YA 2VQFH 4DR4H 2JVZA 2E5LH 2CTLA 4GKJH 4BA2I 2LF0A 3J7AK 2YQRA 4AIMA 2FFMA 2HH2A 1K1GA 4B3MH 4LFBH 1NXUA 1TUAA 2M6QA 4X64H 3T1YH 4LF9H 4AM3A 1N32H 5K36G 4NZRM 2HHHH 2NN6G 4DUZH 2X06A 2Y3MA 4DR3H 1VIGA 1Z2IA 4DR7H 2UXDH 5BR8H 3J81W 1N34H 2PY9A 4DV4H 4DV2H 2UXBH 2K1HA 4OD6A 5IWAH 1ODHA 1XNRH 1EC6A 4NZTM 1HR0H 1J5KA 1WHRA 4QMFB 1S20A 2P2RA 4K0KH 4DV7H 3QD7X 3GABA 1S03G 1DTJA 3OSSD 4X66H 1ZZIA 4G08A 2JE6I 1F0XA 5DT9A 2ZM6H 1J5EH 1ZZJA 2ANRA 4JI2H 1FJGH 1I6UA 4DV5H 4LF7H 4LIJA 2OPUA 3FAUA 5A2QW 4JYAH 2FPHX 4IFDG 2DGRA 1PQXA 2LTLA 3KDKA 4DR2H 2UXCH 2VKCA 1UG8A 3J80W 2ANNA 2D9IA 2QNDA 4JVHA 2CTEA 4AQYH 2UU9H 4LF4H 5C0XG 4DV1H 4DR6H 4JVYA 1SEIA 2FMRA 4JI4H 2M8WA 4JI3H 2CWFA 4JV5H 4X62H 4LF5H 2BA0A 1N33H 1IBMH 4JI6H 1J4WA 2HH3A 2MJHA 4NXNH 2CWHA 1VIHA 1X4NA 2BL5A 3KDGA 3AEVB 1VBIA 4WANA 3GR5A 3JAMW 4JI8H 1N36H 3EZJA 4DUYH 3T1HH 4NXMH 2JA9A 1X4MA 4DV3H 4B3SH 3L7ZC 1MSZA 3OETA 4B8TA 1AN7A 2UUBH 1IBKH 4LFAH 2CTFA 4JI0H 4FJSA 4B8CD 4LFCH 3NCVA 4H8AA 3OTOH 5LMUH 4DR5H 5FLXW 1I94H 2CTMA 1WVNA 2LRRA 2LTMA 4DR1H 2JEAI 4LF8H 2PT7G 1HNXH 3U1KA 1KHMA 2E3UA 4EC5A 5LMNH 2PQUA 4B3TH 1HNWH 2VQEH 3GKUA 4JI7H 1HNZH 1WE8A 2JZXA 2UUAH 5JEAG 4OX9H 2CTKA 3VKEA 1IBLH 2CTJA 4JI1H 4WALA 3RF2A 4E9JA 2CPQA 2OPVA 4NBQA 1ZZKA
chains in the Genus database with same CATH topology
1FKAH 4B3RH 3SB1A 4PDBA 1XNQH 4LF6H 2F4VH 4DV6H 1XMOH 4GKKH 4OCHA 5LL6b 2O4CA 2UUCH 4YY3H 4YHHH 1X9ZA 4X65H 4JI5H 4KHPH 5IT9W 4DV0H 2ZQEA 1XMQH 2VQFH 4DR4H 2E5LH 4GKJH 2LF0A 3J7AK 4LFBH 4B3MH 4X64H 4LF9H 3T1YH 1N32H 4NZRM 2HHHH 4DUZH 2Y3MA 4DR3H 2UXDH 4DR7H 5BR8H 3J81W 1N34H 4DV4H 4DV2H 2UXBH 4OD6A 5IWAH 1ODHA 1XNRH 4NZTM 1HR0H 4K0KH 4DV7H 3QD7X 3GABA 1S03G 3OSSD 4X66H 4G08A 5DT9A 1F0XA 2ZM6H 1J5EH 4JI2H 1FJGH 1I6UA 4DV5H 4LF7H 3FAUA 5A2QW 4JYAH 2FPHX 4DR2H 2UXCH 3KDKA 2VKCA 3J80W 2D9IA 4AQYH 4LF4H 2UU9H 4DR6H 4DV1H 1SEIA 4JI4H 4JI3H 4JV5H 4X62H 4LF5H 1N33H 1IBMH 4JI6H 4NXNH 3KDGA 3GR5A 3JAMW 4JI8H 1N36H 3EZJA 4DUYH 3T1HH 4NXMH 4DV3H 4B3SH 3OETA 1AN7A 2UUBH 1IBKH 4LFAH 4JI0H 4B8CD 4LFCH 3NCVA 3OTOH 5LMUH 4DR5H 1I94H 5FLXW 4DR1H 4LF8H 2PT7G 1HNXH 4EC5A 5LMNH 4B3TH 1HNWH 2VQEH 4JI7H 1HNZH 2UUAH 4OX9H 1IBLH 4JI1H 3RF2A 4E9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EC5 A;  3OSS D;  4E9J A;  3GR5 A;  4G08 A;  2Y3M A;  3EZJ A; 
#chains in the Genus database with same CATH topology
 1FKA H;  4B3R H;  3SB1 A;  3I0P A;  4PDB A;  1XNQ H;  3V69 A;  1ZTG A;  4OO1 G;  4LF6 H;  2F4V H;  4DV6 H;  4FJU A;  1XMO H;  4GKK H;  2AXY A;  4OCH A;  2JEB I;  5LL6 b;  2O4C A;  3UOE A;  1V9N A;  2UUC H;  4YY3 H;  1WTJ A;  4YHH H;  2CPM A;  1X9Z A;  4X65 H;  1V8C A;  4JI5 H;  1XRH A;  4KHP H;  5IT9 W;  1X0A A;  4DV0 H;  1DT4 A;  4BA1 I;  2ZQE A;  2Z0S A;  1XMQ H;  2A1S A;  2G8Y A;  2VQF H;  4DR4 H;  2JVZ A;  2E5L H;  2CTL A;  4GKJ H;  4BA2 I;  2LF0 A;  3J7A K;  2YQR A;  4AIM A;  2FFM A;  2HH2 A;  1K1G A;  4B3M H;  4LFB H;  1NXU A;  1TUA A;  2M6Q A;  4X64 H;  3T1Y H;  4LF9 H;  4AM3 A;  1N32 H;  5K36 G;  4NZR M;  2HHH H;  2NN6 G;  4DUZ H;  2X06 A;  2Y3M A;  4DR3 H;  1VIG A;  1Z2I A;  4DR7 H;  2UXD H;  5BR8 H;  3J81 W;  1N34 H;  2PY9 A;  4DV4 H;  4DV2 H;  2UXB H;  2K1H A;  4OD6 A;  5IWA H;  1ODH A;  1XNR H;  1EC6 A;  4NZT M;  1HR0 H;  1J5K A;  1WHR A;  4QMF B;  1S20 A;  2P2R A;  4K0K H;  4DV7 H;  3QD7 X;  3GAB A;  1S03 G;  1DTJ A;  3OSS D;  4X66 H;  1ZZI A;  4G08 A;  2JE6 I;  1F0X A;  5DT9 A;  2ZM6 H;  1J5E H;  1ZZJ A;  2ANR A;  4JI2 H;  1FJG H;  1I6U A;  4DV5 H;  4LF7 H;  4LIJ A;  2OPU A;  3FAU A;  5A2Q W;  4JYA H;  2FPH X;  4IFD G;  2DGR A;  1PQX A;  2LTL A;  3KDK A;  4DR2 H;  2UXC H;  2VKC A;  1UG8 A;  3J80 W;  2ANN A;  2D9I A;  2QND A;  4JVH A;  2CTE A;  4AQY H;  2UU9 H;  4LF4 H;  5C0X G;  4DV1 H;  4DR6 H;  4JVY A;  1SEI A;  2FMR A;  4JI4 H;  2M8W A;  4JI3 H;  2CWF A;  4JV5 H;  4X62 H;  4LF5 H;  2BA0 A;  1N33 H;  1IBM H;  4JI6 H;  1J4W A;  2HH3 A;  2MJH A;  4NXN H;  2CWH A;  1VIH A;  1X4N A;  2BL5 A;  3KDG A;  3AEV B;  1VBI A;  4WAN A;  3GR5 A;  3JAM W;  4JI8 H;  1N36 H;  3EZJ A;  4DUY H;  3T1H H;  4NXM H;  2JA9 A;  1X4M A;  4DV3 H;  4B3S H;  3L7Z C;  1MSZ A;  3OET A;  4B8T A;  1AN7 A;  2UUB H;  1IBK H;  4LFA H;  2CTF A;  4JI0 H;  4FJS A;  4B8C D;  4LFC H;  3NCV A;  4H8A A;  3OTO H;  5LMU H;  4DR5 H;  5FLX W;  1I94 H;  2CTM A;  1WVN A;  2LRR A;  2LTM A;  4DR1 H;  2JEA I;  4LF8 H;  2PT7 G;  1HNX H;  3U1K A;  1KHM A;  2E3U A;  4EC5 A;  5LMN H;  2PQU A;  4B3T H;  1HNW H;  2VQE H;  3GKU A;  4JI7 H;  1HNZ H;  1WE8 A;  2JZX A;  2UUA H;  5JEA G;  4OX9 H;  2CTK A;  3VKE A;  1IBL H;  2CTJ A;  4JI1 H;  4WAL A;  3RF2 A;  4E9J A;  2CPQ A;  2OPV A;  4NBQ A;  1ZZK A; 
#chains in the Genus database with same CATH homology
 1FKA H;  4B3R H;  3SB1 A;  4PDB A;  1XNQ H;  4LF6 H;  2F4V H;  4DV6 H;  1XMO H;  4GKK H;  4OCH A;  5LL6 b;  2O4C A;  2UUC H;  4YY3 H;  4YHH H;  1X9Z A;  4X65 H;  4JI5 H;  4KHP H;  5IT9 W;  4DV0 H;  2ZQE A;  1XMQ H;  2VQF H;  4DR4 H;  2E5L H;  4GKJ H;  2LF0 A;  3J7A K;  4LFB H;  4B3M H;  4X64 H;  4LF9 H;  3T1Y H;  1N32 H;  4NZR M;  2HHH H;  4DUZ H;  2Y3M A;  4DR3 H;  2UXD H;  4DR7 H;  5BR8 H;  3J81 W;  1N34 H;  4DV4 H;  4DV2 H;  2UXB H;  4OD6 A;  5IWA H;  1ODH A;  1XNR H;  4NZT M;  1HR0 H;  4K0K H;  4DV7 H;  3QD7 X;  3GAB A;  1S03 G;  3OSS D;  4X66 H;  4G08 A;  5DT9 A;  1F0X A;  2ZM6 H;  1J5E H;  4JI2 H;  1FJG H;  1I6U A;  4DV5 H;  4LF7 H;  3FAU A;  5A2Q W;  4JYA H;  2FPH X;  4DR2 H;  2UXC H;  3KDK A;  2VKC A;  3J80 W;  2D9I A;  4AQY H;  4LF4 H;  2UU9 H;  4DR6 H;  4DV1 H;  1SEI A;  4JI4 H;  4JI3 H;  4JV5 H;  4X62 H;  4LF5 H;  1N33 H;  1IBM H;  4JI6 H;  4NXN H;  3KDG A;  3GR5 A;  3JAM W;  4JI8 H;  1N36 H;  3EZJ A;  4DUY H;  3T1H H;  4NXM H;  4DV3 H;  4B3S H;  3OET A;  1AN7 A;  2UUB H;  1IBK H;  4LFA H;  4JI0 H;  4B8C D;  4LFC H;  3NCV A;  3OTO H;  5LMU H;  4DR5 H;  1I94 H;  5FLX W;  4DR1 H;  4LF8 H;  2PT7 G;  1HNX H;  4EC5 A;  5LMN H;  4B3T H;  1HNW H;  2VQE H;  4JI7 H;  1HNZ H;  2UUA H;  4OX9 H;  1IBL H;  4JI1 H;  3RF2 A;  4E9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...