4E9JA

Crystal structure of the n-terminal domain of the secretin xcpq from pseudomonas aeruginosa
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
233
structure length
217
Chain Sequence
AFVPAAHWTINLKDADIREFIDQISEITGETFVVDPRVKGQVSVVSKAQLSLSEVYQLFLSVMSTHGFTVVAQGDQARIVPNAAPDRLETRVIQVQQSPVSELIPLIRPLVPQYGHLAAVPSANALIISDRSANIARIEDVIRQLDQKGSHDYSVINLRYGWVMDAAEVLNNAMSRGQAKGAAGAQVIADARTNRLIILGPPQARAKLVQLAQSLDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Insights into the Assembly of Bacterial Secretins: STRUCTURAL STUDIES OF THE PERIPLASMIC DOMAIN OF XcpQ FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein transport
molecule keywords General secretion pathway protein D
total genus 59
structure length 217
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03958 Secretin_N Bacterial type II/III secretion system short domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4e9jA02
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4e9jA01
3GR5A 4E9JA 4EC5A 3OSSD 2Y3MA 4G08A 3EZJA
chains in the Genus database with same CATH superfamily
3GR5A 1KHMA 2LTMA 3T1HH 2OPUA 1HR0H 2O4CA 2UXDH 3T1YH 4JV5H 2PT7G 3L7ZC 4LF9H 2CWFA 2DGRA 2FPHX 2D9IA 4H8AA 4JI4H 4FJSA 1I94H 4JI5H 4AM3A 2CPMA 3SB1A 4DR4H 3J7AK 2JZXA 2M8WA 4OX9H 4JVYA 1X0AA 2UU9H 4YHHH 1VIGA 1NXUA 2NN6G 1I6UA 5LMNH 5C0XG 1IBKH 1J5KA 1ZZJA 4WALA 4LFCH 1FJGH 4QMFB 1IBLH 1S20A 2UUCH 1J4WA 2UUAH 4WANA 4B3MH 4K0KH 1V9NA 2FMRA 2CPQA 4JI2H 4BA1I 2QNDA 4B3SH 1X4NA 5K36G 2MJHA 1V8CA 2F4VH 5IWAH 1N36H 2PY9A 1XRHA 2CTFA 4DV1H 3U1KA 2CWHA 1DTJA 3OTOH 1UG8A 4AQYH 2LF0A 2CTEA 4LFAH 3EZJA 4B3RH 3NCVA 4DUZH 2Z0SA 2VQFH 1HNXH 1AN7A 2CTKA 2HH2A 2HH3A 4DR2H 5LMUH 3KDGA 4LF8H 2JVZA 4DR6H 1HNWH 2FFMA 4X65H 4LFBH 1WE8A 2CTJA 4DR1H 5IT9W 4NZTM 1WTJA 4DV3H 4EC5A 2BL5A 5DT9A 1S03G 4B8TA 1ODHA 4DUYH 3GKUA 2LRRA 1ZZIA 2ANNA 1XNRH 1XMQH 1X4MA 4NZRM 2BA0A 4DV4H 2HHHH 1X9ZA 2E5LH 2CTMA 2UUBH 3GABA 4DV5H 4FJUA 2VKCA 2AXYA 2M6QA 3JAMW 4OO1G 1F0XA 1VBIA 5FLXW 4E9JA 3AEVB 1Z2IA 3OETA 1EC6A 4DV6H 2VQEH 3J81W 4KHPH 2Y3MA 4DV7H 2E3UA 2UXBH 2LTLA 5A2QW 2X06A 4JI1H 2ZM6H 3I0PA 1N33H 3KDKA 1ZTGA 4GKJH 3V69A 4NXNH 4OD6A 1WHRA 1PQXA 2JE6I 2PQUA 2CTLA 3FAUA 4X62H 1K1GA 1IBMH 4B3TH 2OPVA 4JI6H 4LF7H 4PDBA 1N32H 4JI0H 1HNZH 4JVHA 4X66H 1VIHA 4AIMA 2P2RA 1DT4A 2UXCH 5BR8H 4JI8H 1WVNA 4LIJA 1MSZA 2JEAI 3QD7X 4NBQA 4DV2H 4LF5H 2YQRA 5LL6b 4IFDG 4OCHA 1ZZKA 4JYAH 2JA9A 1TUAA 4DR5H 3UOEA 3OSSD 4X64H 2ZQEA 5JEAG 4YY3H 2K1HA 2ANRA 1FKAH 2JEBI 3J80W 4DR3H 4BA2I 4G08A 4DV0H 2G8YA 1J5EH 4LF4H 1SEIA 4B8CD 4JI7H 4LF6H 2A1SA 4NXMH 3RF2A 1N34H 3VKEA 4JI3H 4DR7H 1XNQH 4GKKH 1XMOH
chains in the Genus database with same CATH topology
3GR5A 2UXDH 3T1HH 1HR0H 2O4CA 3T1YH 4JV5H 2PT7G 4LF9H 2FPHX 2D9IA 4JI4H 1I94H 4JI5H 4LFBH 4DR4H 3SB1A 3J7AK 4OX9H 2UU9H 4YHHH 1I6UA 5LMNH 1IBKH 4LFCH 1FJGH 1IBLH 2UUCH 2UUAH 4B3MH 4K0KH 4B3SH 4JI2H 2F4VH 5IWAH 1N36H 4DV1H 3OTOH 4AQYH 2LF0A 4LFAH 4B3RH 3EZJA 3NCVA 4DUZH 2VQFH 1HNXH 1AN7A 4DR2H 5LMUH 3KDGA 4LF8H 4DR6H 1HNWH 4X65H 4DR1H 5IT9W 4NZTM 4DV3H 4EC5A 5DT9A 1S03G 1ODHA 4DUYH 1XNRH 1XMQH 4NZRM 4DV4H 2HHHH 1X9ZA 2E5LH 2UUBH 3GABA 4DV5H 2VKCA 3JAMW 5FLXW 1F0XA 4E9JA 3OETA 4DV6H 2VQEH 3J81W 4KHPH 2Y3MA 4DV7H 2UXBH 5A2QW 4JI1H 2ZM6H 1N33H 3KDKA 4GKJH 4NXNH 4OD6A 3FAUA 4X62H 1IBMH 4B3TH 4JI6H 4PDBA 4LF7H 1N32H 4JI0H 1HNZH 4X66H 2UXCH 5BR8H 4JI8H 3QD7X 4DV2H 4LF5H 5LL6b 4OCHA 4JYAH 4DR5H 3OSSD 4X64H 2ZQEA 4YY3H 1FKAH 3J80W 4DR3H 4G08A 4DV0H 1J5EH 4LF4H 1SEIA 4B8CD 4JI7H 4LF6H 4NXMH 3RF2A 1N34H 4JI3H 4DR7H 1XNQH 4GKKH 1XMOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GR5 A;  4E9J A;  4EC5 A;  3OSS D;  2Y3M A;  4G08 A;  3EZJ A; 
#chains in the Genus database with same CATH topology
 3GR5 A;  1KHM A;  2LTM A;  3T1H H;  2OPU A;  1HR0 H;  2O4C A;  2UXD H;  3T1Y H;  4JV5 H;  2PT7 G;  3L7Z C;  4LF9 H;  2CWF A;  2DGR A;  2FPH X;  2D9I A;  4H8A A;  4JI4 H;  4FJS A;  1I94 H;  4JI5 H;  4AM3 A;  2CPM A;  3SB1 A;  4DR4 H;  3J7A K;  2JZX A;  2M8W A;  4OX9 H;  4JVY A;  1X0A A;  2UU9 H;  4YHH H;  1VIG A;  1NXU A;  2NN6 G;  1I6U A;  5LMN H;  5C0X G;  1IBK H;  1J5K A;  1ZZJ A;  4WAL A;  4LFC H;  1FJG H;  4QMF B;  1IBL H;  1S20 A;  2UUC H;  1J4W A;  2UUA H;  4WAN A;  4B3M H;  4K0K H;  1V9N A;  2FMR A;  2CPQ A;  4JI2 H;  4BA1 I;  2QND A;  4B3S H;  1X4N A;  5K36 G;  2MJH A;  1V8C A;  2F4V H;  5IWA H;  1N36 H;  2PY9 A;  1XRH A;  2CTF A;  4DV1 H;  3U1K A;  2CWH A;  1DTJ A;  3OTO H;  1UG8 A;  4AQY H;  2LF0 A;  2CTE A;  4LFA H;  3EZJ A;  4B3R H;  3NCV A;  4DUZ H;  2Z0S A;  2VQF H;  1HNX H;  1AN7 A;  2CTK A;  2HH2 A;  2HH3 A;  4DR2 H;  5LMU H;  3KDG A;  4LF8 H;  2JVZ A;  4DR6 H;  1HNW H;  2FFM A;  4X65 H;  4LFB H;  1WE8 A;  2CTJ A;  4DR1 H;  5IT9 W;  4NZT M;  1WTJ A;  4DV3 H;  4EC5 A;  2BL5 A;  5DT9 A;  1S03 G;  4B8T A;  1ODH A;  4DUY H;  3GKU A;  2LRR A;  1ZZI A;  2ANN A;  1XNR H;  1XMQ H;  1X4M A;  4NZR M;  2BA0 A;  4DV4 H;  2HHH H;  1X9Z A;  2E5L H;  2CTM A;  2UUB H;  3GAB A;  4DV5 H;  4FJU A;  2VKC A;  2AXY A;  2M6Q A;  3JAM W;  4OO1 G;  1F0X A;  1VBI A;  5FLX W;  4E9J A;  3AEV B;  1Z2I A;  3OET A;  1EC6 A;  4DV6 H;  2VQE H;  3J81 W;  4KHP H;  2Y3M A;  4DV7 H;  2E3U A;  2UXB H;  2LTL A;  5A2Q W;  2X06 A;  4JI1 H;  2ZM6 H;  3I0P A;  1N33 H;  3KDK A;  1ZTG A;  4GKJ H;  3V69 A;  4NXN H;  4OD6 A;  1WHR A;  1PQX A;  2JE6 I;  2PQU A;  2CTL A;  3FAU A;  4X62 H;  1K1G A;  1IBM H;  4B3T H;  2OPV A;  4JI6 H;  4LF7 H;  4PDB A;  1N32 H;  4JI0 H;  1HNZ H;  4JVH A;  4X66 H;  1VIH A;  4AIM A;  2P2R A;  1DT4 A;  2UXC H;  5BR8 H;  4JI8 H;  1WVN A;  4LIJ A;  1MSZ A;  2JEA I;  3QD7 X;  4NBQ A;  4DV2 H;  4LF5 H;  2YQR A;  5LL6 b;  4IFD G;  4OCH A;  1ZZK A;  4JYA H;  2JA9 A;  1TUA A;  4DR5 H;  3UOE A;  3OSS D;  4X64 H;  2ZQE A;  5JEA G;  4YY3 H;  2K1H A;  2ANR A;  1FKA H;  2JEB I;  3J80 W;  4DR3 H;  4BA2 I;  4G08 A;  4DV0 H;  2G8Y A;  1J5E H;  4LF4 H;  1SEI A;  4B8C D;  4JI7 H;  4LF6 H;  2A1S A;  4NXM H;  3RF2 A;  1N34 H;  3VKE A;  4JI3 H;  4DR7 H;  1XNQ H;  4GKK H;  1XMO H; 
#chains in the Genus database with same CATH homology
 3GR5 A;  2UXD H;  3T1H H;  1HR0 H;  2O4C A;  3T1Y H;  4JV5 H;  2PT7 G;  4LF9 H;  2FPH X;  2D9I A;  4JI4 H;  1I94 H;  4JI5 H;  4LFB H;  4DR4 H;  3SB1 A;  3J7A K;  4OX9 H;  2UU9 H;  4YHH H;  1I6U A;  5LMN H;  1IBK H;  4LFC H;  1FJG H;  1IBL H;  2UUC H;  2UUA H;  4B3M H;  4K0K H;  4B3S H;  4JI2 H;  2F4V H;  5IWA H;  1N36 H;  4DV1 H;  3OTO H;  4AQY H;  2LF0 A;  4LFA H;  4B3R H;  3EZJ A;  3NCV A;  4DUZ H;  2VQF H;  1HNX H;  1AN7 A;  4DR2 H;  5LMU H;  3KDG A;  4LF8 H;  4DR6 H;  1HNW H;  4X65 H;  4DR1 H;  5IT9 W;  4NZT M;  4DV3 H;  4EC5 A;  5DT9 A;  1S03 G;  1ODH A;  4DUY H;  1XNR H;  1XMQ H;  4NZR M;  4DV4 H;  2HHH H;  1X9Z A;  2E5L H;  2UUB H;  3GAB A;  4DV5 H;  2VKC A;  3JAM W;  5FLX W;  1F0X A;  4E9J A;  3OET A;  4DV6 H;  2VQE H;  3J81 W;  4KHP H;  2Y3M A;  4DV7 H;  2UXB H;  5A2Q W;  4JI1 H;  2ZM6 H;  1N33 H;  3KDK A;  4GKJ H;  4NXN H;  4OD6 A;  3FAU A;  4X62 H;  1IBM H;  4B3T H;  4JI6 H;  4PDB A;  4LF7 H;  1N32 H;  4JI0 H;  1HNZ H;  4X66 H;  2UXC H;  5BR8 H;  4JI8 H;  3QD7 X;  4DV2 H;  4LF5 H;  5LL6 b;  4OCH A;  4JYA H;  4DR5 H;  3OSS D;  4X64 H;  2ZQE A;  4YY3 H;  1FKA H;  3J80 W;  4DR3 H;  4G08 A;  4DV0 H;  1J5E H;  4LF4 H;  1SEI A;  4B8C D;  4JI7 H;  4LF6 H;  4NXM H;  3RF2 A;  1N34 H;  4JI3 H;  4DR7 H;  1XNQ H;  4GKK H;  1XMO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...