4E9JA

Crystal structure of the n-terminal domain of the secretin xcpq from pseudomonas aeruginosa
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
233
structure length
217
Chain Sequence
AFVPAAHWTINLKDADIREFIDQISEITGETFVVDPRVKGQVSVVSKAQLSLSEVYQLFLSVMSTHGFTVVAQGDQARIVPNAAPDRLETRVIQVQQSPVSELIPLIRPLVPQYGHLAAVPSANALIISDRSANIARIEDVIRQLDQKGSHDYSVINLRYGWVMDAAEVLNNAMSRGQAKGAAGAQVIADARTNRLIILGPPQARAKLVQLAQSLDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General secretion pathway protein D
publication title New Insights into the Assembly of Bacterial Secretins: STRUCTURAL STUDIES OF THE PERIPLASMIC DOMAIN OF XcpQ FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein transport
total genus 59
structure length 217
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03958 Secretin_N Bacterial type II/III secretion system short domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4e9jA02
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4e9jA01
2Y3MA 4G08A 4E9JA 3OSSD 3EZJA 4EC5A 3GR5A
chains in the Genus database with same CATH superfamily
1IBKH 3AEVB 2NN6G 2ZM6H 4DV6H 3I0PA 4GKJH 1XRHA 2Z0SA 4QMFB 1ZZKA 4AM3A 1X9ZA 4B3MH 1N36H 1X0AA 4OCHA 3OSSD 2FFMA 4H8AA 1X4MA 4KHPH 2K1HA 2UUAH 1NXUA 1HNZH 4LF7H 4PDBA 3RF2A 1ZZJA 2E5LH 1S20A 4OD6A 4DR6H 4B3TH 3GKUA 5LL6b 4LFBH 1I94H 2OPVA 1DT4A 1UG8A 3V69A 4X66H 2F4VH 2JVZA 1XNQH 2VQFH 4WANA 2DGRA 4DV7H 5DT9A 4B8TA 2UUCH 4DUYH 4B8CD 4JI0H 1EC6A 2BA0A 1HNWH 2PQUA 2QNDA 1ODHA 1VIGA 1WHRA 4B3SH 2JZXA 1HNXH 4JI2H 3OTOH 3J80W 3GR5A 3KDKA 2A1SA 2O4CA 2YQRA 1ZZIA 1XMOH 4OX9H 2CTLA 4DR4H 1Z2IA 2JEAI 4K0KH 2HHHH 1AN7A 2HH3A 4DR1H 1V8CA 2PY9A 1J5EH 5LMUH 1IBMH 4DR7H 3OETA 1F0XA 2OPUA 3SB1A 4DV1H 4GKKH 3FAUA 2ANNA 4DV2H 2PT7G 1KHMA 4LF9H 5LMNH 4LF8H 1XNRH 5K36G 2CTEA 4NZRM 1I6UA 4BA1I 1SEIA 4IFDG 2MJHA 2X06A 1N34H 4DV3H 4NXMH 1MSZA 2CPMA 4LIJA 2AXYA 3GABA 4JYAH 3J7AK 5IT9W 2CWFA 4JVYA 4JI4H 2P2RA 4E9JA 4DR5H 1N32H 4X65H 2CPQA 2VQEH 3QD7X 2UXCH 1WTJA 4JI5H 1WVNA 4NXNH 2HH2A 4BA2I 2M8WA 1VBIA 4X64H 4JI8H 5C0XG 3J81W 2JE6I 4AQYH 4JI3H 1X4NA 4JI7H 4YY3H 1XMQH 1TUAA 4G08A 2CTFA 4B3RH 2UXBH 1ZTGA 4FJSA 4EC5A 1S03G 2CTJA 3NCVA 1FKAH 2LRRA 3U1KA 4NBQA 3KDGA 1K1GA 4JI1H 2FMRA 4DR3H 5IWAH 4DUZH 2Y3MA 2ANRA 2G8YA 1N33H 2BL5A 1J4WA 2LTMA 3EZJA 4LFCH 5FLXW 4OO1G 2FPHX 2JA9A 1V9NA 4FJUA 2D9IA 5A2QW 5JEAG 4DV0H 4DR2H 4LF6H 4JI6H 4DV5H 2UU9H 3UOEA 4JVHA 2CWHA 2LTLA 1VIHA 3L7ZC 2UUBH 2UXDH 1FJGH 2JEBI 1DTJA 4DV4H 4LF5H 4JV5H 1WE8A 4NZTM 3T1HH 2ZQEA 2CTMA 2LF0A 3JAMW 4YHHH 2VKCA 1IBLH 1HR0H 4LFAH 4LF4H 4WALA 2E3UA 3T1YH 1PQXA 1J5KA 4AIMA 2CTKA 2M6QA 4X62H 5BR8H 3VKEA
chains in the Genus database with same CATH topology
1IBKH 2ZM6H 4DV6H 4GKJH 1X9ZA 4B3MH 1N36H 4OCHA 3OSSD 4KHPH 2UUAH 1HNZH 4LF7H 4PDBA 3RF2A 2E5LH 4OD6A 4DR6H 4B3TH 5LL6b 4LFBH 1I94H 4X66H 2F4VH 1XNQH 2VQFH 4DV7H 2UUCH 5DT9A 4JI0H 4DUYH 4B8CD 1HNWH 1ODHA 4B3SH 1HNXH 4JI2H 3OTOH 3J80W 3GR5A 3KDKA 2O4CA 4K0KH 1XMOH 4OX9H 4DR4H 2HHHH 1AN7A 4DR1H 1J5EH 5LMUH 1IBMH 4DR7H 3OETA 1F0XA 3SB1A 4DV1H 4GKKH 3FAUA 4DV2H 2PT7G 4LF9H 5LMNH 4LF8H 1XNRH 4NZRM 1I6UA 1SEIA 4NXMH 1N34H 4DV3H 3GABA 4JYAH 3J7AK 5IT9W 4JI4H 4E9JA 4DR5H 1N32H 4X65H 2VQEH 3QD7X 2UXCH 4JI5H 4NXNH 4X64H 4JI8H 3J81W 4AQYH 4JI3H 4JI7H 4YY3H 1XMQH 4G08A 4B3RH 2UXBH 4EC5A 1S03G 3NCVA 1FKAH 3KDGA 4JI1H 4DR3H 5IWAH 4DUZH 2Y3MA 1N33H 4LFCH 3EZJA 5FLXW 2FPHX 4DV0H 4DR2H 2D9IA 5A2QW 4LF6H 4JI6H 4DV5H 2UU9H 2UXDH 2UUBH 1FJGH 4LF5H 4DV4H 4JV5H 4NZTM 3T1HH 2ZQEA 2LF0A 3JAMW 4YHHH 2VKCA 1IBLH 1HR0H 4LFAH 4LF4H 3T1YH 4X62H 5BR8H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y3M A;  4G08 A;  4E9J A;  3OSS D;  3EZJ A;  4EC5 A;  3GR5 A; 
#chains in the Genus database with same CATH topology
 1IBK H;  3AEV B;  2NN6 G;  2ZM6 H;  4DV6 H;  3I0P A;  4GKJ H;  1XRH A;  2Z0S A;  4QMF B;  1ZZK A;  4AM3 A;  1X9Z A;  4B3M H;  1N36 H;  1X0A A;  4OCH A;  3OSS D;  2FFM A;  4H8A A;  1X4M A;  4KHP H;  2K1H A;  2UUA H;  1NXU A;  1HNZ H;  4LF7 H;  4PDB A;  3RF2 A;  1ZZJ A;  2E5L H;  1S20 A;  4OD6 A;  4DR6 H;  4B3T H;  3GKU A;  5LL6 b;  4LFB H;  1I94 H;  2OPV A;  1DT4 A;  1UG8 A;  3V69 A;  4X66 H;  2F4V H;  2JVZ A;  1XNQ H;  2VQF H;  4WAN A;  2DGR A;  4DV7 H;  5DT9 A;  4B8T A;  2UUC H;  4DUY H;  4B8C D;  4JI0 H;  1EC6 A;  2BA0 A;  1HNW H;  2PQU A;  2QND A;  1ODH A;  1VIG A;  1WHR A;  4B3S H;  2JZX A;  1HNX H;  4JI2 H;  3OTO H;  3J80 W;  3GR5 A;  3KDK A;  2A1S A;  2O4C A;  2YQR A;  1ZZI A;  1XMO H;  4OX9 H;  2CTL A;  4DR4 H;  1Z2I A;  2JEA I;  4K0K H;  2HHH H;  1AN7 A;  2HH3 A;  4DR1 H;  1V8C A;  2PY9 A;  1J5E H;  5LMU H;  1IBM H;  4DR7 H;  3OET A;  1F0X A;  2OPU A;  3SB1 A;  4DV1 H;  4GKK H;  3FAU A;  2ANN A;  4DV2 H;  2PT7 G;  1KHM A;  4LF9 H;  5LMN H;  4LF8 H;  1XNR H;  5K36 G;  2CTE A;  4NZR M;  1I6U A;  4BA1 I;  1SEI A;  4IFD G;  2MJH A;  2X06 A;  1N34 H;  4DV3 H;  4NXM H;  1MSZ A;  2CPM A;  4LIJ A;  2AXY A;  3GAB A;  4JYA H;  3J7A K;  5IT9 W;  2CWF A;  4JVY A;  4JI4 H;  2P2R A;  4E9J A;  4DR5 H;  1N32 H;  4X65 H;  2CPQ A;  2VQE H;  3QD7 X;  2UXC H;  1WTJ A;  4JI5 H;  1WVN A;  4NXN H;  2HH2 A;  4BA2 I;  2M8W A;  1VBI A;  4X64 H;  4JI8 H;  5C0X G;  3J81 W;  2JE6 I;  4AQY H;  4JI3 H;  1X4N A;  4JI7 H;  4YY3 H;  1XMQ H;  1TUA A;  4G08 A;  2CTF A;  4B3R H;  2UXB H;  1ZTG A;  4FJS A;  4EC5 A;  1S03 G;  2CTJ A;  3NCV A;  1FKA H;  2LRR A;  3U1K A;  4NBQ A;  3KDG A;  1K1G A;  4JI1 H;  2FMR A;  4DR3 H;  5IWA H;  4DUZ H;  2Y3M A;  2ANR A;  2G8Y A;  1N33 H;  2BL5 A;  1J4W A;  2LTM A;  3EZJ A;  4LFC H;  5FLX W;  4OO1 G;  2FPH X;  2JA9 A;  1V9N A;  4FJU A;  2D9I A;  5A2Q W;  5JEA G;  4DV0 H;  4DR2 H;  4LF6 H;  4JI6 H;  4DV5 H;  2UU9 H;  3UOE A;  4JVH A;  2CWH A;  2LTL A;  1VIH A;  3L7Z C;  2UUB H;  2UXD H;  1FJG H;  2JEB I;  1DTJ A;  4DV4 H;  4LF5 H;  4JV5 H;  1WE8 A;  4NZT M;  3T1H H;  2ZQE A;  2CTM A;  2LF0 A;  3JAM W;  4YHH H;  2VKC A;  1IBL H;  1HR0 H;  4LFA H;  4LF4 H;  4WAL A;  2E3U A;  3T1Y H;  1PQX A;  1J5K A;  4AIM A;  2CTK A;  2M6Q A;  4X62 H;  5BR8 H;  3VKE A; 
#chains in the Genus database with same CATH homology
 1IBK H;  2ZM6 H;  4DV6 H;  4GKJ H;  1X9Z A;  4B3M H;  1N36 H;  4OCH A;  3OSS D;  4KHP H;  2UUA H;  1HNZ H;  4LF7 H;  4PDB A;  3RF2 A;  2E5L H;  4OD6 A;  4DR6 H;  4B3T H;  5LL6 b;  4LFB H;  1I94 H;  4X66 H;  2F4V H;  1XNQ H;  2VQF H;  4DV7 H;  2UUC H;  5DT9 A;  4JI0 H;  4DUY H;  4B8C D;  1HNW H;  1ODH A;  4B3S H;  1HNX H;  4JI2 H;  3OTO H;  3J80 W;  3GR5 A;  3KDK A;  2O4C A;  4K0K H;  1XMO H;  4OX9 H;  4DR4 H;  2HHH H;  1AN7 A;  4DR1 H;  1J5E H;  5LMU H;  1IBM H;  4DR7 H;  3OET A;  1F0X A;  3SB1 A;  4DV1 H;  4GKK H;  3FAU A;  4DV2 H;  2PT7 G;  4LF9 H;  5LMN H;  4LF8 H;  1XNR H;  4NZR M;  1I6U A;  1SEI A;  4NXM H;  1N34 H;  4DV3 H;  3GAB A;  4JYA H;  3J7A K;  5IT9 W;  4JI4 H;  4E9J A;  4DR5 H;  1N32 H;  4X65 H;  2VQE H;  3QD7 X;  2UXC H;  4JI5 H;  4NXN H;  4X64 H;  4JI8 H;  3J81 W;  4AQY H;  4JI3 H;  4JI7 H;  4YY3 H;  1XMQ H;  4G08 A;  4B3R H;  2UXB H;  4EC5 A;  1S03 G;  3NCV A;  1FKA H;  3KDG A;  4JI1 H;  4DR3 H;  5IWA H;  4DUZ H;  2Y3M A;  1N33 H;  4LFC H;  3EZJ A;  5FLX W;  2FPH X;  4DV0 H;  4DR2 H;  2D9I A;  5A2Q W;  4LF6 H;  4JI6 H;  4DV5 H;  2UU9 H;  2UXD H;  2UUB H;  1FJG H;  4LF5 H;  4DV4 H;  4JV5 H;  4NZT M;  3T1H H;  2ZQE A;  2LF0 A;  3JAM W;  4YHH H;  2VKC A;  1IBL H;  1HR0 H;  4LFA H;  4LF4 H;  3T1Y H;  4X62 H;  5BR8 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...