4E9JA

Crystal structure of the n-terminal domain of the secretin xcpq from pseudomonas aeruginosa
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
233
structure length
217
Chain Sequence
b'AFVPAAHWTINLKDADIREFIDQISEITGETFVVDPRVKGQVSVVSKAQLSLSEVYQLFLSVMSTHGFTVVAQGDQARIVPNAAPDRLETRVIQVQQSPVSELIPLIRPLVPQYGHLAAVPSANALIISDRSANIARIEDVIRQLDQKGSHDYSVINLRYGWVMDAAEVLNNAMSRGQAKGAAGAQVIADARTNRLIILGPPQARAKLVQLAQSLDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General secretion pathway protein D
publication title New Insights into the Assembly of Bacterial Secretins: STRUCTURAL STUDIES OF THE PERIPLASMIC DOMAIN OF XcpQ FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein transport
total genus 59
structure length 217
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03958 Secretin_N Bacterial type II/III secretion system short domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4e9jA02
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4e9jA01
4EC5A 3GR5A 3OSSD 3EZJA 4E9JA 2Y3MA 4G08A
chains in the Genus database with same CATH superfamily
2M6QA 2P2RA 3GR5A 5DT9A 1X0AA 4B3RH 1VBIA 4AM3A 1XRHA 4X65H 4DR7H 4PDBA 1HNXH 1I94H 4B3SH 1XMOH 2JA9A 5A2QW 1HNZH 2A1SA 3UOEA 4OD6A 4DV3H 4DV5H 4JI5H 4LF8H 1HR0H 2D9IA 1XMQH 4BA1I 4WANA 2VQEH 4DR5H 5LL6b 4DV6H 1WTJA 3QD7X 4LF7H 3J7AK 2PQUA 1V9NA 2CWHA 2YQRA 4B3TH 2HHHH 4DV1H 1WE8A 1WHRA 4LFCH 4WALA 4GKJH 1XNRH 1N32H 2LF0A 4K0KH 2UXDH 4EC5A 3RF2A 2HH3A 2HH2A 4LF9H 4YY3H 4LFAH 1EC6A 1SEIA 4G08A 5LMUH 2NN6G 4YHHH 4NZTM 3EZJA 2Z0SA 2UUCH 3KDKA 1K1GA 2CTEA 2M8WA 2E5LH 1NXUA 3U1KA 3GKUA 3J81W 4DUYH 4JI0H 4NXMH 2BA0A 4LF5H 2VKCA 2JVZA 2X06A 4JI3H 2CPQA 5C0XG 4JV5H 4DR3H 1TUAA 3OETA 2MJHA 4JI4H 1AN7A 5BR8H 2JEBI 2VQFH 4DV0H 1ZZJA 2UUAH 1VIHA 1S20A 4DR1H 1IBKH 2JZXA 3OTOH 2ANRA 1I6UA 2OPVA 3NCVA 4AQYH 4E9JA 2OPUA 5IWAH 4FJUA 4X64H 1N34H 2UXCH 2G8YA 5IT9W 2O4CA 5JEAG 3GABA 2LTLA 4FJSA 4DR2H 1PQXA 1J5KA 2CTMA 1X4NA 4JI2H 4NBQA 4B8TA 1ODHA 1J4WA 4B3MH 4JI1H 2Y3MA 2F4VH 1WVNA 3AEVB 1VIGA 2CWFA 1IBLH 2JEAI 4BA2I 2CTLA 4DV2H 4JI8H 3SB1A 2LTMA 3JAMW 2CTJA 2CPMA 3VKEA 4JI7H 2PY9A 1F0XA 3T1YH 4H8AA 4DUZH 1KHMA 1DTJA 2CTKA 2AXYA 2E3UA 5LMNH 2FPHX 2PT7G 4GKKH 2BL5A 4DV7H 2UUBH 1N33H 2DGRA 1J5EH 2FFMA 1X4MA 2ZQEA 4B8CD 4KHPH 4QMFB 1MSZA 2UU9H 1XNQH 4JVHA 3L7ZC 5FLXW 3V69A 2FMRA 4IFDG 4OX9H 4X66H 2ANNA 1S03G 4OO1G 4NZRM 1V8CA 1ZZIA 3KDGA 2CTFA 1N36H 2K1HA 1FKAH 4DV4H 3FAUA 4LFBH 3OSSD 1ZZKA 1Z2IA 2LRRA 4OCHA 1IBMH 3I0PA 2ZM6H 1HNWH 1UG8A 4LF4H 4LIJA 2JE6I 4JYAH 1ZTGA 2UXBH 4DR6H 5K36G 3T1HH 4X62H 4JVYA 4AIMA 3J80W 4LF6H 1FJGH 4DR4H 1DT4A 4JI6H 4NXNH 1X9ZA 2QNDA
chains in the Genus database with same CATH topology
3GR5A 5DT9A 4B3RH 4X65H 4DR7H 4PDBA 1HNXH 1I94H 4B3SH 1XMOH 5A2QW 1HNZH 4LF8H 4DV5H 4OD6A 4DV3H 4JI5H 1HR0H 2D9IA 1XMQH 2VQEH 4DR5H 5LL6b 4DV6H 3QD7X 4LF7H 3J7AK 4B3TH 2HHHH 4DV1H 1N32H 4LFCH 4GKJH 1XNRH 4K0KH 2UXDH 4EC5A 3RF2A 1X9ZA 4LF9H 4YY3H 4LFAH 1SEIA 4G08A 5LMUH 4YHHH 4NZTM 3EZJA 2UUCH 3KDKA 2E5LH 3J81W 4JI0H 4DUYH 4NXMH 4LF5H 2VKCA 4JI3H 4JV5H 4DR3H 3OETA 4JI4H 1AN7A 5BR8H 2VQFH 4DV0H 2UUAH 4DR1H 1IBKH 3OTOH 1I6UA 3NCVA 4AQYH 4E9JA 5IWAH 4X64H 1N34H 2UXCH 5IT9W 2O4CA 3GABA 4DR2H 4JI2H 1ODHA 4JI1H 4B3MH 2Y3MA 2F4VH 1IBLH 4DV2H 4JI8H 3SB1A 3JAMW 4JI7H 1F0XA 3T1YH 5LMNH 2FPHX 2PT7G 4GKKH 4DV7H 2UUBH 1N33H 1J5EH 2ZQEA 4B8CD 4KHPH 2UU9H 1XNQH 5FLXW 4OX9H 4X66H 1S03G 4NZRM 3KDGA 1N36H 1FKAH 4DV4H 3FAUA 4LFBH 3OSSD 4OCHA 1IBMH 2ZM6H 1HNWH 2UXBH 4LF4H 4JYAH 4DR6H 3T1HH 4X62H 3J80W 4LF6H 1FJGH 4DR4H 4JI6H 4NXNH 4DUZH 2LF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EC5 A;  3GR5 A;  3OSS D;  3EZJ A;  4E9J A;  2Y3M A;  4G08 A; 
#chains in the Genus database with same CATH topology
 2M6Q A;  2P2R A;  3GR5 A;  5DT9 A;  1X0A A;  4B3R H;  1VBI A;  4AM3 A;  1XRH A;  4X65 H;  4DR7 H;  4PDB A;  1HNX H;  1I94 H;  4B3S H;  1XMO H;  2JA9 A;  5A2Q W;  1HNZ H;  2A1S A;  3UOE A;  4OD6 A;  4DV3 H;  4DV5 H;  4JI5 H;  4LF8 H;  1HR0 H;  2D9I A;  1XMQ H;  4BA1 I;  4WAN A;  2VQE H;  4DR5 H;  5LL6 b;  4DV6 H;  1WTJ A;  3QD7 X;  4LF7 H;  3J7A K;  2PQU A;  1V9N A;  2CWH A;  2YQR A;  4B3T H;  2HHH H;  4DV1 H;  1WE8 A;  1WHR A;  4LFC H;  4WAL A;  4GKJ H;  1XNR H;  1N32 H;  2LF0 A;  4K0K H;  2UXD H;  4EC5 A;  3RF2 A;  2HH3 A;  2HH2 A;  4LF9 H;  4YY3 H;  4LFA H;  1EC6 A;  1SEI A;  4G08 A;  5LMU H;  2NN6 G;  4YHH H;  4NZT M;  3EZJ A;  2Z0S A;  2UUC H;  3KDK A;  1K1G A;  2CTE A;  2M8W A;  2E5L H;  1NXU A;  3U1K A;  3GKU A;  3J81 W;  4DUY H;  4JI0 H;  4NXM H;  2BA0 A;  4LF5 H;  2VKC A;  2JVZ A;  2X06 A;  4JI3 H;  2CPQ A;  5C0X G;  4JV5 H;  4DR3 H;  1TUA A;  3OET A;  2MJH A;  4JI4 H;  1AN7 A;  5BR8 H;  2JEB I;  2VQF H;  4DV0 H;  1ZZJ A;  2UUA H;  1VIH A;  1S20 A;  4DR1 H;  1IBK H;  2JZX A;  3OTO H;  2ANR A;  1I6U A;  2OPV A;  3NCV A;  4AQY H;  4E9J A;  2OPU A;  5IWA H;  4FJU A;  4X64 H;  1N34 H;  2UXC H;  2G8Y A;  5IT9 W;  2O4C A;  5JEA G;  3GAB A;  2LTL A;  4FJS A;  4DR2 H;  1PQX A;  1J5K A;  2CTM A;  1X4N A;  4JI2 H;  4NBQ A;  4B8T A;  1ODH A;  1J4W A;  4B3M H;  4JI1 H;  2Y3M A;  2F4V H;  1WVN A;  3AEV B;  1VIG A;  2CWF A;  1IBL H;  2JEA I;  4BA2 I;  2CTL A;  4DV2 H;  4JI8 H;  3SB1 A;  2LTM A;  3JAM W;  2CTJ A;  2CPM A;  3VKE A;  4JI7 H;  2PY9 A;  1F0X A;  3T1Y H;  4H8A A;  4DUZ H;  1KHM A;  1DTJ A;  2CTK A;  2AXY A;  2E3U A;  5LMN H;  2FPH X;  2PT7 G;  4GKK H;  2BL5 A;  4DV7 H;  2UUB H;  1N33 H;  2DGR A;  1J5E H;  2FFM A;  1X4M A;  2ZQE A;  4B8C D;  4KHP H;  4QMF B;  1MSZ A;  2UU9 H;  1XNQ H;  4JVH A;  3L7Z C;  5FLX W;  3V69 A;  2FMR A;  4IFD G;  4OX9 H;  4X66 H;  2ANN A;  1S03 G;  4OO1 G;  4NZR M;  1V8C A;  1ZZI A;  3KDG A;  2CTF A;  1N36 H;  2K1H A;  1FKA H;  4DV4 H;  3FAU A;  4LFB H;  3OSS D;  1ZZK A;  1Z2I A;  2LRR A;  4OCH A;  1IBM H;  3I0P A;  2ZM6 H;  1HNW H;  1UG8 A;  4LF4 H;  4LIJ A;  2JE6 I;  4JYA H;  1ZTG A;  2UXB H;  4DR6 H;  5K36 G;  3T1H H;  4X62 H;  4JVY A;  4AIM A;  3J80 W;  4LF6 H;  1FJG H;  4DR4 H;  1DT4 A;  4JI6 H;  4NXN H;  1X9Z A;  2QND A; 
#chains in the Genus database with same CATH homology
 3GR5 A;  5DT9 A;  4B3R H;  4X65 H;  4DR7 H;  4PDB A;  1HNX H;  1I94 H;  4B3S H;  1XMO H;  5A2Q W;  1HNZ H;  4LF8 H;  4DV5 H;  4OD6 A;  4DV3 H;  4JI5 H;  1HR0 H;  2D9I A;  1XMQ H;  2VQE H;  4DR5 H;  5LL6 b;  4DV6 H;  3QD7 X;  4LF7 H;  3J7A K;  4B3T H;  2HHH H;  4DV1 H;  1N32 H;  4LFC H;  4GKJ H;  1XNR H;  4K0K H;  2UXD H;  4EC5 A;  3RF2 A;  1X9Z A;  4LF9 H;  4YY3 H;  4LFA H;  1SEI A;  4G08 A;  5LMU H;  4YHH H;  4NZT M;  3EZJ A;  2UUC H;  3KDK A;  2E5L H;  3J81 W;  4JI0 H;  4DUY H;  4NXM H;  4LF5 H;  2VKC A;  4JI3 H;  4JV5 H;  4DR3 H;  3OET A;  4JI4 H;  1AN7 A;  5BR8 H;  2VQF H;  4DV0 H;  2UUA H;  4DR1 H;  1IBK H;  3OTO H;  1I6U A;  3NCV A;  4AQY H;  4E9J A;  5IWA H;  4X64 H;  1N34 H;  2UXC H;  5IT9 W;  2O4C A;  3GAB A;  4DR2 H;  4JI2 H;  1ODH A;  4JI1 H;  4B3M H;  2Y3M A;  2F4V H;  1IBL H;  4DV2 H;  4JI8 H;  3SB1 A;  3JAM W;  4JI7 H;  1F0X A;  3T1Y H;  5LMN H;  2FPH X;  2PT7 G;  4GKK H;  4DV7 H;  2UUB H;  1N33 H;  1J5E H;  2ZQE A;  4B8C D;  4KHP H;  2UU9 H;  1XNQ H;  5FLX W;  4OX9 H;  4X66 H;  1S03 G;  4NZR M;  3KDG A;  1N36 H;  1FKA H;  4DV4 H;  3FAU A;  4LFB H;  3OSS D;  4OCH A;  1IBM H;  2ZM6 H;  1HNW H;  2UXB H;  4LF4 H;  4JYA H;  4DR6 H;  3T1H H;  4X62 H;  3J80 W;  4LF6 H;  1FJG H;  4DR4 H;  4JI6 H;  4NXN H;  4DUZ H;  2LF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...