4E9JA

Crystal structure of the n-terminal domain of the secretin xcpq from pseudomonas aeruginosa
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
233
structure length
217
Chain Sequence
AFVPAAHWTINLKDADIREFIDQISEITGETFVVDPRVKGQVSVVSKAQLSLSEVYQLFLSVMSTHGFTVVAQGDQARIVPNAAPDRLETRVIQVQQSPVSELIPLIRPLVPQYGHLAAVPSANALIISDRSANIARIEDVIRQLDQKGSHDYSVINLRYGWVMDAAEVLNNAMSRGQAKGAAGAQVIADARTNRLIILGPPQARAKLVQLAQSLDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords General secretion pathway protein D
publication title New Insights into the Assembly of Bacterial Secretins: STRUCTURAL STUDIES OF THE PERIPLASMIC DOMAIN OF XcpQ FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 59
structure length 217
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03958 Secretin_N Bacterial type II/III secretion system short domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4e9jA02
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4e9jA01
2Y3MA 3GR5A 3OSSD 4EC5A 3EZJA 4E9JA 4G08A
chains in the Genus database with same CATH superfamily
2BA0A 2CTEA 4DV2H 1XMOH 2UXDH 2CTJA 4DV4H 4DR1H 2ANRA 4GKJH 2P2RA 2M8WA 2UUBH 4YY3H 1UG8A 1HNXH 4JVHA 1Z2IA 4DV5H 1WE8A 5LMNH 2A1SA 1XMQH 2MJHA 2CTMA 4JI0H 4B3RH 4JYAH 2UXCH 3SB1A 3VKEA 1X9ZA 2CWFA 4G08A 4X62H 2LTMA 3J81W 3JAMW 4DR3H 4JI5H 2NN6G 4OD6A 2UXBH 2JVZA 4DUYH 4JI1H 1V9NA 4DR5H 4BA2I 2CPQA 5IWAH 1FJGH 4GKKH 1PQXA 4NBQA 1SEIA 3J7AK 4B3SH 2CTKA 4DUZH 2JE6I 4FJSA 4JI6H 2JEAI 1VIGA 4DV3H 4JVYA 3GKUA 1X0AA 5DT9A 3EZJA 1X4NA 1J4WA 2G8YA 3J80W 4B8TA 4B3TH 4NXNH 3I0PA 4DR6H 3KDGA 3OSSD 1WHRA 1XNQH 1XRHA 4LF8H 1V8CA 1WTJA 3GABA 3QD7X 4OCHA 1IBLH 4DR2H 4E9JA 1ZZJA 1ZTGA 1K1GA 3RF2A 4DR7H 3FAUA 4LIJA 2LRRA 5A2QW 3KDKA 4X65H 4NZTM 2UUCH 1XNRH 4WALA 1J5EH 2YQRA 2UUAH 4OX9H 1ZZIA 2BL5A 4JI7H 1VBIA 2DGRA 2AXYA 5FLXW 4JI4H 1TUAA 1S03G 5JEAG 2ANNA 1ZZKA 4JI2H 2PT7G 2VQEH 2JZXA 1HNZH 3T1HH 3OTOH 2QNDA 2ZM6H 4LF9H 1FKAH 2M6QA 1I94H 4OO1G 2K1HA 4KHPH 1NXUA 2CPMA 2OPUA 1VIHA 2LTLA 3V69A 4B3MH 2D9IA 4EC5A 1F0XA 4IFDG 4DV6H 1IBKH 3U1KA 2PY9A 1DT4A 4AM3A 1X4MA 4LF5H 1N32H 1ODHA 4AIMA 3OETA 2LF0A 3UOEA 2E5LH 4FJUA 4AQYH 2JEBI 1J5KA 4X64H 2O4CA 2X06A 2Z0SA 4YHHH 1IBMH 4DV7H 1N36H 4PDBA 2CWHA 1HNWH 2VKCA 4LF4H 4DR4H 1EC6A 3L7ZC 2ZQEA 4JI3H 4LF6H 1KHMA 3GR5A 1HR0H 2HH3A 2FFMA 5BR8H 2VQFH 3AEVB 2F4VH 4JI8H 2PQUA 1N33H 4WANA 4NXMH 1MSZA 1DTJA 4K0KH 4LFAH 2Y3MA 3T1YH 4LF7H 2CTLA 2CTFA 4LFBH 5C0XG 2JA9A 4JV5H 5IT9W 1S20A 2FPHX 2FMRA 2HHHH 4DV0H 2OPVA 1N34H 1AN7A 2HH2A 4NZRM 4X66H 4LFCH 4B8CD 2UU9H 1I6UA 2E3UA 3NCVA 4BA1I 5LL6b 5K36G 4H8AA 5LMUH 4DV1H 4QMFB 1WVNA
chains in the Genus database with same CATH topology
1XMOH 2UXDH 4DV2H 4DV4H 4DR1H 4GKJH 2UUBH 4YY3H 1HNXH 4DV5H 5LMNH 1XMQH 4JI0H 4B3RH 4JYAH 2UXCH 3SB1A 1X9ZA 4X62H 4G08A 4DR3H 3J81W 4JI5H 3JAMW 4OD6A 2UXBH 4DUYH 4JI1H 4DR5H 4GKKH 5IWAH 1FJGH 1SEIA 3J7AK 4B3SH 4DUZH 4JI6H 4DV3H 5DT9A 3EZJA 3J80W 4B3TH 4NXNH 4DR6H 3KDGA 3OSSD 1XNQH 4LF8H 3GABA 3QD7X 4OCHA 1IBLH 4DR2H 4E9JA 3RF2A 4DR7H 3FAUA 5A2QW 3KDKA 4X65H 4NZTM 2UUCH 1XNRH 1J5EH 2UUAH 4OX9H 4JI7H 5FLXW 4JI4H 1S03G 4JI2H 2PT7G 2VQEH 1HNZH 3T1HH 3OTOH 2ZM6H 4LF9H 1FKAH 1I94H 4KHPH 4B3MH 2D9IA 4EC5A 1F0XA 4DV6H 1IBKH 4LF5H 1N32H 1ODHA 3OETA 2LF0A 2E5LH 4AQYH 4X64H 2O4CA 4YHHH 1IBMH 4DV7H 1N36H 4PDBA 4DR4H 2VKCA 4LF4H 2ZQEA 4JI3H 4LF6H 3GR5A 1HR0H 5BR8H 2VQFH 2F4VH 4JI8H 1N33H 4NXMH 4K0KH 4LFAH 2Y3MA 3T1YH 4LF7H 4LFBH 4JV5H 5IT9W 2FPHX 2HHHH 4DV0H 1N34H 1AN7A 4NZRM 4X66H 4LFCH 4B8CD 2UU9H 1I6UA 3NCVA 5LL6b 5LMUH 4DV1H 1HNWH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y3M A;  3GR5 A;  3OSS D;  4EC5 A;  3EZJ A;  4E9J A;  4G08 A; 
#chains in the Genus database with same CATH topology
 2BA0 A;  2CTE A;  4DV2 H;  1XMO H;  2UXD H;  2CTJ A;  4DV4 H;  4DR1 H;  2ANR A;  4GKJ H;  2P2R A;  2M8W A;  2UUB H;  4YY3 H;  1UG8 A;  1HNX H;  4JVH A;  1Z2I A;  4DV5 H;  1WE8 A;  5LMN H;  2A1S A;  1XMQ H;  2MJH A;  2CTM A;  4JI0 H;  4B3R H;  4JYA H;  2UXC H;  3SB1 A;  3VKE A;  1X9Z A;  2CWF A;  4G08 A;  4X62 H;  2LTM A;  3J81 W;  3JAM W;  4DR3 H;  4JI5 H;  2NN6 G;  4OD6 A;  2UXB H;  2JVZ A;  4DUY H;  4JI1 H;  1V9N A;  4DR5 H;  4BA2 I;  2CPQ A;  5IWA H;  1FJG H;  4GKK H;  1PQX A;  4NBQ A;  1SEI A;  3J7A K;  4B3S H;  2CTK A;  4DUZ H;  2JE6 I;  4FJS A;  4JI6 H;  2JEA I;  1VIG A;  4DV3 H;  4JVY A;  3GKU A;  1X0A A;  5DT9 A;  3EZJ A;  1X4N A;  1J4W A;  2G8Y A;  3J80 W;  4B8T A;  4B3T H;  4NXN H;  3I0P A;  4DR6 H;  3KDG A;  3OSS D;  1WHR A;  1XNQ H;  1XRH A;  4LF8 H;  1V8C A;  1WTJ A;  3GAB A;  3QD7 X;  4OCH A;  1IBL H;  4DR2 H;  4E9J A;  1ZZJ A;  1ZTG A;  1K1G A;  3RF2 A;  4DR7 H;  3FAU A;  4LIJ A;  2LRR A;  5A2Q W;  3KDK A;  4X65 H;  4NZT M;  2UUC H;  1XNR H;  4WAL A;  1J5E H;  2YQR A;  2UUA H;  4OX9 H;  1ZZI A;  2BL5 A;  4JI7 H;  1VBI A;  2DGR A;  2AXY A;  5FLX W;  4JI4 H;  1TUA A;  1S03 G;  5JEA G;  2ANN A;  1ZZK A;  4JI2 H;  2PT7 G;  2VQE H;  2JZX A;  1HNZ H;  3T1H H;  3OTO H;  2QND A;  2ZM6 H;  4LF9 H;  1FKA H;  2M6Q A;  1I94 H;  4OO1 G;  2K1H A;  4KHP H;  1NXU A;  2CPM A;  2OPU A;  1VIH A;  2LTL A;  3V69 A;  4B3M H;  2D9I A;  4EC5 A;  1F0X A;  4IFD G;  4DV6 H;  1IBK H;  3U1K A;  2PY9 A;  1DT4 A;  4AM3 A;  1X4M A;  4LF5 H;  1N32 H;  1ODH A;  4AIM A;  3OET A;  2LF0 A;  3UOE A;  2E5L H;  4FJU A;  4AQY H;  2JEB I;  1J5K A;  4X64 H;  2O4C A;  2X06 A;  2Z0S A;  4YHH H;  1IBM H;  4DV7 H;  1N36 H;  4PDB A;  2CWH A;  1HNW H;  2VKC A;  4LF4 H;  4DR4 H;  1EC6 A;  3L7Z C;  2ZQE A;  4JI3 H;  4LF6 H;  1KHM A;  3GR5 A;  1HR0 H;  2HH3 A;  2FFM A;  5BR8 H;  2VQF H;  3AEV B;  2F4V H;  4JI8 H;  2PQU A;  1N33 H;  4WAN A;  4NXM H;  1MSZ A;  1DTJ A;  4K0K H;  4LFA H;  2Y3M A;  3T1Y H;  4LF7 H;  2CTL A;  2CTF A;  4LFB H;  5C0X G;  2JA9 A;  4JV5 H;  5IT9 W;  1S20 A;  2FPH X;  2FMR A;  2HHH H;  4DV0 H;  2OPV A;  1N34 H;  1AN7 A;  2HH2 A;  4NZR M;  4X66 H;  4LFC H;  4B8C D;  2UU9 H;  1I6U A;  2E3U A;  3NCV A;  4BA1 I;  5LL6 b;  5K36 G;  4H8A A;  5LMU H;  4DV1 H;  4QMF B;  1WVN A; 
#chains in the Genus database with same CATH homology
 1XMO H;  2UXD H;  4DV2 H;  4DV4 H;  4DR1 H;  4GKJ H;  2UUB H;  4YY3 H;  1HNX H;  4DV5 H;  5LMN H;  1XMQ H;  4JI0 H;  4B3R H;  4JYA H;  2UXC H;  3SB1 A;  1X9Z A;  4X62 H;  4G08 A;  4DR3 H;  3J81 W;  4JI5 H;  3JAM W;  4OD6 A;  2UXB H;  4DUY H;  4JI1 H;  4DR5 H;  4GKK H;  5IWA H;  1FJG H;  1SEI A;  3J7A K;  4B3S H;  4DUZ H;  4JI6 H;  4DV3 H;  5DT9 A;  3EZJ A;  3J80 W;  4B3T H;  4NXN H;  4DR6 H;  3KDG A;  3OSS D;  1XNQ H;  4LF8 H;  3GAB A;  3QD7 X;  4OCH A;  1IBL H;  4DR2 H;  4E9J A;  3RF2 A;  4DR7 H;  3FAU A;  5A2Q W;  3KDK A;  4X65 H;  4NZT M;  2UUC H;  1XNR H;  1J5E H;  2UUA H;  4OX9 H;  4JI7 H;  5FLX W;  4JI4 H;  1S03 G;  4JI2 H;  2PT7 G;  2VQE H;  1HNZ H;  3T1H H;  3OTO H;  2ZM6 H;  4LF9 H;  1FKA H;  1I94 H;  4KHP H;  4B3M H;  2D9I A;  4EC5 A;  1F0X A;  4DV6 H;  1IBK H;  4LF5 H;  1N32 H;  1ODH A;  3OET A;  2LF0 A;  2E5L H;  4AQY H;  4X64 H;  2O4C A;  4YHH H;  1IBM H;  4DV7 H;  1N36 H;  4PDB A;  4DR4 H;  2VKC A;  4LF4 H;  2ZQE A;  4JI3 H;  4LF6 H;  3GR5 A;  1HR0 H;  5BR8 H;  2VQF H;  2F4V H;  4JI8 H;  1N33 H;  4NXM H;  4K0K H;  4LFA H;  2Y3M A;  3T1Y H;  4LF7 H;  4LFB H;  4JV5 H;  5IT9 W;  2FPH X;  2HHH H;  4DV0 H;  1N34 H;  1AN7 A;  4NZR M;  4X66 H;  4LFC H;  4B8C D;  2UU9 H;  1I6U A;  3NCV A;  5LL6 b;  5LMU H;  4DV1 H;  1HNW H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...