1V9NA

Structure of malate dehydrogenase from pyrococcus horikoshii ot3
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
360
structure length
348
Chain Sequence
MFEKGYVDENYIRVPKDRLFSFIVRVLTKLGVPEEDAKIVADNLVMADLRGVESHGVQRLKRYVDGIISGGVNLHPKIRVIREGPSYALIDGDEGLGQVVGYRSMKLAIKKAKDTGIGIVIARNSNHYGIAGYYALMAAEEGMIGISMTNSRPLVAPTGGIERILGTNPIALAAPTKDKPFLLDMATSVVPIGKLEWAINREGNITTKVEEVFNGGALLPLGGFGELLGGHKGYGLSLMVDILSGILSGGTWSKYVKNTSEKGSNVCHFFMVIDIEHFIPLEEFKEKISQMIEEIKSSRKHPEFERIWIHGEKGFLTMETRLKLGIPIYRKVLEELNEIAKRVGVEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malate dehydrogenase
publication title Structure of Malate Dehydrogenase from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Oxidoreductase
total genus 99
structure length 348
sequence length 360
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2004-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 1v9nA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 1v9nA02
1NXUA 1X0AA 2CWHA 4FJSA 4FJUA 2X06A 1XRHA 1WTJA 4H8AA 1VBIA 3I0PA 1Z2IA 2CWFA 3UOEA 1S20A 2G8YA 1V9NA
chains in the Genus database with same CATH superfamily
1X0AA 4JI5H 4DR7H 2X06A 2DGRA 2LTMA 1J5EH 4X65H 1ODHA 4YY3H 1ZTGA 2CTKA 2UXDH 1S20A 1EC6A 2JVZA 1J5KA 1FKAH 5LMUH 5IT9W 5DT9A 2Z0SA 5JEAG 1VIGA 2ZQEA 5C0XG 1VBIA 1I94H 3KDKA 1AN7A 1MSZA 4DV1H 2MJHA 1X4NA 1VIHA 5K36G 2CTLA 3KDGA 3J81W 4JI1H 4OO1G 4NXNH 2CTEA 2ANNA 4LFBH 4LFCH 2G8YA 2PT7G 5LL6b 4DV7H 4DUZH 4BA1I 4K0KH 2M8WA 2ANRA 4FJSA 4LF8H 2K1HA 1IBMH 4GKJH 4OD6A 4JI4H 2HH3A 1S03G 1N32H 4LF9H 4JI7H 3AEVB 5LMNH 2E5LH 4DR1H 2JEAI 3JAMW 3GR5A 4JI6H 2F4VH 2FFMA 1N33H 4AM3A 1KHMA 2LRRA 4LF4H 4BA2I 4LF6H 4DR5H 2M6QA 4OX9H 1V9NA 4OCHA 1XMQH 4IFDG 1UG8A 4B3MH 4AIMA 3GABA 4H8AA 2UXCH 4LIJA 5FLXW 2VQEH 2CPQA 4E9JA 3VKEA 3EZJA 2CWHA 2O4CA 3J80W 2CPMA 4DV5H 1ZZIA 2AXYA 1DT4A 2FMRA 4DV6H 4JI8H 4JVHA 3T1HH 1K1GA 2PQUA 3L7ZC 2P2RA 3QD7X 4JI0H 3V69A 2QNDA 4X62H 4X64H 1HNXH 2JA9A 4LF5H 2UU9H 1NXUA 1X9ZA 4DR3H 4JI2H 1N36H 1HNWH 5A2QW 1XNRH 3UOEA 1J4WA 4LF7H 1WVNA 2HH2A 1X4MA 2JEBI 2VQFH 4JYAH 1HNZH 4DV0H 2NN6G 5IWAH 4JVYA 3OSSD 4DUYH 2CTJA 1WHRA 1IBLH 1Z2IA 1F0XA 2A1SA 4AQYH 3U1KA 4QMFB 3RF2A 2CTFA 1TUAA 2VKCA 3SB1A 2OPUA 2UUBH 4G08A 1ZZJA 1WTJA 2JZXA 3I0PA 2UUAH 4DR4H 1XNQH 2BA0A 4DR2H 2PY9A 4DV2H 4LFAH 4FJUA 4YHHH 4DV3H 4PDBA 4B3SH 3OTOH 2FPHX 2CWFA 1HR0H 1FJGH 4WANA 4EC5A 4X66H 4NZRM 4NBQA 4DV4H 2UUCH 5BR8H 3J7AK 1PQXA 1ZZKA 1N34H 2YQRA 4JI3H 4NXMH 3T1YH 3FAUA 2ZM6H 4GKKH 4B3TH 1IBKH 1V8CA 2D9IA 3OETA 4B8CD 2HHHH 3NCVA 4NZTM 2LF0A 1XMOH 1I6UA 2CTMA 4JV5H 2UXBH 2BL5A 1DTJA 2E3UA 4B8TA 3GKUA 4KHPH 1WE8A 1XRHA 2LTLA 2JE6I 4DR6H 1SEIA 2OPVA 4WALA 4B3RH 2Y3MA
chains in the Genus database with same CATH topology
1NXUA 1X0AA 2CWHA 4FJSA 4FJUA 2X06A 1XRHA 1WTJA 4H8AA 1VBIA 3I0PA 1Z2IA 2CWFA 3UOEA 1S20A 2G8YA 1V9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NXU A;  1X0A A;  2CWH A;  4FJS A;  4FJU A;  2X06 A;  1XRH A;  1WTJ A;  4H8A A;  1VBI A;  3I0P A;  1Z2I A;  2CWF A;  3UOE A;  1S20 A;  2G8Y A;  1V9N A; 
#chains in the Genus database with same CATH topology
 1X0A A;  4JI5 H;  4DR7 H;  2X06 A;  2DGR A;  2LTM A;  1J5E H;  4X65 H;  1ODH A;  4YY3 H;  1ZTG A;  2CTK A;  2UXD H;  1S20 A;  1EC6 A;  2JVZ A;  1J5K A;  1FKA H;  5LMU H;  5IT9 W;  5DT9 A;  2Z0S A;  5JEA G;  1VIG A;  2ZQE A;  5C0X G;  1VBI A;  1I94 H;  3KDK A;  1AN7 A;  1MSZ A;  4DV1 H;  2MJH A;  1X4N A;  1VIH A;  5K36 G;  2CTL A;  3KDG A;  3J81 W;  4JI1 H;  4OO1 G;  4NXN H;  2CTE A;  2ANN A;  4LFB H;  4LFC H;  2G8Y A;  2PT7 G;  5LL6 b;  4DV7 H;  4DUZ H;  4BA1 I;  4K0K H;  2M8W A;  2ANR A;  4FJS A;  4LF8 H;  2K1H A;  1IBM H;  4GKJ H;  4OD6 A;  4JI4 H;  2HH3 A;  1S03 G;  1N32 H;  4LF9 H;  4JI7 H;  3AEV B;  5LMN H;  2E5L H;  4DR1 H;  2JEA I;  3JAM W;  3GR5 A;  4JI6 H;  2F4V H;  2FFM A;  1N33 H;  4AM3 A;  1KHM A;  2LRR A;  4LF4 H;  4BA2 I;  4LF6 H;  4DR5 H;  2M6Q A;  4OX9 H;  1V9N A;  4OCH A;  1XMQ H;  4IFD G;  1UG8 A;  4B3M H;  4AIM A;  3GAB A;  4H8A A;  2UXC H;  4LIJ A;  5FLX W;  2VQE H;  2CPQ A;  4E9J A;  3VKE A;  3EZJ A;  2CWH A;  2O4C A;  3J80 W;  2CPM A;  4DV5 H;  1ZZI A;  2AXY A;  1DT4 A;  2FMR A;  4DV6 H;  4JI8 H;  4JVH A;  3T1H H;  1K1G A;  2PQU A;  3L7Z C;  2P2R A;  3QD7 X;  4JI0 H;  3V69 A;  2QND A;  4X62 H;  4X64 H;  1HNX H;  2JA9 A;  4LF5 H;  2UU9 H;  1NXU A;  1X9Z A;  4DR3 H;  4JI2 H;  1N36 H;  1HNW H;  5A2Q W;  1XNR H;  3UOE A;  1J4W A;  4LF7 H;  1WVN A;  2HH2 A;  1X4M A;  2JEB I;  2VQF H;  4JYA H;  1HNZ H;  4DV0 H;  2NN6 G;  5IWA H;  4JVY A;  3OSS D;  4DUY H;  2CTJ A;  1WHR A;  1IBL H;  1Z2I A;  1F0X A;  2A1S A;  4AQY H;  3U1K A;  4QMF B;  3RF2 A;  2CTF A;  1TUA A;  2VKC A;  3SB1 A;  2OPU A;  2UUB H;  4G08 A;  1ZZJ A;  1WTJ A;  2JZX A;  3I0P A;  2UUA H;  4DR4 H;  1XNQ H;  2BA0 A;  4DR2 H;  2PY9 A;  4DV2 H;  4LFA H;  4FJU A;  4YHH H;  4DV3 H;  4PDB A;  4B3S H;  3OTO H;  2FPH X;  2CWF A;  1HR0 H;  1FJG H;  4WAN A;  4EC5 A;  4X66 H;  4NZR M;  4NBQ A;  4DV4 H;  2UUC H;  5BR8 H;  3J7A K;  1PQX A;  1ZZK A;  1N34 H;  2YQR A;  4JI3 H;  4NXM H;  3T1Y H;  3FAU A;  2ZM6 H;  4GKK H;  4B3T H;  1IBK H;  1V8C A;  2D9I A;  3OET A;  4B8C D;  2HHH H;  3NCV A;  4NZT M;  2LF0 A;  1XMO H;  1I6U A;  2CTM A;  4JV5 H;  2UXB H;  2BL5 A;  1DTJ A;  2E3U A;  4B8T A;  3GKU A;  4KHP H;  1WE8 A;  1XRH A;  2LTL A;  2JE6 I;  4DR6 H;  1SEI A;  2OPV A;  4WAL A;  4B3R H;  2Y3M A; 
#chains in the Genus database with same CATH homology
 1NXU A;  1X0A A;  2CWH A;  4FJS A;  4FJU A;  2X06 A;  1XRH A;  1WTJ A;  4H8A A;  1VBI A;  3I0P A;  1Z2I A;  2CWF A;  3UOE A;  1S20 A;  2G8Y A;  1V9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...