1V9NA

Structure of malate dehydrogenase from pyrococcus horikoshii ot3
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
360
structure length
348
Chain Sequence
MFEKGYVDENYIRVPKDRLFSFIVRVLTKLGVPEEDAKIVADNLVMADLRGVESHGVQRLKRYVDGIISGGVNLHPKIRVIREGPSYALIDGDEGLGQVVGYRSMKLAIKKAKDTGIGIVIARNSNHYGIAGYYALMAAEEGMIGISMTNSRPLVAPTGGIERILGTNPIALAAPTKDKPFLLDMATSVVPIGKLEWAINREGNITTKVEEVFNGGALLPLGGFGELLGGHKGYGLSLMVDILSGILSGGTWSKYVKNTSEKGSNVCHFFMVIDIEHFIPLEEFKEKISQMIEEIKSSRKHPEFERIWIHGEKGFLTMETRLKLGIPIYRKVLEELNEIAKRVGVEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malate dehydrogenase
publication title Structure of Malate Dehydrogenase from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Oxidoreductase
total genus 99
structure length 348
sequence length 360
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2004-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 1v9nA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 1v9nA02
1S20A 4FJUA 1XRHA 1Z2IA 2X06A 1VBIA 1V9NA 3I0PA 1WTJA 4H8AA 4FJSA 1NXUA 1X0AA 2CWFA 3UOEA 2CWHA 2G8YA
chains in the Genus database with same CATH superfamily
3OETA 3J81W 1ODHA 1X4NA 1ZTGA 4DV0H 1V8CA 5DT9A 1I94H 4JI4H 2PY9A 4B3MH 4LFCH 1I6UA 2ANNA 2Z0SA 1S20A 4X62H 2UXDH 3J80W 1N36H 1FJGH 1X4MA 2BL5A 4H8AA 1F0XA 3JAMW 4LF4H 1X9ZA 2OPUA 2O4CA 2M6QA 1HNZH 2CWFA 2LTLA 2G8YA 2CTLA 4JI1H 2CTKA 1VBIA 2UUAH 1DTJA 3VKEA 1N33H 4GKKH 2AXYA 4JI2H 2X06A 4G08A 3KDKA 2ANRA 1DT4A 2LRRA 2CWHA 4JYAH 2FPHX 2D9IA 4DV5H 4E9JA 2UU9H 2PQUA 2E3UA 1HR0H 4OX9H 4DUYH 4DV3H 4DV7H 1VIHA 2JEAI 3I0PA 2VQFH 1HNXH 5IT9W 4JI5H 3L7ZC 3GKUA 4WALA 4X65H 4EC5A 4X64H 2MJHA 4JI8H 4AM3A 1J5EH 2DGRA 4FJSA 2CTMA 1ZZIA 4AQYH 3OSSD 1XMQH 4NXNH 4LF7H 4DR3H 2QNDA 2ZQEA 4B8CD 2YQRA 5LMUH 1XNQH 3GR5A 2F4VH 1ZZKA 4JVHA 1FKAH 4JVYA 4KHPH 2M8WA 2CTEA 4NXMH 4BA1I 5FLXW 4DV2H 1N32H 2UXCH 4DR6H 4LF9H 2JVZA 4JI3H 1UG8A 2HHHH 1ZZJA 1WVNA 3V69A 1XMOH 4DV4H 2UUBH 1IBKH 2NN6G 2LTMA 1IBLH 4YHHH 1TUAA 2VQEH 4JV5H 2FFMA 2ZM6H 2JZXA 3QD7X 2JEBI 1S03G 4OO1G 2UUCH 1PQXA 2Y3MA 1WHRA 5JEAG 3UOEA 3T1YH 1K1GA 4LIJA 4OD6A 4DR1H 3T1HH 4LF5H 4DR4H 4WANA 3RF2A 3SB1A 4B8TA 2CPMA 4DUZH 4LF6H 4AIMA 3U1KA 1HNWH 2UXBH 5C0XG 5K36G 1EC6A 1WTJA 2FMRA 2HH2A 2VKCA 3GABA 3AEVB 4DR2H 4FJUA 2JE6I 4LFAH 5A2QW 5IWAH 1WE8A 1IBMH 3OTOH 2P2RA 2K1HA 5LL6b 2CTFA 4DV6H 4JI6H 4GKJH 4DR5H 1N34H 4LF8H 4K0KH 1MSZA 1VIGA 1XRHA 4NBQA 4OCHA 4PDBA 2CTJA 4B3TH 2PT7G 4YY3H 2CPQA 4BA2I 3NCVA 4LFBH 2E5LH 4JI7H 3EZJA 1J5KA 4JI0H 1Z2IA 1XNRH 1AN7A 4X66H 1V9NA 3J7AK 2OPVA 1X0AA 4NZRM 4QMFB 4B3SH 1J4WA 3KDGA 2A1SA 5BR8H 4B3RH 2JA9A 2HH3A 3FAUA 1SEIA 5LMNH 4DR7H 4IFDG 2BA0A 1NXUA 2LF0A 4DV1H 4NZTM 1KHMA
chains in the Genus database with same CATH topology
1S20A 4FJUA 1XRHA 1Z2IA 2X06A 1VBIA 1V9NA 3I0PA 1WTJA 4H8AA 4FJSA 1NXUA 1X0AA 2CWFA 3UOEA 2CWHA 2G8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S20 A;  4FJU A;  1XRH A;  1Z2I A;  2X06 A;  1VBI A;  1V9N A;  3I0P A;  1WTJ A;  4H8A A;  4FJS A;  1NXU A;  1X0A A;  2CWF A;  3UOE A;  2CWH A;  2G8Y A; 
#chains in the Genus database with same CATH topology
 3OET A;  3J81 W;  1ODH A;  1X4N A;  1ZTG A;  4DV0 H;  1V8C A;  5DT9 A;  1I94 H;  4JI4 H;  2PY9 A;  4B3M H;  4LFC H;  1I6U A;  2ANN A;  2Z0S A;  1S20 A;  4X62 H;  2UXD H;  3J80 W;  1N36 H;  1FJG H;  1X4M A;  2BL5 A;  4H8A A;  1F0X A;  3JAM W;  4LF4 H;  1X9Z A;  2OPU A;  2O4C A;  2M6Q A;  1HNZ H;  2CWF A;  2LTL A;  2G8Y A;  2CTL A;  4JI1 H;  2CTK A;  1VBI A;  2UUA H;  1DTJ A;  3VKE A;  1N33 H;  4GKK H;  2AXY A;  4JI2 H;  2X06 A;  4G08 A;  3KDK A;  2ANR A;  1DT4 A;  2LRR A;  2CWH A;  4JYA H;  2FPH X;  2D9I A;  4DV5 H;  4E9J A;  2UU9 H;  2PQU A;  2E3U A;  1HR0 H;  4OX9 H;  4DUY H;  4DV3 H;  4DV7 H;  1VIH A;  2JEA I;  3I0P A;  2VQF H;  1HNX H;  5IT9 W;  4JI5 H;  3L7Z C;  3GKU A;  4WAL A;  4X65 H;  4EC5 A;  4X64 H;  2MJH A;  4JI8 H;  4AM3 A;  1J5E H;  2DGR A;  4FJS A;  2CTM A;  1ZZI A;  4AQY H;  3OSS D;  1XMQ H;  4NXN H;  4LF7 H;  4DR3 H;  2QND A;  2ZQE A;  4B8C D;  2YQR A;  5LMU H;  1XNQ H;  3GR5 A;  2F4V H;  1ZZK A;  4JVH A;  1FKA H;  4JVY A;  4KHP H;  2M8W A;  2CTE A;  4NXM H;  4BA1 I;  5FLX W;  4DV2 H;  1N32 H;  2UXC H;  4DR6 H;  4LF9 H;  2JVZ A;  4JI3 H;  1UG8 A;  2HHH H;  1ZZJ A;  1WVN A;  3V69 A;  1XMO H;  4DV4 H;  2UUB H;  1IBK H;  2NN6 G;  2LTM A;  1IBL H;  4YHH H;  1TUA A;  2VQE H;  4JV5 H;  2FFM A;  2ZM6 H;  2JZX A;  3QD7 X;  2JEB I;  1S03 G;  4OO1 G;  2UUC H;  1PQX A;  2Y3M A;  1WHR A;  5JEA G;  3UOE A;  3T1Y H;  1K1G A;  4LIJ A;  4OD6 A;  4DR1 H;  3T1H H;  4LF5 H;  4DR4 H;  4WAN A;  3RF2 A;  3SB1 A;  4B8T A;  2CPM A;  4DUZ H;  4LF6 H;  4AIM A;  3U1K A;  1HNW H;  2UXB H;  5C0X G;  5K36 G;  1EC6 A;  1WTJ A;  2FMR A;  2HH2 A;  2VKC A;  3GAB A;  3AEV B;  4DR2 H;  4FJU A;  2JE6 I;  4LFA H;  5A2Q W;  5IWA H;  1WE8 A;  1IBM H;  3OTO H;  2P2R A;  2K1H A;  5LL6 b;  2CTF A;  4DV6 H;  4JI6 H;  4GKJ H;  4DR5 H;  1N34 H;  4LF8 H;  4K0K H;  1MSZ A;  1VIG A;  1XRH A;  4NBQ A;  4OCH A;  4PDB A;  2CTJ A;  4B3T H;  2PT7 G;  4YY3 H;  2CPQ A;  4BA2 I;  3NCV A;  4LFB H;  2E5L H;  4JI7 H;  3EZJ A;  1J5K A;  4JI0 H;  1Z2I A;  1XNR H;  1AN7 A;  4X66 H;  1V9N A;  3J7A K;  2OPV A;  1X0A A;  4NZR M;  4QMF B;  4B3S H;  1J4W A;  3KDG A;  2A1S A;  5BR8 H;  4B3R H;  2JA9 A;  2HH3 A;  3FAU A;  1SEI A;  5LMN H;  4DR7 H;  4IFD G;  2BA0 A;  1NXU A;  2LF0 A;  4DV1 H;  4NZT M;  1KHM A; 
#chains in the Genus database with same CATH homology
 1S20 A;  4FJU A;  1XRH A;  1Z2I A;  2X06 A;  1VBI A;  1V9N A;  3I0P A;  1WTJ A;  4H8A A;  4FJS A;  1NXU A;  1X0A A;  2CWF A;  3UOE A;  2CWH A;  2G8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...