1KHMA

C-terminal kh domain of hnrnp k (kh3)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
GSPNSYGDLGGPIITTQVTIPKDLARSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords PROTEIN (HNRNP K)
publication title High precision solution structure of the C-terminal KH domain of heterogeneous nuclear ribonucleoprotein K, a c-myc transcription factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1999-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1khmA00
5K36G 2ANNA 2HH3A 4B8TA 1ZZJA 2JEBI 3AEVB 1KHMA 2BA0A 5JEAG 2CTFA 1EC6A 2OPVA 4LIJA 2JZXA 4AIMA 2JVZA 2NN6G 4NBQA 4WALA 2MJHA 4BA2I 2CPQA 1WVNA 2CTMA 1ZZIA 2CTLA 2CTKA 1DTJA 2PQUA 1DT4A 1J4WA 2ANRA 1J5KA 2OPUA 3VKEA 5C0XG 3U1KA 4WANA 1TUAA 1X4MA 1X4NA 2AXYA 3L7ZC 1ZTGA 2FMRA 4QMFB 4JVYA 4BA1I 1ZZKA 2YQRA 2E3UA 4OO1G 2PY9A 4JVHA 2P2RA 2QNDA 2BL5A 2JEAI 1VIHA 2JE6I 2HH2A 3V69A 2DGRA 1WE8A 2CTEA 2JA9A 2Z0SA 1K1GA 2CTJA 1VIGA 4IFDG 4AM3A
chains in the Genus database with same CATH superfamily
5K36G 2ANNA 2JEBI 3GR5A 4B3MH 4JI1H 1AN7A 2FFMA 4LF7H 2VKCA 1V8CA 5JEAG 1EC6A 1X0AA 2JZXA 4AIMA 3OTOH 4LFBH 4JI2H 2UXCH 4B3SH 2CPQA 1UG8A 1WVNA 2K1HA 1XMOH 2UUAH 3J81W 3T1YH 1HR0H 2F4VH 2CWFA 4NZRM 4JI0H 1X9ZA 2OPUA 1S20A 4X66H 5C0XG 2O4CA 3T1HH 2CWHA 4DUZH 5A2QW 1X4MA 2VQEH 1F0XA 4LF5H 1V9NA 2FMRA 4QMFB 2LTLA 4DUYH 1HNWH 4JVYA 4BA1I 2CPMA 1WTJA 1XMQH 2PY9A 3OSSD 4H8AA 4B3TH 4DR2H 2JEAI 4JYAH 4DV6H 1Z2IA 4LF4H 2HH3A 1ZZJA 3AEVB 3KDGA 1HNXH 3QD7X 4JI5H 2BA0A 2M6QA 1IBMH 2JVZA 2NN6G 4BA2I 2CTMA 4JI8H 4LF6H 1DTJA 2X06A 5IT9W 1DT4A 1XRHA 4DR1H 3VKEA 2UU9H 5IWAH 4DV2H 4YHHH 1NXUA 3GKUA 4AQYH 4YY3H 1N33H 1XNRH 5LMUH 2D9IA 3L7ZC 1ZTGA 2G8YA 1PQXA 3GABA 4NXNH 1IBKH 2UXDH 2YQRA 2E3UA 2ZQEA 4B3RH 4OX9H 1S03G 2A1SA 2DGRA 3J7AK 4JI4H 2Z0SA 1K1GA 4OO1G 2Y3MA 3FAUA 4LF8H 2PT7G 4DV5H 4DR7H 1KHMA 4B8CD 4DV7H 4PDBA 2CTFA 5LL6b 3SB1A 3OETA 4NBQA 2MJHA 2HHHH 4FJUA 4JI6H 3J80W 2UUCH 1ZZIA 2CTKA 4GKKH 2UXBH 3I0PA 1ODHA 4GKJH 1N32H 4NZTM 1J4WA 2ANRA 2LTMA 1J5KA 4JV5H 2E5LH 4G08A 3U1KA 4DV3H 4K0KH 4WANA 1X4NA 1WHRA 2AXYA 2LRRA 4DR5H 1N34H 1J5EH 1I94H 4JI3H 1ZZKA 4DR6H 4EC5A 2FPHX 2UUBH 4DR3H 4JVHA 3NCVA 2QNDA 1VIHA 2JE6I 2HH2A 4LFAH 1WE8A 4OCHA 2CTJA 4NXMH 1VIGA 3JAMW 4DV0H 4DV1H 4B8TA 5FLXW 1XNQH 2ZM6H 1IBLH 4LFCH 2OPVA 4FJSA 4LIJA 4DV4H 4WALA 2CTLA 4OD6A 1HNZH 3UOEA 4X64H 3KDKA 3EZJA 4DR4H 1I6UA 2LF0A 1TUAA 4KHPH 1SEIA 2M8WA 3RF2A 2VQFH 1FJGH 1VBIA 4X62H 5LMNH 5DT9A 2P2RA 1MSZA 4X65H 2BL5A 5BR8H 3V69A 4LF9H 2JA9A 2CTEA 4E9JA 4JI7H 1N36H 2PQUA 4IFDG 1FKAH 4AM3A
chains in the Genus database with same CATH topology
5K36G 2ANNA 2HH3A 4B8TA 1ZZJA 2JEBI 3AEVB 1KHMA 2BA0A 5JEAG 2CTFA 1EC6A 2OPVA 4LIJA 2JZXA 4AIMA 2JVZA 2NN6G 4NBQA 4WALA 2MJHA 4BA2I 2CPQA 1WVNA 2CTMA 1ZZIA 2CTLA 2CTKA 1DTJA 2PQUA 1DT4A 1J4WA 2ANRA 1J5KA 2OPUA 3VKEA 5C0XG 3U1KA 4WANA 1TUAA 1X4MA 1X4NA 2AXYA 3L7ZC 1ZTGA 2FMRA 4QMFB 4JVYA 4BA1I 1ZZKA 2YQRA 2E3UA 4OO1G 2PY9A 4JVHA 2P2RA 2QNDA 2BL5A 2JEAI 1VIHA 2JE6I 2HH2A 3V69A 2DGRA 1WE8A 2CTEA 2JA9A 2Z0SA 1K1GA 2CTJA 1VIGA 4IFDG 4AM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K36 G;  2ANN A;  2HH3 A;  4B8T A;  1ZZJ A;  2JEB I;  3AEV B;  1KHM A;  2BA0 A;  5JEA G;  2CTF A;  1EC6 A;  2OPV A;  4LIJ A;  2JZX A;  4AIM A;  2JVZ A;  2NN6 G;  4NBQ A;  4WAL A;  2MJH A;  4BA2 I;  2CPQ A;  1WVN A;  2CTM A;  1ZZI A;  2CTL A;  2CTK A;  1DTJ A;  2PQU A;  1DT4 A;  1J4W A;  2ANR A;  1J5K A;  2OPU A;  3VKE A;  5C0X G;  3U1K A;  4WAN A;  1TUA A;  1X4M A;  1X4N A;  2AXY A;  3L7Z C;  1ZTG A;  2FMR A;  4QMF B;  4JVY A;  4BA1 I;  1ZZK A;  2YQR A;  2E3U A;  4OO1 G;  2PY9 A;  4JVH A;  2P2R A;  2QND A;  2BL5 A;  2JEA I;  1VIH A;  2JE6 I;  2HH2 A;  3V69 A;  2DGR A;  1WE8 A;  2CTE A;  2JA9 A;  2Z0S A;  1K1G A;  2CTJ A;  1VIG A;  4IFD G;  4AM3 A; 
#chains in the Genus database with same CATH topology
 5K36 G;  2ANN A;  2JEB I;  3GR5 A;  4B3M H;  4JI1 H;  1AN7 A;  2FFM A;  4LF7 H;  2VKC A;  1V8C A;  5JEA G;  1EC6 A;  1X0A A;  2JZX A;  4AIM A;  3OTO H;  4LFB H;  4JI2 H;  2UXC H;  4B3S H;  2CPQ A;  1UG8 A;  1WVN A;  2K1H A;  1XMO H;  2UUA H;  3J81 W;  3T1Y H;  1HR0 H;  2F4V H;  2CWF A;  4NZR M;  4JI0 H;  1X9Z A;  2OPU A;  1S20 A;  4X66 H;  5C0X G;  2O4C A;  3T1H H;  2CWH A;  4DUZ H;  5A2Q W;  1X4M A;  2VQE H;  1F0X A;  4LF5 H;  1V9N A;  2FMR A;  4QMF B;  2LTL A;  4DUY H;  1HNW H;  4JVY A;  4BA1 I;  2CPM A;  1WTJ A;  1XMQ H;  2PY9 A;  3OSS D;  4H8A A;  4B3T H;  4DR2 H;  2JEA I;  4JYA H;  4DV6 H;  1Z2I A;  4LF4 H;  2HH3 A;  1ZZJ A;  3AEV B;  3KDG A;  1HNX H;  3QD7 X;  4JI5 H;  2BA0 A;  2M6Q A;  1IBM H;  2JVZ A;  2NN6 G;  4BA2 I;  2CTM A;  4JI8 H;  4LF6 H;  1DTJ A;  2X06 A;  5IT9 W;  1DT4 A;  1XRH A;  4DR1 H;  3VKE A;  2UU9 H;  5IWA H;  4DV2 H;  4YHH H;  1NXU A;  3GKU A;  4AQY H;  4YY3 H;  1N33 H;  1XNR H;  5LMU H;  2D9I A;  3L7Z C;  1ZTG A;  2G8Y A;  1PQX A;  3GAB A;  4NXN H;  1IBK H;  2UXD H;  2YQR A;  2E3U A;  2ZQE A;  4B3R H;  4OX9 H;  1S03 G;  2A1S A;  2DGR A;  3J7A K;  4JI4 H;  2Z0S A;  1K1G A;  4OO1 G;  2Y3M A;  3FAU A;  4LF8 H;  2PT7 G;  4DV5 H;  4DR7 H;  1KHM A;  4B8C D;  4DV7 H;  4PDB A;  2CTF A;  5LL6 b;  3SB1 A;  3OET A;  4NBQ A;  2MJH A;  2HHH H;  4FJU A;  4JI6 H;  3J80 W;  2UUC H;  1ZZI A;  2CTK A;  4GKK H;  2UXB H;  3I0P A;  1ODH A;  4GKJ H;  1N32 H;  4NZT M;  1J4W A;  2ANR A;  2LTM A;  1J5K A;  4JV5 H;  2E5L H;  4G08 A;  3U1K A;  4DV3 H;  4K0K H;  4WAN A;  1X4N A;  1WHR A;  2AXY A;  2LRR A;  4DR5 H;  1N34 H;  1J5E H;  1I94 H;  4JI3 H;  1ZZK A;  4DR6 H;  4EC5 A;  2FPH X;  2UUB H;  4DR3 H;  4JVH A;  3NCV A;  2QND A;  1VIH A;  2JE6 I;  2HH2 A;  4LFA H;  1WE8 A;  4OCH A;  2CTJ A;  4NXM H;  1VIG A;  3JAM W;  4DV0 H;  4DV1 H;  4B8T A;  5FLX W;  1XNQ H;  2ZM6 H;  1IBL H;  4LFC H;  2OPV A;  4FJS A;  4LIJ A;  4DV4 H;  4WAL A;  2CTL A;  4OD6 A;  1HNZ H;  3UOE A;  4X64 H;  3KDK A;  3EZJ A;  4DR4 H;  1I6U A;  2LF0 A;  1TUA A;  4KHP H;  1SEI A;  2M8W A;  3RF2 A;  2VQF H;  1FJG H;  1VBI A;  4X62 H;  5LMN H;  5DT9 A;  2P2R A;  1MSZ A;  4X65 H;  2BL5 A;  5BR8 H;  3V69 A;  4LF9 H;  2JA9 A;  2CTE A;  4E9J A;  4JI7 H;  1N36 H;  2PQU A;  4IFD G;  1FKA H;  4AM3 A; 
#chains in the Genus database with same CATH homology
 5K36 G;  2ANN A;  2HH3 A;  4B8T A;  1ZZJ A;  2JEB I;  3AEV B;  1KHM A;  2BA0 A;  5JEA G;  2CTF A;  1EC6 A;  2OPV A;  4LIJ A;  2JZX A;  4AIM A;  2JVZ A;  2NN6 G;  4NBQ A;  4WAL A;  2MJH A;  4BA2 I;  2CPQ A;  1WVN A;  2CTM A;  1ZZI A;  2CTL A;  2CTK A;  1DTJ A;  2PQU A;  1DT4 A;  1J4W A;  2ANR A;  1J5K A;  2OPU A;  3VKE A;  5C0X G;  3U1K A;  4WAN A;  1TUA A;  1X4M A;  1X4N A;  2AXY A;  3L7Z C;  1ZTG A;  2FMR A;  4QMF B;  4JVY A;  4BA1 I;  1ZZK A;  2YQR A;  2E3U A;  4OO1 G;  2PY9 A;  4JVH A;  2P2R A;  2QND A;  2BL5 A;  2JEA I;  1VIH A;  2JE6 I;  2HH2 A;  3V69 A;  2DGR A;  1WE8 A;  2CTE A;  2JA9 A;  2Z0S A;  1K1G A;  2CTJ A;  1VIG A;  4IFD G;  4AM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...