1KHMA

C-terminal kh domain of hnrnp k (kh3)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
GSPNSYGDLGGPIITTQVTIPKDLARSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HNRNP K)
publication title High precision solution structure of the C-terminal KH domain of heterogeneous nuclear ribonucleoprotein K, a c-myc transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 16
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1999-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1khmA00
1J4WA 1TUAA 2FMRA 2CTFA 4AM3A 2JEAI 2BL5A 2OPUA 2Z0SA 1ZZIA 1DTJA 2JEBI 3U1KA 4AIMA 1X4MA 3V69A 4WALA 2P2RA 2ANNA 3AEVB 4NBQA 2JA9A 2CTKA 2BA0A 3VKEA 1X4NA 4B8TA 1ZZJA 2HH2A 4IFDG 4OO1G 5JEAG 5K36G 2JE6I 1VIGA 2CPQA 2PY9A 4BA2I 1ZTGA 1J5KA 1DT4A 2QNDA 4LIJA 2CTJA 5C0XG 2OPVA 4QMFB 4JVHA 2CTMA 1WE8A 2JVZA 2JZXA 2PQUA 4WANA 1K1GA 2CTEA 2DGRA 3L7ZC 2MJHA 4JVYA 1EC6A 2E3UA 1VIHA 1WVNA 2CTLA 2HH3A 2NN6G 2YQRA 1ZZKA 2AXYA 2ANRA 1KHMA 4BA1I
chains in the Genus database with same CATH superfamily
2FMRA 1Z2IA 4DUZH 4JI4H 4LFAH 4OX9H 2FPHX 4YY3H 3T1HH 1XMOH 2UXBH 2JEBI 2CPMA 3AEVB 5K36G 1X4MA 2LTLA 2ZQEA 3VKEA 2CTKA 4JV5H 4PDBA 4LF7H 4OO1G 1MSZA 3RF2A 3OETA 5FLXW 1XRHA 2M6QA 2PT7G 1HNZH 2CPQA 2UXDH 4BA2I 4DV1H 4JYAH 4X66H 1J5KA 4E9JA 3T1YH 4QMFB 2UUAH 3SB1A 4B3RH 4YHHH 5IWAH 5DT9A 5BR8H 4DV3H 2VQEH 1SEIA 4WANA 1XMQH 4JVYA 1VIHA 1X9ZA 2CTLA 2A1SA 2HH3A 2YQRA 4B8CD 2UUCH 4DR1H 2ANRA 4B3TH 4BA1I 4DV7H 1J4WA 1N33H 4NXMH 1PQXA 2ZM6H 4NZRM 2UU9H 3U1KA 2CWHA 4NBQA 2VKCA 4GKJH 4DUYH 1ZZJA 1ODHA 4IFDG 1X4NA 4LF4H 1S03G 1V9NA 3KDKA 3QD7X 5JEAG 2K1HA 4DV5H 3J7AK 2PY9A 4DV2H 4X62H 2LF0A 4LF6H 1IBKH 4JI3H 4JVHA 2JZXA 1X0AA 5LMUH 1FKAH 1XNQH 4JI1H 2DGRA 3L7ZC 4DV0H 4KHPH 4JI7H 2E3UA 1S20A 2LTMA 3EZJA 1XNRH 1WVNA 4FJUA 4OCHA 4JI8H 4GKKH 1TUAA 4LFBH 2UXCH 2CTFA 4DR2H 2JEAI 2Z0SA 5LL6b 2M8WA 4AIMA 4WALA 1ZZIA 3V69A 2P2RA 1FJGH 2ANNA 4DR6H 4LFCH 3GKUA 4FJSA 5A2QW 1IBMH 3GABA 2VQFH 3JAMW 5IT9W 2HH2A 3J81W 4DV4H 2JE6I 1WHRA 1HNXH 1DT4A 2G8YA 2CTJA 4K0KH 1NXUA 2E5LH 2OPVA 3OSSD 1I6UA 1UG8A 2X06A 3OTOH 2O4CA 2CTMA 3NCVA 1WE8A 2JVZA 4DR4H 2UUBH 1IBLH 2MJHA 1EC6A 4JI0H 1N34H 1WTJA 1F0XA 1ZZKA 3KDGA 4LIJA 3UOEA 2AXYA 4DR3H 1N36H 2HHHH 3GR5A 1AN7A 1J5EH 4NXNH 4AM3A 2BL5A 2OPUA 4DV6H 1I94H 1DTJA 4JI6H 1VBIA 4AQYH 4X64H 4NZTM 2JA9A 4EC5A 2BA0A 5LMNH 4DR5H 4B8TA 4LF5H 4JI2H 2Y3MA 4LF9H 3FAUA 1VIGA 1ZTGA 4JI5H 4G08A 2QNDA 4B3MH 5C0XG 3I0PA 2D9IA 4X65H 4OD6A 4B3SH 2FFMA 3J80W 2PQUA 2LRRA 1K1GA 2CTEA 1HR0H 2F4VH 4H8AA 1N32H 1HNWH 2NN6G 4LF8H 1V8CA 4DR7H 2CWFA 1KHMA
chains in the Genus database with same CATH topology
1J4WA 1TUAA 2FMRA 2CTFA 4AM3A 2JEAI 2BL5A 2OPUA 2Z0SA 1ZZIA 1DTJA 2JEBI 3U1KA 4AIMA 1X4MA 3V69A 4WALA 2P2RA 2ANNA 3AEVB 4NBQA 2JA9A 2CTKA 2BA0A 3VKEA 1X4NA 4B8TA 1ZZJA 2HH2A 4IFDG 4OO1G 5JEAG 5K36G 2JE6I 1VIGA 2CPQA 2PY9A 4BA2I 1ZTGA 1J5KA 1DT4A 2QNDA 4LIJA 2CTJA 5C0XG 2OPVA 4QMFB 4JVHA 2CTMA 1WE8A 2JVZA 2JZXA 2PQUA 4WANA 1K1GA 2CTEA 2DGRA 3L7ZC 2MJHA 4JVYA 1EC6A 2E3UA 1VIHA 1WVNA 2CTLA 2HH3A 2NN6G 2YQRA 1ZZKA 2AXYA 2ANRA 1KHMA 4BA1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J4W A;  1TUA A;  2FMR A;  2CTF A;  4AM3 A;  2JEA I;  2BL5 A;  2OPU A;  2Z0S A;  1ZZI A;  1DTJ A;  2JEB I;  3U1K A;  4AIM A;  1X4M A;  3V69 A;  4WAL A;  2P2R A;  2ANN A;  3AEV B;  4NBQ A;  2JA9 A;  2CTK A;  2BA0 A;  3VKE A;  1X4N A;  4B8T A;  1ZZJ A;  2HH2 A;  4IFD G;  4OO1 G;  5JEA G;  5K36 G;  2JE6 I;  1VIG A;  2CPQ A;  2PY9 A;  4BA2 I;  1ZTG A;  1J5K A;  1DT4 A;  2QND A;  4LIJ A;  2CTJ A;  5C0X G;  2OPV A;  4QMF B;  4JVH A;  2CTM A;  1WE8 A;  2JVZ A;  2JZX A;  2PQU A;  4WAN A;  1K1G A;  2CTE A;  2DGR A;  3L7Z C;  2MJH A;  4JVY A;  1EC6 A;  2E3U A;  1VIH A;  1WVN A;  2CTL A;  2HH3 A;  2NN6 G;  2YQR A;  1ZZK A;  2AXY A;  2ANR A;  1KHM A;  4BA1 I; 
#chains in the Genus database with same CATH topology
 2FMR A;  1Z2I A;  4DUZ H;  4JI4 H;  4LFA H;  4OX9 H;  2FPH X;  4YY3 H;  3T1H H;  1XMO H;  2UXB H;  2JEB I;  2CPM A;  3AEV B;  5K36 G;  1X4M A;  2LTL A;  2ZQE A;  3VKE A;  2CTK A;  4JV5 H;  4PDB A;  4LF7 H;  4OO1 G;  1MSZ A;  3RF2 A;  3OET A;  5FLX W;  1XRH A;  2M6Q A;  2PT7 G;  1HNZ H;  2CPQ A;  2UXD H;  4BA2 I;  4DV1 H;  4JYA H;  4X66 H;  1J5K A;  4E9J A;  3T1Y H;  4QMF B;  2UUA H;  3SB1 A;  4B3R H;  4YHH H;  5IWA H;  5DT9 A;  5BR8 H;  4DV3 H;  2VQE H;  1SEI A;  4WAN A;  1XMQ H;  4JVY A;  1VIH A;  1X9Z A;  2CTL A;  2A1S A;  2HH3 A;  2YQR A;  4B8C D;  2UUC H;  4DR1 H;  2ANR A;  4B3T H;  4BA1 I;  4DV7 H;  1J4W A;  1N33 H;  4NXM H;  1PQX A;  2ZM6 H;  4NZR M;  2UU9 H;  3U1K A;  2CWH A;  4NBQ A;  2VKC A;  4GKJ H;  4DUY H;  1ZZJ A;  1ODH A;  4IFD G;  1X4N A;  4LF4 H;  1S03 G;  1V9N A;  3KDK A;  3QD7 X;  5JEA G;  2K1H A;  4DV5 H;  3J7A K;  2PY9 A;  4DV2 H;  4X62 H;  2LF0 A;  4LF6 H;  1IBK H;  4JI3 H;  4JVH A;  2JZX A;  1X0A A;  5LMU H;  1FKA H;  1XNQ H;  4JI1 H;  2DGR A;  3L7Z C;  4DV0 H;  4KHP H;  4JI7 H;  2E3U A;  1S20 A;  2LTM A;  3EZJ A;  1XNR H;  1WVN A;  4FJU A;  4OCH A;  4JI8 H;  4GKK H;  1TUA A;  4LFB H;  2UXC H;  2CTF A;  4DR2 H;  2JEA I;  2Z0S A;  5LL6 b;  2M8W A;  4AIM A;  4WAL A;  1ZZI A;  3V69 A;  2P2R A;  1FJG H;  2ANN A;  4DR6 H;  4LFC H;  3GKU A;  4FJS A;  5A2Q W;  1IBM H;  3GAB A;  2VQF H;  3JAM W;  5IT9 W;  2HH2 A;  3J81 W;  4DV4 H;  2JE6 I;  1WHR A;  1HNX H;  1DT4 A;  2G8Y A;  2CTJ A;  4K0K H;  1NXU A;  2E5L H;  2OPV A;  3OSS D;  1I6U A;  1UG8 A;  2X06 A;  3OTO H;  2O4C A;  2CTM A;  3NCV A;  1WE8 A;  2JVZ A;  4DR4 H;  2UUB H;  1IBL H;  2MJH A;  1EC6 A;  4JI0 H;  1N34 H;  1WTJ A;  1F0X A;  1ZZK A;  3KDG A;  4LIJ A;  3UOE A;  2AXY A;  4DR3 H;  1N36 H;  2HHH H;  3GR5 A;  1AN7 A;  1J5E H;  4NXN H;  4AM3 A;  2BL5 A;  2OPU A;  4DV6 H;  1I94 H;  1DTJ A;  4JI6 H;  1VBI A;  4AQY H;  4X64 H;  4NZT M;  2JA9 A;  4EC5 A;  2BA0 A;  5LMN H;  4DR5 H;  4B8T A;  4LF5 H;  4JI2 H;  2Y3M A;  4LF9 H;  3FAU A;  1VIG A;  1ZTG A;  4JI5 H;  4G08 A;  2QND A;  4B3M H;  5C0X G;  3I0P A;  2D9I A;  4X65 H;  4OD6 A;  4B3S H;  2FFM A;  3J80 W;  2PQU A;  2LRR A;  1K1G A;  2CTE A;  1HR0 H;  2F4V H;  4H8A A;  1N32 H;  1HNW H;  2NN6 G;  4LF8 H;  1V8C A;  4DR7 H;  2CWF A;  1KHM A; 
#chains in the Genus database with same CATH homology
 1J4W A;  1TUA A;  2FMR A;  2CTF A;  4AM3 A;  2JEA I;  2BL5 A;  2OPU A;  2Z0S A;  1ZZI A;  1DTJ A;  2JEB I;  3U1K A;  4AIM A;  1X4M A;  3V69 A;  4WAL A;  2P2R A;  2ANN A;  3AEV B;  4NBQ A;  2JA9 A;  2CTK A;  2BA0 A;  3VKE A;  1X4N A;  4B8T A;  1ZZJ A;  2HH2 A;  4IFD G;  4OO1 G;  5JEA G;  5K36 G;  2JE6 I;  1VIG A;  2CPQ A;  2PY9 A;  4BA2 I;  1ZTG A;  1J5K A;  1DT4 A;  2QND A;  4LIJ A;  2CTJ A;  5C0X G;  2OPV A;  4QMF B;  4JVH A;  2CTM A;  1WE8 A;  2JVZ A;  2JZX A;  2PQU A;  4WAN A;  1K1G A;  2CTE A;  2DGR A;  3L7Z C;  2MJH A;  4JVY A;  1EC6 A;  2E3U A;  1VIH A;  1WVN A;  2CTL A;  2HH3 A;  2NN6 G;  2YQR A;  1ZZK A;  2AXY A;  2ANR A;  1KHM A;  4BA1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...