1KHMA

C-terminal kh domain of hnrnp k (kh3)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
b'GSPNSYGDLGGPIITTQVTIPKDLARSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High precision solution structure of the C-terminal KH domain of heterogeneous nuclear ribonucleoprotein K, a c-myc transcription factor.
pubmed doi rcsb
molecule keywords PROTEIN (HNRNP K)
source organism Homo sapiens
molecule tags Rna binding protein
total genus 16
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1999-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1khmA00
2ANRA 1DT4A 4NBQA 3VKEA 1ZZIA 1X4MA 3V69A 4BA1I 1ZTGA 2JEAI 2MJHA 5K36G 2JVZA 2ANNA 2PY9A 2FMRA 2CTEA 2DGRA 5C0XG 3AEVB 2Z0SA 2JEBI 4WALA 1TUAA 2JZXA 2BL5A 1EC6A 2PQUA 4JVHA 2BA0A 1DTJA 2HH3A 5JEAG 1WE8A 4B8TA 2OPUA 4WANA 1VIHA 2QNDA 2CTMA 1WVNA 2P2RA 2YQRA 4JVYA 1ZZKA 2CTLA 4AIMA 2JE6I 2JA9A 2OPVA 4QMFB 2E3UA 3L7ZC 4AM3A 1KHMA 2CTFA 4LIJA 3U1KA 1J4WA 1K1GA 1J5KA 4BA2I 4OO1G 2CTJA 2NN6G 1VIGA 2CTKA 2HH2A 1ZZJA 4IFDG 2CPQA 1X4NA 2AXYA
chains in the Genus database with same CATH superfamily
2ANRA 4YY3H 1X4MA 4BA1I 1XMOH 4DV1H 1ZTGA 2JVZA 1XNRH 3T1YH 3KDKA 4EC5A 2PY9A 2CTEA 3AEVB 4LF5H 2Y3MA 2BL5A 1NXUA 1DTJA 3QD7X 2CPMA 1WE8A 5JEAG 4B8TA 2E5LH 5LL6b 4JI1H 5DT9A 4LFBH 4B3TH 1IBKH 1S03G 1S20A 4JI0H 4OD6A 1WVNA 2UU9H 4DV0H 2YQRA 1ZZKA 2CTLA 2X06A 3OETA 4JI5H 2JE6I 2JA9A 1HNWH 3J7AK 4X66H 1WTJA 1V8CA 4NZTM 4AM3A 3GR5A 1X0AA 2UUBH 4DR1H 4DUYH 4LFAH 1WHRA 4NZRM 4X65H 4E9JA 4OX9H 2CTKA 2UUAH 2AXYA 4DR7H 4FJSA 3VKEA 3V69A 3I0PA 2MJHA 3J81W 5LMNH 1EC6A 2JEBI 3OTOH 2JZXA 1I94H 2PQUA 1V9NA 4JI6H 2UUCH 4LF4H 2BA0A 4JI2H 2HH3A 2LTMA 5LMUH 4JV5H 5A2QW 1J5EH 2LF0A 4AQYH 1HNXH 4LF7H 3OSSD 2F4VH 1N36H 4JYAH 4DV6H 4DR2H 2CWFA 3FAUA 3KDGA 4JI7H 2CTFA 4LIJA 4DV4H 4OCHA 4DV3H 4B8CD 5IWAH 4JI3H 2UXCH 4OO1G 4GKJH 2CTJA 4NXNH 1X4NA 3T1HH 2UXBH 3GKUA 4NBQA 2K1HA 1ZZIA 5K36G 5FLXW 2ZM6H 1XMQH 2ANNA 2FMRA 4X62H 2O4CA 4WALA 1TUAA 4FJUA 4B3MH 4GKKH 4JVHA 2A1SA 1I6UA 2UXDH 4JI4H 1VIHA 1HR0H 1N32H 4YHHH 4DV5H 1AN7A 4JI8H 2FFMA 3JAMW 4B3RH 4JVYA 4LFCH 4B3SH 1Z2IA 2FPHX 4QMFB 4LF9H 1MSZA 4DV7H 1VBIA 4NXMH 2HHHH 1FKAH 1ODHA 1J4WA 1K1GA 1J5KA 4BA2I 4PDBA 4LF6H 2LRRA 3EZJA 2NN6G 1ZZJA 2OPVA 4DR5H 4DR4H 3GABA 1FJGH 2PT7G 1DT4A 2M6QA 2JEAI 1F0XA 3UOEA 3NCVA 1XNQH 4DV2H 4KHPH 4X64H 4LF8H 2DGRA 5C0XG 2VQEH 2Z0SA 1UG8A 1XRHA 1SEIA 2LTLA 2VQFH 3J80W 3SB1A 2G8YA 1N33H 1HNZH 2OPUA 1N34H 4WANA 2M8WA 2QNDA 1IBLH 5BR8H 2CTMA 2P2RA 5IT9W 3RF2A 2D9IA 4DUZH 4AIMA 4DR6H 2E3UA 1X9ZA 3L7ZC 4DR3H 1KHMA 4G08A 3U1KA 2CWHA 1IBMH 4K0KH 1PQXA 4H8AA 2VKCA 1VIGA 2HH2A 2ZQEA 4IFDG 2CPQA
chains in the Genus database with same CATH topology
2ANRA 1DT4A 4NBQA 3VKEA 1ZZIA 1X4MA 3V69A 4BA1I 1ZTGA 2JEAI 2MJHA 5K36G 2JVZA 2ANNA 2PY9A 2FMRA 2CTEA 2DGRA 5C0XG 3AEVB 2Z0SA 2JEBI 4WALA 1TUAA 2JZXA 2BL5A 1EC6A 2PQUA 4JVHA 2BA0A 1DTJA 2HH3A 5JEAG 1WE8A 4B8TA 2OPUA 4WANA 1VIHA 2QNDA 2CTMA 1WVNA 2P2RA 2YQRA 4JVYA 1ZZKA 2CTLA 4AIMA 2JE6I 2JA9A 2OPVA 4QMFB 2E3UA 3L7ZC 4AM3A 1KHMA 2CTFA 4LIJA 3U1KA 1J4WA 1K1GA 1J5KA 4BA2I 4OO1G 2CTJA 2NN6G 1VIGA 2CTKA 2HH2A 1ZZJA 4IFDG 2CPQA 1X4NA 2AXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ANR A;  1DT4 A;  4NBQ A;  3VKE A;  1ZZI A;  1X4M A;  3V69 A;  4BA1 I;  1ZTG A;  2JEA I;  2MJH A;  5K36 G;  2JVZ A;  2ANN A;  2PY9 A;  2FMR A;  2CTE A;  2DGR A;  5C0X G;  3AEV B;  2Z0S A;  2JEB I;  4WAL A;  1TUA A;  2JZX A;  2BL5 A;  1EC6 A;  2PQU A;  4JVH A;  2BA0 A;  1DTJ A;  2HH3 A;  5JEA G;  1WE8 A;  4B8T A;  2OPU A;  4WAN A;  1VIH A;  2QND A;  2CTM A;  1WVN A;  2P2R A;  2YQR A;  4JVY A;  1ZZK A;  2CTL A;  4AIM A;  2JE6 I;  2JA9 A;  2OPV A;  4QMF B;  2E3U A;  3L7Z C;  4AM3 A;  1KHM A;  2CTF A;  4LIJ A;  3U1K A;  1J4W A;  1K1G A;  1J5K A;  4BA2 I;  4OO1 G;  2CTJ A;  2NN6 G;  1VIG A;  2CTK A;  2HH2 A;  1ZZJ A;  4IFD G;  2CPQ A;  1X4N A;  2AXY A; 
#chains in the Genus database with same CATH topology
 2ANR A;  4YY3 H;  1X4M A;  4BA1 I;  1XMO H;  4DV1 H;  1ZTG A;  2JVZ A;  1XNR H;  3T1Y H;  3KDK A;  4EC5 A;  2PY9 A;  2CTE A;  3AEV B;  4LF5 H;  2Y3M A;  2BL5 A;  1NXU A;  1DTJ A;  3QD7 X;  2CPM A;  1WE8 A;  5JEA G;  4B8T A;  2E5L H;  5LL6 b;  4JI1 H;  5DT9 A;  4LFB H;  4B3T H;  1IBK H;  1S03 G;  1S20 A;  4JI0 H;  4OD6 A;  1WVN A;  2UU9 H;  4DV0 H;  2YQR A;  1ZZK A;  2CTL A;  2X06 A;  3OET A;  4JI5 H;  2JE6 I;  2JA9 A;  1HNW H;  3J7A K;  4X66 H;  1WTJ A;  1V8C A;  4NZT M;  4AM3 A;  3GR5 A;  1X0A A;  2UUB H;  4DR1 H;  4DUY H;  4LFA H;  1WHR A;  4NZR M;  4X65 H;  4E9J A;  4OX9 H;  2CTK A;  2UUA H;  2AXY A;  4DR7 H;  4FJS A;  3VKE A;  3V69 A;  3I0P A;  2MJH A;  3J81 W;  5LMN H;  1EC6 A;  2JEB I;  3OTO H;  2JZX A;  1I94 H;  2PQU A;  1V9N A;  4JI6 H;  2UUC H;  4LF4 H;  2BA0 A;  4JI2 H;  2HH3 A;  2LTM A;  5LMU H;  4JV5 H;  5A2Q W;  1J5E H;  2LF0 A;  4AQY H;  1HNX H;  4LF7 H;  3OSS D;  2F4V H;  1N36 H;  4JYA H;  4DV6 H;  4DR2 H;  2CWF A;  3FAU A;  3KDG A;  4JI7 H;  2CTF A;  4LIJ A;  4DV4 H;  4OCH A;  4DV3 H;  4B8C D;  5IWA H;  4JI3 H;  2UXC H;  4OO1 G;  4GKJ H;  2CTJ A;  4NXN H;  1X4N A;  3T1H H;  2UXB H;  3GKU A;  4NBQ A;  2K1H A;  1ZZI A;  5K36 G;  5FLX W;  2ZM6 H;  1XMQ H;  2ANN A;  2FMR A;  4X62 H;  2O4C A;  4WAL A;  1TUA A;  4FJU A;  4B3M H;  4GKK H;  4JVH A;  2A1S A;  1I6U A;  2UXD H;  4JI4 H;  1VIH A;  1HR0 H;  1N32 H;  4YHH H;  4DV5 H;  1AN7 A;  4JI8 H;  2FFM A;  3JAM W;  4B3R H;  4JVY A;  4LFC H;  4B3S H;  1Z2I A;  2FPH X;  4QMF B;  4LF9 H;  1MSZ A;  4DV7 H;  1VBI A;  4NXM H;  2HHH H;  1FKA H;  1ODH A;  1J4W A;  1K1G A;  1J5K A;  4BA2 I;  4PDB A;  4LF6 H;  2LRR A;  3EZJ A;  2NN6 G;  1ZZJ A;  2OPV A;  4DR5 H;  4DR4 H;  3GAB A;  1FJG H;  2PT7 G;  1DT4 A;  2M6Q A;  2JEA I;  1F0X A;  3UOE A;  3NCV A;  1XNQ H;  4DV2 H;  4KHP H;  4X64 H;  4LF8 H;  2DGR A;  5C0X G;  2VQE H;  2Z0S A;  1UG8 A;  1XRH A;  1SEI A;  2LTL A;  2VQF H;  3J80 W;  3SB1 A;  2G8Y A;  1N33 H;  1HNZ H;  2OPU A;  1N34 H;  4WAN A;  2M8W A;  2QND A;  1IBL H;  5BR8 H;  2CTM A;  2P2R A;  5IT9 W;  3RF2 A;  2D9I A;  4DUZ H;  4AIM A;  4DR6 H;  2E3U A;  1X9Z A;  3L7Z C;  4DR3 H;  1KHM A;  4G08 A;  3U1K A;  2CWH A;  1IBM H;  4K0K H;  1PQX A;  4H8A A;  2VKC A;  1VIG A;  2HH2 A;  2ZQE A;  4IFD G;  2CPQ A; 
#chains in the Genus database with same CATH homology
 2ANR A;  1DT4 A;  4NBQ A;  3VKE A;  1ZZI A;  1X4M A;  3V69 A;  4BA1 I;  1ZTG A;  2JEA I;  2MJH A;  5K36 G;  2JVZ A;  2ANN A;  2PY9 A;  2FMR A;  2CTE A;  2DGR A;  5C0X G;  3AEV B;  2Z0S A;  2JEB I;  4WAL A;  1TUA A;  2JZX A;  2BL5 A;  1EC6 A;  2PQU A;  4JVH A;  2BA0 A;  1DTJ A;  2HH3 A;  5JEA G;  1WE8 A;  4B8T A;  2OPU A;  4WAN A;  1VIH A;  2QND A;  2CTM A;  1WVN A;  2P2R A;  2YQR A;  4JVY A;  1ZZK A;  2CTL A;  4AIM A;  2JE6 I;  2JA9 A;  2OPV A;  4QMF B;  2E3U A;  3L7Z C;  4AM3 A;  1KHM A;  2CTF A;  4LIJ A;  3U1K A;  1J4W A;  1K1G A;  1J5K A;  4BA2 I;  4OO1 G;  2CTJ A;  2NN6 G;  1VIG A;  2CTK A;  2HH2 A;  1ZZJ A;  4IFD G;  2CPQ A;  1X4N A;  2AXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...