1KHMA

C-terminal kh domain of hnrnp k (kh3)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
GSPNSYGDLGGPIITTQVTIPKDLARSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High precision solution structure of the C-terminal KH domain of heterogeneous nuclear ribonucleoprotein K, a c-myc transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords PROTEIN (HNRNP K)
total genus 16
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1999-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1khmA00
4LIJA 1WE8A 2BA0A 2HH3A 1VIGA 1ZTGA 4OO1G 5K36G 3VKEA 2PY9A 3AEVB 4WALA 2ANRA 4AIMA 4BA2I 2CTMA 1X4NA 1TUAA 1KHMA 5JEAG 5C0XG 2JVZA 4JVHA 2JZXA 4IFDG 2CTFA 2OPVA 4BA1I 1DTJA 2PQUA 2ANNA 4AM3A 4WANA 4NBQA 1J5KA 1EC6A 1ZZJA 1J4WA 2FMRA 2CPQA 4QMFB 2P2RA 2QNDA 2CTEA 2YQRA 1X4MA 1DT4A 2JEBI 2JA9A 2NN6G 2MJHA 2Z0SA 2CTKA 2HH2A 2OPUA 1VIHA 4JVYA 2CTLA 3L7ZC 1WVNA 3V69A 2AXYA 1K1GA 2DGRA 2E3UA 2CTJA 1ZZKA 3U1KA 2JEAI 1ZZIA 4B8TA 2BL5A 2JE6I
chains in the Genus database with same CATH superfamily
4X64H 2HH3A 4PDBA 2UU9H 2M6QA 5A2QW 4B3SH 2CWHA 3AEVB 4DV1H 2VQEH 4OD6A 1UG8A 1WHRA 3RF2A 4GKKH 2CTMA 5LL6b 1KHMA 1XRHA 5JEAG 3T1YH 1XNRH 2ZQEA 4YHHH 2OPVA 3SB1A 4BA1I 3T1HH 2E5LH 4DR7H 4WANA 1I94H 4EC5A 2FMRA 4DR3H 1IBMH 2D9IA 1HNZH 2P2RA 5LMNH 4JI3H 1IBKH 4K0KH 1FJGH 2JEBI 2G8YA 4LFAH 1NXUA 2NN6G 4DV6H 2HH2A 2UUBH 4NXMH 2VQFH 3V69A 4LFCH 4GKJH 1HNWH 1X9ZA 1XMOH 4DV0H 2JVZA 4JV5H 4B8CD 4LF4H 1N32H 1ODHA 4JI8H 1IBLH 4JI4H 4B3RH 4H8AA 4FJUA 4LF8H 4WALA 2ANRA 4AIMA 2A1SA 1X4NA 1F0XA 1TUAA 4DV7H 4JVHA 2JZXA 1J5EH 4IFDG 3FAUA 4NBQA 2PT7G 3KDGA 5IT9W 4AQYH 1ZZJA 4G08A 2CPQA 5IWAH 3QD7X 4QMFB 1S20A 2FFMA 2QNDA 2YQRA 1DT4A 1X0AA 4KHPH 2Z0SA 2X06A 1VIHA 2UXCH 4NZRM 1I6UA 1WVNA 4DV2H 4JI0H 3GR5A 3J80W 3EZJA 2CTJA 4DR2H 4JI1H 2F4VH 4LFBH 1ZZKA 2JEAI 3I0PA 2O4CA 4B8TA 1ZZIA 2BL5A 4LF5H 4DR4H 1WE8A 2BA0A 5BR8H 1VIGA 3OTOH 1ZTGA 4OO1G 2Y3MA 2PY9A 1S03G 5LMUH 4OX9H 4X65H 4JI7H 4BA2I 2HHHH 2LTMA 4E9JA 3KDKA 4X62H 1VBIA 4JYAH 2CPMA 2M8WA 2ANNA 2VKCA 4X66H 2UUAH 4NZTM 2FPHX 4LF7H 1J5KA 1EC6A 1J4WA 1V9NA 4NXNH 4DUZH 2CTEA 1X4MA 1PQXA 4YY3H 2OPUA 2UUCH 3L7ZC 2AXYA 4LF9H 5FLXW 4DR5H 1K1GA 2DGRA 3GKUA 3OSSD 3UOEA 4LF6H 3U1KA 3J7AK 4B3TH 2JE6I 4DR1H 4LIJA 3J81W 4DV3H 5K36G 3VKEA 5DT9A 1WTJA 2UXBH 4JI2H 1N33H 2LRRA 1MSZA 4OCHA 5C0XG 2CTFA 4DV4H 2UXDH 1DTJA 2PQUA 4AM3A 4JI6H 4DV5H 3JAMW 1XNQH 3NCVA 1N34H 1Z2IA 2K1HA 1V8CA 1N36H 2JA9A 4B3MH 4JI5H 2MJHA 2CTKA 3OETA 3GABA 4JVYA 2LF0A 1SEIA 2CTLA 1HR0H 4FJSA 2ZM6H 1AN7A 2E3UA 1XMQH 1FKAH 4DR6H 2LTLA 1HNXH 4DUYH 2CWFA
chains in the Genus database with same CATH topology
4LIJA 1WE8A 2BA0A 2HH3A 1VIGA 1ZTGA 4OO1G 5K36G 3VKEA 2PY9A 3AEVB 4WALA 2ANRA 4AIMA 4BA2I 2CTMA 1X4NA 1TUAA 1KHMA 5JEAG 5C0XG 2JVZA 4JVHA 2JZXA 4IFDG 2CTFA 2OPVA 4BA1I 1DTJA 2PQUA 2ANNA 4AM3A 4WANA 4NBQA 1J5KA 1EC6A 1ZZJA 1J4WA 2FMRA 2CPQA 4QMFB 2P2RA 2QNDA 2CTEA 2YQRA 1X4MA 1DT4A 2JEBI 2JA9A 2NN6G 2MJHA 2Z0SA 2CTKA 2HH2A 2OPUA 1VIHA 4JVYA 2CTLA 3L7ZC 1WVNA 3V69A 2AXYA 1K1GA 2DGRA 2E3UA 2CTJA 1ZZKA 3U1KA 2JEAI 1ZZIA 4B8TA 2BL5A 2JE6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LIJ A;  1WE8 A;  2BA0 A;  2HH3 A;  1VIG A;  1ZTG A;  4OO1 G;  5K36 G;  3VKE A;  2PY9 A;  3AEV B;  4WAL A;  2ANR A;  4AIM A;  4BA2 I;  2CTM A;  1X4N A;  1TUA A;  1KHM A;  5JEA G;  5C0X G;  2JVZ A;  4JVH A;  2JZX A;  4IFD G;  2CTF A;  2OPV A;  4BA1 I;  1DTJ A;  2PQU A;  2ANN A;  4AM3 A;  4WAN A;  4NBQ A;  1J5K A;  1EC6 A;  1ZZJ A;  1J4W A;  2FMR A;  2CPQ A;  4QMF B;  2P2R A;  2QND A;  2CTE A;  2YQR A;  1X4M A;  1DT4 A;  2JEB I;  2JA9 A;  2NN6 G;  2MJH A;  2Z0S A;  2CTK A;  2HH2 A;  2OPU A;  1VIH A;  4JVY A;  2CTL A;  3L7Z C;  1WVN A;  3V69 A;  2AXY A;  1K1G A;  2DGR A;  2E3U A;  2CTJ A;  1ZZK A;  3U1K A;  2JEA I;  1ZZI A;  4B8T A;  2BL5 A;  2JE6 I; 
#chains in the Genus database with same CATH topology
 4X64 H;  2HH3 A;  4PDB A;  2UU9 H;  2M6Q A;  5A2Q W;  4B3S H;  2CWH A;  3AEV B;  4DV1 H;  2VQE H;  4OD6 A;  1UG8 A;  1WHR A;  3RF2 A;  4GKK H;  2CTM A;  5LL6 b;  1KHM A;  1XRH A;  5JEA G;  3T1Y H;  1XNR H;  2ZQE A;  4YHH H;  2OPV A;  3SB1 A;  4BA1 I;  3T1H H;  2E5L H;  4DR7 H;  4WAN A;  1I94 H;  4EC5 A;  2FMR A;  4DR3 H;  1IBM H;  2D9I A;  1HNZ H;  2P2R A;  5LMN H;  4JI3 H;  1IBK H;  4K0K H;  1FJG H;  2JEB I;  2G8Y A;  4LFA H;  1NXU A;  2NN6 G;  4DV6 H;  2HH2 A;  2UUB H;  4NXM H;  2VQF H;  3V69 A;  4LFC H;  4GKJ H;  1HNW H;  1X9Z A;  1XMO H;  4DV0 H;  2JVZ A;  4JV5 H;  4B8C D;  4LF4 H;  1N32 H;  1ODH A;  4JI8 H;  1IBL H;  4JI4 H;  4B3R H;  4H8A A;  4FJU A;  4LF8 H;  4WAL A;  2ANR A;  4AIM A;  2A1S A;  1X4N A;  1F0X A;  1TUA A;  4DV7 H;  4JVH A;  2JZX A;  1J5E H;  4IFD G;  3FAU A;  4NBQ A;  2PT7 G;  3KDG A;  5IT9 W;  4AQY H;  1ZZJ A;  4G08 A;  2CPQ A;  5IWA H;  3QD7 X;  4QMF B;  1S20 A;  2FFM A;  2QND A;  2YQR A;  1DT4 A;  1X0A A;  4KHP H;  2Z0S A;  2X06 A;  1VIH A;  2UXC H;  4NZR M;  1I6U A;  1WVN A;  4DV2 H;  4JI0 H;  3GR5 A;  3J80 W;  3EZJ A;  2CTJ A;  4DR2 H;  4JI1 H;  2F4V H;  4LFB H;  1ZZK A;  2JEA I;  3I0P A;  2O4C A;  4B8T A;  1ZZI A;  2BL5 A;  4LF5 H;  4DR4 H;  1WE8 A;  2BA0 A;  5BR8 H;  1VIG A;  3OTO H;  1ZTG A;  4OO1 G;  2Y3M A;  2PY9 A;  1S03 G;  5LMU H;  4OX9 H;  4X65 H;  4JI7 H;  4BA2 I;  2HHH H;  2LTM A;  4E9J A;  3KDK A;  4X62 H;  1VBI A;  4JYA H;  2CPM A;  2M8W A;  2ANN A;  2VKC A;  4X66 H;  2UUA H;  4NZT M;  2FPH X;  4LF7 H;  1J5K A;  1EC6 A;  1J4W A;  1V9N A;  4NXN H;  4DUZ H;  2CTE A;  1X4M A;  1PQX A;  4YY3 H;  2OPU A;  2UUC H;  3L7Z C;  2AXY A;  4LF9 H;  5FLX W;  4DR5 H;  1K1G A;  2DGR A;  3GKU A;  3OSS D;  3UOE A;  4LF6 H;  3U1K A;  3J7A K;  4B3T H;  2JE6 I;  4DR1 H;  4LIJ A;  3J81 W;  4DV3 H;  5K36 G;  3VKE A;  5DT9 A;  1WTJ A;  2UXB H;  4JI2 H;  1N33 H;  2LRR A;  1MSZ A;  4OCH A;  5C0X G;  2CTF A;  4DV4 H;  2UXD H;  1DTJ A;  2PQU A;  4AM3 A;  4JI6 H;  4DV5 H;  3JAM W;  1XNQ H;  3NCV A;  1N34 H;  1Z2I A;  2K1H A;  1V8C A;  1N36 H;  2JA9 A;  4B3M H;  4JI5 H;  2MJH A;  2CTK A;  3OET A;  3GAB A;  4JVY A;  2LF0 A;  1SEI A;  2CTL A;  1HR0 H;  4FJS A;  2ZM6 H;  1AN7 A;  2E3U A;  1XMQ H;  1FKA H;  4DR6 H;  2LTL A;  1HNX H;  4DUY H;  2CWF A; 
#chains in the Genus database with same CATH homology
 4LIJ A;  1WE8 A;  2BA0 A;  2HH3 A;  1VIG A;  1ZTG A;  4OO1 G;  5K36 G;  3VKE A;  2PY9 A;  3AEV B;  4WAL A;  2ANR A;  4AIM A;  4BA2 I;  2CTM A;  1X4N A;  1TUA A;  1KHM A;  5JEA G;  5C0X G;  2JVZ A;  4JVH A;  2JZX A;  4IFD G;  2CTF A;  2OPV A;  4BA1 I;  1DTJ A;  2PQU A;  2ANN A;  4AM3 A;  4WAN A;  4NBQ A;  1J5K A;  1EC6 A;  1ZZJ A;  1J4W A;  2FMR A;  2CPQ A;  4QMF B;  2P2R A;  2QND A;  2CTE A;  2YQR A;  1X4M A;  1DT4 A;  2JEB I;  2JA9 A;  2NN6 G;  2MJH A;  2Z0S A;  2CTK A;  2HH2 A;  2OPU A;  1VIH A;  4JVY A;  2CTL A;  3L7Z C;  1WVN A;  3V69 A;  2AXY A;  1K1G A;  2DGR A;  2E3U A;  2CTJ A;  1ZZK A;  3U1K A;  2JEA I;  1ZZI A;  4B8T A;  2BL5 A;  2JE6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...