1KHMA

C-terminal kh domain of hnrnp k (kh3)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
GSPNSYGDLGGPIITTQVTIPKDLARSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HNRNP K)
publication title High precision solution structure of the C-terminal KH domain of heterogeneous nuclear ribonucleoprotein K, a c-myc transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 16
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1999-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1khmA00
2CTFA 1VIHA 1X4MA 2Z0SA 2CTEA 2HH3A 1J4WA 3VKEA 1ZZIA 1ZTGA 4IFDG 5C0XG 2E3UA 4WANA 2BA0A 4LIJA 3U1KA 1DTJA 3V69A 2JEAI 3AEVB 2NN6G 4BA2I 2PY9A 2ANRA 2JVZA 2CTKA 4B8TA 2CTLA 2OPVA 2MJHA 2DGRA 2YQRA 2BL5A 2FMRA 1J5KA 5JEAG 2JA9A 1ZZJA 5K36G 1TUAA 4NBQA 2CTJA 1K1GA 2AXYA 2JE6I 2JZXA 4JVYA 1WVNA 2CPQA 1DT4A 2OPUA 2JEBI 4BA1I 2ANNA 1EC6A 2QNDA 4WALA 4OO1G 2HH2A 1X4NA 2CTMA 4QMFB 1KHMA 2PQUA 1ZZKA 4AM3A 4AIMA 3L7ZC 2P2RA 4JVHA 1VIGA 1WE8A
chains in the Genus database with same CATH superfamily
1VIHA 2CTEA 2CPMA 4E9JA 4DV5H 4IFDG 1HNWH 4K0KH 2A1SA 3U1KA 2ZM6H 4DR3H 1XMOH 1S03G 2NN6G 2JEAI 2LRRA 3FAUA 2CTKA 2MJHA 2DGRA 5LL6b 4OD6A 2BL5A 3GABA 3T1YH 3OETA 2FMRA 1J5KA 2JA9A 4DV1H 1ZZJA 4NBQA 4X65H 2CTJA 4LFBH 5IT9W 2JZXA 4JVYA 1N33H 1IBLH 2FFMA 3GR5A 4LF6H 1N34H 1MSZA 2UUCH 4QMFB 1FKAH 4LFCH 4X62H 3SB1A 4DR4H 3J80W 2F4VH 1VIGA 5A2QW 2CTFA 1X4MA 4B3RH 2Z0SA 4LF8H 2HH3A 2FPHX 1XNQH 1ZZIA 4LF4H 2LF0A 2HHHH 4DUYH 3AEVB 4JI6H 2JVZA 4JI7H 1XMQH 2M8WA 1PQXA 3JAMW 4B8TA 4B3TH 1N32H 4B3MH 4LF9H 4OX9H 3OSSD 3UOEA 4LF5H 2O4CA 4X64H 1V9NA 2M6QA 4DV4H 4LFAH 1UG8A 5BR8H 2AXYA 4YY3H 1WVNA 1F0XA 2JEBI 2ANNA 1EC6A 2ZQEA 4JI0H 4JI3H 3J81W 4GKKH 1NXUA 2VQEH 2CTMA 4DR7H 1SEIA 1J5EH 1ZZKA 5LMNH 1WE8A 1HNXH 1ZTGA 2E5LH 4DR6H 2E3UA 4WANA 2BA0A 4LIJA 4FJUA 1DTJA 3V69A 3NCVA 4OCHA 4JI2H 4DV0H 4JI5H 1S20A 4BA2I 4JI1H 2CTLA 4FJSA 4DV3H 2X06A 2LTLA 1XRHA 1HNZH 2UUBH 4NZTM 2UXCH 2LTMA 4DR2H 2UU9H 1I94H 1TUAA 4LF7H 1K1GA 2PT7G 4NZRM 1FJGH 4DUZH 1DT4A 1X0AA 1VBIA 2UUAH 4PDBA 4B3SH 2CWFA 2CWHA 2QNDA 2Y3MA 1N36H 3J7AK 2G8YA 4DV7H 1HR0H 2HH2A 4NXMH 5FLXW 2PQUA 4NXNH 4AIMA 3L7ZC 5LMUH 2ANRA 4JVHA 4BA1I 1AN7A 4DR5H 3I0PA 4G08A 4DR1H 4JI4H 1IBMH 2D9IA 1J4WA 3VKEA 1Z2IA 4EC5A 5C0XG 4OO1G 1X9ZA 1IBKH 2PY9A 4DV6H 3KDGA 2OPVA 4AQYH 1XNRH 4GKJH 4DV2H 2YQRA 1WHRA 5JEAG 5K36G 4KHPH 3EZJA 3RF2A 3KDKA 1ODHA 2UXBH 2JE6I 2VQFH 4JYAH 1I6UA 4B8CD 4JV5H 2CPQA 2OPUA 4X66H 1WTJA 2K1HA 4JI8H 2UXDH 4YHHH 3QD7X 4WALA 3OTOH 3GKUA 1X4NA 1V8CA 1KHMA 5IWAH 4AM3A 2P2RA 3T1HH 4H8AA 5DT9A 2VKCA
chains in the Genus database with same CATH topology
2CTFA 1VIHA 1X4MA 2Z0SA 2CTEA 2HH3A 1J4WA 3VKEA 1ZZIA 1ZTGA 4IFDG 5C0XG 2E3UA 4WANA 2BA0A 4LIJA 3U1KA 1DTJA 3V69A 2JEAI 3AEVB 2NN6G 4BA2I 2PY9A 2ANRA 2JVZA 2CTKA 4B8TA 2CTLA 2OPVA 2MJHA 2DGRA 2YQRA 2BL5A 2FMRA 1J5KA 5JEAG 2JA9A 1ZZJA 5K36G 1TUAA 4NBQA 2CTJA 1K1GA 2AXYA 2JE6I 2JZXA 4JVYA 1WVNA 2CPQA 1DT4A 2OPUA 2JEBI 4BA1I 2ANNA 1EC6A 2QNDA 4WALA 4OO1G 2HH2A 1X4NA 2CTMA 4QMFB 1KHMA 2PQUA 1ZZKA 4AM3A 4AIMA 3L7ZC 2P2RA 4JVHA 1VIGA 1WE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTF A;  1VIH A;  1X4M A;  2Z0S A;  2CTE A;  2HH3 A;  1J4W A;  3VKE A;  1ZZI A;  1ZTG A;  4IFD G;  5C0X G;  2E3U A;  4WAN A;  2BA0 A;  4LIJ A;  3U1K A;  1DTJ A;  3V69 A;  2JEA I;  3AEV B;  2NN6 G;  4BA2 I;  2PY9 A;  2ANR A;  2JVZ A;  2CTK A;  4B8T A;  2CTL A;  2OPV A;  2MJH A;  2DGR A;  2YQR A;  2BL5 A;  2FMR A;  1J5K A;  5JEA G;  2JA9 A;  1ZZJ A;  5K36 G;  1TUA A;  4NBQ A;  2CTJ A;  1K1G A;  2AXY A;  2JE6 I;  2JZX A;  4JVY A;  1WVN A;  2CPQ A;  1DT4 A;  2OPU A;  2JEB I;  4BA1 I;  2ANN A;  1EC6 A;  2QND A;  4WAL A;  4OO1 G;  2HH2 A;  1X4N A;  2CTM A;  4QMF B;  1KHM A;  2PQU A;  1ZZK A;  4AM3 A;  4AIM A;  3L7Z C;  2P2R A;  4JVH A;  1VIG A;  1WE8 A; 
#chains in the Genus database with same CATH topology
 1VIH A;  2CTE A;  2CPM A;  4E9J A;  4DV5 H;  4IFD G;  1HNW H;  4K0K H;  2A1S A;  3U1K A;  2ZM6 H;  4DR3 H;  1XMO H;  1S03 G;  2NN6 G;  2JEA I;  2LRR A;  3FAU A;  2CTK A;  2MJH A;  2DGR A;  5LL6 b;  4OD6 A;  2BL5 A;  3GAB A;  3T1Y H;  3OET A;  2FMR A;  1J5K A;  2JA9 A;  4DV1 H;  1ZZJ A;  4NBQ A;  4X65 H;  2CTJ A;  4LFB H;  5IT9 W;  2JZX A;  4JVY A;  1N33 H;  1IBL H;  2FFM A;  3GR5 A;  4LF6 H;  1N34 H;  1MSZ A;  2UUC H;  4QMF B;  1FKA H;  4LFC H;  4X62 H;  3SB1 A;  4DR4 H;  3J80 W;  2F4V H;  1VIG A;  5A2Q W;  2CTF A;  1X4M A;  4B3R H;  2Z0S A;  4LF8 H;  2HH3 A;  2FPH X;  1XNQ H;  1ZZI A;  4LF4 H;  2LF0 A;  2HHH H;  4DUY H;  3AEV B;  4JI6 H;  2JVZ A;  4JI7 H;  1XMQ H;  2M8W A;  1PQX A;  3JAM W;  4B8T A;  4B3T H;  1N32 H;  4B3M H;  4LF9 H;  4OX9 H;  3OSS D;  3UOE A;  4LF5 H;  2O4C A;  4X64 H;  1V9N A;  2M6Q A;  4DV4 H;  4LFA H;  1UG8 A;  5BR8 H;  2AXY A;  4YY3 H;  1WVN A;  1F0X A;  2JEB I;  2ANN A;  1EC6 A;  2ZQE A;  4JI0 H;  4JI3 H;  3J81 W;  4GKK H;  1NXU A;  2VQE H;  2CTM A;  4DR7 H;  1SEI A;  1J5E H;  1ZZK A;  5LMN H;  1WE8 A;  1HNX H;  1ZTG A;  2E5L H;  4DR6 H;  2E3U A;  4WAN A;  2BA0 A;  4LIJ A;  4FJU A;  1DTJ A;  3V69 A;  3NCV A;  4OCH A;  4JI2 H;  4DV0 H;  4JI5 H;  1S20 A;  4BA2 I;  4JI1 H;  2CTL A;  4FJS A;  4DV3 H;  2X06 A;  2LTL A;  1XRH A;  1HNZ H;  2UUB H;  4NZT M;  2UXC H;  2LTM A;  4DR2 H;  2UU9 H;  1I94 H;  1TUA A;  4LF7 H;  1K1G A;  2PT7 G;  4NZR M;  1FJG H;  4DUZ H;  1DT4 A;  1X0A A;  1VBI A;  2UUA H;  4PDB A;  4B3S H;  2CWF A;  2CWH A;  2QND A;  2Y3M A;  1N36 H;  3J7A K;  2G8Y A;  4DV7 H;  1HR0 H;  2HH2 A;  4NXM H;  5FLX W;  2PQU A;  4NXN H;  4AIM A;  3L7Z C;  5LMU H;  2ANR A;  4JVH A;  4BA1 I;  1AN7 A;  4DR5 H;  3I0P A;  4G08 A;  4DR1 H;  4JI4 H;  1IBM H;  2D9I A;  1J4W A;  3VKE A;  1Z2I A;  4EC5 A;  5C0X G;  4OO1 G;  1X9Z A;  1IBK H;  2PY9 A;  4DV6 H;  3KDG A;  2OPV A;  4AQY H;  1XNR H;  4GKJ H;  4DV2 H;  2YQR A;  1WHR A;  5JEA G;  5K36 G;  4KHP H;  3EZJ A;  3RF2 A;  3KDK A;  1ODH A;  2UXB H;  2JE6 I;  2VQF H;  4JYA H;  1I6U A;  4B8C D;  4JV5 H;  2CPQ A;  2OPU A;  4X66 H;  1WTJ A;  2K1H A;  4JI8 H;  2UXD H;  4YHH H;  3QD7 X;  4WAL A;  3OTO H;  3GKU A;  1X4N A;  1V8C A;  1KHM A;  5IWA H;  4AM3 A;  2P2R A;  3T1H H;  4H8A A;  5DT9 A;  2VKC A; 
#chains in the Genus database with same CATH homology
 2CTF A;  1VIH A;  1X4M A;  2Z0S A;  2CTE A;  2HH3 A;  1J4W A;  3VKE A;  1ZZI A;  1ZTG A;  4IFD G;  5C0X G;  2E3U A;  4WAN A;  2BA0 A;  4LIJ A;  3U1K A;  1DTJ A;  3V69 A;  2JEA I;  3AEV B;  2NN6 G;  4BA2 I;  2PY9 A;  2ANR A;  2JVZ A;  2CTK A;  4B8T A;  2CTL A;  2OPV A;  2MJH A;  2DGR A;  2YQR A;  2BL5 A;  2FMR A;  1J5K A;  5JEA G;  2JA9 A;  1ZZJ A;  5K36 G;  1TUA A;  4NBQ A;  2CTJ A;  1K1G A;  2AXY A;  2JE6 I;  2JZX A;  4JVY A;  1WVN A;  2CPQ A;  1DT4 A;  2OPU A;  2JEB I;  4BA1 I;  2ANN A;  1EC6 A;  2QND A;  4WAL A;  4OO1 G;  2HH2 A;  1X4N A;  2CTM A;  4QMF B;  1KHM A;  2PQU A;  1ZZK A;  4AM3 A;  4AIM A;  3L7Z C;  2P2R A;  4JVH A;  1VIG A;  1WE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...