2BL5A

Solution structure of the kh-qua2 region of the xenopus star-gsg quaking protein.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
134
Chain Sequence
QLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAELKLKRAVEEVKKLLVPAAEGEDSLKKMKLMELAILNGTYRDANLKSPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MGC83862 PROTEIN
publication title Solution Structure and Backbone Dynamics of the Kh-Qua2 Region of the Xenopus Star/Gsg Quaking Protein
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Rna binding
total genus 32
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2bl5A00
2Z0SA 4WALA 2JEAI 2P2RA 1J5KA 2OPUA 5JEAG 5K36G 2YQRA 1KHMA 1ZZIA 4BA1I 2MJHA 2ANRA 4AIMA 1ZTGA 2JZXA 2QNDA 4LIJA 2CPQA 4NBQA 2CTFA 2CTLA 2OPVA 4WANA 2FMRA 2JA9A 2ANNA 2CTEA 2AXYA 1K1GA 2CTJA 4IFDG 2PQUA 1VIGA 2JE6I 2PY9A 1EC6A 2NN6G 1X4NA 3AEVB 1ZZJA 2BA0A 4AM3A 1ZZKA 1TUAA 3L7ZC 4B8TA 4JVHA 1DTJA 2HH3A 3U1KA 1J4WA 4OO1G 4JVYA 2CTKA 1X4MA 1VIHA 2BL5A 2JEBI 2JVZA 3VKEA 3V69A 1WVNA 1DT4A 2E3UA 4QMFB 2CTMA 5C0XG 2HH2A 2DGRA 1WE8A 4BA2I
chains in the Genus database with same CATH superfamily
1IBLH 2Z0SA 4WALA 1XNQH 1XRHA 2M6QA 2LTMA 5K36G 2UXBH 4DR4H 2FPHX 3OSSD 4X66H 2UUAH 4FJSA 2MJHA 4X62H 4AIMA 3I0PA 4JI8H 1ZTGA 4B3SH 2JZXA 4NBQA 2VKCA 4LFBH 2JA9A 2CTEA 2E5LH 1X4NA 3AEVB 3GABA 1S20A 1HR0H 1TUAA 4DV0H 4B8TA 3GKUA 4DR2H 2LRRA 1J4WA 5LL6b 4OO1G 2UXDH 3OTOH 2BL5A 4FJUA 4OX9H 2ZM6H 1N33H 1HNXH 2K1HA 4JI0H 1HNZH 5LMUH 2OPUA 1FKAH 1I6UA 2UXCH 4LF9H 3J80W 4DR3H 4JI1H 4LFAH 4OCHA 4E9JA 3NCVA 4B3MH 1Z2IA 2CPQA 2CTFA 2FFMA 1J5EH 3J81W 3EZJA 4DV7H 3SB1A 2NN6G 5A2QW 4DR7H 3KDKA 2ZQEA 2BA0A 2X06A 2LTLA 2F4VH 4DUZH 3L7ZC 4JV5H 4K0KH 4JVHA 3JAMW 1DTJA 4DV2H 1N36H 4LF5H 3QD7X 4H8AA 3UOEA 1VIHA 4B8CD 2JVZA 3VKEA 4NXNH 1WVNA 2O4CA 3T1YH 2UUCH 3J7AK 2CTMA 3FAUA 3U1KA 1XMOH 1WTJA 4JI7H 4JI4H 1X0AA 4B3TH 2JEAI 4LF6H 4LF7H 4KHPH 1X9ZA 5FLXW 5JEAG 4LF4H 1WHRA 4OD6A 1KHMA 1ZZIA 4NXMH 2ANRA 5DT9A 1F0XA 1XNRH 2QNDA 4LIJA 4B3RH 1V9NA 2CTLA 2OPVA 5BR8H 2ANNA 1AN7A 1K1GA 2CTJA 4IFDG 2UU9H 2JE6I 2PY9A 1EC6A 4LFCH 4YY3H 4LF8H 1ZZJA 1VBIA 4AQYH 4JI2H 3KDGA 3RF2A 4DV5H 4DR1H 2UUBH 4JI3H 1V8CA 2HH3A 4DV3H 2CTKA 1IBMH 1I94H 2G8YA 4YHHH 2VQEH 3T1HH 2M8WA 1XMQH 3V69A 2E3UA 1DT4A 4DUYH 1ODHA 2D9IA 4GKJH 4X64H 5C0XG 4JYAH 2YQRA 2DGRA 4JI6H 5IT9W 2CWFA 4BA2I 4PDBA 4EC5A 4DR6H 4GKKH 2P2RA 1FJGH 2LF0A 1J5KA 3GR5A 1SEIA 4NZRM 4BA1I 4DV1H 4WANA 1NXUA 1N34H 2FMRA 5LMNH 2AXYA 1MSZA 4NZTM 2PQUA 1VIGA 2PT7G 4DR5H 2CWHA 5IWAH 1UG8A 4X65H 1ZZKA 1S03G 4JVYA 1X4MA 4G08A 1IBKH 4JI5H 1HNWH 4DV4H 2JEBI 1PQXA 1N32H 2A1SA 4QMFB 2Y3MA 3OETA 2HHHH 2VQFH 2HH2A 4DV6H 2CPMA 1WE8A 4AM3A
chains in the Genus database with same CATH topology
2Z0SA 4WALA 2JEAI 2P2RA 1J5KA 2OPUA 5JEAG 5K36G 2YQRA 1KHMA 1ZZIA 4BA1I 2MJHA 2ANRA 4AIMA 1ZTGA 2JZXA 2QNDA 4LIJA 2CPQA 4NBQA 2CTFA 2CTLA 2OPVA 4WANA 2FMRA 2JA9A 2ANNA 2CTEA 2AXYA 1K1GA 2CTJA 4IFDG 2PQUA 1VIGA 2JE6I 2PY9A 1EC6A 2NN6G 1X4NA 3AEVB 1ZZJA 2BA0A 4AM3A 1ZZKA 1TUAA 3L7ZC 4B8TA 4JVHA 1DTJA 2HH3A 3U1KA 1J4WA 4OO1G 4JVYA 2CTKA 1X4MA 1VIHA 2BL5A 2JEBI 2JVZA 3VKEA 3V69A 1WVNA 1DT4A 2E3UA 4QMFB 2CTMA 5C0XG 2HH2A 2DGRA 1WE8A 4BA2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0S A;  4WAL A;  2JEA I;  2P2R A;  1J5K A;  2OPU A;  5JEA G;  5K36 G;  2YQR A;  1KHM A;  1ZZI A;  4BA1 I;  2MJH A;  2ANR A;  4AIM A;  1ZTG A;  2JZX A;  2QND A;  4LIJ A;  2CPQ A;  4NBQ A;  2CTF A;  2CTL A;  2OPV A;  4WAN A;  2FMR A;  2JA9 A;  2ANN A;  2CTE A;  2AXY A;  1K1G A;  2CTJ A;  4IFD G;  2PQU A;  1VIG A;  2JE6 I;  2PY9 A;  1EC6 A;  2NN6 G;  1X4N A;  3AEV B;  1ZZJ A;  2BA0 A;  4AM3 A;  1ZZK A;  1TUA A;  3L7Z C;  4B8T A;  4JVH A;  1DTJ A;  2HH3 A;  3U1K A;  1J4W A;  4OO1 G;  4JVY A;  2CTK A;  1X4M A;  1VIH A;  2BL5 A;  2JEB I;  2JVZ A;  3VKE A;  3V69 A;  1WVN A;  1DT4 A;  2E3U A;  4QMF B;  2CTM A;  5C0X G;  2HH2 A;  2DGR A;  1WE8 A;  4BA2 I; 
#chains in the Genus database with same CATH topology
 1IBL H;  2Z0S A;  4WAL A;  1XNQ H;  1XRH A;  2M6Q A;  2LTM A;  5K36 G;  2UXB H;  4DR4 H;  2FPH X;  3OSS D;  4X66 H;  2UUA H;  4FJS A;  2MJH A;  4X62 H;  4AIM A;  3I0P A;  4JI8 H;  1ZTG A;  4B3S H;  2JZX A;  4NBQ A;  2VKC A;  4LFB H;  2JA9 A;  2CTE A;  2E5L H;  1X4N A;  3AEV B;  3GAB A;  1S20 A;  1HR0 H;  1TUA A;  4DV0 H;  4B8T A;  3GKU A;  4DR2 H;  2LRR A;  1J4W A;  5LL6 b;  4OO1 G;  2UXD H;  3OTO H;  2BL5 A;  4FJU A;  4OX9 H;  2ZM6 H;  1N33 H;  1HNX H;  2K1H A;  4JI0 H;  1HNZ H;  5LMU H;  2OPU A;  1FKA H;  1I6U A;  2UXC H;  4LF9 H;  3J80 W;  4DR3 H;  4JI1 H;  4LFA H;  4OCH A;  4E9J A;  3NCV A;  4B3M H;  1Z2I A;  2CPQ A;  2CTF A;  2FFM A;  1J5E H;  3J81 W;  3EZJ A;  4DV7 H;  3SB1 A;  2NN6 G;  5A2Q W;  4DR7 H;  3KDK A;  2ZQE A;  2BA0 A;  2X06 A;  2LTL A;  2F4V H;  4DUZ H;  3L7Z C;  4JV5 H;  4K0K H;  4JVH A;  3JAM W;  1DTJ A;  4DV2 H;  1N36 H;  4LF5 H;  3QD7 X;  4H8A A;  3UOE A;  1VIH A;  4B8C D;  2JVZ A;  3VKE A;  4NXN H;  1WVN A;  2O4C A;  3T1Y H;  2UUC H;  3J7A K;  2CTM A;  3FAU A;  3U1K A;  1XMO H;  1WTJ A;  4JI7 H;  4JI4 H;  1X0A A;  4B3T H;  2JEA I;  4LF6 H;  4LF7 H;  4KHP H;  1X9Z A;  5FLX W;  5JEA G;  4LF4 H;  1WHR A;  4OD6 A;  1KHM A;  1ZZI A;  4NXM H;  2ANR A;  5DT9 A;  1F0X A;  1XNR H;  2QND A;  4LIJ A;  4B3R H;  1V9N A;  2CTL A;  2OPV A;  5BR8 H;  2ANN A;  1AN7 A;  1K1G A;  2CTJ A;  4IFD G;  2UU9 H;  2JE6 I;  2PY9 A;  1EC6 A;  4LFC H;  4YY3 H;  4LF8 H;  1ZZJ A;  1VBI A;  4AQY H;  4JI2 H;  3KDG A;  3RF2 A;  4DV5 H;  4DR1 H;  2UUB H;  4JI3 H;  1V8C A;  2HH3 A;  4DV3 H;  2CTK A;  1IBM H;  1I94 H;  2G8Y A;  4YHH H;  2VQE H;  3T1H H;  2M8W A;  1XMQ H;  3V69 A;  2E3U A;  1DT4 A;  4DUY H;  1ODH A;  2D9I A;  4GKJ H;  4X64 H;  5C0X G;  4JYA H;  2YQR A;  2DGR A;  4JI6 H;  5IT9 W;  2CWF A;  4BA2 I;  4PDB A;  4EC5 A;  4DR6 H;  4GKK H;  2P2R A;  1FJG H;  2LF0 A;  1J5K A;  3GR5 A;  1SEI A;  4NZR M;  4BA1 I;  4DV1 H;  4WAN A;  1NXU A;  1N34 H;  2FMR A;  5LMN H;  2AXY A;  1MSZ A;  4NZT M;  2PQU A;  1VIG A;  2PT7 G;  4DR5 H;  2CWH A;  5IWA H;  1UG8 A;  4X65 H;  1ZZK A;  1S03 G;  4JVY A;  1X4M A;  4G08 A;  1IBK H;  4JI5 H;  1HNW H;  4DV4 H;  2JEB I;  1PQX A;  1N32 H;  2A1S A;  4QMF B;  2Y3M A;  3OET A;  2HHH H;  2VQF H;  2HH2 A;  4DV6 H;  2CPM A;  1WE8 A;  4AM3 A; 
#chains in the Genus database with same CATH homology
 2Z0S A;  4WAL A;  2JEA I;  2P2R A;  1J5K A;  2OPU A;  5JEA G;  5K36 G;  2YQR A;  1KHM A;  1ZZI A;  4BA1 I;  2MJH A;  2ANR A;  4AIM A;  1ZTG A;  2JZX A;  2QND A;  4LIJ A;  2CPQ A;  4NBQ A;  2CTF A;  2CTL A;  2OPV A;  4WAN A;  2FMR A;  2JA9 A;  2ANN A;  2CTE A;  2AXY A;  1K1G A;  2CTJ A;  4IFD G;  2PQU A;  1VIG A;  2JE6 I;  2PY9 A;  1EC6 A;  2NN6 G;  1X4N A;  3AEV B;  1ZZJ A;  2BA0 A;  4AM3 A;  1ZZK A;  1TUA A;  3L7Z C;  4B8T A;  4JVH A;  1DTJ A;  2HH3 A;  3U1K A;  1J4W A;  4OO1 G;  4JVY A;  2CTK A;  1X4M A;  1VIH A;  2BL5 A;  2JEB I;  2JVZ A;  3VKE A;  3V69 A;  1WVN A;  1DT4 A;  2E3U A;  4QMF B;  2CTM A;  5C0X G;  2HH2 A;  2DGR A;  1WE8 A;  4BA2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...