2BL5A

Solution structure of the kh-qua2 region of the xenopus star-gsg quaking protein.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
134
Chain Sequence
QLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAELKLKRAVEEVKKLLVPAAEGEDSLKKMKLMELAILNGTYRDANLKSPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding
molecule keywords MGC83862 PROTEIN
publication title Solution Structure and Backbone Dynamics of the Kh-Qua2 Region of the Xenopus Star/Gsg Quaking Protein
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2bl5A00
2JVZA 4LIJA 3L7ZC 2CTEA 3V69A 4AM3A 1WVNA 3U1KA 2BA0A 2MJHA 1WE8A 1X4NA 5JEAG 2BL5A 2PQUA 4IFDG 2JEAI 1K1GA 3AEVB 2QNDA 4JVYA 2E3UA 2NN6G 2HH3A 2YQRA 2CPQA 3VKEA 2ANNA 1EC6A 1DT4A 1ZTGA 4OO1G 4AIMA 2CTKA 5C0XG 2CTJA 4BA1I 1J4WA 1VIHA 2FMRA 2ANRA 2PY9A 1ZZJA 4JVHA 1KHMA 2HH2A 2OPVA 1ZZKA 1ZZIA 2Z0SA 2CTMA 1TUAA 4QMFB 2AXYA 2JA9A 2JEBI 1J5KA 4WANA 4BA2I 1VIGA 2CTLA 1X4MA 2JZXA 2OPUA 2DGRA 4B8TA 2CTFA 2P2RA 5K36G 2JE6I 4NBQA 1DTJA 4WALA
chains in the Genus database with same CATH superfamily
4YHHH 1WTJA 1J5EH 4DV2H 1XRHA 2CTEA 1WVNA 3U1KA 2BA0A 1IBMH 4B3RH 5JEAG 1I94H 2PQUA 2UXDH 3AEVB 2NN6G 2ANNA 4AQYH 4OO1G 2CTKA 2LF0A 1VBIA 2LTMA 2VKCA 2UXCH 1HNWH 4LFBH 1VIHA 2FMRA 1KHMA 1XMQH 2PY9A 4JVHA 4OD6A 1ZZIA 2CTMA 3QD7X 4DR4H 1HNXH 2PT7G 4QMFB 1N36H 2VQFH 1N33H 5BR8H 4YY3H 2F4VH 4JI8H 3GKUA 4DR1H 4X64H 5LMUH 2OPUA 4B8TA 2P2RA 4B3SH 3NCVA 2ZQEA 4NBQA 4OCHA 4WALA 2UXBH 4JI3H 1S20A 4LIJA 4B3MH 1FJGH 2UU9H 4LF6H 3J80W 4GKJH 2K1HA 3J7AK 1X9ZA 3T1HH 4DV5H 4EC5A 4X65H 2YQRA 2HHHH 1MSZA 1ZTGA 4AIMA 3I0PA 2LRRA 1F0XA 1WHRA 4X66H 1AN7A 1Z2IA 2CWFA 4NXMH 5DT9A 2UUAH 4LFCH 2HH2A 4OX9H 1ZZKA 5FLXW 4JV5H 4FJSA 4FJUA 4K0KH 2AXYA 1V8CA 1XMOH 2JEBI 3KDKA 2M8WA 1J5KA 4LF5H 4WANA 1XNRH 2M6QA 1N34H 2CTLA 2Y3MA 1X4MA 4LF4H 2DGRA 2FPHX 4DR3H 3FAUA 3T1YH 5K36G 4DR6H 2VQEH 1PQXA 2E5LH 3L7ZC 1ODHA 4JI5H 4DR2H 2UUBH 3V69A 4JI7H 2CPMA 2A1SA 4IFDG 2JEAI 1K1GA 4JVYA 2QNDA 4LF8H 2E3UA 3UOEA 3OSSD 1NXUA 4DUZH 1I6UA 4E9JA 4X62H 2O4CA 3SB1A 4DV1H 1J4WA 1XNQH 2X06A 1ZZJA 1HNZH 1IBLH 3GR5A 2OPVA 4JI6H 1TUAA 2ZM6H 4GKKH 4B8CD 3RF2A 1HR0H 2UUCH 2JA9A 3OTOH 5LMNH 4DR7H 4BA2I 1V9NA 1VIGA 4JI4H 4KHPH 4H8AA 4JI0H 1FKAH 1SEIA 4PDBA 4BA1I 4DV7H 2JVZA 2D9IA 4DV4H 3J81W 4AM3A 2MJHA 4DV6H 1WE8A 1UG8A 1X4NA 2BL5A 4LF7H 4NXNH 2HH3A 1EC6A 2CPQA 3VKEA 1DT4A 4B3TH 5C0XG 3OETA 2CTJA 4LFAH 4LF9H 5A2QW 4JYAH 1N32H 5IT9W 4DV3H 2ANRA 5IWAH 4DV0H 3EZJA 4NZTM 3GABA 1X0AA 2Z0SA 3JAMW 4JI1H 4DUYH 4NZRM 3KDGA 2FFMA 2CWHA 1S03G 4JI2H 4G08A 2JZXA 2LTLA 1IBKH 2CTFA 5LL6b 2JE6I 2G8YA 4DR5H 1DTJA
chains in the Genus database with same CATH topology
2JVZA 4LIJA 3L7ZC 2CTEA 3V69A 4AM3A 1WVNA 3U1KA 2BA0A 2MJHA 1WE8A 1X4NA 5JEAG 2BL5A 2PQUA 4IFDG 2JEAI 1K1GA 3AEVB 2QNDA 4JVYA 2E3UA 2NN6G 2HH3A 2YQRA 2CPQA 3VKEA 2ANNA 1EC6A 1DT4A 1ZTGA 4OO1G 4AIMA 2CTKA 5C0XG 2CTJA 4BA1I 1J4WA 1VIHA 2FMRA 2ANRA 2PY9A 1ZZJA 4JVHA 1KHMA 2HH2A 2OPVA 1ZZKA 1ZZIA 2Z0SA 2CTMA 1TUAA 4QMFB 2AXYA 2JA9A 2JEBI 1J5KA 4WANA 4BA2I 1VIGA 2CTLA 1X4MA 2JZXA 2OPUA 2DGRA 4B8TA 2CTFA 2P2RA 5K36G 2JE6I 4NBQA 1DTJA 4WALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JVZ A;  4LIJ A;  3L7Z C;  2CTE A;  3V69 A;  4AM3 A;  1WVN A;  3U1K A;  2BA0 A;  2MJH A;  1WE8 A;  1X4N A;  5JEA G;  2BL5 A;  2PQU A;  4IFD G;  2JEA I;  1K1G A;  3AEV B;  2QND A;  4JVY A;  2E3U A;  2NN6 G;  2HH3 A;  2YQR A;  2CPQ A;  3VKE A;  2ANN A;  1EC6 A;  1DT4 A;  1ZTG A;  4OO1 G;  4AIM A;  2CTK A;  5C0X G;  2CTJ A;  4BA1 I;  1J4W A;  1VIH A;  2FMR A;  2ANR A;  2PY9 A;  1ZZJ A;  4JVH A;  1KHM A;  2HH2 A;  2OPV A;  1ZZK A;  1ZZI A;  2Z0S A;  2CTM A;  1TUA A;  4QMF B;  2AXY A;  2JA9 A;  2JEB I;  1J5K A;  4WAN A;  4BA2 I;  1VIG A;  2CTL A;  1X4M A;  2JZX A;  2OPU A;  2DGR A;  4B8T A;  2CTF A;  2P2R A;  5K36 G;  2JE6 I;  4NBQ A;  1DTJ A;  4WAL A; 
#chains in the Genus database with same CATH topology
 4YHH H;  1WTJ A;  1J5E H;  4DV2 H;  1XRH A;  2CTE A;  1WVN A;  3U1K A;  2BA0 A;  1IBM H;  4B3R H;  5JEA G;  1I94 H;  2PQU A;  2UXD H;  3AEV B;  2NN6 G;  2ANN A;  4AQY H;  4OO1 G;  2CTK A;  2LF0 A;  1VBI A;  2LTM A;  2VKC A;  2UXC H;  1HNW H;  4LFB H;  1VIH A;  2FMR A;  1KHM A;  1XMQ H;  2PY9 A;  4JVH A;  4OD6 A;  1ZZI A;  2CTM A;  3QD7 X;  4DR4 H;  1HNX H;  2PT7 G;  4QMF B;  1N36 H;  2VQF H;  1N33 H;  5BR8 H;  4YY3 H;  2F4V H;  4JI8 H;  3GKU A;  4DR1 H;  4X64 H;  5LMU H;  2OPU A;  4B8T A;  2P2R A;  4B3S H;  3NCV A;  2ZQE A;  4NBQ A;  4OCH A;  4WAL A;  2UXB H;  4JI3 H;  1S20 A;  4LIJ A;  4B3M H;  1FJG H;  2UU9 H;  4LF6 H;  3J80 W;  4GKJ H;  2K1H A;  3J7A K;  1X9Z A;  3T1H H;  4DV5 H;  4EC5 A;  4X65 H;  2YQR A;  2HHH H;  1MSZ A;  1ZTG A;  4AIM A;  3I0P A;  2LRR A;  1F0X A;  1WHR A;  4X66 H;  1AN7 A;  1Z2I A;  2CWF A;  4NXM H;  5DT9 A;  2UUA H;  4LFC H;  2HH2 A;  4OX9 H;  1ZZK A;  5FLX W;  4JV5 H;  4FJS A;  4FJU A;  4K0K H;  2AXY A;  1V8C A;  1XMO H;  2JEB I;  3KDK A;  2M8W A;  1J5K A;  4LF5 H;  4WAN A;  1XNR H;  2M6Q A;  1N34 H;  2CTL A;  2Y3M A;  1X4M A;  4LF4 H;  2DGR A;  2FPH X;  4DR3 H;  3FAU A;  3T1Y H;  5K36 G;  4DR6 H;  2VQE H;  1PQX A;  2E5L H;  3L7Z C;  1ODH A;  4JI5 H;  4DR2 H;  2UUB H;  3V69 A;  4JI7 H;  2CPM A;  2A1S A;  4IFD G;  2JEA I;  1K1G A;  4JVY A;  2QND A;  4LF8 H;  2E3U A;  3UOE A;  3OSS D;  1NXU A;  4DUZ H;  1I6U A;  4E9J A;  4X62 H;  2O4C A;  3SB1 A;  4DV1 H;  1J4W A;  1XNQ H;  2X06 A;  1ZZJ A;  1HNZ H;  1IBL H;  3GR5 A;  2OPV A;  4JI6 H;  1TUA A;  2ZM6 H;  4GKK H;  4B8C D;  3RF2 A;  1HR0 H;  2UUC H;  2JA9 A;  3OTO H;  5LMN H;  4DR7 H;  4BA2 I;  1V9N A;  1VIG A;  4JI4 H;  4KHP H;  4H8A A;  4JI0 H;  1FKA H;  1SEI A;  4PDB A;  4BA1 I;  4DV7 H;  2JVZ A;  2D9I A;  4DV4 H;  3J81 W;  4AM3 A;  2MJH A;  4DV6 H;  1WE8 A;  1UG8 A;  1X4N A;  2BL5 A;  4LF7 H;  4NXN H;  2HH3 A;  1EC6 A;  2CPQ A;  3VKE A;  1DT4 A;  4B3T H;  5C0X G;  3OET A;  2CTJ A;  4LFA H;  4LF9 H;  5A2Q W;  4JYA H;  1N32 H;  5IT9 W;  4DV3 H;  2ANR A;  5IWA H;  4DV0 H;  3EZJ A;  4NZT M;  3GAB A;  1X0A A;  2Z0S A;  3JAM W;  4JI1 H;  4DUY H;  4NZR M;  3KDG A;  2FFM A;  2CWH A;  1S03 G;  4JI2 H;  4G08 A;  2JZX A;  2LTL A;  1IBK H;  2CTF A;  5LL6 b;  2JE6 I;  2G8Y A;  4DR5 H;  1DTJ A; 
#chains in the Genus database with same CATH homology
 2JVZ A;  4LIJ A;  3L7Z C;  2CTE A;  3V69 A;  4AM3 A;  1WVN A;  3U1K A;  2BA0 A;  2MJH A;  1WE8 A;  1X4N A;  5JEA G;  2BL5 A;  2PQU A;  4IFD G;  2JEA I;  1K1G A;  3AEV B;  2QND A;  4JVY A;  2E3U A;  2NN6 G;  2HH3 A;  2YQR A;  2CPQ A;  3VKE A;  2ANN A;  1EC6 A;  1DT4 A;  1ZTG A;  4OO1 G;  4AIM A;  2CTK A;  5C0X G;  2CTJ A;  4BA1 I;  1J4W A;  1VIH A;  2FMR A;  2ANR A;  2PY9 A;  1ZZJ A;  4JVH A;  1KHM A;  2HH2 A;  2OPV A;  1ZZK A;  1ZZI A;  2Z0S A;  2CTM A;  1TUA A;  4QMF B;  2AXY A;  2JA9 A;  2JEB I;  1J5K A;  4WAN A;  4BA2 I;  1VIG A;  2CTL A;  1X4M A;  2JZX A;  2OPU A;  2DGR A;  4B8T A;  2CTF A;  2P2R A;  5K36 G;  2JE6 I;  4NBQ A;  1DTJ A;  4WAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...