2BL5A

Solution structure of the kh-qua2 region of the xenopus star-gsg quaking protein.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
134
Chain Sequence
QLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAELKLKRAVEEVKKLLVPAAEGEDSLKKMKLMELAILNGTYRDANLKSPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MGC83862 PROTEIN
publication title Solution Structure and Backbone Dynamics of the Kh-Qua2 Region of the Xenopus Star/Gsg Quaking Protein
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Rna binding
total genus 32
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2bl5A00
5K36G 2JZXA 2CTJA 4QMFB 3AEVB 4OO1G 2YQRA 2FMRA 4AIMA 2JE6I 1VIHA 1J5KA 1X4MA 2CPQA 2Z0SA 4IFDG 2BL5A 2NN6G 1WE8A 4AM3A 2CTKA 2AXYA 2JVZA 2JEAI 1ZZJA 1TUAA 3U1KA 5JEAG 1J4WA 4NBQA 4BA2I 2CTEA 3VKEA 4WALA 2JEBI 1ZZIA 4B8TA 3L7ZC 4BA1I 2OPVA 2CTMA 2CTFA 1DT4A 1ZTGA 1EC6A 2PQUA 1ZZKA 2HH2A 1K1GA 2BA0A 2P2RA 2MJHA 2ANRA 2ANNA 2QNDA 1DTJA 3V69A 2PY9A 1KHMA 1WVNA 5C0XG 2DGRA 2E3UA 2CTLA 4WANA 2HH3A 2JA9A 4JVYA 4LIJA 1X4NA 2OPUA 1VIGA 4JVHA
chains in the Genus database with same CATH superfamily
3JAMW 4LF9H 5LMUH 2JE6I 1N33H 2Z0SA 3KDKA 2BL5A 5LMNH 4DV7H 5A2QW 5BR8H 4DR1H 2AXYA 2JEAI 5JEAG 5IT9W 2CTEA 1VBIA 4WALA 4B8CD 2VKCA 4FJUA 4JI7H 2M6QA 2UU9H 4LF8H 5DT9A 1XNQH 1N36H 4OX9H 4GKKH 2G8YA 4E9JA 2VQEH 2HHHH 2M8WA 4B3SH 4JI3H 4DR2H 1HNXH 1EC6A 1ZZKA 1HNWH 2BA0A 3OSSD 4JI0H 2LTLA 2UXDH 1F0XA 3V69A 4DR6H 3T1HH 1V8CA 1XMQH 1X4NA 2OPUA 1K1GA 4KHPH 2O4CA 4JVHA 5K36G 2JZXA 1IBMH 4LF7H 3GR5A 2LRRA 4FJSA 3AEVB 4GKJH 1FJGH 1J5KA 1X4MA 1MSZA 1WE8A 3KDGA 2CTKA 3QD7X 2JVZA 4X66H 1TUAA 3U1KA 1IBLH 4DV2H 3GKUA 4DR4H 2PT7G 4B3MH 4LF6H 1Z2IA 2Y3MA 1AN7A 1X0AA 1NXUA 2CWHA 1V9NA 5LL6b 3OTOH 4PDBA 4NZRM 2UUBH 1WTJA 3I0PA 3SB1A 4LF5H 5FLXW 1FKAH 4OD6A 4DV4H 1HNZH 1WHRA 2MJHA 4X64H 4DV3H 2PY9A 1KHMA 4K0KH 2DGRA 3RF2A 4WANA 2HH3A 2JA9A 4LIJA 3UOEA 4QMFB 4DUYH 3EZJA 4AIMA 4LF4H 1HR0H 1XMOH 2NN6G 3GABA 4LFAH 1ZZJA 2A1SA 4LFBH 4NBQA 5IWAH 3VKEA 1N32H 4DR7H 2JEBI 1ZZIA 4B8TA 1I6UA 3L7ZC 4BA1I 2UUAH 2OPVA 3NCVA 4JI5H 2UXCH 2UXBH 2CTFA 4NXMH 1J5EH 2CWFA 1ZTGA 2HH2A 2P2RA 2ZQEA 2UUCH 2QNDA 4DV1H 4DR3H 1UG8A 2FFMA 2LF0A 2CTLA 3J81W 4AQYH 4DV5H 2FMRA 1VIGA 1J4WA 4DR5H 2CTJA 4JYAH 4OO1G 2YQRA 4X65H 4JI6H 1VIHA 1S20A 1SEIA 3FAUA 2CPQA 4YHHH 3T1YH 1S03G 4IFDG 3OETA 2CPMA 4G08A 4B3RH 4AM3A 1IBKH 4YY3H 4BA2I 4LFCH 2ZM6H 4NXNH 4X62H 2E5LH 4JI8H 1XNRH 2LTMA 4JI1H 4NZTM 1XRHA 2CTMA 2VQFH 4DV0H 1N34H 1DT4A 2K1HA 2D9IA 1X9ZA 4JI2H 4B3TH 2ANNA 2ANRA 1DTJA 2F4VH 1PQXA 4DUZH 1WVNA 5C0XG 4EC5A 4DV6H 1ODHA 2FPHX 4JI4H 3J7AK 2X06A 3J80W 2E3UA 1I94H 4H8AA 4JV5H 4JVYA 2PQUA 4OCHA
chains in the Genus database with same CATH topology
5K36G 2JZXA 2CTJA 4QMFB 3AEVB 4OO1G 2YQRA 2FMRA 4AIMA 2JE6I 1VIHA 1J5KA 1X4MA 2CPQA 2Z0SA 4IFDG 2BL5A 2NN6G 1WE8A 4AM3A 2CTKA 2AXYA 2JVZA 2JEAI 1ZZJA 1TUAA 3U1KA 5JEAG 1J4WA 4NBQA 4BA2I 2CTEA 3VKEA 4WALA 2JEBI 1ZZIA 4B8TA 3L7ZC 4BA1I 2OPVA 2CTMA 2CTFA 1DT4A 1ZTGA 1EC6A 2PQUA 1ZZKA 2HH2A 1K1GA 2BA0A 2P2RA 2MJHA 2ANRA 2ANNA 2QNDA 1DTJA 3V69A 2PY9A 1KHMA 1WVNA 5C0XG 2DGRA 2E3UA 2CTLA 4WANA 2HH3A 2JA9A 4JVYA 4LIJA 1X4NA 2OPUA 1VIGA 4JVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K36 G;  2JZX A;  2CTJ A;  4QMF B;  3AEV B;  4OO1 G;  2YQR A;  2FMR A;  4AIM A;  2JE6 I;  1VIH A;  1J5K A;  1X4M A;  2CPQ A;  2Z0S A;  4IFD G;  2BL5 A;  2NN6 G;  1WE8 A;  4AM3 A;  2CTK A;  2AXY A;  2JVZ A;  2JEA I;  1ZZJ A;  1TUA A;  3U1K A;  5JEA G;  1J4W A;  4NBQ A;  4BA2 I;  2CTE A;  3VKE A;  4WAL A;  2JEB I;  1ZZI A;  4B8T A;  3L7Z C;  4BA1 I;  2OPV A;  2CTM A;  2CTF A;  1DT4 A;  1ZTG A;  1EC6 A;  2PQU A;  1ZZK A;  2HH2 A;  1K1G A;  2BA0 A;  2P2R A;  2MJH A;  2ANR A;  2ANN A;  2QND A;  1DTJ A;  3V69 A;  2PY9 A;  1KHM A;  1WVN A;  5C0X G;  2DGR A;  2E3U A;  2CTL A;  4WAN A;  2HH3 A;  2JA9 A;  4JVY A;  4LIJ A;  1X4N A;  2OPU A;  1VIG A;  4JVH A; 
#chains in the Genus database with same CATH topology
 3JAM W;  4LF9 H;  5LMU H;  2JE6 I;  1N33 H;  2Z0S A;  3KDK A;  2BL5 A;  5LMN H;  4DV7 H;  5A2Q W;  5BR8 H;  4DR1 H;  2AXY A;  2JEA I;  5JEA G;  5IT9 W;  2CTE A;  1VBI A;  4WAL A;  4B8C D;  2VKC A;  4FJU A;  4JI7 H;  2M6Q A;  2UU9 H;  4LF8 H;  5DT9 A;  1XNQ H;  1N36 H;  4OX9 H;  4GKK H;  2G8Y A;  4E9J A;  2VQE H;  2HHH H;  2M8W A;  4B3S H;  4JI3 H;  4DR2 H;  1HNX H;  1EC6 A;  1ZZK A;  1HNW H;  2BA0 A;  3OSS D;  4JI0 H;  2LTL A;  2UXD H;  1F0X A;  3V69 A;  4DR6 H;  3T1H H;  1V8C A;  1XMQ H;  1X4N A;  2OPU A;  1K1G A;  4KHP H;  2O4C A;  4JVH A;  5K36 G;  2JZX A;  1IBM H;  4LF7 H;  3GR5 A;  2LRR A;  4FJS A;  3AEV B;  4GKJ H;  1FJG H;  1J5K A;  1X4M A;  1MSZ A;  1WE8 A;  3KDG A;  2CTK A;  3QD7 X;  2JVZ A;  4X66 H;  1TUA A;  3U1K A;  1IBL H;  4DV2 H;  3GKU A;  4DR4 H;  2PT7 G;  4B3M H;  4LF6 H;  1Z2I A;  2Y3M A;  1AN7 A;  1X0A A;  1NXU A;  2CWH A;  1V9N A;  5LL6 b;  3OTO H;  4PDB A;  4NZR M;  2UUB H;  1WTJ A;  3I0P A;  3SB1 A;  4LF5 H;  5FLX W;  1FKA H;  4OD6 A;  4DV4 H;  1HNZ H;  1WHR A;  2MJH A;  4X64 H;  4DV3 H;  2PY9 A;  1KHM A;  4K0K H;  2DGR A;  3RF2 A;  4WAN A;  2HH3 A;  2JA9 A;  4LIJ A;  3UOE A;  4QMF B;  4DUY H;  3EZJ A;  4AIM A;  4LF4 H;  1HR0 H;  1XMO H;  2NN6 G;  3GAB A;  4LFA H;  1ZZJ A;  2A1S A;  4LFB H;  4NBQ A;  5IWA H;  3VKE A;  1N32 H;  4DR7 H;  2JEB I;  1ZZI A;  4B8T A;  1I6U A;  3L7Z C;  4BA1 I;  2UUA H;  2OPV A;  3NCV A;  4JI5 H;  2UXC H;  2UXB H;  2CTF A;  4NXM H;  1J5E H;  2CWF A;  1ZTG A;  2HH2 A;  2P2R A;  2ZQE A;  2UUC H;  2QND A;  4DV1 H;  4DR3 H;  1UG8 A;  2FFM A;  2LF0 A;  2CTL A;  3J81 W;  4AQY H;  4DV5 H;  2FMR A;  1VIG A;  1J4W A;  4DR5 H;  2CTJ A;  4JYA H;  4OO1 G;  2YQR A;  4X65 H;  4JI6 H;  1VIH A;  1S20 A;  1SEI A;  3FAU A;  2CPQ A;  4YHH H;  3T1Y H;  1S03 G;  4IFD G;  3OET A;  2CPM A;  4G08 A;  4B3R H;  4AM3 A;  1IBK H;  4YY3 H;  4BA2 I;  4LFC H;  2ZM6 H;  4NXN H;  4X62 H;  2E5L H;  4JI8 H;  1XNR H;  2LTM A;  4JI1 H;  4NZT M;  1XRH A;  2CTM A;  2VQF H;  4DV0 H;  1N34 H;  1DT4 A;  2K1H A;  2D9I A;  1X9Z A;  4JI2 H;  4B3T H;  2ANN A;  2ANR A;  1DTJ A;  2F4V H;  1PQX A;  4DUZ H;  1WVN A;  5C0X G;  4EC5 A;  4DV6 H;  1ODH A;  2FPH X;  4JI4 H;  3J7A K;  2X06 A;  3J80 W;  2E3U A;  1I94 H;  4H8A A;  4JV5 H;  4JVY A;  2PQU A;  4OCH A; 
#chains in the Genus database with same CATH homology
 5K36 G;  2JZX A;  2CTJ A;  4QMF B;  3AEV B;  4OO1 G;  2YQR A;  2FMR A;  4AIM A;  2JE6 I;  1VIH A;  1J5K A;  1X4M A;  2CPQ A;  2Z0S A;  4IFD G;  2BL5 A;  2NN6 G;  1WE8 A;  4AM3 A;  2CTK A;  2AXY A;  2JVZ A;  2JEA I;  1ZZJ A;  1TUA A;  3U1K A;  5JEA G;  1J4W A;  4NBQ A;  4BA2 I;  2CTE A;  3VKE A;  4WAL A;  2JEB I;  1ZZI A;  4B8T A;  3L7Z C;  4BA1 I;  2OPV A;  2CTM A;  2CTF A;  1DT4 A;  1ZTG A;  1EC6 A;  2PQU A;  1ZZK A;  2HH2 A;  1K1G A;  2BA0 A;  2P2R A;  2MJH A;  2ANR A;  2ANN A;  2QND A;  1DTJ A;  3V69 A;  2PY9 A;  1KHM A;  1WVN A;  5C0X G;  2DGR A;  2E3U A;  2CTL A;  4WAN A;  2HH3 A;  2JA9 A;  4JVY A;  4LIJ A;  1X4N A;  2OPU A;  1VIG A;  4JVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...