3L7ZC

Crystal structure of the s. solfataricus archaeal exosome
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
222
structure length
222
Chain Sequence
QKIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKSGCSIFVANNGRIWATCPSRFSEEILIEAIRKIENESHIKGLTDRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna binding protein
molecule keywords Probable exosome complex exonuclease 2
publication title Crystal structure of the S. solfataricus archaeal exosome reveals conformational flexibility in the RNA-binding ring.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 37
structure length 222
sequence length 222
chains with identical sequence F, I
ec nomenclature
pdb deposition date 2009-12-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3l7zC01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3l7zC02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 3l7zC03
4B3SL 1NMGA 1VQOA 4LF6Q 1HZAA 1PYSB 3PV0A 3CW2C 1EQRA 1Q81C 3RR5A 1HZCA 1WYDA 4GOPC 3D31A 3J80c 2CTJA 4DR6Q 5HY6A 4JBJA 1VQHA 1PH9A 3CCMA 5C0XI 2D2CC 3N6RA 2PMZE 2PNRC 1U0LA 1C7YA 2PQAB 3I2ZA 4DV2L 4A3GG 4DR7L 1B7YB 4BXXG 2PQUA 1K8MA 4DR4Q 5EAYA 1VQNA 1MJCA 1V1QA 4J15A 5BR8Q 4PZ8A 3HKZG 2A69C 1WI5A 3CRKC 1NBWA 4AH6A 3CCJA 2R93H 3PSIA 1T9HA 1IBKL 1I6VC 2QA4A 1N36Q 4HJAA 4NXML 2F4VL 2HHHQ 2BE5D 4DV1L 2LXJA 1Q82C 2DGRA 3A74A 2Y0SG 1Y8OB 1KRTA 3PGZA 1VQJA 4POGA 1K83H 3T56B 4A3CH 2D0OA 1XPUA 1X6OA 3HOWH 5HGQA 3T1YL 3NBHB 5J3BA 4BBSG 3TZUA 2JZXA 3TS0A 4JI6Q 3KFUA 2EJMA 2KHJA 4AQYQ 1E1TA 4L8JA 1VQ4A 4A3DH 1KC8C 4DV6Q 2YV5A 4GKJQ 4QIWE 5KNDA 4R4TA 2WFWA 4DR2L 1KAWA 1N34Q 3B6YA 1E24A 4NB3A 5C0XH 3ICEA 4RG1A 3S14H 3AEVB 1XNRL 4DV0L 2OPVA 1VCIA 4NXNL 4HIOA 4DV7Q 3JAMi 3GTLH 2YTXA 4DR5Q 4A93H 4BY7H 4YCUA 4I7ZC 1KHIA 2N3SA 4UPAA 4MTNA 2MNAA 1U5KA 1P8LA 1LABA 4YWKA 2ATWA 5FLMG 1ZYRC 4KN7C 4JI0Q 2VUMH 1N33L 3VR3A 4L5TA 2CCZA 5M3MG 4PG3A 4HIDA 3BZCA 3S24A 3SGIA 1E22A 4BA1I 3KJPA 4B3TQ 1Z9FA 3H0GG 1I6HH 2D0PA 1TWCH 2NVQH 3H3VI 2JK8A 1SE8A 3HFZB 1XTDA 4JI4L 2VNUD 1Y1WG 1I3QH 1S72A 2CTMA 4APVA 1HNZQ 3KOJA 2ANNA 2VQEL 2R92G 3BJUA 3I4NG 3F8TA 1TWHH 4IQZA 1J5EL 2WAQE 5JJKA 1BBUA 2OQ0A 3M9BA 1VQMA 2RCNA 2BA1A 1M90C 1XPRA 1HZ9A 5JEAH 1O7LA 2PY9A 4DK6C 4HIKA 1E2WA 1XJVA 5C4XG 1H9RA 2NN6I 1VQPA 4A3MH 3PO2H 5IYCG 5LMNW 4JI3Q 3S15H 3QIAA 1Q86C 5M5YH 3CRLC 3OOCA 1VDZA 2KCCA 1VQ8A 5IP9G 4RMFA 4A3LH 2FXQA 1RL2A 2BL5A 2GN5A 2E3UA 2DGYA 1X4NA 2JEAI 1N8RC 2EDGA 2XTIA 4JG2A 2V1CC 2DNCA 1Q8KA 1CTMA 1L1OC 2Q2IA 2ZM6Q 2JQOA 1GJXA 1J4WA 1C9OA 4X64L 4YHHQ 1YJ9A 4KHPL 3H3VH 3IRBA 1YNXA 4LFBL 3HOVH 5IWAL 3S2DH 2EVBA 2RHSB 1X9NA 3T1HL 4NBQA 4JI7L 4BBRH 2B63H 2I5HA 1VQIA 2YU9H 1V9PA 4IJLA 4DV4L 4AYBE 2Q2UA 1AE3A 4JBKA 3VKEA 4YWMA 2A6EC 1A0IA 2Z6KA 2EQSA 1CFMA 1LACA 3NELA 1J6QA 4WALA 1XNQQ 1OXXK 4LW1A 3F2CA 4IFDG 1HQMC 2VS1A 1TWFH 1YHBA 1IBML 3GTKH 3JAMc 2UUAQ 2ASBA 1X54A 2OQKA 4R4CA 4OGQC 1VQ9A 1XMOL 4NPSA 3LNNA 3CCVA 1BVSA 1NY4A 1W2BA 4LNQA 2KBNA 4DUYL 1B9NA 1H9MA 4X62L 1W3SA 3CMEA 2PNHA 3DLLA 3CD6A 1ZZKA 2QNDA 2HQLA 1OTCA 4K0KQ 1WVNA 1GKHA 1VQDA 4DUZL 3S16H 3IFTA 4L5RC 1VQBA 3UDFA 4A3JH 2V4DA 1IYUA 5K36H 2R7FA 1YHAA 4LFAQ 3KLWA 4A3IH 3I72A 1YITA 1GHJA 4DV3Q 3A8JE 3PUZA 4JCVE 3JC66 5C44G 2VQFQ 2ANRA 4GLVB 1X4MA 3CCSA 1QZGA 4DR6L 2A6HC 2JA6G 1DGSA 1M1KC 1IL2A 1K3RA 3I73A 5IT9c 2I0QA 4DR4L 3S1NH 3RLNA 2NVTH 5BR8L 1VQFA 2JJQA 2QF7A 2A6ED 4A3FH 4JOIA 1EYGA 5GAGC 1KD1C 1GD7A 1DT4A 3RLFA 2I5MX 1N36L 1HNXQ 4C3JH 2NVXH 3I4LA 3A5UA 2HHHL 1HR0W 2Q2HA 1I5FA 1N32Q 4JBWA 3UDXA 2JA5H 1H9KA 3G48A 2JA7H 4DPGA 2R7DA 1ZZJA 3CCUA 2YYZA 3VR2A 2ZJPA 3HOYH 5GAEC 3S17H 1EC6A 2CQOA 4JVYA 1ASYA 3ULJA 4L5QA 1OXVA 3F2DA 1SLJA 4HR7B 1VQ5A 4C3HH 5IYBG 4Y7NH 4AQYL 4BY7G 4A93G 2MQHA 1HNWQ 1KHMA 4IOAA 2B29A 3MXUA 5AJ3L 3U4ZA 1KXLA 4B3RQ 3F1ZA 3CC7A 1H95A 4UP9A 1XPOA 1VQ7A 3CPFA 5DLQE 3SE0A 2OTLA 1YZ6A 1CKNA 1CSPA 1Q7YC 1QUQA 4DV7L 1ZKOA 4YY3Q 5ELOA 1VQLA 2HH3A 4DK1A 2E8GA 4PZ6A 2CTEA 4DR5L 1VS0A 4YWLA 3CF5A 3VR6A 3CCLA 1GUNA 1PH7A 1FJGQ 2ZT9C 3ULLA 2P2RA 1LM0A 5C3EH 3I4MH 3LGJA 3AFQA 1C0AA 3GTOH 1BKBA 4JI0L 3KF8B 2O5IC 3U58A 3EQLC 4GNXB 2R7ZH 4B3TL 2HT1A 4B3MQ 5JEAG 4P74A 2UXBQ 4BY1G 3HKZE 3FHWA 2MO1A 2UUBQ 3RZDH 4X66Q 4P75A 1OXUA 1YBYA 4LF4Q 3CXCA 4A3MG 5BN5A 1WE8A 3CPWA 4LJZC 1EIFA 1E2VA 3G6EA 1D8LA 2WB1E 2AUKA 3W1GA 4A3KH 1HNZL 3OPOA 1V43A 3FKIH 1AE2A 2JA8G 3PUWA 2KCMA 4A3LG 3GTQH 2YTYA 1Z6HA 2Y0SE 4OWXB 3T53B 4G7ZC 3MFYA 1ASZA 1PH5A 1MJEA 4YCVA 2F1MA 4KN4C 4A3EH 1IYVA 1E3PA 4X65Q 2OTJA 3U1KA 2JE6I 1I94Q 1VQKA 4DV2Q 2EIFA 1JB7A 4LFCQ 1K73C 1EFWA 4UP8A 3SDZA 2WP8J 3PUYA 2E5LL 5LMUQ 1EUJA 3FP9A 3STBC 2A69D 2RHQB 1XMQL 4KMUC 4DR3Q 3EIVA 2ZM6L 2A68C 4DV1Q 4IFDJ 1PVOA 4BXXH 3K8AA 2AUJD 3A7LA 2A1AA 4P73A 2BA0A 4YHHL 1QVFA 1PA6A 3AFPA 5IE8A 1KRSA 1YNJC 2NN6G 1N9WA 4L5SA 4H13C 1CI3M 1E2ZA 5H1SE 1Q90A 3T1YQ 5IP7G 4GNXA 1X56A 4R4OA 2ID0A 4JYAQ 5JJLA 3G71A 4AM3A 4IPGA 5GROA 2FMRA 3RN2A 1H9SA 2ZTCA 4C3IH 1VQCA 4JV5Q 1AH9A 1ZTGA 1FL0A 4LUVA 1TWAH 1VQGA 3A8IE 2AHOB 4LUZA 4GOPA 4DNTB 2N49A 2K5VA 2UUCQ 4JOIC 4DR1Q 3D4RA 1IW7C 2F3IA 3K80C 3S2HH 1Y8NB 4BBSH 3IKJA 1KL9A 2C35B 2VL6A 3W3AA 3CP0A 1K9MC 3OW2A 3CC2A 2XGTA 2K7VA 1GUGA 4TQUS 4A3BG 2NZHA 2ALYB 1SN8A 3HOUH 4JI8L 1WCMH 3E9IA 1LUZA 4OX9Q 4K0KL 2ZTEA 3L0OA 3UDGA 2IT1A 2OCEA 1O78A 3L2PA 2K33A 4B8TA 3QJYA 3STBD 4PZ7A 3HOXG 1PH3A 3NENA 1G51A 1S40A 3U4VA 2CTKA 3J7ZC 2MJHA 4LFAL 1A62A 2DN8A 1GUSA 3ERSX 5JJIA 2VW9A 2A68D 4DV3L 3QG1A 2UU9Q 3GTGH 4UP7A 4C2MH 2VQFL 4A3FG 3PIOA 3WWVA 3TRZA 4OXPA 3GTMH 2LMCB 2Q8IB 5FLMH 1PH4A 3GTPH 1VQAA 3I56A 3Q8DA 4GKKL 5M3MH 1QVCA 4R4IA 5C0XJ 2JA5G 2JA7G 1I50H 2B8FA 3H0GH 1G6PA 1PFSA 1GO3E 1HTPA 1KQSA 3M4PA 1HH2P 4LF9Q 1Y1WH 1YJNA 4ME3A 4A4IA 1CUKA 3FPPA 2IHFA 1Y8PB 4PV1C 4JI2Q 4LUOA 4IO9A 4MNOA 4BA2I 1YVCA 3ND8A 4JI1Q 5LMNQ 3GD7A 3D0FA 3M4YA 3PO3H 1IW7D 1D7QA 1VIHA 3HKSA 2IX1A 1MKHA 4DNIA 1N32L 5IYDH 2R92H 1YJWA 2EJFC 3I4NH 4LWCA 2L15A 3VR5A 1S3OA 2BDOA 1BBWA 2YTVA 1IBLQ 4LF8Q 4EX5A 1UE5A 2IHEA 1PV4A 1NJIC 2KCTA 1SR3A 4LF6L 3BU2A 1Z7TA 1G291 1CKNB 1FGUA 5IYCH 1QUQB 1ZZIA 4DV5Q 1CKMA 1YHQA 1A63A 3FMCA 3KLRA 2AXYA 4KHZA 4H02A 4TVAB 5FJ8H 1H9JA 4GLAC 4O2DA 2R93G 3LWUA 4HIMA 3M85A 1DD2A 3S1RH 4LFBQ 1Y1VH 3I4MG 4B3RL 1GUTA 3VR4A 4JI5Q 4KKUA 1LYLA 3WDNA 4OO1I 2E74C 5JEAJ 4X6AH 3I4OA 4YY3L 4DV4Q 2R7ZG 1K8GA 3BG3A 4RCNA 4A3CG 3HOWG 2E75C 3OW7A 1FJGL 1K8AC 2ZJRA 3AB9A 1L0WA 1Y14B 4A3DG 4QQBX 2E76C 2HH2A 4A3KG 3TS2A 1P16A 1XMOQ 4GZYC 1X3EA 2CWPA 4LF5Q 2MFIA 3RNUA 1PH6A 4IPHA 1GM5A 3U9SA 3M4OH 2ZJQA 2UXDQ 4TKOB 4B3ML 5C0XG 3J7A5 2UXBL 4HJ7A 4YCWA 2UUBL 3MXNB 1E7ZA 4LF7Q 4A3EG 4JI6L 4G7HC 3M4QA 1UE7A 4QY7A 3VDYA 4KKSA 1NTGA 4KKTA 4LF4L 1JJCB 4GNXC 4XIGS 5GADC 3GO5A 4DAYB 2CKZB 1L1OA 1R9TH 4DV6L 1B9MA 1OXSC 1QVGA 4GKJL 1DXMA 5ELNA 4XTCS 4O0AA 1N34L 1WOCA 1TWGH 2VUMG 1VQ6A 3G4SA 2A19A 3PUVA 3UE0A 2UXCQ 4OO1H 2A6HD 3HOZH 2YQRA 3PF4A 4X65L 1DTJA 1I94L 3K0XA 2D62A 3ND9A 3S1MH 1A6XA 1TXYA 4LFCL 2MO0A 1NE3A 3I55A 2KA7A 4Y52H 1QZHA 5LMUL 1VQEA 2K52A 3T51B 2A8VA 3V69A 3HGBA 5C44H 3OTOQ 4H0LC 1ONLA 4HJ8A 4P72A 4GN5A 1YEZA 2K50A 2JA6H 4DR3L 4LK1C 2WB1G 1TUAA 5BN4A 1HR0Q 1IZ6A 3F2BA 3KDFA 2VZAA 3RN5A 2K32A 1H9SB 1Q1EA 2N78A 1HJPA 5M3FH 2PI2E 1FR3A 4WJ4A 1NMFA 1SMXA 4AIMA 3NEMA 3BZKA 3PO2G 4GOPB 2HIXA 2Z0SA 3GTJH 4HJ5A 2ES2A 1SMYC 1JMCA 4B3SQ 3AQQA 1YNNC 4JYAL 2Z6KC 4DK3C 2L5TA 2KENA 4JV5L 3OYYA 1GVPA 3DM3A 4JBMA 3CC4A 3HOUG 5AJ3Q 4IPDA 1WCMG 2QGQA 1TU2B 2UUCL 4DR1L 4JI3L 4FDBA 4DR7Q 3BDOA 3TEHB 1K1GA 2CTLA 1WFQA 3KF6B 3UDIA 5IYBH 3HOVG 1VF7A 1V8QA 2PPBC 2PCFB 1MIUA 3K7UC 1J5KA 5IY0A 1LTLA 1CSQA 3PF5A 4BBRG 1IBKQ 2PQAA 2B63G 4OX9L 2Q2TA 4NXMQ 4POFA 2F4VQ 4A3GH 1L2FA 3AYHB 2PI2A 2NZOA 2WAQG 3ER0A 2I5LX 1SFOH 2JEBI 2EXDA 2E2JH 2K5NA 2GVAA 3CCRA 3GQBA 2AMCB 4MZ9A 4DNRB 2UU9L 1JT8A 1PHJA 2OPUA 5A35A 3E9HA 5BN3A 3EN2A 4KI0A 1X3FA 4GN4B 3PO3G 3NE5B 5IYDG 2IY5B 1B8AA 4DR2Q 2VY3A 2LXKA 1XNQL 3MEFA 1BDOA 1FYCA 4PMWA 1GHKA 4P71A 1PH1A 1CKOA 1XNRQ 5M5WH 1PYBA 4DV0Q 2UUAL 4A3JG 4BY1H 4LF9L 4NXNQ 3CCQA 5K36G 1YI2A 2LSSA 4JI2L 1IXRA 4IOCA 3DXJC 4JI1L 5LMNL 4A3IG 3PCOB 1RIPA 2K75A 2AWNA 4GLXA 1PMRA 5FJ8G 4OWWB 3J81i 2E5LQ 1QJOA 2JA8H 1EWIA 4QGUA 2ZTDA 1X3GA 1E1OA 3A5ZB 2CW0C 3AEVA 3E0EA 1Y1VG 1IBLL 2JXMB 1EIYB 1UE6A 3CAMA 4LF8L 1Q1BA 1N33Q 3ZJYC 3KF6A 3J81j 4A76A 1HPCA 3RZOH 1XMQQ 5FLXc 4AYBG 4DV5L 1Y69U 2F52A 4JVHA 4IPCA 3S1QH 1O7IA 2HIVA 4JI4Q 5E7NA 4JC0A 5KNBA 3CMAA 1VF5C 3J80i 2QEXA 1HZBA 4HJ9A 4JI5L 2JVZA 4GN3B 4EQ5A 1TKWB 3PUXA 2VQEQ 2RF4A 3CQZH 1J5EQ 1T5EA 3K81C 1Q12A 4QL5A 2O5JC 1SRUA 1VIGA 5GQOA 2KHIA 2OWOA 1PH8A 3W1BA 3HOYG 1WJJA 4GS3A 4G7OC 1X55A 2K4KA 3UE1A 2D5DA 3CCEA 4WANA 4UY8C 3ULPA 4ALPA 1HNXL 4A75A 2NN6H 4QMFB 1JJGA 2CWAA 4IJHA 5IP7H 4WJ3M 3M7NA 5KNCA 1Z47A 2K5HA 4OWTB 4LF5L 5M5XH 2N8NA 2AKWB 1L1OB 4R1JA 1EOVA 1GUOA 2UXDL 3TQYA 1EWHA 3PIPA 3H15A 4IFDI 1A8VA 1IYJB 5C4XH 4JI8Q 4DKAC 2JA9A 3KJOA 4OO1G 4LF7L 1Q46A 1PH2A 1FVIA 4H44C 2AWOA 2CFMA 3KYHC 3HOZG 3M3YH 3A8KE 3U50C 4X64Q 1UWVA 3RLOA 4R4QA 1HNWL 4KHPQ 4JK1C 5IP9H 2BH2A 3W5OA 1B70B 4LIJA 1UE1A 5C3EG 5IWAQ 2H5XA 1KIXA 1JE5A 2GVBA 2DUDA 1SROA 3GDEA 4A3BH 4DAMA 3T1HQ 4JI7Q 1JJ2A 3H94A 2UXCL 5C4JH 3A0JA 1EQQA 3HOXH 4GKKQ 2B8GA 5M3FG 1OXTA 3KDFB 3K7AH 4QJFA 3TREA 2DNEA 2IX0A 3P20A 3L7ZC 1IBMQ 2BE5C 2K14A 3VA7A 4KLKA 5GAHC 2CTFA 1X65A 3OTOL 3FKIG 2E2HH 1HCZA 3EBEA 2CPQA 2BH8A 1DCZA 4DUYQ 1UEBA 4X62Q 1YIJA 3J81c 1HR0L 2EJGC 1K0RA 2B3GA 4OONA 1K8OA 4X66L 4IFDH 2R6GA 2E2IH 3A7AB 2NVYH 4DK0A 4DUZQ 3I7FA
chains in the Genus database with same CATH superfamily
1DYQA 1WTWA 4CKEA 4B3SL 5C4HA 1KAAA 1NMGA 1VQOA 4LF6Q 1HZAA 1HNXH 1PYSB 4BY7B 3PV0A 2O4XA 3CW2C 1EQRA 4ZRZA 1V9NA 1Q81C 4DAVA 3G6JB 3RR5A 4FXDA 1HZCA 1N32H 1WYDA 1FGBD 4GOPC 1IHZA 3D31A 4LF5H 4Q0FA 3L3OC 4N8FA 2QEJC 3J80c 2CTJA 4DR6Q 5EKIA 5HY6A 4JBJA 1VQHA 1PH9A 3CCMA 5C0XI 2D2CC 3N6RA 1STYA 3OHXC 2PMZE 2PNRC 1U0LA 1PDQA 5KEEA 1C7YA 2PQAB 3I2ZA 4DV2L 4A3GG 2K03A 4DR7L 1B7YB 1SFOB 4BXXG 2PQUA 1LT4D 1K8MA 2O4CA 4LF7H 1AFPA 1D5ZC 1KLUD 4DR4Q 2R61A 1D6EC 3J7YW 5EAYA 2E2JB 3C3LA 5CV6A 1VQNA 1MJCA 1R4PB 1ET6A 1V1QA 2NVQB 1VMCA 4K5WA 4TRDA 4J15A 5BR8Q 1HNWH 3BS1A 2KCNA 4PZ8A 3SK6A 3HKZG 1W6KA 2A69C 2VKCA 1WI5A 3CRKC 3ONAB 1NBWA 4AH6A 5CMDA 3K5MA 3CCJA 2J7ZA 2R93H 4B3RH 2XWJB 3PSIA 1T9HA 4DAPA 1IBKL 1I6VC 1GOZA 2K05A 2QA4A 4MHEA 2L55A 1N36Q 4QUCA 4HJAA 4NXML 4C3IG 2F4VL 2TMPA 1UG8A 2HHHQ 2BE5D 4DV1L 1LTAD 1B53A 4E6IA 1PFNA 4FNFA 4Q5VA 2ENBA 2LXJA 1Q82C 2DGRA 1C8CA 5JPNC 5T1GA 1RODA 3A74A 2HCCA 2Y0SG 2PW7A 5M5WB 2NUCA 1Y8OB 1KRTA 4BY1B 3PGZA 1RTNA 1VQJA 4POGA 5DEHA 1K83H 3T56B 4A3CH 2D0OA 5A2QL 1XPUA 5HURA 1X6OA 2ZXPA 4YIJA 5HGQA 3T1YL 3HOWH 4A3MB 3NBHB 5J3BA 4BBSG 5I2YA 3TZUA 2JZXA 3TS0A 4JI6Q 3KFUA 2F0PA 2EJMA 2CPMA 2KHJA 1PXUA 3L9AX 4AQYQ 1E1TA 4L8JA 1QB5D 1VQ4A 4A3DH 2JA8B 1KC8C 4DV6Q 1EEID 3WOFA 2YV5A 5I6YA 3K6OA 2CH4W 4GKJQ 4QIWE 5KNDA 4QMGA 4R4TA 2WFWA 4DR2L 1KAWA 1N34Q 4RWSC 4EC5A 3B6YA 3Q23A 1E24A 4NB3A 5C0XH 3RZOB 5A2QE 3ICEA 3MHBA 4RG1A 3S14H 3AEVB 1XNRL 1XWEA 4DV0L 2OPVA 1R4QB 3GV3A 2DY7A 4X66H 1VCIA 4NXNL 4HIOA 4LF4H 1SYBA 1CZGA 4DV7Q 3JAMi 5IGDA 1BQQT 3SB1A 3QO2A 3S1QB 3GTLH 2YTXA 3TSSA 4U68A 4DR5Q 4A93H 4BY7H 3PIP3 4YCUA 4I7ZC 1KHIA 2N3SA 4UPAA 1JICA 4IUNA 4X3SA 4MTNA 2MNAA 5F2DA 3SK8A 1U5KA 1P8LA 1LABA 4YWKA 2ATWA 3ERQA 1BCPB 1LV9A 2I46A 3V05A 3JAMW 3ZYYX 5FLMG 3KLSX 1ZYRC 4KN7C 4JI0Q 2VUMH 3CQZB 1N33L 2EY5A 1F2ZA 4L5TA 3VR3A 2CCZA 2I07B 5M3MG 4ID6A 4PG3A 4HIDA 3BZCA 3S24A 1I94H 3SGIA 1E22A 4OIKA 4DV2H 4BA1I 3KJPA 4B3TQ 1Z9FA 1JC7A 4LFCH 3H0GG 4X3UA 1I6HH 3QB3A 1UUPA 2D0PA 4R9WA 1TWCH 2NVQH 2X06A 5K5PA 3H3VI 2KHSA 4FJUA 2JK8A 1SE8A 3HFZB 3BYTB 1XTDA 4JVZA 4JI4L 2VNUD 1Y1WG 1BOSA 1I3QH 4CKCA 1S72A 2CTMA 4ZQ3A 3NPPA 1PTOF 2A5HA 3KF8A 1NR4A 2QCPX 4APVA 2F0DA 3M7GA 1HNZQ 5M5XB 5I6WA 1IBKH 3KOJA 2ANNA 1EU4A 5ISRA 2VQEL 1SMYD 2R92G 1WTOA 3BJUA 5DM63 3I4NG 3F8TA 1TWHH 1STNA 4IQZA 1YNND 2F4VH 2WAQE 1J5EL 5JJKA 1BBUA 2OQ0A 3M9BA 5AFWA 1VQMA 4DV1H 5KIXA 2FMMA 2RCNA 2BA1A 4K8JA 1XPRA 1M90C 1HZ9A 5C4XB 1TS4A 5JEAH 1O7LA 2PY9A 1LO5D 3VYRA 5ELFA 4DK6C 4HIKA 1E2WA 1XJVA 5C4XG 1M8AA 2RQXA 1H9RA 2NN6I 1TS5A 3S16B 1VQPA 3M3YB 4A3MH 2KVMA 3PO2H 1ESFA 3T1YH 5IYCG 5LMNW 4JI3Q 1L0YB 3S15H 3QIAA 1Q86C 1WTRA 3VYSA 1X3QA 5M5YH 5IT9L 3CRLC 3MAQA 5IT9W 4XT1B 2CH4A 1VDZA 3OOCA 4JYAH 2KCCA 4ZYSA 3C1EA 5E1FA 1S03G 1V1PA 1VQ8A 5IODA 5IP9G 4A3BB 4RMFA 3EFXD 5CGKA 4A3LH 1EL0A 1PRTB 3MEHA 2FXQA 2O2LD 3A54A 1PTOC 4X3KA 5C4JB 5CR3A 1RL2A 2BL5A 2GN5A 1NAPA 2DGYA 2E3UA 1X4NA 2JEAI 1N8RC 3RF2A 2EDGA 2KOLA 2XTIA 4JG2A 1SYCA 3LWEA 2V1CC 2DNCA 1Q8KA 4FP5D 4NDXA 1CTMA 1XYIA 1L1OC 3HOXB 3KK7A 2Q2IA 1EY5A 3DM1A 2ZM6Q 2JQOA 4NXNH 3NP8A 1CQFA 1GJXA 1J4WA 3X3NA 1C9OA 3K7AB 3GR5A 3S1NB 4X64L 5IT9E 1S5BD 4YHHQ 1YJ9A 4HMJA 4KHPL 2M9VA 4DN4M 1LTBD 3H3VH 4XT3B 3IRBA 1JWSD 1YNXA 4LFBL 3HOVH 1A3UA 5IWAL 1XRHA 5JVH3 2E2HB 3S2DH 2EVBA 2RHSB 1X9NA 4J1MA 3NQTA 4KD3A 3T1HL 4OX9H 1XTCD 2ICEC 4JI7L 4NBQA 2KUMA 4BBRH 4CDDC 1ZXTA 2B63H 2I5HA 1VQIA 2YU9H 1V9PA 2B2UC 4IJLA 4DV4L 3BVZA 3NTHA 1VMPA 2RSNA 1DZ1A 1STHA 4AYBE 2Q2UA 2IW3A 1AE3A 4JBKA 3VKEA 4YWMA 4IUTA 1S5CD 3ITPA 2A6EC 1A0IA 5EPLA 2Z6KA 2EQSA 4DFAA 1CFMA 5COYA 1LACA 2E2IB 3NELA 3SXHA 2NVYB 3D4DA 1J6QA 3QWNA 3HG9A 1EZ8A 4WALA 1ENCA 1XNQQ 1OXXK 4LW1A 3F2CA 4IFDG 1HQMC 2VS1A 1TWFH 2XN9C 2K28A 1YHBA 1IBML 1F9PA 3GTKH 2UU9H 4JI4H 3JAMc 2UUAQ 1CHQD 1X54A 2OQKA 4R4CA 2F03A 2ASBA 3DEOA 1S5DD 4OGQC 1VQ9A 1XMOL 4NPSA 1CA6A 3MXGA 2DJGC 3LNNA 3CCVA 4LMQD 1BVSA 1HHVA 1NY4A 1W2BA 2B2VA 4LNQA 2KBNA 4J8QA 4DUYL 1B9NA 1H9MA 1C4QA 4X62L 2VQEH 3Q6SA 2B2YC 1W3SA 3CMEA 1EFID 2PNHA 3DLLA 4CKBA 1DONA 3CD6A 1S4ZA 1DJRD 5C5MA 1ZZKA 2QNDA 1AP0A 1FNVA 1D1IA 2HQLA 1I4RA 1OTCA 1PLFA 4K0KQ 3K59A 1WVNA 1GKHA 1PYWD 4LF9H 1VQDA 4DUZL 3S16H 1EU3A 3IFTA 2CVRA 4L5RC 1VQBA 3UDFA 4A3JH 1SNDA 2V4DA 1JOKA 4XYOA 2NZ1D 3D8GA 1IYUA 5K36H 1TIID 2R7FA 1YHAA 2FFMA 1I4QA 3DUZA 4LFAQ 1B1ZA 1SAPA 2BCOA 3R2IA 1RKNA 2VXWA 3I72A 3KLWA 4A3IH 1YITA 1GHJA 4DV3Q 3A8JE 3OMCA 2R93B 5CV4A 3VYTA 3PUZA 2Q8RE 4JCVE 3JC66 5C44G 2VQFQ 2ANRA 4GLVB 1X4MA 2LF0A 3CCSA 1QZGA 4DR6L 1IBLH 2SEBD 4MN3A 2A6HC 4DXFA 4KV6A 2JA6G 3GABA 1DGSA 1M1KC 1IL2A 1K3RA 3I73A 4E9JA 2R7ZB 1SDFA 5IT9c 2I0QA 4DR4L 1K83B 4IALA 1MD2D 1STBA 3RLNA 3S1NH 4KHVA 2NVTH 1O7ZA 1QCBD 3BYYB 3HOWB 3WOEA 4X64H 4EQOA 1NR2A 5BR8L 2G5DA 1K3BC 1VQFA 4KHPH 1AN7A 2JJQA 1JB3A 1EY0A 3J7AK 2QF7A 4DXGA 2A6ED 3MWYW 5D14A 1SNMA 4A3FH 4JOIA 4LFBH 5DM73 1EYGA 3H91A 2EY2A 5GAGC 1KD1C 1GD7A 1G8ZD 3FDTA 3NWSA 1DT4A 4A3DB 3RLFA 4WJWA 2I5MX 1N36L 4A3KB 1A3TA 2M8WA 1HNXQ 4C3JH 5JAVA 3Q22A 2NVXH 2GA4B 3I4LA 3A5UA 3VYUA 2WKCA 2HHHL 1HR0W 2K1HA 2Q2HA 3FRPB 1I5FA 1N32Q 2CQAA 4JBWA 1X32A 4DV4H 3UDXA 2C9OA 1LTSD 2FMCA 2JA5H 3G7LA 1EOTA 1H9KA 3G48A 2XIWA 3I90A 2JA7H 5IOCA 3S14B 3NQIA 4DPGA 4FF4A 4K2KA 2R7DA 1ZZJA 3CCUA 2YYZA 5FK9C 4MIUA 1ICWA 3OSOA 1SE3A 3VR2A 2PMZB 2ZJPA 3HOYH 5GAEC 3S17H 1EC6A 2CQOA 4JVYA 1ASYA 1J8IA 3GTLB 3ULJA 4L5QA 5IGBA 1OXVA 5EGTA 3F2DA 2JP1A 1SLJA 5ELEA 4A93B 2EYHA 4HR7B 1VQ5A 1ML0D 2LTLA 2X69A 2B2TC 4C3HH 5IYBG 4Y7NH 4AQYL 4J6HA 1IKMA 4G57A 2MUYA 4BY7G 4A93G 2SDFA 1XMOH 4F87A 1PFMA 2MQHA 1HNWQ 1B50A 1RDPD 1KHMA 4IOAA 2B29A 3MXUA 1BCPF 1X0AA 5AJ3L 4ZKBB 1B2TA 4DUYH 1U4RA 5KYLA 2UXDH 2HQEA 3U4ZA 1RD9D 2VUMB 1QNUA 1KXLA 4B3RQ 3F1ZA 3CC7A 1H95A 4UP9A 1XPOA 1VQ7A 1QOHA 3CPFA 1JORA 3NTKA 5DLQE 3SE0A 2OTLA 1YZ6A 1CT1D 1F2MA 1Q8IA 1CKNA 1CSPA 5CBAE 1Q7YC 1QUQA 3T13A 3BVGA 4DV7L 1I6HB 1ZKOA 2EZVA 4F7XA 1TWCB 4YY3Q 5ELOA 4DUZH 1VQLA 2HH3A 1LTRD 4DK1A 2E8GA 4PZ6A 4N8X1 2CTEA 4DR5L 4C56C 1VS0A 2QILA 3GV6A 4PNYA 1I3QB 4YWLA 2PYKA 3CF5A 3I70A 3VR6A 3CCLA 3MZ5A 1GUNA 5EJWA 1PH7A 4RA8A 1FJGQ 2ZT9C 2F0SA 1F9QA 1LM0A 3ULLA 5CC4A 5C3EH 2P2RA 3I4MH 3LGJA 3AFQA 4ODGA 3GTOH 1C0AA 2K5QA 1BKBA 4TSSA 1MSZA 4JI0L 5JOBA 5TSSA 1TWHB 3QR8A 4DR6H 2UXCH 2SOBA 3KF8B 3U58A 2O5IC 3DEPA 1TY2A 4F88A 4FXKC 2VB2X 3K5NA 2A73B 3BZDB 4OELB 1HA6A 1BCPC 3EQLC 5C6AA 4QIWB 4GNXB 2R7ZH 4B3TL 2HT1A 4B3MQ 3O13A 5JEAG 3EROA 4RAUC 4DR4H 5A2QW 2K5WA 4P74A 2UXBQ 1Z2IA 3K5LA 1UNSA 3EJIA 4BY1G 3HKZE 3FHWA 1RTOA 3PO2B 2MO1A 2UUBQ 1B3QA 4WORA 3RZDH 1SNCA 3S15B 1MHWC 5BR8H 4X66Q 4P75A 2EYMA 1OXUA 3BDCA 1YBYA 3CU7A 3I91A 5G3LF 4LF4Q 3CXCA 4A3MG 5M5YB 1ENAA 4JW0A 3X3MA 4HSVA 5BN5A 3I3CA 1MBYA 1WE8A 4CJ2C 1DOLA 3CPWA 4LJZC 1B44D 3OTOH 4HSPA 4QUFA 1EIFA 5I9PA 1E2VA 3G6EA 1D8LA 2WB1E 2AUKA 3W1GA 4A3KH 1HNZL 3OPOA 1SYEA 1V43A 3R8BA 1D2BA 3FKIH 1N36H 1AE2A 2JA8G 3PUWA 3TN2A 5HGTA 1A15A 2KCMA 3DHQA 1HR0H 1PRTF 2G9HD 4A3LG 3GTQH 1V1PB 4X3TA 2YTYA 1QWYA 1Z6HA 2Y0SE 3Q24A 2RKSA 4OWXB 3T53B 1MI2A 4MTKA 3V2TA 3MXNA 4G7ZC 3MFYA 1ASZA 1PH5A 1HUNA 1KNEA 1MJEA 3IFDA 4YCVA 2F1MA 3EA6A 4KN4C 4PMBA 4A3EH 4DAYA 3SK4A 1WHRA 3UI2A 1IYVA 1E3PA 2F0JA 3BVMA 2JYOA 4X65Q 2OTJA 3U1KA 2JE6I 1I94Q 1VQKA 4DV2Q 4CJ1B 4B3SH 2FJ2A 2EIFA 4RCOA 1MSGA 2D9IA 2WINB 1JB7A 4LFCQ 3N52A 5EKLA 1K73C 1BBXC 1EFWA 5ELCA 2L4NA 4UP8A 3FVQA 3SDZA 3HOVB 2WP8J 4RHRA 3PUYA 1CA5A 2B2WC 4AQYH 2E5LL 3S2DB 5LMUQ 1S5FD 3R2TA 1EY4A 1EUJA 3KBXA 3FP9A 1EY6A 3W2DA 4BBRB 3J7AV 3STBC 1PFBA 2B63B 3I0PA 2A69D 1B4OA 5LHY1 2YU9B 2RHQB 5J22A 4FVMA 3DWAA 1JWMD 1XMQL 1TR5A 2CWHA 5IGGA 5FO8B 4PDBA 1D5MC 4KMUC 4DR3Q 4IUQA 4DR7H 2EYLA 3EIVA 2WAQB 1V1OA 2KJXA 4I7AA 2ZM6L 1PRTC 2A68C 4DV1Q 4IFDJ 1PVOA 4BXXH 3K8AA 2AUJD 3A7LA 2A1AA 4P73A 2BA0A 2ZQEA 4YHHL 4FJSA 1TWFB 1QILA 4FF3A 1QVFA 1PA6A 3GTKB 1GXDC 3OMGA 4CBVA 1JE4A 1NSNS 2AQ1B 3AFPA 5IE8A 3I8ZA 4DR5H 5EPKA 1KDBA 1KRSA 1YNJC 1N9WA 2NN6G 5E4WC 4L5SA 4KTAA 4H13C 2M00A 4KK7A 5IGCA 1CI3M 1E2ZA 3T16A 3E6ZX 5H1SE 1Q90A 3T1YQ 5IP7G 2IX3A 4GNXA 4HTHA 1X56A 3QOLA 4R4OA 4NXMH 1WTXA 2ID0A 4JYAQ 5JJLA 3G71A 4AM3A 2L1BA 1MSHA 4HAEA 4IPGA 4IUPA 5GROA 2FMRA 3RN2A 1H9SA 2ZTCA 4C3IH 1VQCA 4JV5Q 3J7AF 1AH9A 1ZTGA 1FL0A 5DNFA 4LUVA 1TWAH 1VQGA 2F0OA 3A8IE 4UAIA 1B3AA 1RF2D 2AHOB 2QW7A 4Z9CB 3GKUA 1ILPA 4FF2A 4B3TH 1SEBD 4LUZA 3HRZC 1JR0D 4GOPA 2N49A 4DNTB 2K5VA 1JWUD 1SE4A 4A3JB 1AW7A 1F9SA 2UUCQ 3AU7A 4JOIC 4DR1Q 3D4RA 4XQQA 2G8YA 1IW7C 2F3IA 3K80C 3S2HH 2RBMA 3NBIA 1Y8NB 1HUMA 2LY7A 4IUUA 4BBSH 3IKJA 2MHVA 2F0UA 4A3IB 2IWHA 1KL9A 2C35B 5EQ0A 1ILQA 2K04A 2MJ8A 3VA5A 2Z8LA 2VL6A 2P5ZX 3W3AA 3CP0A 1K9MC 3OW2A 3CC2A 1O80A 2G9DA 2XGTA 2K7VA 1K28A 5IGEA 1I4GA 1GUGA 4O42A 1HA5A 1PQXA 4TQUS 3HS0C 4A3BG 2NZHA 5I2XA 4ABNA 2HDLA 1E0BA 2ALYB 1SN8A 2PW5A 3E5SA 3DWQA 5JJZA 1PZKD 2OXPA 3HOUH 4JI8L 4DR2H 4CJ0B 1WCMH 3E9IA 1LUZA 4O1NA 4OX9Q 4HMIA 2F3WA 2NTSA 4K0KL 2ZTEA 3L0OA 3UDGA 1XNRH 2IT1A 2OCEA 4HCEA 4DV0H 1O78A 3L2PA 2K33A 4B8TA 3QJYA 1ZYRD 4AYBB 3STBD 2WACA 4PZ7A 3HOXG 2NVTB 2RDHA 1PH3A 2F0EA 4RFBA 4H7BA 3NENA 1G51A 1S40A 3U4VA 2CTKA 3J7ZC 2MJHA 4LFAL 1A62A 1L0XB 2DN8A 2EXZA 2DJFC 1GUSA 2QKIC 4A3FB 3ERSX 4K6LA 2F0HA 1EIHA 5JJIA 1PRTD 2VW9A 2A68D 4DV3L 3QG1A 1HFNA 2E5LH 2UU9Q 3GTGH 2L12A 4UP7A 4C2MH 4C3JB 2EOTA 2VQFL 4A3FG 3PIOA 3WWVA 2NVXB 3TRZA 4OXPA 3GTMH 4CDCC 2LMCB 2Q8IB 1F0XA 1N33H 4C3JG 1QNKA 5FLMH 1PH4A 3GTPH 1VQAA 2Q8TA 3H09A 3K5OA 3I56A 2JA5B 4IUVA 2JA7B 1HRJA 1XMQH 3Q8DA 1U4MA 5KYIA 1WTQA 4NZRM 4GKKL 5M3MH 1QVCA 4R4IA 5C0XJ 4OD6A 5EKKA 1G2SA 3OWEB 2JA5G 2JA7G 4OEMB 3HOYB 4ZKCB 3URYA 3S17B 1I50H 2B8FA 4CGYB 3H0GH 1LTTD 1G6PA 1PFSA 4QF4A 1GO3E 2F0GA 5J1ZA 1HTPA 1KQSA 3M4PA 2RCFA 1HH2P 3J80L 4LF9Q 1Y1WH 1YJNA 4ME3A 1TY0A 4C3HB 1TQOA 4A4IA 4Y7NB 1CUKA 2PT7G 2R3ZA 2IHFA 3FPPA 1Y8PB 4PV1C 4JI2Q 4LUOA 4IO9A 1KDAA 4MNOA 4BA2I 3FPUB 1TS3A 1YVCA 3ND8A 4JI1Q 5LMNQ 1V8CA 3OETA 2EYFA 3GD7A 3D0FA 4IURA 3M4YA 2MPMA 5D3IB 3PO3H 1IW7D 1D7QA 1VIHA 3HKSA 4G4KA 2IX1A 3RD4A 1MKHA 2M2LA 4DNIA 1N32L 1J5EH 5IYDH 2R92H 3BDLA 3P1HA 1YJWA 2EJFC 3I4NH 4LWCA 2L15A 3D6WA 1S3OA 3QOJA 3VR5A 4XQJA 3FAUA 1ET9A 2BDOA 4RGMA 3KDGA 1QE6A 1BBWA 2YTVA 1IBLQ 2OEOA 4LF8Q 4EX5A 4OL7A 1UE5A 2IHEA 2KEDA 1PV4A 5JVG3 5CBEE 1PTOD 1G6ZA 4KJOA 3HOZB 1NJIC 1FKAH 2KCTA 1SR3A 4LF6L 3BU2A 1Z7TA 4V0BA 1G291 2RSOA 3NWTA 1CKNB 1FGUA 4I65A 4QCLA 5IYCH 1QUQB 4K5XA 4DV5Q 1ZZIA 1CKMA 2EYOA 1YHQA 3FMCA 3KLRA 1A63A 2AXYA 4KD4A 4IN3A 4KHZA 4H02A 4IZ8A 4TVAB 5C3EB 5FJ8H 1X9ZA 3I4MB 2F0QA 2IPKD 1H9JA 4GLAC 4O2DA 3GTOB 2R93G 4C1NI 5DT9A 3LWUA 1BR9A 4WRDA 3M85A 4HIMA 1NNXA 3OIPA 3S1RH 1DD2A 4LFBQ 2N55A 1JOQA 1Y1VH 2B39A 3I4MG 4B3RL 4ZAIA 1GUTA 3VR4A 4JI5Q 4JI8H 1LYLA 4KKUA 3WDNA 4OO1I 1X3PA 2E74C 1KABA 5LL6X 4K0KH 5JEAJ 1BXTA 4X6AH 2PZWA 4N9TA 2NYZD 3I4OA 4NP5A 4NW2A 4YY3L 4DV4Q 2R7ZG 1AZQA 1EY8A 1K8GA 4ZUJA 4ZCKA 5FKAC 5M3FB 2Z9HA 3BG3A 2OT2A 1EZ6A 4RCNA 2AQ3B 3RZDB 4A3CG 4ZLTF 2RVLA 2L0CA 2XRQD 3HOWG 2E75C 3TBIB 2LS01 4L6TB 5IWAH 2H4OA 4C1NK 2XRSD 3OW7A 1FJGL 1K8AC 2ZJRA 3AB9A 3GTJB 1L0WA 1Y14B 4PMCA 3FKIB 3T1HH 4JI7H 2VQFH 3MTSA 4A3DG 4QQBX 2E76C 2HH2A 3HEJA 3C1FA 4A3KG 4RGNA 1P16A 3TS2A 1XMOQ 4GZYC 4NZTM 1X3EA 3GTQB 4XDXA 2CWPA 4LF5Q 4ILWA 2MFIA 3RNUA 1EY7A 1PH6A 4IPHA 1GM5A 1ICFB 3U9SA 1HXYD 5FOBB 3M4OH 4UDUC 2ZJQA 2UXDQ 4EVOA 4GKKH 4OHJA 4TKOB 4B3ML 2ICIA 2RDFA 5C0XG 4A3EB 3J7A5 2UXBL 4HJ7A 4YCWA 1WTPA 1F77A 2UUBL 3MXNB 1E7ZA 1IBMH 4LF7Q 4A3EG 4JI6L 4G7HC 3M4QA 1UE7A 4QY7A 3VDYA 1NTGA 4KKSA 4KKTA 4LF4L 4KY6A 2F4IA 1AEXA 1JJCB 4GNXC 4XIGS 5GADC 3GO5A 2XWBB 4DAYB 3SK5A 1LT6D 1FNWA 1O7YA 5J39A 5IIFA 1S5ED 2CKZB 1L1OA 1R9TH 4DV6L 1B9MA 1PTOH 1DM0B 1OXSC 2F3VA 3MXPA 1QVGA 4GKJL 1DXMA 1SEIA 5ELNA 4X62H 2HUGA 2K6AA 4XTCS 4BS9A 1DOMA 4O0AA 4JPBW 1N34L 4LAAA 2SNSA 1PZID 2HCIA 1WOCA 1TWGH 3C2PA 2VUMG 1VQ6A 3AMUA 3G4SA 1J9OA 5FO9B 2A19A 3PUVA 3NHHA 4EGVA 3OSSD 3UE0A 2UXCQ 4OO1H 3GP7A 2FHTA 3F2UA 4A3GB 1GUWA 1ODHA 2A6HD 3HOZH 2YQRA 1RJTA 3PF4A 4X65L 1DTJA 1ZEQX 3K0XA 1I94L 2D62A 1BF4A 4ZUIA 3ND9A 3S1MH 1BNZA 5ELDA 2CWFA 4LF6H 1A6XA 2B2UA 1TXYA 3NSWA 1SYDA 2XVSA 2F0FA 2MO0A 4LFCL 1NE3A 3H6MA 4QB4A 3EVQA 3I55A 2KA7A 1ENFA 4Y52H 3HKZB 5CV7A 1SYGA 1QZHA 1G91A 5LMUL 1VQEA 2K52A 3T51B 4ULLA 2A8VA 3V69A 3HGBA 3V96A 3H3VC 2AQ2B 5C44H 3OTOQ 4H0LC 1ONLA 4HJ8A 2WB1B 1DOKA 2QDLA 4P72A 4C3IB 4GN5A 1YEZA 2K50A 2JA6H 4B8CD 1TWAB 4DR3L 2VB3X 1EQVA 2KEEA 4LK1C 2WB1G 4CHTB 1I4XA 2EE1A 1UAPA 4KY5A 5BN4A 1HR0Q 1TUAA 1IZ6A 3F2BA 3KDFA 2VZAA 3RN5A 2EPBA 2K32A 1SNQA 3U9OA 1H9SB 1Q1EA 2Y0SB 5CV5A 3SR1A 4YY3H 2N78A 1HJPA 1G2TA 2A1SA 5M3FH 2PI2E 2K1BA 1FR3A 1STAA 3PIO3 4P2CB 2B2YA 4WJ4A 3PQIA 5D3DA 2E2DC 1NMFA 2NWGA 1STGA 4EQPA 3S2HB 3S9WA 2J4XA 1SMXA 2CHBD 1LTGD 4AIMA 4FF1A 3NEMA 3BZKA 4M8AA 3PO2G 4BBSB 4GOPB 2HIXA 2LRRA 3DMUA 3SEBA 1SJED 3R3OA 2Z0SA 3GTJH 4HJ5A 2ES2A 1CZWA 1SMYC 1JMCA 1FJGH 1BUVT 4B3SQ 3MA2B 5FLXL 5FLXW 3KDKA 3AQQA 1YNNC 4K2LA 4JYAL 2Z6KC 4DK3C 2HHHH 1EYAA 2L5TA 4N9PA 2KENA 3HOUB 4JV5L 3OYYA 1GVPA 1WCMB 3DM3A 4JBMA 2Z4HA 2D9UA 1SYFA 3CC4A 2ZXOA 4RGTA 3HOUG 5AJ3Q 4HN7A 1RHPA 4IPDA 2F0MA 1WCMG 2QGQA 3DWPA 1TU2B 4B3MH 5KRUA 4NKLA 2UXBH 2UUCL 4DR1L 4JI3L 2JN4A 4FDBA 4DR7Q 1LT5D 2UUBH 3BDOA 3TEHB 1C48A 2B2VC 5KGUA 4JI6H 1K0SA 5FLXE 1K1GA 3P75A 1D5XC 2X6GA 4XYQA 5CV9A 2CTLA 1WFQA 2FPHX 1WD0A 3KF6B 4HCSA 5ELBA 3UDIA 5IYBH 3GTGB 1QG7A 3HOVG 1VF7A 1SBBB 1V8QA 2PPBC 4DV6H 4C2MB 3TDQA 2F0TA 4DF7A 2PCFB 5LL6b 1MIUA 3K7UC 4GKJH 1J5KA 1LT3D 4FO2A 3GTMB 5IY0A 1LTLA 1TT2A 2M6QA 1CSQA 3PF5A 1N34H 4BBRG 1IBKQ 3GTPB 2L9HA 4OCHA 2PQAA 1M4VA 2JSOA 2B63G 4OX9L 2Q2TA 4HEDA 4NXMQ 4POFA 3JAML 2F4VQ 5M3MB 2MGSA 5CV8A 2DY8A 4A3GH 3HP3A 3R93A 1L2FA 1U4PA 2IL8A 4DV7H 3AYHB 3PMFA 2PI2A 2WKDA 1XXGA 2K5DA 1EYDA 2NZOA 2WAQG 1I50B 2HD3A 3ER0A 3TP6A 3H0GB 1AZPA 2I5LX 1SFOH 4X65H 2LFNA 2JEBI 4R8NA 5EBDA 1I6UA 2EXDA 2ZXRA 1BCPD 1IL8A 2E2JH 1Y1WB 1S20A 2K5NA 2GVAA 3CCRA 2NBFA 3GQBA 2AMCB 2LKVA 4MZ9A 3IAYA 3NXWA 4DNRB 1FNUA 2UU9L 5FO7B 5LMUH 3SHLA 3SVMA 1JT8A 5C3XA 3PO3B 2J0TD 1PHJA 2OPUA 5A35A 4JI0H 3JAME 1LTID 2HDMA 3E9HA 2OF1A 5BN3A 5D65A 2R92B 3A56A 1SNPA 3EN2A 1NXUA 3I4NB 4KI0A 1X3FA 4GN4B 3PO3G 1NUCA 4B9XA 1FD7D 3NE5B 5IGFA 4OIJA 2B2TA 5IYDG 2IY5B 1CK1A 4DR3H 4RHSA 1B8AA 2PO4A 2WIIB 4DR2Q 2VY3A 2LXKA 1XNQL 2IJ0A 3MEFA 1BDOA 1FYCA 4PMWA 3TP5A 1GHKA 3NBHA 4P71A 1PH1A 1CKOA 5EBCA 1XNRQ 5M5WH 1PYBA 4DV0Q 2UUAL 1OO9B 4A3JG 4BY1H 4LF9L 4NXNQ 3KBGA 3CCQA 5K36G 1YI2A 1WTVA 5T1IA 1VBIA 2LSSA 1F2YA 4JI2L 1IXRA 4IOCA 1HNZH 3DXJC 4JI1L 5LMNL 2XSCA 4A3IG 3OIQA 3PCOB 3KUPA 1RIPA 2K75A 2SNMA 2AWNA 3S1RB 4GLXA 1PMRA 1Y1VB 5FJ8G 4OWWB 4G08A 3J81i 4UHVA 1CQVA 2QDBA 2E5LQ 1QJOA 3NUCA 2JA8H 4WFN3 2F0VA 3Q0AA 1EWIA 4JV5H 4QGUA 2ZTDA 1X3GA 1E1OA 3A5ZB 2CW0C 3AEVA 3E0EA 2PQEA 1Y1VG 2F0IA 1IBLL 4H8AA 1BO0A 2JXMB 1EIYB 1UE6A 3CAMA 5G3LD 4LF8L 1Q1BA 1N33Q 3ZJYC 5M9OA 2FINB 3UOEA 4ZK9B 3KF6A 4DA2A 3J81j 4A76A 1HPCA 3RZOH 1XMQQ 1A2UA 1SXTA 2UUCH 3D4WA 4DR1H 5FLXc 4JI3H 4AYBG 1W6JA 2EY1A 3J81L 3J81W 4B08A 1KDCA 5C4ZA 4DV5L 1Y69U 1SE2A 3T4AC 2F52A 1T5XD 4JVHA 4IPCA 4KJNA 3S1QH 4FYDA 4NMZA 1O7IA 2HIVA 1EY9A 4JI4Q 2H1EA 4BWGB 5E7NA 4JC0A 5KNBA 3CMAA 3TZDA 1VF5C 3HZXA 2TSSA 3EZJA 3J80i 3MC0B 2Z4IA 3OWFA 2QEXA 1HZBA 4DU9A 1YNJD 4HJ9A 4JI5L 2JVZA 2WV6D 1RCVD 4GN3B 4EQ5A 1TKWB 3PUXA 2VQEQ 4RGOS 5C3WA 2RF4A 2MP1A 3M4OB 4U673 2RDGA 3CQZH 1J5EQ 1LLRD 1T5EA 3K81C 2ZM6H 2PZUA 1Q3LA 1Q12A 1WTHA 4QL5A 2O5JC 3J81E 3MVVA 4XQNA 1SRUA 1U4LA 1VIGA 5EPJA 5JPMC 5GQOA 2KHIA 1ESRA 4RH6A 2OWOA 4YHHH 1PH8A 5C5LA 4EQNA 3W1BA 4K5VA 3HOYG 3E0JA 1MGSA 3J80W 3D3RA 1WJJA 4GS3A 4G7OC 1X55A 3LX0A 2K4KA 3UE1A 1KLGD 2D5DA 2EY6A 3CCEA 4WANA 4UY8C 1D1KA 3ULPA 4ALPA 1R9TB 1HNXL 4A75A 4C3HG 2NN6H 1JOOA 4K8IA 4RKBA 1PTOB 3P7JA 1I4PA 4QMFB 1JJGA 3FEWX 3IL8A 3NK9A 2CWAA 4IJHA 5IP7H 3K0YA 4WJ3M 1F9RA 3M7NA 3C46A 4ME5A 5KNCA 1Z47A 2K5HA 2XNAC 2EYPA 4OWTB 4LF5L 5M5XH 2N8NA 1TWGB 1L1OB 2AKWB 4K6DA 4R1JA 4KY7A 1AN8A 1EOVA 1GUOA 2UXDL 3NCVA 3TQYA 1JQYD 2B2WA 2C5CA 1EWHA 3PIPA 5DAUA 3H15A 4PQXA 3J80E 1TVXA 4XXEA 4IFDI 1A8VA 2F0LA 1IYJB 5C4XH 4JI8Q 2L11A 4DKAC 1XNQH 1II3A 1U9RA 2JA9A 3KJOA 3D6CA 3RMHA 4OO1G 4LF7L 1Q46A 1PH2A 1A2TA 1FVIA 4H44C 2AWOA 2K01A 3S1MB 1EQTA 2CFMA 3KYHC 1EYCA 3HOZG 1WTJA 2CW0D 2UUAH 2F0NA 3CKIB 1KTKA 5I9OA 2F0WA 5NUCA 3M3YH 3A8KE 3U50C 4X64Q 1UWVA 3RLOA 2F0KA 1CHPD 1EEFD 4R4QA 1HNWL 4JI2H 4KHPQ 2Z1CA 4JK1C 5I4DA 4JI1H 5LMNH 5IP9H 2BH2A 3W5OA 1B70B 2N88A 4LIJA 1UE1A 4L63B 5C3EG 4CDFC 1NCVA 5IWAQ 5C44B 2H5XA 1KIXA 1JE5A 2GVBA 2DUDA 1SROA 3GDEA 4A3BH 4DAMA 1XX8A 2LTMA 2JA6B 3T1HQ 4JI7Q 2BDNA 5CYUA 1SJHD 1HQRD 1JJ2A 3H94A 4M1UB 5C4JH 2UXCL 2Y3MA 1JCKB 5E3FA 4B9WA 4LF8H 2PZTA 4CDEC 5LL6S 3TP8A 3A0JA 4RKLA 1EQQA 4F8MA 3HOXH 1WD1A 3TMEA 4GKKQ 2EYJA 2X6LA 2B8GA 5M3FG 1OXTA 4LFAH 3KDFB 1F2LA 3K7AH 4DV5H 4QJFA 2NTTA 3TREA 2DNEA 4DGZA 3KLSA 4DV3H 2IX0A 3P20A 1UEAB 2RA4A 3L7ZC 1IBMQ 4R8IA 3A55A 3NTIA 3RUZA 1SSOA 2BE5C 2K14A 1EIGA 2NB0A 4K14A 1EWCA 3VA7A 2KQ3A 4KLKA 5GAHC 2CTFA 1X65A 3OTOL 2Z6BA 3FKIG 2E2HH 1HCZA 2FFKB 3EBEA 1WVLA 2CPQA 2BH8A 1DCZA 1KNAA 2KECA 3K58A 2BOSA 4JI5H 1I4HA 5E4XA 4DUYQ 5L37A 3E3XA 5CORA 1UEBA 4X62Q 3TP7A 3J81c 1YIJA 1HR0L 1HFGA 1SNOA 2EJGC 1K0RA 1CM9A 1TS2A 2B3GA 4V190 4OONA 4FXGC 1PZJD 1IKLA 4S3SA 3K57A 1K8OA 4X66L 4IFDH 2R6GA 1A3VA 2E2IH 3A7AB 3MFGA 2NVYH 3QD7X 4DK0A 4DUZQ 2A74C 3CHBD 1HTLD 1STEA 3I7FA
chains in the Genus database with same CATH topology
1DYQA 1WTWA 4CKEA 4B3SL 5C4HA 1KAAA 1NMGA 1VQOA 4LF6Q 1HZAA 1PYSB 4BY7B 3PV0A 2O4XA 3CW2C 1EQRA 4ZRZA 1Q81C 4DAVA 3G6JB 3RR5A 4FXDA 1HZCA 1WYDA 1FGBD 4GOPC 1IHZA 3D31A 4Q0FA 3L3OC 2QEJC 3J80c 2CTJA 4DR6Q 5EKIA 5HY6A 4JBJA 1VQHA 1PH9A 3CCMA 5C0XI 2D2CC 3N6RA 1STYA 3OHXC 2PMZE 2PNRC 1U0LA 1PDQA 5KEEA 1C7YA 2PQAB 3I2ZA 4DV2L 4A3GG 2K03A 4DR7L 1SFOB 1B7YB 4BXXG 2PQUA 1LT4D 1K8MA 1AFPA 1D5ZC 1KLUD 4DR4Q 2R61A 1D6EC 3J7YW 5EAYA 2E2JB 3C3LA 5CV6A 1VQNA 1MJCA 1R4PB 1ET6A 1V1QA 2NVQB 1VMCA 4K5WA 4TRDA 4J15A 5BR8Q 3BS1A 2KCNA 4PZ8A 3SK6A 3HKZG 1W6KA 2A69C 1WI5A 3CRKC 3ONAB 5CMDA 1NBWA 4AH6A 3K5MA 3CCJA 2J7ZA 2R93H 2XWJB 3PSIA 1T9HA 4DAPA 1IBKL 1I6VC 1GOZA 2K05A 2QA4A 4MHEA 2L55A 1N36Q 4QUCA 4HJAA 4NXML 4C3IG 2F4VL 2TMPA 2HHHQ 2BE5D 4DV1L 1LTAD 1B53A 4E6IA 1PFNA 4FNFA 4Q5VA 2ENBA 2LXJA 1Q82C 2DGRA 1C8CA 5JPNC 5T1GA 1RODA 3A74A 2HCCA 2Y0SG 2PW7A 5M5WB 2NUCA 1Y8OB 1KRTA 4BY1B 3PGZA 1RTNA 1VQJA 4POGA 5DEHA 1K83H 3T56B 4A3CH 2D0OA 5A2QL 1XPUA 5HURA 1X6OA 2ZXPA 4YIJA 5HGQA 3T1YL 3HOWH 4A3MB 3NBHB 5J3BA 4BBSG 5I2YA 3TZUA 2JZXA 3TS0A 4JI6Q 3KFUA 2F0PA 2EJMA 2KHJA 1PXUA 3L9AX 4AQYQ 1E1TA 4L8JA 1QB5D 1VQ4A 4A3DH 2JA8B 1KC8C 4DV6Q 1EEID 3WOFA 5I6YA 2YV5A 3K6OA 4GKJQ 4QIWE 5KNDA 4QMGA 4R4TA 2WFWA 4DR2L 1KAWA 1N34Q 4RWSC 3B6YA 3Q23A 1E24A 4NB3A 5C0XH 3RZOB 5A2QE 3ICEA 3MHBA 4RG1A 3S14H 3AEVB 1XNRL 1XWEA 4DV0L 2OPVA 1R4QB 3GV3A 2DY7A 1VCIA 4NXNL 4HIOA 1SYBA 1CZGA 4DV7Q 3JAMi 5IGDA 1BQQT 3QO2A 3S1QB 3GTLH 2YTXA 3TSSA 4U68A 4DR5Q 4A93H 4BY7H 3PIP3 4YCUA 4I7ZC 1KHIA 2N3SA 4UPAA 1JICA 4IUNA 4X3SA 4MTNA 2MNAA 5F2DA 3SK8A 1U5KA 1P8LA 1LABA 4YWKA 2ATWA 3ERQA 1BCPB 1LV9A 2I46A 3V05A 3ZYYX 5FLMG 3KLSX 1ZYRC 4KN7C 4JI0Q 2VUMH 3CQZB 1N33L 2EY5A 1F2ZA 3VR3A 4L5TA 2CCZA 2I07B 5M3MG 4ID6A 4PG3A 4HIDA 3BZCA 3S24A 3SGIA 1E22A 4OIKA 4BA1I 3KJPA 4B3TQ 1Z9FA 1JC7A 3H0GG 4X3UA 1I6HH 3QB3A 1UUPA 2D0PA 4R9WA 1TWCH 2NVQH 5K5PA 3H3VI 2KHSA 2JK8A 1SE8A 3HFZB 3BYTB 1XTDA 2VNUD 4JI4L 1Y1WG 1BOSA 4CKCA 1I3QH 1S72A 2CTMA 4ZQ3A 3NPPA 1PTOF 2A5HA 3KF8A 1NR4A 2QCPX 4APVA 2F0DA 3M7GA 1HNZQ 5M5XB 5I6WA 3KOJA 2ANNA 1EU4A 5ISRA 2VQEL 1SMYD 2R92G 1WTOA 3BJUA 5DM63 3I4NG 3F8TA 1TWHH 1STNA 4IQZA 1YNND 2WAQE 1J5EL 5JJKA 1BBUA 5AFWA 2OQ0A 3M9BA 1VQMA 5KIXA 2FMMA 4K8JA 2BA1A 2RCNA 1XPRA 1M90C 1HZ9A 5C4XB 1TS4A 5JEAH 1O7LA 2PY9A 1LO5D 3VYRA 5ELFA 4DK6C 4HIKA 1E2WA 1XJVA 5C4XG 1M8AA 2RQXA 1H9RA 2NN6I 1TS5A 3S16B 1VQPA 3M3YB 4A3MH 2KVMA 3PO2H 1ESFA 5IYCG 5LMNW 4JI3Q 1L0YB 3S15H 3QIAA 1Q86C 1WTRA 3VYSA 1X3QA 5M5YH 5IT9L 3CRLC 3MAQA 4XT1B 3OOCA 1VDZA 2KCCA 4ZYSA 3C1EA 5E1FA 1V1PA 1VQ8A 5IODA 5IP9G 4A3BB 4RMFA 3EFXD 5CGKA 4A3LH 1EL0A 1PRTB 3MEHA 2FXQA 2O2LD 3A54A 1PTOC 4X3KA 5C4JB 5CR3A 1RL2A 2BL5A 2GN5A 1NAPA 2DGYA 2E3UA 1X4NA 2JEAI 1N8RC 2EDGA 2KOLA 2XTIA 4JG2A 1SYCA 3LWEA 2V1CC 2DNCA 4FP5D 1Q8KA 4NDXA 1CTMA 1XYIA 1L1OC 3HOXB 3KK7A 2Q2IA 1EY5A 3DM1A 2ZM6Q 2JQOA 3NP8A 1CQFA 1GJXA 1J4WA 3X3NA 3K7AB 1C9OA 3S1NB 4X64L 5IT9E 1S5BD 4YHHQ 1YJ9A 4HMJA 4KHPL 2M9VA 4DN4M 1LTBD 3H3VH 4XT3B 3IRBA 1JWSD 1YNXA 4LFBL 3HOVH 1A3UA 5IWAL 5JVH3 2E2HB 3S2DH 2EVBA 2RHSB 1X9NA 4J1MA 3NQTA 4KD3A 3T1HL 1XTCD 2ICEC 4JI7L 4NBQA 2KUMA 4BBRH 1ZXTA 2B63H 2I5HA 1VQIA 2YU9H 2B2UC 1V9PA 4IJLA 4DV4L 3BVZA 3NTHA 1VMPA 2RSNA 1DZ1A 1STHA 4AYBE 2Q2UA 2IW3A 1AE3A 4JBKA 3VKEA 4YWMA 4IUTA 1S5CD 3ITPA 4DFAA 2A6EC 5EPLA 1A0IA 2EQSA 2Z6KA 1CFMA 5COYA 1LACA 2E2IB 3NELA 3SXHA 2NVYB 3D4DA 1J6QA 3QWNA 3HG9A 1EZ8A 4WALA 1ENCA 1XNQQ 1OXXK 4LW1A 3F2CA 4IFDG 1HQMC 2VS1A 1TWFH 2XN9C 2K28A 1YHBA 1IBML 1F9PA 3GTKH 3JAMc 2UUAQ 1CHQD 1X54A 2F03A 2OQKA 4R4CA 2ASBA 3DEOA 1S5DD 4OGQC 1VQ9A 1XMOL 1CA6A 4NPSA 3MXGA 3LNNA 3CCVA 4LMQD 1BVSA 1HHVA 1NY4A 1W2BA 2B2VA 4LNQA 2KBNA 4J8QA 4DUYL 1B9NA 1H9MA 1C4QA 4X62L 3Q6SA 2B2YC 1W3SA 3CMEA 1EFID 2PNHA 1DONA 4CKBA 3DLLA 3CD6A 1S4ZA 1DJRD 5C5MA 1ZZKA 2QNDA 1AP0A 1FNVA 1D1IA 2HQLA 1I4RA 1OTCA 1PLFA 4K0KQ 3K59A 1WVNA 1GKHA 1PYWD 1VQDA 4DUZL 3S16H 1EU3A 3IFTA 2CVRA 4L5RC 1VQBA 3UDFA 4A3JH 1SNDA 2V4DA 1JOKA 4XYOA 2NZ1D 3D8GA 1IYUA 5K36H 1TIID 2R7FA 1YHAA 1I4QA 3DUZA 4LFAQ 1B1ZA 1SAPA 2BCOA 3R2IA 1RKNA 2VXWA 3I72A 3KLWA 4A3IH 1YITA 1GHJA 2R93B 3A8JE 3OMCA 4DV3Q 5CV4A 3VYTA 3PUZA 2Q8RE 4JCVE 3JC66 5C44G 2VQFQ 2ANRA 4GLVB 1X4MA 3CCSA 1QZGA 4DR6L 2SEBD 4MN3A 2A6HC 4DXFA 4KV6A 2JA6G 1DGSA 1M1KC 1IL2A 1K3RA 3I73A 2R7ZB 1SDFA 5IT9c 2I0QA 4DR4L 1K83B 4IALA 1MD2D 1STBA 3RLNA 3S1NH 4KHVA 2NVTH 1O7ZA 1QCBD 3BYYB 3HOWB 3WOEA 4EQOA 1NR2A 5BR8L 1VQFA 2JJQA 1JB3A 1EY0A 2QF7A 4DXGA 2A6ED 3MWYW 5D14A 1SNMA 4A3FH 4JOIA 5DM73 1EYGA 3H91A 2EY2A 5GAGC 1KD1C 1GD7A 1G8ZD 3FDTA 3NWSA 1DT4A 4A3DB 3RLFA 4WJWA 2I5MX 1N36L 4A3KB 1A3TA 1HNXQ 4C3JH 5JAVA 3Q22A 2NVXH 2GA4B 3I4LA 3A5UA 3VYUA 2WKCA 2HHHL 1HR0W 2Q2HA 3FRPB 1I5FA 1N32Q 2CQAA 4JBWA 1X32A 3UDXA 2C9OA 1LTSD 2FMCA 2JA5H 3G7LA 1EOTA 1H9KA 3G48A 2XIWA 3I90A 2JA7H 5IOCA 3S14B 3NQIA 4DPGA 4FF4A 4K2KA 2R7DA 1ZZJA 3CCUA 2YYZA 5FK9C 4MIUA 1ICWA 3OSOA 1SE3A 3VR2A 2PMZB 2ZJPA 3HOYH 5GAEC 3S17H 1EC6A 2CQOA 4JVYA 1J8IA 1ASYA 3GTLB 3ULJA 4L5QA 5IGBA 1OXVA 5EGTA 3F2DA 2JP1A 4A93B 5ELEA 1SLJA 2EYHA 4HR7B 1VQ5A 1ML0D 2X69A 2B2TC 4C3HH 5IYBG 4Y7NH 4AQYL 4J6HA 1IKMA 4G57A 2MUYA 4BY7G 4A93G 2SDFA 4F87A 1PFMA 2MQHA 1HNWQ 1B50A 1RDPD 1KHMA 4IOAA 2B29A 3MXUA 1BCPF 5AJ3L 4ZKBB 1B2TA 1U4RA 5KYLA 2HQEA 3U4ZA 1RD9D 2VUMB 1QNUA 1KXLA 4B3RQ 3F1ZA 3CC7A 1H95A 4UP9A 1XPOA 1VQ7A 1QOHA 3CPFA 1JORA 3NTKA 5DLQE 3SE0A 2OTLA 1YZ6A 1Q8IA 1CT1D 1F2MA 1CKNA 1CSPA 5CBAE 1Q7YC 1QUQA 3T13A 3BVGA 1I6HB 4DV7L 1ZKOA 2EZVA 4F7XA 1TWCB 4YY3Q 5ELOA 1VQLA 2HH3A 1LTRD 4DK1A 2E8GA 4PZ6A 2CTEA 4DR5L 4C56C 2QILA 3GV6A 4PNYA 1VS0A 1I3QB 4YWLA 2PYKA 3CF5A 3I70A 3VR6A 3CCLA 3MZ5A 1GUNA 5EJWA 1PH7A 4RA8A 1FJGQ 2ZT9C 2F0SA 1F9QA 1LM0A 5CC4A 3ULLA 5C3EH 2P2RA 3I4MH 3LGJA 3AFQA 4ODGA 3GTOH 1C0AA 2K5QA 4TSSA 1BKBA 4JI0L 5JOBA 5TSSA 1TWHB 2SOBA 3KF8B 2O5IC 3U58A 3DEPA 1TY2A 4F88A 4FXKC 2VB2X 3K5NA 2A73B 3BZDB 1HA6A 1BCPC 3EQLC 5C6AA 4QIWB 4GNXB 2R7ZH 4B3TL 2HT1A 4B3MQ 3O13A 5JEAG 3EROA 4RAUC 2K5WA 4P74A 2UXBQ 3K5LA 1UNSA 3EJIA 4BY1G 3HKZE 3FHWA 1RTOA 3PO2B 2MO1A 2UUBQ 4WORA 3RZDH 1SNCA 3S15B 4X66Q 4P75A 2EYMA 1OXUA 3BDCA 3CU7A 3I91A 5G3LF 1YBYA 4LF4Q 3CXCA 5M5YB 4A3MG 1ENAA 3X3MA 4HSVA 5BN5A 3I3CA 1MBYA 1WE8A 4CJ2C 1DOLA 3CPWA 4LJZC 1B44D 4HSPA 4QUFA 5I9PA 1EIFA 1E2VA 3G6EA 1D8LA 2WB1E 2AUKA 3W1GA 4A3KH 1HNZL 3OPOA 1SYEA 1V43A 3R8BA 1D2BA 3FKIH 1AE2A 2JA8G 3PUWA 3TN2A 5HGTA 1A15A 3DHQA 2KCMA 1PRTF 2G9HD 4A3LG 3GTQH 1V1PB 4X3TA 2YTYA 1QWYA 1Z6HA 3Q24A 2Y0SE 2RKSA 4OWXB 3T53B 3V2TA 1MI2A 3MXNA 4G7ZC 3MFYA 1ASZA 1PH5A 1HUNA 1KNEA 1MJEA 3IFDA 4YCVA 2F1MA 3EA6A 4KN4C 4PMBA 4A3EH 4DAYA 3SK4A 3UI2A 1IYVA 1E3PA 2F0JA 3BVMA 2JYOA 4X65Q 2OTJA 3U1KA 2JE6I 1I94Q 1VQKA 4DV2Q 4CJ1B 2FJ2A 2EIFA 4RCOA 1MSGA 2WINB 1JB7A 4LFCQ 3N52A 5EKLA 1BBXC 1K73C 1EFWA 5ELCA 2L4NA 4UP8A 3FVQA 3SDZA 3HOVB 2WP8J 4RHRA 3PUYA 1CA5A 2B2WC 2E5LL 3S2DB 5LMUQ 1S5FD 3R2TA 1EY4A 3KBXA 1EUJA 3FP9A 1EY6A 3W2DA 4BBRB 3J7AV 3STBC 1PFBA 2B63B 2A69D 1B4OA 5LHY1 2YU9B 2RHQB 5J22A 4FVMA 3DWAA 1JWMD 1XMQL 1TR5A 5IGGA 5FO8B 1D5MC 4KMUC 4DR3Q 4IUQA 2EYLA 3EIVA 2WAQB 1V1OA 2KJXA 2ZM6L 1PRTC 2A68C 4IFDJ 4DV1Q 1PVOA 4BXXH 3K8AA 2AUJD 3A7LA 2A1AA 4P73A 2BA0A 4YHHL 1TWFB 1QILA 4FF3A 1QVFA 1PA6A 3GTKB 1GXDC 3OMGA 4CBVA 1JE4A 1NSNS 2AQ1B 3AFPA 5IE8A 3I8ZA 5EPKA 1KDBA 1KRSA 1YNJC 2NN6G 5E4WC 1N9WA 4L5SA 4KTAA 4H13C 2M00A 4KK7A 5IGCA 1CI3M 1E2ZA 3T16A 3E6ZX 5H1SE 1Q90A 3T1YQ 5IP7G 2IX3A 4GNXA 4HTHA 1X56A 3QOLA 4R4OA 1WTXA 2ID0A 4JYAQ 5JJLA 3G71A 4AM3A 2L1BA 1MSHA 4HAEA 4IPGA 4IUPA 5GROA 2FMRA 3RN2A 1H9SA 2ZTCA 4C3IH 1VQCA 4JV5Q 3J7AF 1AH9A 1ZTGA 1FL0A 5DNFA 4LUVA 1TWAH 1VQGA 2F0OA 3A8IE 4UAIA 1B3AA 1RF2D 4Z9CB 2AHOB 1ILPA 4FF2A 1SEBD 4LUZA 3HRZC 1JR0D 4GOPA 4DNTB 2N49A 2K5VA 1JWUD 1SE4A 4A3JB 1AW7A 1F9SA 2UUCQ 3AU7A 4JOIC 4DR1Q 3D4RA 4XQQA 1IW7C 2F3IA 3K80C 3S2HH 2RBMA 3NBIA 1Y8NB 1HUMA 2LY7A 4IUUA 4BBSH 3IKJA 2MHVA 2F0UA 4A3IB 2IWHA 1KL9A 5EQ0A 2C35B 1ILQA 2K04A 2MJ8A 3VA5A 2Z8LA 2VL6A 3W3AA 3CP0A 1K9MC 3OW2A 3CC2A 1O80A 2G9DA 2XGTA 2K7VA 5IGEA 1I4GA 1GUGA 4O42A 1HA5A 4TQUS 3HS0C 4A3BG 2NZHA 5I2XA 4ABNA 2HDLA 1E0BA 2PW5A 3E5SA 1SN8A 2ALYB 3DWQA 5JJZA 1PZKD 2OXPA 3HOUH 4JI8L 4CJ0B 1WCMH 3E9IA 1LUZA 4O1NA 4OX9Q 4HMIA 2F3WA 2NTSA 4K0KL 2ZTEA 3L0OA 3UDGA 2IT1A 4HCEA 2OCEA 1O78A 3L2PA 2K33A 4B8TA 3QJYA 1ZYRD 4AYBB 3STBD 2WACA 4PZ7A 3HOXG 2NVTB 2RDHA 1PH3A 2F0EA 4RFBA 4H7BA 3NENA 1G51A 1S40A 3U4VA 2CTKA 3J7ZC 2MJHA 4LFAL 1A62A 1L0XB 2DN8A 2EXZA 1GUSA 2QKIC 4A3FB 3ERSX 4K6LA 2F0HA 1EIHA 5JJIA 1PRTD 2VW9A 2A68D 4DV3L 3QG1A 1HFNA 2UU9Q 3GTGH 2L12A 4UP7A 4C3JB 4C2MH 2EOTA 2VQFL 4A3FG 3PIOA 3WWVA 2NVXB 3TRZA 4OXPA 3GTMH 2LMCB 2Q8IB 4C3JG 1QNKA 5FLMH 1PH4A 3GTPH 1VQAA 2Q8TA 3H09A 3K5OA 2JA5B 3I56A 4IUVA 2JA7B 1HRJA 3Q8DA 1U4MA 5KYIA 1WTQA 4GKKL 5M3MH 1QVCA 5C0XJ 4R4IA 5EKKA 1G2SA 3OWEB 2JA5G 2JA7G 3HOYB 4ZKCB 3URYA 3S17B 1I50H 2B8FA 4CGYB 3H0GH 1LTTD 1G6PA 1PFSA 4QF4A 1GO3E 2F0GA 5J1ZA 1HTPA 1KQSA 3M4PA 1HH2P 3J80L 4LF9Q 1Y1WH 1YJNA 4ME3A 1TY0A 4C3HB 1TQOA 4Y7NB 4A4IA 1CUKA 2R3ZA 3FPPA 2IHFA 1Y8PB 4PV1C 4JI2Q 4LUOA 4IO9A 1KDAA 4MNOA 4BA2I 3FPUB 1TS3A 1YVCA 3ND8A 4JI1Q 5LMNQ 2EYFA 3GD7A 4IURA 5D3IB 3M4YA 2MPMA 3D0FA 3PO3H 1IW7D 1D7QA 1VIHA 3HKSA 4G4KA 2IX1A 3RD4A 1MKHA 2M2LA 4DNIA 1N32L 5IYDH 2R92H 3BDLA 3P1HA 1YJWA 2EJFC 3I4NH 4LWCA 3D6WA 3QOJA 3VR5A 1S3OA 2L15A 4XQJA 1ET9A 2BDOA 4RGMA 1QE6A 1BBWA 2YTVA 1IBLQ 2OEOA 4LF8Q 4EX5A 4OL7A 1UE5A 2IHEA 2KEDA 1PV4A 5JVG3 5CBEE 1PTOD 1G6ZA 4KJOA 3HOZB 1NJIC 2KCTA 1SR3A 4LF6L 3BU2A 1Z7TA 4V0BA 1G291 2RSOA 3NWTA 1CKNB 1FGUA 4I65A 4QCLA 5IYCH 4K5XA 1QUQB 4DV5Q 1ZZIA 2EYOA 1CKMA 1YHQA 3FMCA 3KLRA 1A63A 2AXYA 4KD4A 4IN3A 4KHZA 4IZ8A 4H02A 4TVAB 5C3EB 5FJ8H 3I4MB 2F0QA 2IPKD 1H9JA 4GLAC 3GTOB 4O2DA 2R93G 4C1NI 3LWUA 1BR9A 4WRDA 3M85A 4HIMA 1DD2A 3OIPA 3S1RH 4LFBQ 2N55A 1JOQA 1Y1VH 2B39A 3I4MG 4B3RL 4ZAIA 1GUTA 3VR4A 4JI5Q 4KKUA 1LYLA 3WDNA 4OO1I 1X3PA 2E74C 1KABA 5LL6X 5JEAJ 1BXTA 4X6AH 2PZWA 4N9TA 2NYZD 4NP5A 3I4OA 4NW2A 4YY3L 4DV4Q 2R7ZG 1AZQA 1EY8A 1K8GA 4ZUJA 5FKAC 5M3FB 3BG3A 2OT2A 1EZ6A 4RCNA 2AQ3B 3RZDB 4A3CG 4ZLTF 2RVLA 2L0CA 2XRQD 3HOWG 2E75C 3TBIB 2LS01 4L6TB 2H4OA 4C1NK 2XRSD 3OW7A 1FJGL 1K8AC 2ZJRA 3AB9A 3GTJB 1L0WA 4PMCA 1Y14B 3FKIB 3MTSA 4A3DG 4QQBX 2E76C 2HH2A 3HEJA 3C1FA 4A3KG 4RGNA 1P16A 3TS2A 1XMOQ 4GZYC 3GTQB 1X3EA 4XDXA 2CWPA 4LF5Q 4ILWA 2MFIA 3RNUA 1EY7A 1PH6A 4IPHA 1GM5A 3U9SA 1HXYD 5FOBB 3M4OH 4UDUC 2ZJQA 2UXDQ 4EVOA 4OHJA 4TKOB 4B3ML 2ICIA 2RDFA 5C0XG 4A3EB 3J7A5 2UXBL 4HJ7A 4YCWA 1WTPA 1F77A 2UUBL 3MXNB 1E7ZA 4LF7Q 4A3EG 4JI6L 4G7HC 3M4QA 1UE7A 4QY7A 3VDYA 4KKSA 1NTGA 4KKTA 4LF4L 4KY6A 2F4IA 1AEXA 1JJCB 4GNXC 4XIGS 5GADC 3GO5A 2XWBB 4DAYB 3SK5A 1LT6D 1FNWA 1O7YA 5J39A 5IIFA 1S5ED 2CKZB 1L1OA 1R9TH 4DV6L 1B9MA 1PTOH 1DM0B 1OXSC 2F3VA 3MXPA 1QVGA 4GKJL 1DXMA 5ELNA 2HUGA 2K6AA 4XTCS 4BS9A 1DOMA 4O0AA 1N34L 4LAAA 2SNSA 1PZID 2HCIA 1WOCA 1TWGH 3C2PA 2VUMG 3AMUA 1VQ6A 3G4SA 1J9OA 5FO9B 2A19A 3PUVA 3NHHA 4EGVA 3UE0A 2UXCQ 4OO1H 3GP7A 2FHTA 3F2UA 4A3GB 1GUWA 2A6HD 3HOZH 2YQRA 1RJTA 3PF4A 4X65L 1DTJA 1ZEQX 3K0XA 1BF4A 2D62A 1I94L 4ZUIA 3ND9A 3S1MH 1BNZA 5ELDA 1A6XA 2B2UA 3NSWA 1TXYA 1SYDA 2XVSA 2F0FA 2MO0A 4LFCL 1NE3A 3H6MA 4QB4A 3EVQA 3I55A 2KA7A 1ENFA 4Y52H 3HKZB 5CV7A 1SYGA 1QZHA 1G91A 5LMUL 1VQEA 2K52A 3T51B 4ULLA 2A8VA 3V69A 3HGBA 3V96A 3H3VC 2AQ2B 5C44H 3OTOQ 4H0LC 1ONLA 4HJ8A 2WB1B 1DOKA 4C3IB 4P72A 4GN5A 1YEZA 2K50A 2JA6H 1TWAB 4DR3L 2VB3X 1EQVA 2KEEA 4LK1C 2WB1G 4CHTB 1I4XA 2EE1A 1UAPA 4KY5A 5BN4A 1HR0Q 1TUAA 1IZ6A 3F2BA 3KDFA 2VZAA 3RN5A 2EPBA 2K32A 1SNQA 3U9OA 1H9SB 1Q1EA 2Y0SB 5CV5A 3SR1A 2N78A 1HJPA 1G2TA 5M3FH 2PI2E 2K1BA 1FR3A 1STAA 3PIO3 4P2CB 2B2YA 4WJ4A 5D3DA 2E2DC 1NMFA 2NWGA 1STGA 4EQPA 3S2HB 3S9WA 2J4XA 1SMXA 2CHBD 1LTGD 4AIMA 4FF1A 3NEMA 4M8AA 3BZKA 3PO2G 4BBSB 4GOPB 2HIXA 3DMUA 3SEBA 1SJED 3R3OA 2Z0SA 3GTJH 4HJ5A 2ES2A 1CZWA 1SMYC 1JMCA 1BUVT 4B3SQ 3MA2B 5FLXL 3AQQA 1YNNC 4K2LA 4JYAL 2Z6KC 4DK3C 1EYAA 2L5TA 4N9PA 2KENA 3HOUB 4JV5L 3OYYA 1WCMB 1GVPA 3DM3A 4JBMA 2Z4HA 2D9UA 1SYFA 3CC4A 2ZXOA 4RGTA 3HOUG 5AJ3Q 4HN7A 1RHPA 4IPDA 2F0MA 1WCMG 2QGQA 3DWPA 1TU2B 5KRUA 4NKLA 2UUCL 4DR1L 4JI3L 4FDBA 4DR7Q 1LT5D 3BDOA 3TEHB 1C48A 2B2VC 5KGUA 5FLXE 1K1GA 3P75A 1D5XC 2X6GA 4XYQA 5CV9A 2CTLA 1WFQA 1WD0A 5ELBA 4HCSA 3KF6B 3UDIA 5IYBH 3GTGB 1QG7A 3HOVG 1VF7A 1SBBB 1V8QA 2PPBC 4C2MB 3TDQA 2F0TA 4DF7A 2PCFB 1MIUA 3K7UC 1J5KA 1LT3D 4FO2A 3GTMB 5IY0A 1LTLA 1TT2A 1CSQA 3PF5A 4BBRG 1IBKQ 3GTPB 2L9HA 2PQAA 1M4VA 2JSOA 2B63G 4OX9L 2Q2TA 4HEDA 4NXMQ 3JAML 4POFA 2F4VQ 5M3MB 2MGSA 5CV8A 2DY8A 4A3GH 3HP3A 3R93A 1L2FA 1U4PA 2IL8A 3PMFA 3AYHB 2PI2A 2WKDA 1XXGA 2K5DA 1EYDA 2NZOA 2WAQG 1I50B 3ER0A 3TP6A 3H0GB 1AZPA 2I5LX 1SFOH 2LFNA 2JEBI 4R8NA 5EBDA 2ZXRA 2EXDA 1BCPD 1IL8A 2E2JH 1Y1WB 2K5NA 2GVAA 3CCRA 2NBFA 3GQBA 2AMCB 2LKVA 4MZ9A 3IAYA 3NXWA 4DNRB 1FNUA 2UU9L 5FO7B 3SHLA 3SVMA 1JT8A 5C3XA 3PO3B 2J0TD 1PHJA 2OPUA 5A35A 3JAME 1LTID 2HDMA 2R92B 2OF1A 5BN3A 5D65A 3E9HA 3A56A 1SNPA 3EN2A 3I4NB 4KI0A 1X3FA 4GN4B 3PO3G 1NUCA 4B9XA 1FD7D 3NE5B 5IGFA 4OIJA 2B2TA 5IYDG 2IY5B 1CK1A 4RHSA 1B8AA 2PO4A 2WIIB 4DR2Q 2VY3A 2LXKA 1XNQL 2IJ0A 3MEFA 1BDOA 1FYCA 4PMWA 3TP5A 1GHKA 3NBHA 4P71A 1PH1A 1CKOA 5EBCA 1XNRQ 5M5WH 1PYBA 4DV0Q 2UUAL 1OO9B 4A3JG 4BY1H 4LF9L 4NXNQ 3KBGA 3CCQA 5K36G 1YI2A 1WTVA 5T1IA 2LSSA 1F2YA 4JI2L 1IXRA 4IOCA 3DXJC 4JI1L 5LMNL 2XSCA 4A3IG 3OIQA 3PCOB 3KUPA 1RIPA 2SNMA 2K75A 2AWNA 3S1RB 4GLXA 1PMRA 1Y1VB 5FJ8G 4OWWB 3J81i 1CQVA 2QDBA 2E5LQ 1QJOA 3NUCA 2JA8H 4WFN3 2F0VA 3Q0AA 1EWIA 4QGUA 2ZTDA 1X3GA 1E1OA 3A5ZB 2CW0C 3AEVA 3E0EA 2PQEA 1Y1VG 2F0IA 1IBLL 1BO0A 2JXMB 1EIYB 1UE6A 3CAMA 5G3LD 4LF8L 1Q1BA 1N33Q 3ZJYC 5M9OA 2FINB 4ZK9B 3KF6A 4DA2A 3J81j 4A76A 1HPCA 3RZOH 1XMQQ 1A2UA 1SXTA 3D4WA 5FLXc 4AYBG 1W6JA 2EY1A 3J81L 4B08A 1KDCA 5C4ZA 4DV5L 1Y69U 1SE2A 3T4AC 2F52A 1T5XD 4JVHA 4KJNA 4IPCA 3S1QH 4FYDA 4NMZA 1O7IA 2HIVA 1EY9A 4JI4Q 2H1EA 4BWGB 5E7NA 4JC0A 5KNBA 3CMAA 3TZDA 1VF5C 3HZXA 2TSSA 3J80i 3MC0B 2Z4IA 3OWFA 2QEXA 4DU9A 1HZBA 1YNJD 4HJ9A 4JI5L 2JVZA 2WV6D 1RCVD 4GN3B 4EQ5A 1TKWB 3PUXA 2VQEQ 4RGOS 5C3WA 2RF4A 2MP1A 3M4OB 4U673 2RDGA 3CQZH 1J5EQ 1LLRD 1T5EA 3K81C 2PZUA 1Q3LA 1Q12A 4QL5A 2O5JC 3J81E 3MVVA 4XQNA 1U4LA 1SRUA 1VIGA 5EPJA 5JPMC 5GQOA 4RH6A 1ESRA 2KHIA