3L7ZC

Crystal structure of the s. solfataricus archaeal exosome
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
222
structure length
222
Chain Sequence
QKIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKSGCSIFVANNGRIWATCPSRFSEEILIEAIRKIENESHIKGLTDRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the S. solfataricus archaeal exosome reveals conformational flexibility in the RNA-binding ring.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase/rna binding protein
molecule keywords Probable exosome complex exonuclease 2
total genus 37
structure length 222
sequence length 222
chains with identical sequence F, I
ec nomenclature
pdb deposition date 2009-12-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3l7zC01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3l7zC02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 3l7zC03
2K52A 5FLMG 2JA7G 3UE0A 1MKHA 3TREA 1Q82C 2IHFA 4X66L 1S72A 4A3BH 2R92G 4QMFB 4IPHA 2PY9A 1VQ9A 3CC4A 5C0XG 3ER0A 5C44H 5JJIA 3G48A 2JK8A 4DUZQ 5BN5A 4YCUA 4BBRH 4KN4C 2F52A 1H9SA 2UUCL 3HOWG 1N32L 2CTMA 3S17H 3S1NH 1VDZA 3D4RA 5ELOA 5LMUL 4DAMA 1UE5A 1PH5A 1VQLA 4LF9L 4TQUS 2K5HA 4IPDA 2AMCB 3EBEA 2B63H 3ND9A 4YCWA 4DV0L 1N33L 4DR7Q 3RR5A 4HIDA 3J7A5 1L1OC 2K5NA 2KBNA 3GQBA 5KNDA 2CKZB 1DCZA 4IJHA 1VQPA 3AFPA 4LK1C 1KAWA 4JI3Q 1HNXQ 1XPRA 4PMWA 4GN5A 1JJGA 3MXUA 2VL6A 4BBRG 3UDFA 4DNTB 1BBUA 2YV5A 4X62Q 4A93G 3JC66 2A6HC 5C0XH 4HJ9A 1Z47A 1O78A 3T56B 2XGTA 3EN2A 4JCVE 4QIWE 1Q46A 5C3EG 3RN5A 2Q2HA 3OTOQ 1N34L 4DV0Q 4GOPA 2JEBI 3ULPA 2VNUD 1YJNA 4KKSA 2F4VL 1CKNB 5E7NA 3HOVG 1IBKL 2ZT9C 2E5LQ 4KLKA 1SN8A 1W3SA 4A3GG 4R4QA 4L5RC 3ERSX 4WJ4A 3BU2A 4A3FG 2UU9Q 1X4NA 5C4JH 3PO2G 4EX5A 4DV3Q 2JXMB 2QF7A 2EJGC 1EQRA 3VR5A 4BA1I 1GHKA 1IYVA 4KMUC 1SRUA 2B29A 2BH8A 3A74A 3J80i 1KRTA 1X55A 4XTCS 4DV4L 3TS0A 1YI2A 1TWCH 4LF5L 4DR6L 2CTLA 2DGRA 3VR3A 2UXBL 1EUJA 2CPQA 1KHMA 3L2PA 1FJGL 1V9PA 3AQQA 1Y1VG 3J81c 1YNJC 3A7AB 1SE8A 4A3JG 5J3BA 1JB7A 4DV7Q 1GUTA 1E2VA 2EXDA 3U9SA 3MFYA 1E1OA 4JI2Q 3OPOA 4IFDG 2R7FA 3FPPA 2V4DA 4DNIA 2D62A 1Q1EA 1E22A 4L5QA 3MXNB 1HZAA 3KJOA 2B63G 1A63A 3BJUA 2VQFL 1X3FA 3CC7A 2K32A 1YBYA 1Z7TA 3HFZB 1DGSA 2NVTH 1CTMA 3S14H 1TXYA 3PO3H 5GAGC 2JE6I 5M3FH 3CCMA 2OTLA 3OW2A 1NMFA 1H9SB 4AYBE 1N36Q 2ANRA 2O5IC 3I2ZA 1GJXA 2JA7H 3T1HL 1K8OA 1QZHA 4JV5Q 1VQEA 2C35B 4NPSA 2E8GA 3ULLA 3U58A 4R1JA 3HOVH 1EOVA 2PI2E 5LMNQ 1SFOH 1I94L 2JJQA 2BDOA 5IP9G 1UWVA 3J7ZC 2JA8H 3PV0A 4DK0A 4BXXG 2HT1A 4GLAC 2GVBA 4PZ7A 3A5ZB 3HKZE 2VZAA 1IYJB 1HPCA 1OTCA 4BY1H 2R7ZH 2VUMH 2IHEA 4BY7H 2GN5A 1PH3A 2OQKA 3J81i 1N32Q 1L0WA 2ASBA 2L15A 4LUOA 3A0JA 4LF6Q 4JI4L 4GNXA 2UXDL 2EIFA 1PH7A 2QGQA 1GO3E 4IJLA 4A3EG 4JI2L 4DR4L 1P8LA 4MNOA 2OQ0A 2QEXA 3I4NG 2D2CC 3B6YA 1A62A 5K36G 4DR2Q 1PMRA 1KIXA 1X9NA 4BXXH 2CQOA 2UXBQ 1ZKOA 1Y8NB 1VQDA 4QL5A 2Q2UA 2UXDQ 3M85A 1OXVA 4C3JH 4A3GH 3CMAA 1SR3A 1EQQA 1JE5A 4P74A 3M4PA 1ONLA 4H02A 3W1GA 4JK1C 4JBKA 2OPUA 5ELNA 4DR5Q 4AQYL 5IYBG 2UU9L 4L5SA 2N78A 4DV5Q 3I4NH 2NVXH 1HZBA 4OWWB 4LF7Q 4G7OC 3PF5A 1VQIA 1C9OA 4P72A 5M5XH 1IBKQ 2HIXA 2WAQE 3KF6A 4LFAQ 4PG3A 4K0KL 3MEFA 3U4ZA 3S15H 1RIPA 4LFBL 2KCMA 1IXRA 2YTXA 5C0XI 1VQNA 3HOYH 5GAEC 3A7LA 2AUJD 4KN7C 1W2BA 4A75A 3GTMH 1ASYA 3L7ZC 3LGJA 4LWCA 5M5YH 3HOUH 4B3TQ 3IKJA 1IZ6A 4A4IA 1M90C 5C0XJ 1QJOA 2I5LX 5JEAJ 1QVGA 2UUAQ 1PYBA 4J15A 4UP7A 4YY3L 2RHQB 4C3IH 1HR0L 1LYLA 2PNRC 1EIFA 3KLWA 4JI1L 3CCVA 3A8KE 4G7ZC 2IT1A 2HHHQ 2MJHA 4HR7B 1H9RA 2HH2A 2B8GA 5C44G 1Q7YC 1PH4A 2Q2TA 2K75A 3T1YQ 2JA6G 2E2IH 3TS2A 3I72A 2QA4A 1HTPA 1I6VC 2MO0A 4HIOA 1O7IA 2PQAB 1YITA 2R92H 3M7NA 4R4IA 3ND8A 1EWIA 1K0RA 2KENA 4OGQC 4RMFA 4DK1A 5LMNL 4HJ7A 4A3CH 3PIPA 1HR0Q 3CCQA 4X65Q 2NVQH 2IY5B 4JOIA 4X64Q 3TQYA 4BA2I 2N3SA 2ZJPA 3T1HQ 3F2CA 1RL2A 4Y52H 3CPWA 1X4MA 4JBMA 2ES2A 3AEVA 1EC6A 3CRKC 1IW7C 1VCIA 2A6EC 2PI2A 2Z6KA 3U50C 3UDGA 2MNAA 2Y0SE 3S1MH 1VQ6A 5FJ8H 1YJWA 4A93H 1G51A 3HOYG 1JT8A 2JZXA 2NN6G 2CWAA 3KYHC 3CC2A 2ZTCA 4IFDJ 1QUQB 4LUZA 4A3KH 4OONA 2JA9A 1Q1BA 1EFWA 1HNZQ 1IW7D 3M4OH 1ZZJA 4DKAC 2KCCA 1IYUA 1SLJA 2MFIA 2A69D 3J80c 2E2HH 1YEZA 4DV7L 4A3EH 3S24A 4L8JA 3U4VA 1Y8PB 2ZTDA 4LNQA 3UE1A 4C3HH 4DUYQ 4LUVA 1ASZA 1D7QA 1VQCA 3RLNA 1X54A 3VR4A 1E24A 1CSQA 3CPFA 1YHAA 1FYCA 5IYCH 4DV6Q 2JA5H 5IWAL 1I50H 1H9KA 3GO5A 4DK3C 4WJ3M 2AUKA 1JJCB 1S3OA 1S40A 1YNNC 3HKSA 1Y69U 5C3EH 2KHJA 3PGZA 5BN4A 5FLXc 2OTJA 4BBSH 4KI0A 3I4OA 4GN3B 1QVCA 1HR0W 1C0AA 3V69A 5H1SE 1XNQL 3T53B 1UEBA 3GD7A 4A3DG 3OOCA 1LUZA 1NE3A 2IX0A 2WB1E 1Q81C 2JVZA 3HKZG 2AWOA 1NTGA 1N9WA 5FJ8G 3JAMi 4UY8C 3KJPA 5AJ3Q 1V8QA 3H15A 4DR3L 2R7ZG 2UXCQ 5BR8L 4GZYC 4PZ6A 2UUAL 3NENA 2CTFA 1B70B 4DR1Q 3OW7A 3H3VI 4KKUA 1GD7A 2KCTA 4JI7Q 4MZ9A 2N49A 4JG2A 1U0LA 4AYBG 4YWLA 4GS3A 1CUKA 3Q8DA 3CF5A 1HNWL 1PH1A 4MTNA 1FR3A 1YHBA 2EVBA 2QNDA 5BN3A 3AYHB 4AH6A 3RNUA 2EQSA 4LW1A 4JI8Q 4GKKL 4LF7L 2K50A 2NZHA 2A1AA 3NBHB 4O2DA 2VQFQ 3S1QH 1J6QA 2I5HA 4R4TA 5HGQA 2UUBL 3KLRA 4LF8L 2NN6I 4UP8A 1A0IA 4R4OA 3S2DH 3I4MG 1SMYC 2BA1A 2LMCB 4GN4B 1CFMA 4P71A 4LF4Q 2R93H 3K7AH 5GQOA 1BBWA 3I55A 1Q86C 3CAMA 1VQMA 2E75C 1QUQA 4X6AH 4IOCA 2DN8A 4DR2L 3F8TA 1FJGQ 3TZUA 1IBLQ 3VR2A 4OWXB 4OXPA 2OWOA 2JEAI 4LF5Q 3G71A 1K8GA 3CD6A 5GAHC 2ZTEA 1M1KC 1LM0A 3A8IE 4X65L 4KHZA 2AKWB 4H44C 1K73C 4JI0L 3G4SA 3PUVA 4LF8Q 3PCOB 2RF4A 4P75A 1I6HH 1GUSA 3S1RH 3DLLA 4JI5Q 5IYDH 5JJLA 3CCUA 3HOXG 1E2ZA 2BA0A 2FXQA 2K14A 4DV1Q 1PH2A 1PH8A 2JA8G 3PUWA 3I4MH 2F4VQ 2R93G 1H95A 1DT4A 3H94A 1DXMA 1AE2A 4QJFA 3LWUA 4JI1Q 1YNXA 1TWAH 3A8JE 4YY3Q 5KNCA 2I5MX 4X62L 1VQ8A 5IYDG 3M4YA 3I56A 4JV5L 3L0OA 1KL9A 3K7UC 5M3FG 3D0FA 4JI3L 2HIVA 2BE5D 2N8NA 3NELA 5JEAG 5M3MH 2R6GA 3UDXA 1L1OB 2Q8IB 3KDFA 5BR8Q 4A3MG 3ULJA 5C4XG 1KXLA 3U1KA 4DR1L 4PZ8A 4DR3Q 2Y0SG 3G6EA 1PA6A 2Z6KC 3GTLH 3SGIA 1FGUA 3KFUA 1X65A 1I3QH 2PQUA 4XIGS 3A5UA 2ID0A 2MQHA 2VUMG 4IFDH 1EYGA 3VA7A 1Q8KA 4NXMQ 4JBWA 2LXKA 1VQ4A 4JI5L 4A3JH 3AFQA 2Q2IA 4GLVB 1Q12A 4YHHQ 2VW9A 1TU2B 1J5EQ 2UUCQ 4JI0Q 2RCNA 2D0OA 3EQLC 4DUZL 4HJ8A 1H9MA 3FMCA 2D0PA 2R7DA 1IBLL 4NBQA 4A76A 4B3MQ 3J81j 1B8AA 1K9MC 1PH6A 4ME3A 4DR4Q 1LABA 1Y1VH 3WWVA 1XMOL 2K4KA 2KHIA 4A3CG 3HOWH 1TWHH 2E74C 4BBSG 5C4XH 1BVSA 4DV2L 4LJZC 1O7LA 2ZM6Q 4DUYL 1WFQA 2ZJQA 3QJYA 1QZGA 4GOPC 3PO2H 1BKBA 4APVA 4A3BG 2WP8J 5GROA 1EIYB 2OCEA 1X6OA 4DV4Q 2CTKA 4RCNA 2ALYB 3KF6B 2MO1A 4DNRB 4AM3A 1NY4A 4LFCL 1VQJA 1VQOA 4JI4Q 1WVNA 4A3LG 1VQFA 2KA7A 3PSIA 1HNZL 1OXSC 2A6HD 4HIKA 1R9TH 1GHJA 4B8TA 1J4WA 3HOXH 1KC8C 1WI5A 1G291 2PPBC 4WANA 4JI6Q 4P73A 1WE8A 3D31A 2A68D 1WCMH 3TRZA 2P2RA 1E1TA 1YHQA 2EJFC 1KQSA 4LIJA 3GTGH 3E9IA 4JYAL 1CI3M 3E0EA 4YCVA 3CCJA 2UUBQ 1SROA 3AEVB 1VQ7A 4YWMA 1WCMG 4OO1H 2XTIA 4DK6C 2K7VA 2YTYA 3FHWA 4ALPA 5IP7G 1CSPA 1HNXL 5IE8A 4QGUA 4IOAA 2IX1A 4H0LC 1XNRL 1VQHA 2UXCL 1K3RA 3E9HA 1YVCA 4AIMA 4NB3A 3CCEA 3VKEA 4UP9A 2JA5G 1V1QA 1B9NA 2LXJA 4JI6L 3CCSA 4DV1L 2F1MA 1QVFA 4JBJA 3S16H 2DUDA 2A19A 4L5TA 1FL0A 5M5WH 1N8RC 2YTVA 2Z0SA 5M3MG 4TKOB 3HGBA 5K36H 1VQGA 1TUAA 3K8AA 1XPUA 2EDGA 3AB9A 2AXYA 1XMQL 4QQBX 1ZYRC 3STBC 1CKNA 1NJIC 2YYZA 3FP9A 4B3TL 2K5VA 2VQEL 5FLMH 4OWTB 1J5KA 1HH2P 4X66Q 5IWAQ 2DNEA 4A3KG 1IL2A 1WJJA 3OYYA 3P20A 4GNXC 3W3AA 5A35A 4POGA 2O5JC 3HOZG 3RZOH 2LSSA 3K0XA 3H3VH 4WALA 2HHHL 1ZTGA 1X56A 3N6RA 1EWHA 2BE5C 3WDNA 3STBD 2AWNA 4GOPB 4A3IG 1HZ9A 3F1ZA 4FDBA 1XPOA 4YWKA 4B3SQ 4LFAL 3M3YH 4DV3L 4OX9L 4DV5L 2CTEA 1J5EL 1E3PA 4YHHL 4O0AA 1UE1A 3PUZA 1K8AC 1WOCA 4Y7NH 2A6ED 2L5TA 1L2FA 1X3EA 1Y1WG 3S2HH 1BDOA 3ZJYC 1H9JA 3CRLC 1OXTA 3PUXA 3QIAA 4I7ZC 1PFSA 3GDEA 5LMNW 1A8VA 2D5DA 3DM3A 3GTQH 4DR6Q 1VF7A 3FKIH 4LF6L 4HIMA 5IYCG 3M4QA 5JJKA 2B3GA 2DNCA 1Z9FA 2NVYH 2V1CC 4JC0A 1A6XA 4GKJQ 2VQEQ 3GTKH 2GVAA 1JJ2A 4X64L 1D8LA 1XJVA 1MJEA 1HJPA 1Q90A 3H0GG 1VIHA 1VS0A 1XMQQ 3IFTA 1LTLA 3ICEA 5AJ3L 2PQAA 3HOUG 3EIVA 3JAMc 3T51B 4POFA 4DR7L 1OXUA 2DGYA 4QY7A 2WB1G 4HJ5A 4OO1G 3DXJC 1C7YA 1MIUA 3SDZA 3KOJA 5IT9c 3CMEA 2YQRA 1ZZKA 1I94Q 4GLXA 1TWFH 2E2JH 3KDFB 1XNRQ 2PMZE 1GUGA 1K83H 3I73A 3K81C 1GUOA 4G7HC 3CXCA 3H0GH 1YJ9A 2CCZA 2VY3A 2ATWA 1V43A 1FVIA 1VQBA 3K80C 2E3UA 2NZOA 4NXNQ 4KKTA 1Y14B 1NBWA 4DV6L 2PCFB 1PHJA 1DTJA 1Y8OB 4H13C 1PV4A 3QG1A 2ANNA 3BG3A 1OXXK 2PNHA 3FKIG 3PUYA 4LF4L 1KRSA 1Y1WH 3I4LA 2AHOB 1WYDA 1MJCA 4DR5L 3GTOH 4LFCQ 3GTJH 2RHSB 4GKKQ 4JI8L 4IFDI 1DD2A 3VDYA 4PV1C 4EQ5A 4OO1I 2I0QA 2FMRA 4GNXB 1NMGA 3F2DA 3VR6A 1VQ5A 4IPGA 1HNWQ 3BDOA 3CW2C 2ZM6L 1JMCA 4DV2Q 3LNNA 1TWGH 3RLOA 1L1OA 1VF5C 4NXNL 4JI7L 5IP7H 1XMOQ 2VS1A 4B3ML 1AE3A 1PYSB 2WFWA 3TEHB 4HJAA 1PVOA 3CQZH 4KHPQ 4IPCA 5DLQE 1N33Q 5EAYA 1ZZIA 5JEAH 4A3MH 1G6PA 1XTDA 3NE5B 4UPAA 1IBMQ 1YZ6A 4DPGA 1P16A 2ZJRA 4JOIC 4NXML 2E5LL 2BH2A 2A8VA 1Z6HA 1GVPA 5GADC 3T1YL 2CTJA 5IYBH 2JQOA 1VQAA 5IY0A 2E76C 1GM5A 1N34Q 1KD1C 4R4CA 3OTOL 1IBML 1XNQQ 3PO3G 4JVHA 2A68C 1E2WA 3PF4A 4DAYB 4A3LH 4KHPL 3GTPH 3I7FA 1B9MA 3CCLA 1HCZA 1CKMA 1HZCA 3NEMA 2F3IA 3W1BA 3PIOA 4GKJL 2EJMA 3RZDH 1PH9A 2A69C 4B3RQ 4TVAB 2CW0C 4IQZA 5KNBA 3KF8B 1N36L 4JYAQ 2JA6H 4LFBQ 3CCRA 3BZKA 1HQMC 1VIGA 1GUNA 3SE0A 1X3GA 2H5XA 2YU9H 3RLFA 2WAQG 1E7ZA 1T5EA 1T9HA 2NN6H 4K0KQ 1VQKA 4C2MH 1CKOA 1K8MA 1I5FA 5LMUQ 1TKWB 1SMXA 1B7YB 3F2BA 4IO9A 4LF9Q 4A3IH 4BY7G 1AH9A 2HH3A 1UE7A 3CP0A 4AQYQ 4OX9Q 2BL5A 1GKHA 4BY1G 2OPVA 2HQLA 4JVYA 5IP9H 3BZCA 3IRBA 2K33A 2CFMA 3M9BA 1YIJA 4B3SL 2CWPA 2B8FA 4B3RL 3UDIA 4A3FH 1KHIA 4RG1A 5HY6A 3W5OA 3HOZH 1UE6A 4A3DH 3RN2A 1LACA 1U5KA 1K1GA
chains in the Genus database with same CATH superfamily
2K52A 3HOZB 2JA7G 1SFOB 3UE0A 3SB1A 3HOVB 1S72A 1B2TA 4IPHA 2JK8A 3E5SA 3HOWG 1HNWH 1TT2A 2CTMA 3RMHA 5CBEE 3S17H 1HFGA 3S1NH 3MAQA 3D4RA 5ELOA 4DV6H 1UE5A 3GTOB 2B2YC 2K5HA 2AMCB 3ND9A 3RR5A 4HIDA 1L1OC 3HOWB 5KNDA 1R9TB 1K28A 1VQPA 5COYA 4K2LA 1HNXQ 4PMWA 1TS3A 4GN5A 2EY5A 4J6HA 5E4WC 1ET9A 2QILA 4G57A 5EKLA 3JC66 2F0JA 2KECA 3Q23A 2XGTA 5KRUA 5C3EG 4X3TA 4FO2A 5EPJA 1JC7A 4HMIA 3RN5A 3OTOQ 3MA2B 1N34L 1D2BA 1YJNA 5E7NA 1CA6A 2ZT9C 1SYGA 4A3GG 4R4QA 3Q0AA 4A3FG 2M8WA 3KF8A 2NTTA 5G3LD 3NTIA 4DV3Q 1EQRA 2EJGC 1GHKA 2B29A 1IYVA 4DV4L 1D7QA 3J80i 3TS0A 1X55A 1PTOD 4O1NA 1LTSD 1EY7A 5DAUA 1V9PA 2OF1A 2EYOA 3HOYB 4JI2Q 1DTJA 1J4WA 4TSSA 4L5QA 3MXNB 1HZAA 1SBBB 3BJUA 5CBAE 2K32A 1YBYA 3OIQA 1EEFD 1DGSA 1TWAB 2LFNA 1CTMA 4H7BA 2PZUA 5GAGC 2P5ZX 4QUCA 4UHVA 2ANRA 2HCCA 2NYZD 1GJXA 4DV1H 4JV5Q 1XWEA 1K3BC 5IGCA 4R1JA 3HOVH 1SFOH 1I94L 2JJQA 1HR0H 2JA8H 1LTRD 2Z4IA 1OTCA 2VZAA 1IYJB 3TP5A 2GN5A 1PH3A 2OQKA 3TZDA 3J81i 1ILPA 2L15A 4IUUA 4PNYA 2ICIA 2F0GA 4GNXA 3SK5A 4K5WA 2LS01 1PH7A 4JI2L 2M6QA 4M8AA 4MNOA 2QEXA 2D2CC 1PMRA 2CQOA 2EYJA 1ZKOA 1Y8NB 1UG8A 3R8BA 1HA6A 2VKCA 3UOEA 3URYA 1BCPF 1SR3A 1F9RA 4P74A 1PZJD 4H02A 4JBKA 1SNPA 5ELNA 4DR5Q 4DV5Q 2NVXH 1HZBA 3KBGA 4P72A 2HIXA 3KF6A 4LFAQ 3SVMA 1WTOA 3MEFA 3U4ZA 1IBLH 2KEDA 4C1NK 4LFBL 2NWGA 1N33H 5JVG3 3HOYH 2AUJD 4A75A 3GTMH 1ASYA 3L7ZC 3DEPA 5M5YH 3HOUH 4B3TQ 1IZ6A 4A4IA 2I5LX 3KFUA 2LKVA 1QVGA 2RHQB 3KLWA 4JI1L 3CCVA 1I4QA 1TWGB 3W2DA 1PH4A 2JA6G 4FF4A 2MO0A 2SEBD 1SMYD 1G2TA 4R4IA 3ND8A 4RMFA 1K0RA 4PMCA 3P7JA 3TQYA 2N3SA 3S15B 2F0LA 3LX0A 3AEVA 5A2QW 4KD4A 3CRKC 2A6EC 1S5CD 1ENAA 2Y0SE 3EJIA 1WTJA 1S5FD 4KJOA 3D4WA 1JT8A 2JZXA 2K1BA 2ZTCA 3CC2A 4A3KH 2JA9A 3MXPA 1SNMA 5FO9B 4DV7L 1CZWA 3DWPA 2Z1CA 3D8GA 4L8JA 2C9OA 2ZTDA 3EROA 3J7AK 1ASZA 1VQCA 5IYCH 1FYCA 4LAAA 4DV6Q 1QCBD 5LHY1 4DK3C 1JJCB 1X0AA 1S3OA 4N9TA 1YNNC 2NZ1D 3PGZA 5FLXc 4RH6A 4GN3B 1EU4A 4DR6H 4ZKBB 1MSZA 3BDLA 1Q81C 2J7ZA 5FJ8G 2UUAH 3H15A 2R7ZG 3KDKA 4DR3H 2UXCQ 5BR8L 4GZYC 3NENA 4DR1Q 1GD7A 2X6GA 3NTHA 2N49A 4CJ0B 1U0LA 4AYBG 4YWLA 3CF5A 4MTNA 2Z9HA 2EVBA 1WTRA 5I9PA 4LW1A 3VYSA 1U4MA 2RVLA 4JI8Q 1J8IA 3S1QH 4R4TA 1IL8A 3KLRA 3OIPA 5CR3A 2BDNA 1JQYD 1A0IA 3I4MG 1SMYC 2G9HD 4LF4Q 2R93H 1CFMA 5IT9L 3FEWX 3K7AH 5D3IB 2MUYA 4C56C 4X6AH 2EE1A 2DN8A 5HURA 5J1ZA 4OXPA 2NVTB 4LF5Q 1M1KC 2WKCA 1K73C 1K1GA 1R4PB 3PCOB 1GUSA 3S1RH 2X06A 2FXQA 5M3FB 4DV1Q 2IPKD 1DXMA 3LWUA 5LMNH 3A8JE 4G4KA 4YY3Q 4RWSC 5KNCA 3NSWA 2MHVA 2B2VC 1G91A 1Q8IA 1KL9A 5M3FG 4FJSA 4GOPA 4DR1L 2PYKA 4XDXA 2R6GA 2WKDA 1L1OB 4IALA 5IT9E 3T13A 5ISRA 5D14A 1PA6A 3SGIA 1X65A 4XIGS 3A5UA 3J80W 2BCOA 5EPKA 4FXKC 4JI5L 2QEJC 2XSCA 3AFQA 3S2HB 1Q12A 2D0OA 3EQLC 1IBLL 1V8CA 1CQVA 3S2HH 1B8AA 1K9MC 1LABA 3RN2A 1O7ZA 1TWHH 2E74C 4BBSG 1TY2A 4AQYH 1RD9D 1EYCA 4GOPC 3KLSX 5GROA 2FMMA 4KV6A 4AM3A 3FKIB 4RCNA 1NY4A 1SAPA 1VMCA 1VQJA 1VQOA 3MWYW 4A3LG 3PSIA 4F8MA 1GHJA 3GV6A 1G291 2A74C 5EJWA 1WE8A 3I4NB 1E1TA 4R9WA 1KQSA 3AEVB 4YWMA 1D5ZC 4B3RL 2YTYA 3FHWA 5IP7G 1HNXL 2IX1A 4H0LC 3VYUA 1VQHA 4V190 3E9HA 4AIMA 2JYOA 3I70A 4B9WA 1B9NA 3H09A 3CCSA 1QVFA 3S16H 1ENFA 4RGOS 1FL0A 5FLXW 2YTVA 2Z0SA 5M3MG 1A2UA 4RAUC 4E6IA 2AXYA 1X3PA 3STBC 4B3TL 4DN4M 3GTMB 5FLMH 1ML0D 4KD3A 1WJJA 1U4RA 2FINB 2I07B 4YHHH 4HEDA 5A35A 2O5JC 1ZTGA 3EFXD 3K0XA 2HHHL 2K1HA 1X56A 1EWHA 2B2WC 2BE5C 5M5XB 4MTKA 4A3IG 2AWNA 4LFAL 4A3MB 1XPOA 4B3SQ 4DV5L 1PZKD 1TY0A 3R2TA 5CV8A 2JA5B 3H0GB 1PZID 3ZJYC 3MXNA 3PUXA 3QIAA 3HP3A 3GTQH 2F0SA 2CQAA 4DR6Q 4A3EB 1BNZA 3M4QA 1RTNA 4GKJQ 2VQEQ 3GTKH 4JI6H 1JJ2A 1V1OA 4E9JA 4POFA 4DR7L 4OO1G 1WVLA 3SDZA 2JA8B 1SE3A 3NWSA 1ZZKA 1I94Q 3GTJB 3I73A 2CCZA 3MTSA 1HA5A 1VQBA 1FVIA 2NZOA 3D3RA 4N8FA 1Y14B 1PHJA 5DNFA 4CKBA 4H13C 3T16A 4C3JG 3BG3A 1FD7D 2IJ0A 3FKIG 1F2LA 3HOXB 2RSOA 4XT3B 2AHOB 1A2TA 3GTOH 4LFCQ 4ABNA 2I0QA 1VQ5A 4IPGA 5C4HA 1HNWQ 1PRTC 1PLFA 5C5MA 1JMCA 1CQFA 2NUCA 2OXPA 1FNVA 1L1OA 1VF5C 1Y1VB 1EY8A 1CM9A 5IP7H 2RQXA 2CWFA 3D6CA 1TR5A 4WORA 3NE5B 1IBMQ 2RDFA 4JI3H 1F2MA 2XIWA 2E5LL 1GVPA 1GM5A 2JQOA 4JVHA 1N34Q 4NP5A 1EZ8A 1STAA 4A3LH 2EYPA 1TIID 3CCLA 3NEMA 3PIOA 3T1YH 3RZDH 1PH9A 1N36L 4CDEC 1W6JA 4LFBQ 1HQMC 2H5XA 4U673 4A3IB 5KYLA 1CKOA 4KHVA 2HH3A 4A3IH 3SEBA 4AQYQ 4BS9A 2CFMA 1JICA 4IUPA 4NZRM 4RG1A 1U5KA 4EQOA 3C3LA 3K6OA 4GKKH 2IHFA 4QMFB 4EVOA 3CC4A 2X6LA 5C0XG 5JJIA 4YCUA 4BBRH 3GTLB 2F52A 1H9SA 1LT6D 1N32L 4AYBB 3MHBA 2AQ3B 2ZXRA 5D65A 3OWFA 4YCWA 1F9QA 3QOJA 3GQBA 2CKZB 4LK1C 1W6KA 1KAWA 1BF4A 3MXUA 4BBRG 3J81L 1XNQH 4A93G 4HJ9A 1LV9A 5C0XH 2UUBL 1Z47A 3T56B 4DR6L 3C1FA 1SDFA 2F03A 5E4XA 3ULPA 4KKSA 1CKNB 3BYYB 4NZTM 1W3SA 2TSSA 4K5XA 4L5RC 2TMPA 3ERSX 2L11A 5C4JH 4XQQA 1SYFA 2QDBA 4BA1I 1SRUA 3A74A 1KRTA 2IWHA 1X4NA 4LF5L 4XTCS 1TWCH 3VR3A 1JE4A 3L2PA 1FJGL 4OX9H 2ZQEA 1Y1VG 1IKMA 3OETA 3A7AB 1SE8A 4CBVA 1JB7A 2EY6A 2EXDA 3U9SA 3MFYA 1E1OA 2HHHH 2E2IB 4GLXA 1Q1EA 1A63A 5IGDA 3HFZB 3JAME 1FKAH 4RKBA 4B3TH 4FF3A 5M3FH 1XMQH 3CCMA 4ZKCB 1H9SB 3S1NB 4L6TB 1RKNA 2O5IC 3I2ZA 2JA7H 3T1HL 1QZHA 2IX3A 3FDTA 4JI1H 2PI2E 4FNFA 5IP9G 5AFWA 4XQNA 2JSOA 2GVBA 2RDHA 4N8X1 3HKZE 2VUMH 4BY7H 4C1NI 3WOFA 1N32Q 2ASBA 4LUOA 2R7ZB 3E0JA 2B63B 4IJLA 1GO3E 1P8LA 1NCVA 1JWSD 3I4NG 3B6YA 4BXXH 4WJWA 5JPNC 1JWUD 4LFCH 3HG9A 4C3JH 4A3GH 3CMAA 4R8IA 4DUYH 4AQYL 3I4NH 2N78A 1VMPA 2XVSA 2M2LA 3K7AB 5E3FA 1STBA 4LF7Q 1A3UA 4OWWB 3PF5A 4G7OC 1GUWA 5EBCA 3JAMW 4TRDA 4PG3A 4YIJA 1DZ1A 4JI4H 4RCOA 2YTXA 1W2BA 1II3A 3F2UA 3LGJA 4LWCA 3IKJA 3HRZC 2UUAQ 3NPPA 4YY3L 3TBIB 2K01A 1LYLA 4G7ZC 3M7GA 2IT1A 2HH2A 2Q2TA 4DF7A 3T1YQ 2B2UC 4JV5H 2QA4A 4HIOA 1I6VC 2K04A 1SNQA 1EWIA 1IKLA 4DK1A 5LMNL 4HJ7A 1EIGA 3ERQA 4JOIA 3GTQB 2SDFA 2ZJPA 1X4MA 1RL2A 2ES2A 2RKSA 4UDUC 3UDGA 4LF6H 5EKKA 1QE6A 1VQ6A 1G51A 3M3YB 3K5OA 2CWAA 3FPUB 3OSOA 2SNSA 1Q1BA 1SJHD 2UXBH 4ILWA 1WD1A 4ZK9B 1YEZA 3U4VA 1NNXA 1KABA 3CPFA 1YHAA 1DOLA 5FLXL 2B2YA 5IWAL 1I50H 3BYTB 4BY7B 1EFID 2HCIA 1NUCA 1S40A 2SNMA 3V2TA 4RA8A 1Y69U 1C0AA 4JPBW 2G5DA 3I4OA 4KI0A 3GTPB 4KTAA 5H1SE 1JCKB 1UEBA 3E3XA 1DOKA 1ZXTA 4CHTB 2B2TA 4EQNA 3HKZG 3NQIA 1B3QA 1I4GA 3KJPA 1EQTA 1DONA 3H3VI 4A3DB 4K14A 4MZ9A 4ZAIA 1JOKA 5D3DA 3O13A 2L12A 1FR3A 1F2ZA 5BN3A 5FLXE 4GKKL 2A1AA 2NN6I 3S2DH 1G2SA 4GN4B 3PIO3 2NVXB 1LTBD 4B8CD 1Q86C 3CAMA 1QUQA 4DR2L 3F8TA 3NXWA 3TZUA 4DFAA 4OWXB 4DAVA 3CD6A 1PFBA 1I4XA 2CH4W 5GAHC 1I3QB 4RKLA 3A8IE 3EZJA 1KLGD 4LF6L 4H44C 4LF8Q 1MBYA 2RF4A 3GP7A 2LRRA 1FNUA 1D6EC 2BA0A 2HQEA 1ZYRD 4QB4A 1LT4D 1VIGA 3PUWA 5CV7A 1DT4A 3H94A 4QJFA 4A3KB 4K5VA 4JI1Q 1TWAH 2KVMA 2I5MX 4X62L 3SXHA 1A3VA 5FO8B 3L0OA 1PFNA 2N8NA 3NELA 1KXLA 2Q8IB 2B2VA 2DY7A 5IGEA 4DR3Q 4PZ8A 3PO2B 2Y0SG 3NBIA 2FHTA 3GTLH 3IFDA 1FGUA 4DU9A 1S03G 2JA7B 2M9VA 2MQHA 1TWFB 1CT1D 3QO2A 3VA7A 3J7YW 1EYGA 2UXDL 1VQ4A 4BBSB 1B1ZA 1MSGA 4YHHQ 4HAEA 3BS1A 1J5EQ 4KY5A 4JI0Q 3LWEA 4HJ8A 2R3ZA 4DUZL 2D0PA 4A76A 4B3MQ 3J81j 2CW0D 4K0KH 2OT2A 1Y1VH 5I9OA 2K4KA 4JI8H 4HSPA 5C4XH 1BVSA 1U4PA 2ZM6Q 1O7LA 3QJYA 4A3BG 4APVA 4F88A 4LF4H 1X6OA 3MFGA 2K5DA 1XRHA 4LFCL 4S3SA 1VQFA 1HNZL 1OXSC 4HIKA 3DWQA 1R9TH 5CV9A 4BWGB 3HOXH 1SYCA 4HCSA 4A3BB 5L37A 5M5WB 4JI6Q 2Z6BA 4P73A 1V1PB 2D9IA 5ELDA 3D31A 3TRZA 1YHQA 1F77A 2FFKB 3CCJA 1VQ7A 4CDCC 4OO1H 4DK6C 2K7VA 4K8IA 4LMQD 4IOAA 1F9SA 2J0TD 4QGUA 2E2JB 4DR7H 3SK4A 1I94H 1K3RA 3CCEA 2LXJA 1STYA 2EYHA 4DV1L 2F1MA 2A19A 1N8RC 5K36H 1VQGA 3K8AA 5LL6S 1XPUA 3AB9A 4OHJA 3NCVA 1ZYRC 2YYZA 2VQEL 3OWEB 1HH2P 4X66Q 4NKLA 4A3KG 4ID6A 3W3AA 3RZOH 2LSSA 3H3VH 5FK9C 4DV3H 2WV6D 3N6RA 2G8YA 1TWCB 3WDNA 1AZPA 2WAQB 3QWNA 4FDBA 4J8QA 4DV3L 2FMCA 5F2DA 3PQIA 4IN3A 2CTEA 3K57A 2ZXOA 4O0AA 4JYAL 1L2FA 1WVNA 1H9JA 3VDYA 3MVVA 4I7ZC 2OTJA 1I4PA 2B3GA 2DNCA 2NVYH 5EPLA 1S5DD 2V1CC 3SR1A 1A6XA 1WTHA 3DHQA 4X64L 3K5MA 1XJVA 1MJEA 1N34H 1LTLA 2L9HA 2PQAA 3HOUG 1AZQA 4HCEA 4K6LA 3T51B 4BY1B 3MZ5A 2WB1G 4KJNA 2VXWA 1MIUA 3KOJA 5IT9c 1S20A 4JYAH 1S5BD 3RUZA 4F7XA 2E2JH 2A5HA 2PMZE 3K81C 2ATWA 4G7HC 4F87A 2VY3A 1V43A 4NXNQ 3H6MA 4KKTA 4DV6L 1BUVT 1PV4A 2ANNA 2H4OA 1OXXK 3ZYYX 3PUYA 3R2IA 1KRSA 4DA2A 1PQXA 1MJCA 2CHBD 3NWTA 3GTJH 4IFDI 3S17B 2L0CA 4B3SH 1NMGA 4DUZH 1QB5D 3CW2C 2BOSA 4NMZA 2ZM6L 4JVZA 3RLOA 4JI5H 4C3IB 2VS1A 2F0WA 4B3ML 1AE3A 4HJAA 3TEHB 4JW0A 4IPCA 1ZZIA 1RF2D 4G08A 1KDAA 1AFPA 2A8VA 2CTJA 4IUVA 3TP8A 5IYBH 4V0BA 1VQAA 1IBML 1XNQQ 2PW5A 4QIWB 5CV6A 1NR4A 4DAYB 3IAYA 2E2DC 3I7FA 1HCZA 1CKMA 1HZCA 1DYQA 2PQEA 4OELB 4TVAB 4XT1B 1RCVD 2F0KA 3T4AC 3CCRA 4X65H 3BZKA 4MIUA 3RLFA 2WAQG 1T9HA 3J7AF 2NN6H 2EYFA 2QDLA 1VQKA 1K8MA 5LMUQ 4IO9A 4LF9Q 1B7YB 3DM1A 1AH9A 4FF1A 1YIJA 2PT7G 4EGVA 4A3FH 5HY6A 3W5OA 2K28A 4A3DH 2Q8TA 5C3EB 3NQTA 2XRSD 3DWAA 3HEJA 5FLMG 1LLRD 1M8AA 2K6AA 2NTSA 4X66L 1NAPA 1Q82C 4A3BH 2PY9A 2D9UA 3G48A 1T5XD 1ILQA 3NBHA 1VQLA 4TQUS 4IPDA 1EL0A 4DR7Q 4DV0L 5DT9A 5CYUA 3KDGA 1I6UA 3J7A5 2PO4A 1ZEQX 2KBNA 5ELFA 3VYTA 4IJHA 4H8AA 4ZYSA 1QILA 1XPRA 4WFN3 4JI3Q 5K5PA 2R61A 1JOQA 4DNTB 3EN2A 4JCVE 5A2QE 3I8ZA 4DV0Q 2VNUD 1A3TA 2F4VL 3EVQA 1IBKL 3BU2A 1EY0A 4EX5A 1X3QA 2JXMB 1EY5A 5JJKA 2BH8A 1YI2A 1NSNS 4XQJA 2CTLA 2FPHX 1EUJA 1K83B 3AQQA 4QUFA 3J81c 1YNJC 2QKIC 1E2VA 2R7FA 4FVMA 1SYDA 2V4DA 2D62A 4ZQ3A 3KJOA 2B63G 2LTMA 1Z7TA 2NVTH 1KDCA 2PZTA 1HUNA 3S14H 1TXYA 3PO3H 2JE6I 2OTLA 3OW2A 4A3FB 4AYBE 4CKEA 1K8OA 4NPSA 3ULLA 2B2WA 3U58A 1EOVA 4I7AA 5LMNQ 4C3HG 1UWVA 4YY3H 5EGTA 1S5ED 1XNRH 3PV0A 5ELCA 3A5ZB 1SEIA 4BY1H 1HPCA 5JVH3 5IGGA 1WTQA 2IL8A 4LF6Q 3A0JA 4JI4L 3TP7A 1TVXA 3J81E 2QGQA 4DR4L 5C6AA 2F0IA 1STHA 1XYIA 3MXGA 1KIXA 1A62A 4DR2Q 2UU9H 1HNZH 3D6WA 2UXBQ 1D5MC 1OXVA 1UUPA 4DXGA 1SNDA 2F3VA 1EQQA 3EA6A 3M4PA 1FGBD 4JK1C 5LL6X 4DXFA 2UU9L 4L5SA 4DV2H 2F0OA 1VQIA 1C9OA 1XMOH 1BCPC 4DR4H 1FNWA 4K0KL 3S15H 4ZUIA 1PXUA 1VQNA 1IXRA 5C0XI 5GAEC 3BVZA 2KHSA 4KN7C 3N52A 1PTOC 5I2XA 5C0XJ 5JEAJ 3I91A 1PYBA 3KK7A 4J15A 4UP7A 1HR0L 1EIFA 2MJHA 4HR7B 4OD6A 5C44G 1Q7YC 2K75A 4X3KA 1BXTA 4QCLA 3TS2A 5C4JB 1YITA 1HTPA 2R92H 1O7IA 2PQAB 1HRJA 3M7NA 2DJGC 2QW7A 1BBXC 2MPMA 2ENBA 3X3MA 5JAVA 4A3CH 3PIPA 4X65Q 1JR0D 4FXGC 4X64Q 2LY7A 4BA2I 3T1HQ 3V05A 3F2CA 4Y52H 1V9NA 2PI2A 2Z6KA 3U50C 2RBMA 1I4HA 3Q6SA 1SNOA 1ICFB 1YJWA 1HHVA 2FJ2A 4C3HB 3VA5A 1FJGH 1IW7D 3M4OH 1RJTA 1IYUA 1SLJA 2MFIA 3J80c 2E2HH 1F0XA 1Y8PB 1AP0A 4LNQA 4FF2A 4DUYQ 4LUVA 4LF8H 1WTXA 1UAPA 3RLNA 1X54A 1E24A 1CSQA 4LF7H 1H9KA 1IBKH 4WJ3M 2AUKA 2VUMB 3HZXA 3HKSA 5C3EH 2KHJA 5TSSA 4HSVA 5EQ0A 1RTOA 4DAPA 1XNQL 1S4ZA 4C3JB 3GD7A 4A3DG 2WB1E 1NE3A 2JVZA 1NTGA 3JAMi 2O2LD 5BR8H 1C4QA 4Z9CB 5AJ3Q 1V8QA 4DR3L 5JJZA 4PZ6A 2UUAL 1DM0B 2CTFA 4DV0H 1UEAB 1QNUA 3OW7A 4KKUA 2KCTA 4JI7Q 1PTOB 5EKIA 4GS3A 3WOEA 1PH1A 2HDLA 1L0XB 2HUGA 1C48A 3AYHB 4UAIA 3RNUA 1JB3A 4HMJA 4LF7L 2K50A 2NZHA 3NBHB 2VQFQ 1J6QA 2I5HA 5HGQA 4QMGA 2LF0A 4P71A 2BA1A 2LMCB 1PYWD 5GQOA 1BBWA 3I55A 3R93A 5IIFA 2E75C 4IOCA 2OWOA 2F0PA 2JEAI 3G71A 1HTLD 2ZTEA 1LM0A 3RZOB 4KHZA 2AKWB 4JI0L 3PUVA 2MP1A 5IYDH 2C5CA 5JJLA 1ESFA 4PMBA 3CCUA 2UXDQ 3SK6A 2JA8G 2F4VQ 3I90A 1YNXA 3KUPA 2VB2X 1XX8A 3J7AV 1IBMH 1SEBD 4ZRZA 3I56A 1U4LA 3K7UC 1EY6A 3S1MB 2HIVA 2BE5D 5M3MH 5JEAG 1CA5A 3KDFA 5CMDA 3PIP3 1EOTA 3G6EA 2Z6KC 2WB1B 2ID0A 2VUMG 3BVGA 4IFDH 4JBWA 4ODGA 4Y7NB 4A3JH 4A93B 4GLVB 2N88A 2Q2IA 2Z4HA 3K59A 1N33L 2UUCQ 4LFBH 3J80E 1EU3A 1H9MA 5CV4A 2EPBA 2R7DA 3OSSD 2Y3MA 1IHZA 4ME3A 1PH6A 2KQ3A 3WWVA 1XMOL 2KHIA 4A3CG 4DR5H 2XRQD 4DV2L 4LJZC 1AN8A 4DUYL 3PO2H 1SE4A 1EIYB 2EY1A 2CTKA 2ALYB 2F0NA 4DNRB 4BBRB 2F0QA 2XWJB 5C4XB 3ONAB 2KA7A 1F9PA 2F0HA 4B8TA 2A1SA 1KC8C 1WI5A 1PFMA 2PPBC 5C5LA 3AMUA 1WCMH 2A68D 2EJFC 2CVRA 3OMGA 2WINB 3E9IA 3GTGH 1CI3M 3E0EA 1CHPD 2HD3A 4OL7A 1SROA 2XNAC 1EWCA 3Q22A 1WCMG 3J80L 1E0BA 4ALPA 1CSPA 5IE8A 5KYIA 1XNRL 2JP1A 1YVCA 5KIXA 2EYLA 4UP9A 4B08A 2X69A 4X64H 2JA5G 2F0EA 3K58A 3T1HH 4QF4A 5M5WH 3HGBA 1I4RA 4IUNA 4K6DA 1PRTF 1OO9B 4QQBX 3QR8A 3FP9A 3AU7A 2K5VA 1KAAA 1J5KA 1YNJD 5IWAQ 2DNEA 1IL2A 1EY9A 1BCPB 3P20A 4NDXA 1J5EH 5JOBA 4POGA 3HOZG 3M4OB 1RODA 2JA6B 2ZXPA 1HZ9A 3FRPB 4YWKA 3G6JB 1J5EL 1E3PA 3PO3B 1ET6A 1UE1A 3PUZA 3IL8A 1XTCD 4Y7NH 4DV4H 1XXGA 3A54A 2L5TA 1NXUA 1X3EA 1Y1WG 1BDOA 5GADC 2HHHQ 1OXTA 1PFSA 3GDEA 1JJGA 4PQXA 1A8VA 1O7YA 2D5DA 3DM3A 1VF7A 3FKIH 5HGTA 4JC0A 2EY2A 2KJXA 2E2HB 2GVAA 1D8LA 1DOMA 1I50B 1XMQQ 2UXCH 3EIVA 2UUBH 1OXUA 1C7YA 4B3RH 5I6YA 3CMEA 4XXEA 5I6WA 2L1BA 1WD0A 1TS2A 1TWFH 2L4NA 3KDFB 1EIHA 1K83H 3H0GH 1TWHB 3K80C 3SK8A 4R8NA 5LMUH 4LF9H 2PCFB 1N32H 3QG1A 2K5QA 1JORA 2PNHA 2KOLA 5C3WA 1DJRD 1EQVA 4X66H 3S2DB 2DJFC 4DR5L 4X3UA 4FXDA 2RHSB 3TDQA 4PV1C 4EQ5A 2F0VA 3F2DA 3VR6A 1SNCA 3C1EA 3LNNA 4NXNL 4JI7L 2UXDH 1MHWC 5NUCA 1BO0A 1BR9A 2WFWA 2Q8RE 1PVOA 1HUMA 5EAYA 4A3MH 2B2UA 3GR5A 2N55A 4UPAA 2ZJRA 3QOLA 4NXML 1ODHA 5IY0A 2E76C 1KD1C 4R4CA 4DGZA 2A68C 1E2WA 2QCPX 4KHPL 3OTOH 2XN9C 4NW2A 4P2CB 1B9MA 3W1BA 1AW7A 1TQOA 2EJMA 2CW0C 4IQZA 4ULLA 2F3WA 5KNBA 4JYAQ 2JA6H 2K5WA 1GUNA 3SE0A 5J39A 2M00A 1E7ZA 3S1RB 4NXNH 1I5FA 1LTAD 4BY7G 1SMXA 1SJED 1QWYA 2BL5A 1GKHA 2IW3A 4BY1G 2OPVA 2HQLA 4JVYA 5IP9H 3BZCA 3IRBA 2K33A 4B3SL 2CWPA 2B8FA 2J4XA 3TP6A 3JAML 1Y1WB 1KHIA 2F4IA 1UE6A 3QB3A 1LACA 3A56A 3C46A 1MKHA 3TREA 2R93B 3NHHA 2R92G 3I3CA 1VQ9A 3ER0A 5C44H 4DUZQ 1WTPA 5BN5A 2UUCL 4KN4C 2NB0A 2O4CA 1VDZA 5LMUL 4DAMA 1PH5A 4LF9L 1G8ZD 3EBEA 3NTKA 2B63H 2K5NA 1KLUD 2WACA 2MGSA 2PZWA 1DCZA 1LT5D 2F0TA 3AFPA 2VL6A 3UDFA 1BBUA 2YV5A 4X62Q 3H3VC 1M90C 2A6HC 4LIJA 3K5LA 1O78A 1SXTA 4QIWE 1Q46A 2Q2HA 2JEBI 3BVMA 5C44B 3HOVG 2E5LQ 5IWAH 4KLKA 1SN8A 5T1GA 4WJ4A 2UU9Q 3PO2G 1PRTB 2RCFA 2QF7A 4A3EG 3VR5A 1BOSA 4KMUC 1STGA 2DGRA 3DUZA 1KHMA 2UXBL 2CPQA 1NR2A 2K05A 4DV5H 5DM63 1U9RA 3HOUB 5M5YB 1LT3D 4KK7A 2EZVA 4LFAH 4A3JG 5J3BA 4DR4Q 4DV7Q 1GUTA 3PMFA 4PDBA 2K03A 3OPOA 4IFDG 4DNIA 3FPPA 1IBLQ 1E22A 4EC5A 2F0DA 1SSOA 5CC4A 2VQFL 3CC7A 1ENCA 1X3FA 5FO7B 1PDQA 3FAUA 2EYMA 2VQEH 3HKZB 4ZCKA 4FJUA 5KEEA 1NMFA 1Q3LA 3RD4A 1N36Q 3L9AX 1I6HB 2GA4B 5ELBA 2JN4A 1VQEA 2C35B 2NVQB 2PMZB 2E8GA 2BDOA 3J7ZC 3GTGB 4DK0A 4BXXG 5M9OA 4GLAC 4PZ7A 2HT1A 1HNXH 2F0MA 3E6ZX 2R7ZH 2IHEA 2CPMA 5EBDA 4B9XA 1B44D 2RDGA 1KTKA 1L0WA 3Q24A 1TS5A 1LO5D 3A55A 2EIFA 1JWMD 2KEEA 2OQ0A 5K36G 1X9NA 4ME5A 3P75A 1VQDA 2KCNA 4QL5A 2Q2UA 3M85A 2FFMA 1PTOH 1JE5A 1ONLA 3W1GA 2H1EA 5IYBG 2O4XA 1WTWA 4HN7A 4HTHA 1EY4A 5M5XH 1IBKQ 2WAQE 1VBIA 4JI2H 1R4QB 5IGFA 1J9OA 1RIPA 2KCMA 5IODA 1SYEA 3A7LA 5KGUA 1CK1A 1BCPD 1QJOA 4C3IH 2PNRC 1JOOA 3A8KE 4DAYA 1H9RA 4DR1H 2B8GA 1F2YA 2E2IH 3I72A 2KENA 4J1MA 4OGQC 2IY5B 1HR0Q 3CCQA 4CJ1B 2NVQH 4CGYB 1B3AA 1EC6A 1GXDC 3CPWA 4JBMA 2VQFH 1IW7C 1VCIA 3S9WA 2MNAA 3S1MH 3H91A 1D1KA 1QOHA 2KUMA 5FJ8H 3TN2A 4A3JB 4A93H 3HOYG 2PW7A 2NN6G 3KYHC 4IFDJ 1QUQB 4LUZA 4X3SA 4OONA 5DM73 4DR2H 1EFWA 1HNZQ 1ZZJA 4DKAC 2KCCA 1GOZA 2A69D 2NVYB 4LF5H 3NK9A 4A3EH 3S24A 5M3MB 1K0SA 1LTGD 2LTLA 3UE1A 4C3HH 3VR4A 2JA5H 1L0YB 5ELEA 3GO5A 1HXYD 4CKCA 2F4VH 3U9OA 5BN4A 4BBSH 1HR0W 1QVCA 3V69A 3BZDB 2DY8A 3T53B 1LUZA 2IX0A 3OOCA 1LTTD 3K0YA 2AWOA 4UY8C 1N9WA 4RHSA 1YNND 3L3OC 2VB3X 2YU9B 1B70B 4JG2A 5IGBA 2UUCH 1CUKA 3Q8DA 3S16B 3VYRA 1HNWL 1YHBA 3GTKB 3V96A 2F0UA 2QNDA 4RGMA 1PTOF 4AH6A 2EQSA 4O2DA 1AEXA 2L55A 4LF8L 4UP8A 4R4OA 2CWHA 4DV7H 3DMUA 3CQZB 1KDBA 1VQMA 4WRDA 1FJGQ 3VR2A 1K8GA 4IUQA 4X65L 4K2KA 3G4SA 4P75A 1I6HH 4C2MB 5C4ZA 3DLLA 4JI5Q 1N36H 3HOXG 1E2ZA 3RF2A 2K14A 1PH2A 1PH8A 3I4MH 2R93G 1H95A 4L63B 3NUCA 3SHLA 1AE2A 5DEHA 4ZUJA 4KHPH 1KNAA 3G7LA 1VQ8A 2CH4A 3C2PA 5IYDG 3M4YA 3OHXC 1RDPD 4JV5L 1WTVA 3D0FA 4JI3L 4A3MG 5C4XG 3UDXA 5BR8Q 2NBFA 2Z8LA 3ULJA 5FOBB 4M1UB 3U1KA 3CKIB 3J81W 2SOBA 1I3QH 3KLSA 5I4DA 2PQUA 4NXMQ 1Q8KA 4JI7H 2LXKA 5E1FA 3HS0C 2VW9A 1MI2A 1TU2B 2RCNA 3QD7X 4NBQA 3FMCA 1M4VA 2AQ1B 1V1PA 5IT9W 1MSHA 3X3NA 1HFNA 3HOWH 4MHEA 1WFQA 2ZJQA 1QZGA 1MGSA 1BKBA 2WP8J 1ESRA 1MD2D 2OCEA 4DV4Q 1LTID 2G9DA 3KF6B 2MO1A 1QG7A 1STNA 4JI4Q 2A73B 2A6HD 3OMCA 1HQRD 5JPMC 4WANA 4XYQA 4FYDA 2WIIB 4IZ8A 4OIKA 2P2RA 4KY6A 4IUTA 4FP5D 2UUBQ 4YCVA 5CORA 2XTIA 5FKAC 1O80A 5IOCA 1C8CA 2UXCL 1QNKA 4NB3A 3VKEA 4K8JA 4MN3A 1V1QA 1EZ6A 4JI6L 4JBJA 2DUDA 4L5TA 1D5XC 1TUAA 2I46A 4TKOB 2EDGA 1XMQL 4EQPA 3I4MB 1CKNA 1NJIC 3S1QB 4OCHA 4OWTB 3OYYA 4GNXC 2OEOA 4WALA 3TSSA 3STBD 4GOPB 3F1ZA 1BQQT 2RSNA 3M3YH 4OX9L 1A15A 4YHHL 4I65A 1K8AC 1WOCA 4U68A 1RHPA 1SE2A 2A6ED 4O42A 3TMEA 3CRLC 5LMNW 1EYDA 4HIMA 5IYCG 3MEHA 4CJ2C 1Z9FA 4RGTA 2R92B 2HDMA 1VIHA 1HJPA 1Q90A 3H0GG 4KY7A 1VS0A 3ICEA 3IFTA 2B2TC 5AJ3L 3JAMc 4QY7A 2DGYA 4HJ5A 4OIJA 3DXJC 3BDCA 2RA4A 5I2YA 2F0FA 2YQRA 4RHRA 5CV5A 1AN7A 1EEID 1XNRQ 1GUGA 2OPUA 1YJ9A 1GUOA 3CXCA 1Z2IA 2E3UA 1NBWA 1Y8OB 3GKUA 1SYBA 2AQ2B 1CZGA 1B50A 4CDDC 4LF4L 1Y1WH 5G3LF 3I4LA 3CHBD 4RFBA 2MJ8A 4A3GB 1TS4A 1WYDA 5LL6b 1KNEA 3I0PA 4GKKQ 3FVQA 3R3OA 4JI8L 2XWBB 1DD2A 1G6ZA 3GABA 4OO1I 4RGNA 2FMRA 1B4OA 4GNXB 4IURA 3BDOA 2EXZA 4Q5VA 1X9ZA 2ICEC 4DV2Q 1TWGH 3UI2A 3ITPA 1XMOQ 4XYOA 1PYSB 3CQZH 4KHPQ 5DLQE 1N33Q 1D1IA 2B39A 1PRTD 2EOTA 1XTDA 5JEAH 1G6PA 5A2QL 1YZ6A 4DPGA 1P16A 5J22A 4JOIC 2BH2A 1Z6HA 4GKJH 3T1YL 4X62H 3PO3G 3OTOL 4CDFC 3GV3A 3PF4A 3GTPH 3K5NA 1WCMB 2F3IA 4GKJL 4B3RQ 2E5LH 1B53A 2A69C 3S14B 4NXMH 1UNSA 3KF8B 3NP8A 4JI0H 3DEOA 3D4DA 4Q0FA 4ZLTF 1X3GA 1CHQD 2YU9H 1ICWA 4K0KQ 1T5EA 4B3MH 4C3IG 5C3XA 3CU7A 4C2MH 1TKWB 3F2BA 1X32A 3P1HA 4OEMB 1UE7A 3CP0A 2ZM6H 4OX9Q 1WHRA 5CGKA 3M9BA 3UDIA 5T1IA 3HOZH 4N9PA 3KBXA 3RZDB 1EYAA 3MC0B 2Y0SB 1STEA
chains in the Genus database with same CATH topology
2K52A 3HOZB 2JA7G 1SFOB 3UE0A 3HOVB 1S72A 1B2TA 4IPHA 2JK8A 3E5SA 3HOWG 1TT2A 2CTMA 3RMHA 5CBEE 3S17H 1HFGA 3S1NH 3MAQA 3D4RA 5ELOA 1UE5A 3GTOB 2B2YC 2K5HA 2AMCB 3ND9A 3RR5A 4HIDA 1L1OC 3HOWB 5KNDA 1R9TB 1VQPA 5COYA 4K2LA 1HNXQ 4PMWA 1TS3A 4GN5A 2EY5A 4J6HA 5E4WC 1ET9A 2QILA 4G57A 5EKLA 3Q23A 2F0JA 2KECA 3JC66 5KRUA 2XGTA 5C3EG 4X3TA 4FO2A 5EPJA 1JC7A 4HMIA 3RN5A 3OTOQ 3MA2B 1D2BA 1N34L 1YJNA 1CA6A 5E7NA 2ZT9C 1SYGA 4A3GG 3Q0AA 4R4QA 4A3FG 3KF8A 2NTTA 5G3LD 3NTIA 4DV3Q 2EJGC 1EQRA 1GHKA 1IYVA 2B29A 4DV4L 1D7QA 3J80i 3TS0A 1X55A 1PTOD 4O1NA 1LTSD 1EY7A 5DAUA 1V9PA 2OF1A 2EYOA 3HOYB 4JI2Q 1DTJA 1J4WA 4TSSA 4L5QA 3MXNB 1SBBB 1HZAA 3BJUA 5CBAE 2K32A 2LFNA 3OIQA 1EEFD 1TWAB 1DGSA 1YBYA 1CTMA 4H7BA 2PZUA 5GAGC 4QUCA 2ANRA 2HCCA 2NYZD 1GJXA 4JV5Q 1XWEA 5IGCA 4R1JA 3HOVH 1SFOH 1I94L 2JJQA 2JA8H 1LTRD 2Z4IA 1OTCA 2VZAA 1IYJB 3TP5A 2GN5A 1PH3A 2OQKA 3TZDA 1ILPA 3J81i 4IUUA 2L15A 4PNYA 2ICIA 2F0GA 4GNXA 3SK5A 4K5WA 2LS01 1PH7A 4JI2L 4M8AA 4MNOA 2QEXA 2D2CC 1PMRA 2EYJA 2CQOA 1ZKOA 1Y8NB 3R8BA 1HA6A 3URYA 1BCPF 1SR3A 1F9RA 4P74A 1PZJD 4H02A 4JBKA 1SNPA 5ELNA 4DR5Q 4DV5Q 2NVXH 3KBGA 1HZBA 4P72A 2HIXA 3KF6A 4LFAQ 3SVMA 1WTOA 3MEFA 3U4ZA 2KEDA 4C1NK 4LFBL 2NWGA 5JVG3 3HOYH 2AUJD 4A75A 3GTMH 1ASYA 3L7ZC 3DEPA 5M5YH 3HOUH 4B3TQ 1IZ6A 4A4IA 2I5LX 3KFUA 2LKVA 1QVGA 2RHQB 3KLWA 4JI1L 3CCVA 1I4QA 1TWGB 3W2DA 1PH4A 2JA6G 4FF4A 2SEBD 2MO0A 1SMYD 1G2TA 4R4IA 3ND8A 4RMFA 1K0RA 4PMCA 3P7JA 3TQYA 3S15B 2N3SA 2F0LA 3LX0A 3AEVA 4KD4A 3CRKC 2A6EC 1S5CD 1ENAA 2Y0SE 3EJIA 1S5FD 4KJOA 3D4WA 1JT8A 2JZXA 2K1BA 2ZTCA 3CC2A 4A3KH 3MXPA 2JA9A 1SNMA 5FO9B 4DV7L 1CZWA 3DWPA 2Z1CA 3D8GA 4L8JA 2C9OA 3EROA 2ZTDA 1ASZA 1VQCA 5IYCH 1FYCA 4LAAA 4DV6Q 1QCBD 5LHY1 4DK3C 1JJCB 4N9TA 1S3OA 1YNNC 2NZ1D 3PGZA 5FLXc 4RH6A 4GN3B 1EU4A 4ZKBB 3BDLA 1Q81C 2J7ZA 5FJ8G 3H15A 2R7ZG 2UXCQ 5BR8L 4GZYC 3NENA 4DR1Q 1GD7A 2X6GA 3NTHA 2N49A 4CJ0B 1U0LA 4AYBG 4YWLA 3CF5A 4MTNA 2EVBA 1WTRA 5I9PA 3VYSA 4LW1A 1U4MA 2RVLA 4JI8Q 1J8IA 3S1QH 4R4TA 1IL8A 3KLRA 3OIPA 5CR3A 2BDNA 1JQYD 1A0IA 3I4MG 1SMYC 2G9HD 4LF4Q 2R93H 1CFMA 5IT9L 3FEWX 3K7AH 5D3IB 2MUYA 4C56C 4X6AH 2EE1A 2DN8A 5HURA 5J1ZA 4OXPA 2NVTB 4LF5Q 1M1KC 2WKCA 1K73C 1K1GA 1R4PB 3PCOB 1GUSA 3S1RH 2FXQA 5M3FB 4DV1Q 2IPKD 1DXMA 3LWUA 3A8JE 4G4KA 4YY3Q 4RWSC 5KNCA 3NSWA 2MHVA 2B2VC 1G91A 1Q8IA 1KL9A 5M3FG 4GOPA 4DR1L 2PYKA 4XDXA 2R6GA 5IT9E 2WKDA 4IALA 1L1OB 3T13A 5ISRA 5D14A 1PA6A 3SGIA 1X65A 4XIGS 3A5UA 2BCOA 5EPKA 4FXKC 4JI5L 2QEJC 2XSCA 3S2HB 3AFQA 1Q12A 2D0OA 3EQLC 1IBLL 1CQVA 3S2HH 1B8AA 1K9MC 1LABA 3RN2A 1O7ZA 1TWHH 2E74C 4BBSG 1TY2A 1RD9D 1EYCA 4GOPC 3KLSX 5GROA 2FMMA 4KV6A 4AM3A 3FKIB 4RCNA 1SAPA 1NY4A 1VMCA 1VQJA 1VQOA 3MWYW 4A3LG 3PSIA 4F8MA 1GHJA 3GV6A 1G291 2A74C 5EJWA 1WE8A 3I4NB 1E1TA 4R9WA 1KQSA 3AEVB 4YWMA 1D5ZC 4B3RL 2YTYA 3FHWA 5IP7G 1HNXL 2IX1A 4H0LC 3VYUA 1VQHA 4V190 3E9HA 4AIMA 2JYOA 3I70A 4B9WA 1B9NA 3H09A 3CCSA 1QVFA 3S16H 1ENFA 4RGOS 1FL0A 2YTVA 2Z0SA 5M3MG 1A2UA 4RAUC 4E6IA 2AXYA 1X3PA 3STBC 4B3TL 4DN4M 3GTMB 5FLMH 1ML0D 4KD3A 1WJJA 1U4RA 2FINB 2I07B 4HEDA 5A35A 2O5JC 1ZTGA 3EFXD 3K0XA 2HHHL 1X56A 1EWHA 2B2WC 2BE5C 5M5XB 4A3IG 2AWNA 4LFAL 4A3MB 1XPOA 4B3SQ 4DV5L 1PZKD 1TY0A 3R2TA 5CV8A 2JA5B 3H0GB 1PZID 3ZJYC 3MXNA 3PUXA 3HP3A 3QIAA 3GTQH 2F0SA 2CQAA 4DR6Q 4A3EB 1BNZA 3M4QA 1RTNA 4GKJQ 2VQEQ 3GTKH 1JJ2A 1V1OA 4POFA 4DR7L 4OO1G 1WVLA 3SDZA 2JA8B 1SE3A 3NWSA 1ZZKA 1I94Q 3GTJB 3I73A 2CCZA 3MTSA 1HA5A 1VQBA 1FVIA 2NZOA 3D3RA 1Y14B 1PHJA 5DNFA 4CKBA 4H13C 3T16A 4C3JG 3BG3A 1FD7D 2IJ0A 3FKIG 1F2LA 3HOXB 2RSOA 4XT3B 2AHOB 1A2TA 3GTOH 4LFCQ 4ABNA 2I0QA 1VQ5A 5C4HA 4IPGA 1HNWQ 1PRTC 5C5MA 1PLFA 1JMCA 1CQFA 2NUCA 2OXPA 1FNVA 1L1OA 1VF5C 1Y1VB 1EY8A 1CM9A 5IP7H 2RQXA 3D6CA 1TR5A 4WORA 3NE5B 1IBMQ 2RDFA 1F2MA 2XIWA 2E5LL 1GVPA 1GM5A 2JQOA 4JVHA 1N34Q 4NP5A 1EZ8A 1STAA 4A3LH 2EYPA 1TIID 3CCLA 3NEMA 3PIOA 3RZDH 1PH9A 1N36L 1W6JA 4LFBQ 1HQMC 2H5XA 4U673 4A3IB 5KYLA 1CKOA 4KHVA 2HH3A 4A3IH 3SEBA 4AQYQ 4BS9A 2CFMA 1JICA 4IUPA 4RG1A 1U5KA 4EQOA 3C3LA 3K6OA 2IHFA 4QMFB 4EVOA 3CC4A 2X6LA 5C0XG 5JJIA 4YCUA 4BBRH 3GTLB 2F52A 1H9SA 1LT6D 1N32L 4AYBB 3MHBA 2AQ3B 2ZXRA 5D65A 3OWFA 4YCWA 1F9QA 3QOJA 3GQBA 2CKZB 4LK1C 1W6KA 1KAWA 1BF4A 3MXUA 4BBRG 3J81L 4A93G 4HJ9A 1LV9A 5C0XH 2UUBL 1Z47A 3T56B 4DR6L 3C1FA 1SDFA 2F03A 5E4XA 3ULPA 4KKSA 1CKNB 3BYYB 4K5XA 2TSSA 1W3SA 4L5RC 2TMPA 3ERSX 2L11A 5C4JH 4XQQA 1SYFA 2QDBA 4BA1I 1SRUA 3A74A 1KRTA 2IWHA 1X4NA 4LF5L 4XTCS 1TWCH 3VR3A 1JE4A 3L2PA 1FJGL 1Y1VG 1IKMA 3A7AB 1SE8A 4CBVA 1JB7A 2EY6A 2EXDA 3U9SA 3MFYA 1E1OA 2E2IB 4GLXA 1Q1EA 1A63A 5IGDA 3HFZB 3JAME 4RKBA 4FF3A 5M3FH 3CCMA 4ZKCB 1H9SB 3S1NB 4L6TB 1RKNA 2O5IC 3I2ZA 2JA7H 3T1HL 1QZHA 2IX3A 3FDTA 4FNFA 2PI2E 5IP9G 5AFWA 4XQNA 2JSOA 2GVBA 2RDHA 3HKZE 2VUMH 4BY7H 4C1NI 3WOFA 1N32Q 2ASBA 4LUOA 2R7ZB 3E0JA 2B63B 4IJLA 1GO3E 1P8LA 1NCVA 1JWSD 3I4NG 3B6YA 4BXXH 4WJWA 5JPNC 1JWUD 3HG9A 4C3JH 4A3GH 3CMAA 4R8IA 4AQYL 3I4NH 2XVSA 1VMPA 2N78A 2M2LA 3K7AB 5E3FA 1STBA 4LF7Q 1A3UA 4G7OC 1GUWA 3PF5A 4OWWB 5EBCA 4TRDA 4PG3A 4YIJA 1DZ1A 4RCOA 2YTXA 1W2BA 1II3A 3F2UA 3LGJA 4LWCA 3IKJA 3HRZC 2UUAQ 3NPPA 4YY3L 3TBIB 2K01A 1LYLA 4G7ZC 3M7GA 2IT1A 2HH2A 2Q2TA 4DF7A 3T1YQ 2B2UC 2QA4A 4HIOA 1I6VC 2K04A 1SNQA 1EWIA 1IKLA 4DK1A 5LMNL 4HJ7A 1EIGA 3ERQA 3GTQB 4JOIA 2SDFA 2ZJPA 1X4MA 1RL2A 2ES2A 2RKSA 4UDUC 3UDGA 5EKKA 1QE6A 1VQ6A 1G51A 3M3YB 3K5OA 2CWAA 3FPUB 3OSOA 2SNSA 1Q1BA 1SJHD 4ILWA 1WD1A 4ZK9B 1YEZA 3U4VA 1KABA 3CPFA 1YHAA 1DOLA 5FLXL 2B2YA 5IWAL 1I50H 3BYTB 4BY7B 1EFID 2HCIA 1NUCA 1S40A 2SNMA 3V2TA 4RA8A 1Y69U 1C0AA 4KI0A 3GTPB 3I4OA 4KTAA 5H1SE 1JCKB 1UEBA 1DOKA 1ZXTA 4CHTB 2B2TA 4EQNA 3HKZG 3NQIA 1I4GA 3KJPA 1EQTA 1DONA 3H3VI 4A3DB 4K14A 4MZ9A 4ZAIA 1JOKA 5D3DA 3O13A 2L12A 1FR3A 1F2ZA 5BN3A 5FLXE 4GKKL 2A1AA 2NN6I 3S2DH 1G2SA 4GN4B 3PIO3 2NVXB 1LTBD 1Q86C 3CAMA 1QUQA 4DR2L 3F8TA 3NXWA 3TZUA 4DFAA 4OWXB 4DAVA 3CD6A 1PFBA 1I4XA 5GAHC 1I3QB 4RKLA 3A8IE 1KLGD 4LF6L 4H44C 4LF8Q 1MBYA 2RF4A 3GP7A 1FNUA 1D6EC 2BA0A 2HQEA 1ZYRD 4QB4A 1LT4D 1VIGA 3PUWA 5CV7A 1DT4A 3H94A 4QJFA 4A3KB 4K5VA 4JI1Q 1TWAH 2KVMA 2I5MX 4X62L 3SXHA 1A3VA 5FO8B 3L0OA 1PFNA 2N8NA 3NELA 1KXLA 2Q8IB 2B2VA 2DY7A 5IGEA 4DR3Q 3PO2B 4PZ8A 3NBIA 2Y0SG 2FHTA 3GTLH 3IFDA 1FGUA 4DU9A 2JA7B 2M9VA 2MQHA 1TWFB 1CT1D 3QO2A 3J7YW 3VA7A 1EYGA 2UXDL 1VQ4A 4BBSB 1B1ZA 1MSGA 4YHHQ 3BS1A 4HAEA 1J5EQ 4KY5A 4JI0Q 3LWEA 4HJ8A 2R3ZA 4DUZL 2D0PA 4A76A 4B3MQ 3J81j 2CW0D 2OT2A 1Y1VH 5I9OA 2K4KA 4HSPA 5C4XH 1BVSA 1U4PA 2ZM6Q 1O7LA 3QJYA 4A3BG 4APVA 4F88A 1X6OA 2K5DA 3MFGA 4LFCL 4S3SA 1VQFA 1HNZL 1OXSC 4HIKA 3DWQA 1R9TH 5CV9A 4BWGB 3HOXH 1SYCA 4HCSA 4A3BB 5M5WB 4JI6Q 4P73A 1V1PB 5ELDA 3D31A 3TRZA 1YHQA 1F77A 2FFKB 3CCJA 1VQ7A 4OO1H 4DK6C 2K7VA 4K8IA 4LMQD 4IOAA 1F9SA 2J0TD 2E2JB 4QGUA 3SK4A 1K3RA 3CCEA 2LXJA 1STYA 2EYHA 4DV1L 2F1MA 2A19A 1N8RC 5K36H 1VQGA 5LL6S 3K8AA 1XPUA 3AB9A 4OHJA 1ZYRC 2YYZA 2VQEL 3OWEB 1HH2P 4X66Q 4NKLA 4A3KG 4ID6A 3W3AA 3RZOH 2LSSA 3H3VH 5FK9C 2WV6D 3N6RA 1TWCB 3WDNA 1AZPA 2WAQB 3QWNA 4FDBA 4J8QA 4DV3L 2FMCA 5F2DA 4IN3A 2CTEA 3K57A 2ZXOA 4O0AA 1L2FA 1WVNA 1H9JA 3VDYA 3MVVA 4I7ZC 2OTJA 1I4PA 2B3GA 2DNCA 5EPLA 2NVYH 1S5DD 2V1CC 3SR1A 1A6XA 3DHQA 4X64L 3K5MA 1XJVA 1MJEA 1LTLA 2L9HA 2PQAA 3HOUG 1AZQA 4HCEA 4K6LA 3T51B 4BY1B 3MZ5A 4KJNA 2WB1G 2VXWA 1MIUA 3KOJA 5IT9c 1S5BD 3RUZA 4F7XA 2E2JH 2A5HA 2PMZE 3K81C 2ATWA 4G7HC 4F87A 2VY3A 1V43A 4NXNQ 3H6MA 4KKTA 4DV6L 1BUVT 1PV4A 2ANNA 2H4OA 1OXXK 3ZYYX 3PUYA 3R2IA 1KRSA 4DA2A 1MJCA 2CHBD 3NWTA 3GTJH 4IFDI 3S17B 2L0CA 1NMGA 1QB5D 4NMZA 2BOSA 3CW2C 2ZM6L 3RLOA 4C3IB 2VS1A 2F0WA 4B3ML 1AE3A 4HJAA 3TEHB 4IPCA 1ZZIA 1RF2D 1KDAA 1AFPA 2A8VA 2CTJA 4IUVA 3TP8A 5IYBH 4V0BA 1VQAA 1IBML 1XNQQ 2PW5A 4QIWB 5CV6A 1NR4A 4DAYB 3IAYA 2E2DC 3I7FA 1HCZA 1CKMA 1HZCA 1DYQA 2PQEA 4TVAB 4XT1B 1RCVD 2F0KA 3T4AC 3CCRA 3BZKA 4MIUA 3RLFA 2WAQG 1T9HA 3J7AF 2NN6H 2EYFA 1VQKA 1K8MA 5LMUQ 4IO9A 4LF9Q 1B7YB 3DM1A 1AH9A 4FF1A 1YIJA 4EGVA 4A3FH 5HY6A 3W5OA 2K28A 4A3DH 2Q8TA 5C3EB 3NQTA 2XRSD 3DWAA 3HEJA 5FLMG 1LLRD 1M8AA 2K6AA 2NTSA 4X66L 1NAPA 1Q82C 4A3BH 2PY9A 2D9UA 3G48A 1T5XD 1ILQA 3NBHA 1VQLA 4TQUS 4IPDA 1EL0A 4DR7Q 4DV0L 5CYUA 3J7A5 2PO4A 1ZEQX 2KBNA 5ELFA 3VYTA 4IJHA 4ZYSA 1QILA 1XPRA 4WFN3 4JI3Q 5K5PA 2R61A 1JOQA 4DNTB 3EN2A 5A2QE 4JCVE 3I8ZA 4DV0Q 2VNUD 1A3TA 2F4VL 3EVQA 1IBKL 3BU2A 1EY0A 4EX5A 1X3QA 2JXMB 1EY5A 5JJKA 2BH8A 1YI2A 1NSNS 4XQJA 2CTLA 1EUJA 1K83B 4QUFA 3AQQA 3J81c 1YNJC 2QKIC 1E2VA 4FVMA 2R7FA 1SYDA 2V4DA 2D62A 4ZQ3A 3KJOA 2B63G 1Z7TA 2NVTH 1KDCA 2PZTA 1HUNA 3S14H 1TXYA 3PO3H 2JE6I 2OTLA 3OW2A 4A3FB 4AYBE 4CKEA 1K8OA 4NPSA 3ULLA 2B2WA 3U58A 1EOVA 5LMNQ 4C3HG 1UWVA 5EGTA 1S5ED 3PV0A 5ELCA 3A5ZB 4BY1H 1HPCA 5JVH3 1WTQA 5IGGA 2IL8A 4LF6Q 3A0JA 4JI4L 3TP7A 1TVXA 3J81E 2QGQA 4DR4L 5C6AA 2F0IA 1STHA 1XYIA 3MXGA 1KIXA 1A62A 4DR2Q 3D6WA 2UXBQ 1D5MC 1OXVA 1UUPA 4DXGA 1SNDA 2F3VA 1EQQA 3EA6A 3M4PA 1FGBD 4JK1C 5LL6X 4DXFA 2UU9L 4L5SA 2F0OA 1VQIA 1C9OA 1BCPC 1FNWA 4K0KL 3S15H 4ZUIA 1PXUA 1VQNA 1IXRA 5C0XI 5GAEC 3BVZA 2KHSA 4KN7C 3N52A 1PTOC 5I2XA 5C0XJ 5JEAJ 3I91A 1PYBA 3KK7A 4J15A 4UP7A 1HR0L 1EIFA 2MJHA 4HR7B 5C44G 1Q7YC 4X3KA 4QCLA 1BXTA 2K75A 3TS2A 5C4JB 1YITA 1HTPA 2R92H 1O7IA 1HRJA 2PQAB 3M7NA 1BBXC 2MPMA 2ENBA 3X3MA 5JAVA 4A3CH 3PIPA 4X65Q 1JR0D 4FXGC 4X64Q 2LY7A 4BA2I 3T1HQ 3V05A 3F2CA 4Y52H 2PI2A 2Z6KA 3U50C 2RBMA 1I4HA 3Q6SA 1SNOA 1YJWA 1HHVA 2FJ2A 4C3HB 3VA5A 1IW7D 3M4OH 1RJTA 1IYUA 1SLJA 2MFIA 3J80c 2E2HH 1Y8PB 1AP0A 4LNQA 4FF2A 4DUYQ 4LUVA 1WTXA 1UAPA 3RLNA 1X54A 1E24A 1CSQA 1H9KA 4WJ3M 2AUKA 2VUMB 3HZXA 3HKSA 5C3EH 2KHJA 5TSSA 4HSVA 5EQ0A 1RTOA 4DAPA 1XNQL 1S4ZA 4C3JB 3GD7A 4A3DG 2WB1E 1NE3A 2JVZA 1NTGA 3JAMi 2O2LD 1C4QA 4Z9CB 5AJ3Q 1V8QA 4DR3L 5JJZA 4PZ6A 2UUAL 1DM0B 2CTFA 1UEAB 1QNUA 3OW7A 4KKUA 2KCTA 4JI7Q 1PTOB 5EKIA 4GS3A 3WOEA 1PH1A 2HDLA 1L0XB 2HUGA 1C48A 3AYHB 4UAIA 3RNUA 1JB3A 4HMJA 4LF7L 2K50A 2NZHA 3NBHB 2VQFQ 1J6QA 2I5HA 5HGQA 4QMGA 4P71A 2BA1A 2LMCB 1PYWD 5GQOA 1BBWA 3I55A 3R93A 5IIFA 2E75C 4IOCA 2OWOA 2F0PA 2JEAI 3G71A 1HTLD 2ZTEA 1LM0A 3RZOB 4KHZA 2AKWB 4JI0L 3PUVA 2MP1A 5IYDH 2C5CA 5JJLA 1ESFA 4PMBA 3CCUA 2UXDQ 3SK6A 2JA8G 2F4VQ 3I90A 1YNXA 3KUPA 2VB2X 1XX8A 3J7AV 1SEBD 4ZRZA 3I56A 1U4LA 3K7UC 1EY6A 3S1MB 2HIVA 2BE5D 5M3MH 5JEAG 1CA5A 5CMDA 3PIP3 3KDFA 1EOTA 3G6EA 2Z6KC 2WB1B 2ID0A 2VUMG 3BVGA 4IFDH 4JBWA 4ODGA 4Y7NB 4A93B 4A3JH 2N88A 2Q2IA 4GLVB 2Z4HA 3K59A 1N33L 2UUCQ 3J80E 1EU3A 1H9MA 5CV4A 2EPBA 2R7DA 1IHZA 4ME3A 1PH6A 2KQ3A 3WWVA 1XMOL 2KHIA 4A3CG 2XRQD 4DV2L 4LJZC 1AN8A 4DUYL 3PO2H 1SE4A 1EIYB 2EY1A 2CTKA 2F0NA 2ALYB 4DNRB 4BBRB 2F0QA 2XWJB 5C4XB 3ONAB 2KA7A 1F9PA 2F0HA 4B8TA 1KC8C 1WI5A 1PFMA 2PPBC 5C5LA 3AMUA 2A68D 1WCMH 2EJFC 2CVRA 3OMGA 2WINB 3E9IA 3GTGH 1CI3M 4OL7A 1CHPD 3Q22A 3E0EA 2XNAC 1SROA 1EWCA 4JYAL 1WCMG 3J80L 1E0BA 4ALPA 1CSPA 5IE8A 5KYIA 1XNRL 2JP1A 5KIXA 1YVCA 2EYLA 4UP9A 4B08A 2X69A 2JA5G 2F0EA 3K58A 4QF4A 5M5WH 3HGBA 1I4RA 4IUNA 4K6DA 1PRTF 1OO9B 4QQBX 3FP9A 3AU7A 2K5VA 1KAAA 1J5KA 1YNJD 5IWAQ 2DNEA 1IL2A 1EY9A 1BCPB 3P20A 4NDXA 5JOBA 4POGA 3M4OB 3HOZG 1RODA 2JA6B 2ZXPA 3FRPB 1HZ9A 4YWKA 3G6JB 3PO3B 1E3PA 1J5EL 1ET6A 3PUZA 1UE1A 3IL8A 1XTCD 4Y7NH 1XXGA 3A54A 2L5TA 1X3EA 1Y1WG 1BDOA 5GADC 2HHHQ 1OXTA 1PFSA 3GDEA 1JJGA 4PQXA 1O7YA 2D5DA 1A8VA 3DM3A 1VF7A 5HGTA 3FKIH 4JC0A 2EY2A 2KJXA 2E2HB 2GVAA 1D8LA 1DOMA 1I50B 1XMQQ 3EIVA 1OXUA 1C7YA 5I6YA 3CMEA 4XXEA 5I6WA 2L1BA 1WD0A 1TS2A 1TWFH 2L4NA 3KDFB 1EIHA 1K83H 3H0GH 1TWHB 3K80C 3SK8A 4R8NA 2PCFB 3QG1A 2K5QA 1JORA 2PNHA 2KOLA 5C3WA 1DJRD 1EQVA 3S2DB 4DR5L 4X3UA 4FXDA 2RHSB 3TDQA 4PV1C 4EQ5A 2F0VA 3F2DA 3VR6A 1SNCA 3C1EA 3LNNA 4NXNL 4JI7L 5NUCA 1BO0A 1BR9A 2WFWA 2Q8RE 1PVOA 1HUMA 5EAYA 4A3MH 2B2UA 2N55A 4UPAA 2ZJRA 3QOLA 4NXML 5IY0A 2E76C 1KD1C 4R4CA 4DGZA 2A68C 1E2WA 2QCPX 4KHPL 2XN9C 4NW2A 4P2CB 1B9MA 3W1BA 1AW7A 1TQOA 2EJMA 2CW0C 4IQZA 4ULLA 2F3WA 5KNBA 4JYAQ 2JA6H 2K5WA 5J39A 1GUNA 3SE0A 2M00A 1E7ZA 3S1RB 1LTAD 1I5FA 4BY7G 1SMXA 1SJED 1QWYA 2BL5A 1GKHA 2IW3A 4BY1G 2OPVA 2HQLA 4JVYA 5IP9H 3BZCA 3IRBA 2K33A 4B3SL 2J4XA 2B8FA 2CWPA 3TP6A 3JAML 1Y1WB 1KHIA 2F4IA 3QB3A 1UE6A 1LACA 3A56A 3C46A 1MKHA 3TREA 2R93B 3NHHA 2R92G 3I3CA 1VQ9A 3ER0A 5C44H 1WTPA 4DUZQ 5BN5A 2UUCL 4KN4C 2NB0A 1VDZA 5LMUL 4DAMA 1PH5A 4LF9L 1G8ZD 3NTKA 3EBEA 2B63H 2K5NA 1KLUD 2WACA 2MGSA 2PZWA 1DCZA 1LT5D 2F0TA 3AFPA 2VL6A 3UDFA 1BBUA 2YV5A 3H3VC 4X62Q 1M90C 2A6HC 4LIJA 3K5LA 1O78A 1SXTA 4QIWE 1Q46A 2Q2HA 2JEBI 3BVMA 5C44B 3HOVG 2E5LQ 4KLKA 1SN8A 5T1GA 4WJ4A 2UU9Q 3PO2G 1PRTB 2QF7A 4A3EG 3VR5A 1BOSA 4KMUC 1STGA 2DGRA 3DUZA 1KHMA 2UXBL 2CPQA 1NR2A 2K05A 5DM63 1U9RA 3HOUB 5M5YB 1LT3D 4KK7A 2EZVA 4A3JG 5J3BA 4DR4Q 4DV7Q 1GUTA 3PMFA 2K03A 3OPOA 4IFDG 4DNIA 3FPPA 1IBLQ 1E22A 2F0DA 1SSOA 5CC4A 2VQFL 3CC7A 1ENCA 1X3FA 5FO7B 1PDQA 2EYMA 3HKZB 5KEEA 1Q3LA 1I6HB 3RD4A 1NMFA 3L9AX 1N36Q 2GA4B 5ELBA 1VQEA 2NVQB 2C35B 2PMZB 2E8GA 2BDOA 3GTGB 3J7ZC 4DK0A 4BXXG 5M9OA 4GLAC 4PZ7A 2HT1A 2F0MA 3E6ZX 2R7ZH 2IHEA 5EBDA 4B9XA 1B44D 2RDGA 1KTKA 3Q24A 1L0WA 1TS5A 1LO5D 3A55A 2EIFA 1JWMD 2KEEA 2OQ0A 5K36G 1X9NA 4ME5A 3P75A 1VQDA 2KCNA 4QL5A 2Q2UA 3M85A 1PTOH 1JE5A 1ONLA 3W1GA 2H1EA 5IYBG 2O4XA 1WTWA 4HN7A 4HTHA 1EY4A 5M5XH 1IBKQ 2WAQE 1R4QB 5IGFA 1J9OA 1RIPA 2KCMA 5IODA 1SYEA 3A7LA 5KGUA 1CK1A 1BCPD 1QJOA 4C3IH 2PNRC 1JOOA 3A8KE 4DAYA 1H9RA 2B8GA 1F2YA 2E2IH 3I72A 2KENA 4J1MA 4OGQC 2IY5B 1HR0Q 3CCQA 4CJ1B 2NVQH 4CGYB 1B3AA 1EC6A 1GXDC 3CPWA 4JBMA 1IW7C 1VCIA 3S9WA 2MNAA 3S1MH 3H91A 1D1KA 1QOHA 2KUMA 5FJ8H 3TN2A 4A3JB 4A93H 3HOYG 2PW7A 2NN6G 3KYHC 4IFDJ 4X3SA 1QUQB 4LUZA 4OONA 5DM73 1EFWA 1HNZQ 1ZZJA 4DKAC 2KCCA 1GOZA 2A69D 2NVYB 3NK9A 4A3EH 3S24A 5M3MB 1LTGD 3UE1A 4C3HH 3VR4A 2JA5H 1L0YB 5ELEA 3GO5A 1HXYD 4CKCA 3U9OA 5BN4A 4BBSH 1HR0W 1QVCA 3V69A 3BZDB 2DY8A 3T53B 2IX0A 3OOCA 1LUZA 1LTTD 3K0YA 2AWOA 4UY8C 4RHSA 1N9WA 1YNND 3L3OC 2VB3X 2YU9B 1B70B 4JG2A 5IGBA 3S16B 1CUKA 3Q8DA 3VYRA 1HNWL 1YHBA 3GTKB 3V96A 2F0UA 2QNDA 4RGMA 1PTOF 4AH6A 2EQSA 4O2DA 1AEXA 2L55A 4LF8L 4UP8A 4R4OA 3DMUA 3CQZB 1KDBA 1VQMA 4WRDA 1FJGQ 3VR2A 1K8GA 4IUQA 4X65L 4K2KA 3G4SA 4P75A 1I6HH 4C2MB 5C4ZA 3DLLA 4JI5Q 3HOXG 1E2ZA 2K14A 1PH2A 1PH8A 3I4MH 2R93G 1H95A 4L63B 3NUCA 3SHLA 5DEHA 1AE2A 4ZUJA 1KNAA 3G7LA 3C2PA 1VQ8A 5IYDG 3M4YA 3OHXC 1RDPD 4JV5L 1WTVA 3D0FA 4JI3L 4A3MG 5C4XG