3L7ZC

Crystal structure of the s. solfataricus archaeal exosome
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
222
structure length
222
Chain Sequence
QKIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKSGCSIFVANNGRIWATCPSRFSEEILIEAIRKIENESHIKGLTDRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable exosome complex exonuclease 2
publication title Crystal structure of the S. solfataricus archaeal exosome reveals conformational flexibility in the RNA-binding ring.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase/rna binding protein
total genus 37
structure length 222
sequence length 222
chains with identical sequence F, I
ec nomenclature
pdb deposition date 2009-12-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3l7zC01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3l7zC02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 3l7zC03
3HOXG 1O7LA 1OXUA 3A0JA 3PIOA 2K33A 1VQDA 1J5KA 1JJ2A 1SMXA 4LF5L 2R7FA 4YHHQ 4XTCS 2QEXA 3KJOA 2ZTCA 1Q1BA 2UUAL 3T1YQ 4K0KL 3PF4A 4DR2Q 2CWAA 3KF6B 3LNNA 2UUCQ 2A19A 1N34Q 4DNRB 3E9HA 5H1SE 2VW9A 2MO1A 1VF5C 1IBLL 5C0XI 3N6RA 4B3RQ 1A0IA 4JBKA 1CKNA 2E76C 3GTLH 1XTDA 1E1TA 4L5SA 3U50C 2YTXA 4UY8C 1OXTA 4DR1Q 1KHMA 2E2HH 3NENA 1MIUA 4GZYC 4JCVE 1HPCA 1I50H 2QGQA 4DNTB 3VKEA 1N36L 5C3EH 3IRBA 1NY4A 3KF8B 4OO1I 1IYVA 3T51B 1A6XA 5FLMH 2MQHA 3G6EA 1TWCH 4ME3A 1GUOA 3GTQH 2R92G 1B70B 2OPVA 1MJEA 2NN6G 3HOUH 3PO2G 1ZKOA 5GROA 4LFAL 1PA6A 4A3JH 2E2JH 3MXUA 2E75C 2ZM6L 5IYBG 3M85A 2XGTA 3HOZG 2ATWA 3JAMi 2KCTA 3T53B 2Z6KC 2OTLA 3HOVH 1KQSA 5C44G 3CXCA 4LWCA 1L1OB 3AFPA 2VS1A 4BA2I 3KLRA 4DR5Q 1NMFA 3DLLA 4IJHA 1VDZA 4DV7L 1VQMA 3OPOA 5HY6A 1R9TH 1DXMA 4HJAA 1GM5A 3AFQA 1ZZIA 4GN4B 1XNRL 4X65L 1KIXA 2K50A 4JI5L 1XMOL 3J81i 2IHEA 2CCZA 1O7IA 1N32L 2UXDQ 4MTNA 4NXNQ 1I5FA 5ELOA 1Y14B 4JBJA 3GO5A 3S24A 4LK1C 3BG3A 3WWVA 2YYZA 4GKJL 3U1KA 5HGQA 1OXXK 3T56B 1BBUA 3VA7A 5E7NA 3KF6A 1LYLA 4LFBQ 2ZJRA 1NTGA 4YCUA 1IW7C 4LNQA 3I55A 2RHQB 4P75A 2CKZB 2A68D 4DK3C 2AMCB 5BR8Q 1C0AA 1V43A 1UE5A 1VQKA 5IE8A 1B9MA 1GHKA 3NBHB 3LWUA 1PH1A 4JOIC 2LSSA 5BN3A 3GTOH 1HNZQ 5GADC 5JJIA 4B8TA 2F3IA 2E5LQ 5C3EG 1EFWA 1M90C 5LMNQ 5BN4A 5M3FH 2KCCA 2KHIA 3TRZA 1PVOA 5FLMG 3UDXA 4KN4C 1V9PA 4JV5Q 1XMQQ 1VF7A 4OXPA 2F52A 4OONA 2AWOA 1PH6A 3HOUG 1C9OA 2ZJPA 3HKZG 1YVCA 3WDNA 5AJ3Q 4DR3Q 4A3JG 4OWXB 1CKMA 1SN8A 2ANNA 2CW0C 2JZXA 3EBEA 5JEAJ 2KENA 2O5JC 3JAMc 1N8RC 4AIMA 3CCLA 2V4DA 4LUZA 1DCZA 1A8VA 5KNDA 3KLWA 1E1OA 2I5HA 1PH4A 2B63H 3HOVG 1L1OA 3EIVA 3ZJYC 1NJIC 4DUZQ 4L5QA 2YQRA 1L1OC 1Q12A 2DNCA 1SE8A 1J6QA 1HNXQ 4AM3A 1KRSA 4R4CA 1S40A 4PZ7A 2UUAQ 4LF6Q 4C3JH 1N9WA 1VQEA 4K0KQ 4X62L 4JG2A 1TWFH 1PFSA 4BXXH 2YV5A 2R7ZH 4JI2Q 1YJ9A 2B8GA 1IBLQ 3ND8A 4YCVA 2JA8H 1NE3A 4RMFA 1UWVA 2JQOA 1W3SA 1XPRA 4YY3Q 4EX5A 1IL2A 5M5WH 3J81c 4GNXA 4B3SL 2F4VQ 2RCNA 1EOVA 2OPUA 4DK1A 4LF4L 2V1CC 5IWAL 2JK8A 4KHPL 3FKIH 4A3EH 2PPBC 4OX9L 4JI0Q 4DR6L 4KKTA 4A4IA 1VQJA 4J15A 1N36Q 1GUTA 1J5EL 1HH2P 3VR6A 1QZHA 2Q2TA 2CTMA 1X55A 4X66Q 4JI1L 4DK6C 1CFMA 3VR5A 2O5IC 3JC66 2GN5A 1HZBA 3PGZA 4HIDA 3OTOQ 1VQ6A 5LMUL 2I0QA 3S1NH 5BN5A 2ZM6Q 4GN3B 3T1HL 5JEAH 4DKAC 3M4QA 4X64L 2NN6H 4HIMA 1PH7A 2ALYB 3AEVA 5IP9H 1H9SB 4MNOA 1YI2A 3I2ZA 1GUGA 5M3FG 4IPGA 1DTJA 3CCQA 2KA7A 4BY7H 1N33L 4GOPA 2K4KA 2WFWA 3HOYH 4X6AH 1M1KC 4DV1L 2LMCB 2IY5B 4AH6A 4A3BH 3D31A 5EAYA 4HJ5A 3RNUA 2UU9Q 2UUBQ 1HNWL 3OW7A 4G7ZC 3GTPH 1P8LA 2Q2IA 3EN2A 1EYGA 4X65Q 2R7DA 2K7VA 1VIGA 4JI8L 1H9KA 4LUOA 4JI5Q 2JJQA 3A5UA 2YTYA 4JC0A 3H15A 3H3VI 4GS3A 1U5KA 2A8VA 1Z6HA 2QNDA 1MKHA 3S1QH 3TS2A 1H95A 3MEFA 1XNQQ 4PG3A 4POGA 2B63G 3TS0A 1H9JA 2WP8J 2JE6I 1Y8PB 1GJXA 2C35B 2EIFA 4LFCL 1Q86C 4A3CH 1WCMH 1X6OA 5C4XH 1KD1C 1KL9A 1E7ZA 1FGUA 3M7NA 4BXXG 2CTJA 4H13C 1VQAA 2FXQA 2R7ZG 4GLAC 1K73C 3HKZE 1K8GA 2XTIA 4DR4Q 2JA8G 2LXKA 4LF9L 4LIJA 5M5YH 1OXVA 4B3TL 1L0WA 3W1BA 3AYHB 4POFA 1IBML 1E2VA 3I72A 3I4NH 2UXBL 2K5NA 3FKIG 4A3EG 2NVTH 3J80c 4UP9A 3SGIA 1TUAA 2CTLA 1PH2A 2E74C 2ID0A 3CPFA 2JA9A 2NZHA 4DNIA 3L2PA 2E3UA 4WALA 3KYHC 5IP7H 2H5XA 2OTJA 3W5OA 1HR0W 3MFYA 2NVXH 3STBC 4DV5L 1WFQA 4Y52H 3Q8DA 1TU2B 5M5XH 1YEZA 3FP9A 2HHHQ 2ZTDA 1PH9A 3BZCA 3OYYA 1ASZA 2NVQH 5JEAG 3TREA 4DAMA 1VS0A 3U4VA 4A3LH 4AQYL 1I94L 1H9SA 5IP9G 1QUQB 4C3IH 1YHQA 4NXMQ 1ONLA 3BZKA 4TKOB 1GHJA 3W1GA 2BE5C 4BY7G 2JA5H 4KHZA 2Z6KA 1JE5A 1K3RA 3HOYG 3F2BA 4DV3L 4PV1C 4A3BG 1K83H 2PNHA 3U58A 1XPUA 3D4RA 3PUYA 1HZ9A 3ULLA 3BU2A 2HH2A 3K0XA 1VQ8A 4QGUA 4AYBE 1SRUA 4DV2Q 1WI5A 3BJUA 2AWNA 1EIYB 5IWAQ 1Y8OB 1O78A 4G7OC 4WJ3M 1YJNA 2A68C 2EJGC 1RL2A 2OQ0A 4R4OA 1BBWA 3I56A 3HFZB 4JI7Q 1Z47A 4R4QA 3S17H 4JK1C 4A3CG 1WCMG 1GO3E 5C4XG 2AHOB 4B3ML 1YHBA 2AXYA 1HTPA 2K5VA 1J5EQ 4YCWA 2AUJD 4KLKA 3K81C 3CRLC 3HOWG 1CI3M 4JI1Q 2K5HA 4LF7Q 3CCEA 3DXJC 2OQKA 3D0FA 5GQOA 1Z9FA 1VQFA 2HIVA 3L7ZC 1FJGQ 2A6HD 3I4NG 3K80C 3M4OH 4DUYQ 4Y7NH 1K8OA 4X64Q 3I4LA 1HR0L 4A3DH 4KKUA 3KDFB 1X65A 4KKSA 1A63A 4YHHL 1K8AC 1ZTGA 3TEHB 1RIPA 4JOIA 2NZOA 2PMZE 4GKKQ 5A35A 4LF8Q 2YTVA 2GVBA 3S2HH 5IP7G 4DV6L 1L2FA 2IX1A 1PV4A 4DR2L 1G291 2UUCL 2EQSA 4DV1Q 2A6ED 3RLNA 4B3RL 2ANRA 2QF7A 3RZOH 3ND9A 2WB1G 4A3FH 1HNWQ 3DM3A 1JT8A 3GTMH 2IHFA 4APVA 3CD6A 3QJYA 4QIWE 4A3LG 4DR1L 3FMCA 2MFIA 4OGQC 1TXYA 1QUQA 5FJ8H 2OWOA 4IQZA 2VQEL 1HJPA 2HH3A 4HJ7A 2B3GA 2VQFQ 3CC7A 3EQLC 1VIHA 3H94A 4HJ9A 3QG1A 4JI6L 2JA5G 1VQBA 3H0GH 2IT1A 2UXCL 2P2RA 1NBWA 2I5MX 4LFCQ 2B8FA 3TQYA 3ER0A 1YBYA 4IJLA 4LF5Q 2CWPA 2JA7H 1OXSC 1GUSA 1IXRA 3F2CA 4P71A 4NBQA 2DGYA 4IO9A 4A3MH 2CPQA 3HGBA 2ASBA 4JYAL 1X56A 5JJKA 5C0XJ 5KNBA 1GUNA 1VQ4A 1H9MA 4IPDA 4IOAA 1SROA 1IBMQ 3K7AH 4PMWA 5IYDH 3GTKH 4XIGS 1EUJA 4H02A 3CPWA 1XPOA 1E2WA 1AH9A 1FVIA 4YWLA 2AKWB 1DGSA 1BDOA 1Q81C 3S16H 3A7AB 3UDFA 3PUWA 2R6GA 3PUVA 2A69C 1EC6A 4DR5L 2Q2UA 1TWGH 4O2DA 1WE8A 4R1JA 4NPSA 4IPHA 2A1AA 2E8GA 2KBNA 2JA6H 5C4JH 3A8KE 4UP7A 1FL0A 1K9MC 5GAGC 2CTKA 4BBRH 3ERSX 1Y69U 1BVSA 1V8QA 1T5EA 3PO3H 4I7ZC 2HQLA 3A8IE 3KDFA 5ELNA 2UXDL 1I3QH 4A3DG 4NXNL 4LFAQ 4QQBX 1IYJB 1SLJA 1VQPA 4L5TA 3I4MH 3G4SA 2GVAA 4IFDI 1CTMA 1Z7TA 2K14A 1KXLA 1I6VC 2JEBI 3RN2A 4L5RC 4LFBL 1KAWA 2DN8A 2ZTEA 3PUXA 2HT1A 1U0LA 1X54A 1VQLA 3G48A 3AB9A 3U9SA 4A3FG 3U4ZA 1ASYA 1JJCB 1HQMC 3CW2C 4GLXA 1YZ6A 5BR8L 4JI4L 1MJCA 4BA1I 3UE1A 2N78A 3PUZA 2Z0SA 4DV7Q 3CP0A 5C0XH 2NVYH 2WAQG 3A5ZB 3I73A 5FJ8G 1HNZL 1ZZJA 1XNRQ 1Q46A 2MNAA 2K32A 4A93H 4MZ9A 5M3MH 1LM0A 1XMOQ 1Y8NB 1HCZA 5LMNL 1VQIA 4UP8A 1EWIA 3CRKC 3H0GG 4LJZC 1PMRA 2I5LX 1HZAA 1N32Q 4P73A 3RZDH 1XJVA 2RHSB 1KC8C 1IYUA 2JA7G 4QY7A 4IOCA 4JV5L 3QIAA 3S2DH 4OO1H 4GKJQ 2BDOA 3VR3A 4A3MG 4DV0L 1KHIA 5AJ3L 4DR3L 4O0AA 3KFUA 3PIPA 3CCMA 1Q90A 4JI3L 1E3PA 1G51A 1JJGA 4L8JA 2QA4A 3HOWH 5IYDG 3CC2A 3B6YA 1Y1WH 1IZ6A 2D0PA 2VUMH 4DAYB 1X4MA 2ES2A 1HR0Q 2CTFA 2NN6I 4DUZL 1CKOA 1A62A 3CCRA 2DNEA 2PQAB 1K0RA 1HNXL 3CCSA 4YWKA 1VQCA 2K52A 4BBSH 4LF6L 1X3GA 3F8TA 1LABA 1S72A 4DV6Q 1HZCA 2JA6G 4JI2L 1X9NA 1QJOA 1WOCA 4DPGA 4BBRG 4DV4L 3K7UC 1PHJA 3AQQA 4YY3L 4A3IH 2BL5A 3PO3G 4OWTB 2F4VL 5IY0A 5J3BA 3VDYA 1YHAA 1VQ9A 4P74A 3SE0A 2VQEQ 5K36H 2N3SA 3I4MG 4JI0L 4JBWA 5DLQE 3V69A 1JB7A 4DR7L 2PNRC 4JI6Q 3HKSA 1Q7YC 3J7ZC 2UXCQ 3E0EA 4LW1A 4HIOA 2VL6A 3ICEA 1VQGA 4X66L 1FYCA 3BDOA 2K75A 2DUDA 3VR4A 1VCIA 3FPPA 1Y1VH 3UDIA 2N8NA 1OTCA 2EDGA 3OTOL 3GTJH 4BY1H 1DT4A 4OWWB 4JYAQ 1GD7A 5C0XG 4X62Q 3J81j 1PH3A 1CSPA 4RCNA 1YJWA 1QVCA 1SR3A 1QZGA 3NE5B 4ALPA 3GD7A 1IBKL 1EIFA 3IKJA 2JVZA 4A93G 3K8AA 3W3AA 5M3MG 1VQ5A 1FR3A 3STBD 4B3SQ 3CAMA 3F2DA 3L0OA 1EWHA 4LF4Q 2A6HC 1DD2A 1D7QA 3CMAA 4H0LC 3VR2A 3CMEA 1SFOH 4KHPQ 1LTLA 3I7FA 3CCUA 1V1QA 4OX9Q 4OO1G 1UE6A 4DR6Q 1QVFA 5IYCH 2BA1A 4JVYA 2UU9L 2UUBL 2MO0A 3UE0A 1VQOA 3PCOB 5GAEC 4EQ5A 2WAQE 1P16A 2R93H 1YNJC 3NELA 3ULJA 1NMGA 2BE5D 2D5DA 3CC4A 2A6EC 1Y1WG 4GNXB 2JEAI 4HIKA 2VUMG 1XNQL 4JVHA 2CQOA 2BH2A 4HJ8A 1G6PA 4KMUC 2PQAA 5LMUQ 4IFDJ 3A74A 2HIXA 3PSIA 4BBSG 2LXJA 1WYDA 3T1HQ 2ZT9C 1PYSB 2D62A 5KNCA 1AE2A 3M4YA 4DR4L 4QMFB 2L5TA 2VZAA 4TVAB 4H44C 1BKBA 4HR7B 3T1YL 4A3IG 1N33Q 1AE3A 3RR5A 3GDEA 2Y0SG 4A3KH 1UEBA 4JI4Q 1D8LA 2BA0A 3A7LA 1N34L 3S15H 1ZZKA 1ZYRC 1YNXA 3RN5A 2F1MA 2OCEA 3E9IA 2PI2E 1LACA 2ZJQA 1W2BA 5K36G 2E2IH 3CF5A 3OOCA 1K1GA 1X3EA 1VQHA 3CCJA 2PCFB 4JI8Q 2EJFC 2EVBA 1SMYC 3AEVB 5IT9c 4WJ4A 1Q1EA 3P20A 1T9HA 1X4NA 4GOPB 2D2CC 1CUKA 1PH5A 4IPCA 4PZ6A 1B8AA 1IW7D 2IX0A 1X3FA 3PV0A 1Y1VG 1YNNC 1UE7A 2HHHL 4DK0A 4BY1G 4DV0Q 1TWAH 1WVNA 1I6HH 4NB3A 4JI3Q 4GN5A 4A3GH 5LMNW 4LF9Q 1EQRA 3IFTA 4B3TQ 4NXML 2Q2HA 2N49A 3M4PA 4IFDH 1KRTA 2L15A 2RF4A 4KI0A 3F1ZA 3HOXH 1S3OA 1Q8KA 2UXBQ 3RLOA 2KCMA 2CFMA 3M9BA 1E22A 1LUZA 4GLVB 5IYCG 2CTEA 1CSQA 3ULPA 4PZ8A 4DV4Q 1VQNA 2R93G 1B7YB 2D0OA 1E2ZA 2VNUD 4DV2L 1EQQA 1H9RA 4P72A 4GNXC 4DV5Q 3S1RH 2JXMB 4WANA 4C3HH 2B29A 3S14H 1C7YA 3CCVA 1JMCA 3J80i 4JI7L 3H3VH 2PI2A 1CKNB 2EJMA 3M3YH 3GQBA 1YIJA 3UDGA 4DR7Q 1UE1A 4AQYQ 1I94Q 3OW2A 4QJFA 3KOJA 2KHJA 5GAHC 4LUVA 3KJPA 1TWHH 2EXDA 4FDBA 1VQ7A 3FHWA 4LF7L 1K8MA 1TKWB 1Q82C 2YU9H 3A8JE 1PYBA 4UPAA 4A3KG 4DV3Q 1YITA 1FJGL 1B9NA 4DUYL 2A69D 4R4IA 2R92H 1E24A 3MXNB 4AYBG 3S1MH 2AUKA 4QL5A 1IBKQ 3PO2H 4JBMA 2DGRA 2BH8A 4GKKL 4LF8L 2VY3A 5IYBH 4TQUS 1GVPA 4G7HC 3I4OA 2FMRA 3HOZH 3J7A5 4RG1A 4A75A 2E5LL 3LGJA 4YWMA 4GOPC 2PY9A 1PH8A 3TZUA 1WJJA 5C44H 2Y0SE 3RLFA 4B3MQ 3GTGH 4R4TA 4A76A 4KN7C 2WB1E 4C2MH 1XMQL 4A3GG 3SDZA 2PQUA 3G71A 3PF5A 1QVGA 3CQZH 5FLXc 1GKHA 2MJHA 3NEMA 5JJLA 1J4WA 2Q8IB 2VQFL 4IFDG
chains in the Genus database with same CATH superfamily
3HOXG 1O7LA 2Q8TA 1OXUA 3A0JA 1HFGA 5IT9L 3PIOA 5LL6X 2K33A 1O80A 1VQDA 1BO0A 3NPPA 4K8IA 1J5KA 1JJ2A 1SMXA 4LF5L 2R7FA 2M8WA 4YHHQ 4XTCS 1SFOB 2QEXA 3KJOA 2F0KA 2ZTCA 1Q1BA 1QOHA 4R8NA 3LX0A 1C8CA 2UUAL 3EROA 2UU9H 3T1YQ 2UUBH 1PZKD 3IAYA 4K0KL 3PF4A 4X65H 4DR2Q 2CWAA 1CQFA 3KF6B 3LNNA 2UUCQ 2A19A 1N34Q 1Q8IA 4JI5H 3E9HA 1EY9A 1SBBB 4DNRB 5H1SE 2VW9A 2MO1A 5JVH3 1VF5C 1IBLL 5C0XI 1BCPB 3N6RA 2R93B 4B3RQ 1A0IA 4C3HG 4YIJA 3J80E 1WTWA 3FEWX 4JBKA 1IHZA 1CKNA 1VMCA 2E76C 3GTLH 1XTDA 1WVLA 1E1TA 4OHJA 2O4CA 4L5SA 3P1HA 3U50C 2YTXA 3PIO3 1SE4A 1II3A 4UY8C 1OXTA 1KTKA 4DR1Q 1D6EC 1A2TA 2B2WC 4NP5A 4F87A 1KHMA 2E2HH 5KGUA 3DMUA 3NENA 1MIUA 3TBIB 1LTRD 3MXGA 2XWJB 4GZYC 4JCVE 1HPCA 1I50H 3T4AC 2NZ1D 1CZGA 3GABA 1ENAA 2QGQA 4DNTB 3VKEA 1N36L 5JPMC 5C3EH 3IRBA 1NY4A 3KF8B 4IALA 3H91A 4OO1I 1IYVA 2HCCA 3MEHA 4ZAIA 1X3PA 2XVSA 4KJNA 4NW2A 3SVMA 3T51B 2N88A 1A6XA 2CH4W 5CV7A 3NTHA 5FLMH 2L55A 2MQHA 1TY2A 3G6EA 5D65A 1TWCH 3MXNA 4ME3A 1EQTA 1GUOA 1F9PA 3GTQH 2R92G 1B70B 1PTOF 4A3KB 2OPVA 1FNVA 1LTTD 1MJEA 1CA5A 1V8CA 2NN6G 3QWNA 3OWFA 3HOUH 3PO2G 3S15B 1TT2A 1ZKOA 5F2DA 5GROA 1SNPA 4LFAL 3RD4A 5DNFA 1JWMD 1PA6A 4A3JH 2E2JH 1A15A 3MXUA 2E75C 2SNSA 4RGNA 2ZM6L 3DWAA 2E2IB 4AYBB 1F2LA 5IYBG 3KDKA 5DEHA 4QMGA 5A2QE 2XGTA 1I4XA 3M85A 3HOZG 3FVQA 2ATWA 3JAMi 2KCTA 1LTBD 3AU7A 5FK9C 3T53B 3DM1A 3BVGA 1AW7A 2Z6KC 2OTLA 3HOVH 1TVXA 2F3VA 5EPKA 1KQSA 1NR4A 5C44G 3CXCA 4LWCA 1L1OB 3AFPA 3DWPA 1S5FD 1S4ZA 2VS1A 2PZTA 1JCKB 2F0WA 4BA2I 1SE3A 1F77A 2OEOA 3KLRA 1MGSA 1W6JA 4DR5Q 1NMFA 1CA6A 3DLLA 4IJHA 1VDZA 2HHHH 4OEMB 1ENCA 3PMFA 4DV7L 1HUNA 1VQMA 5J22A 3OPOA 3BDCA 5HY6A 2WINB 1R9TH 1DXMA 1TWAB 4PMBA 4HJAA 1KLUD 4FF4A 1KLGD 3MFGA 1GM5A 3AFQA 1I6HB 4GN4B 1ZZIA 1PDQA 1XNRL 2ICIA 4X65L 1F2MA 2VB3X 4A3GB 1XTCD 1KIXA 2K50A 4JI5L 1XMOL 3OMCA 1EY4A 3J81i 2IHEA 4IUTA 2CCZA 2ENBA 1O7IA 1PZID 1N32L 2QDBA 1IKLA 2B2YA 4EGVA 2UXDQ 4MTNA 3HOXB 2H1EA 4NXNQ 1I5FA 5ELOA 1LLRD 1Y14B 4JBJA 1BOSA 3GO5A 1ESFA 3C1EA 3S24A 4LK1C 4C3JB 3BG3A 3KDGA 3WWVA 2YYZA 4GKJL 3U1KA 5HGQA 1OXXK 3T56B 1TWFB 4U68A 1F0XA 1BBUA 3VA7A 5E7NA 4RAUC 3KF6A 1LTGD 2VB2X 2JA8B 1LYLA 4LFBQ 4NDXA 2ZJRA 2EY6A 5KRUA 1NTGA 3IFDA 1PLFA 1BCPC 4YCUA 4DV2H 2RBMA 1IW7C 4P2CB 4KHVA 4LNQA 2MJ8A 3I55A 2RHQB 4FP5D 3E5SA 5IWAH 4P75A 5LL6b 2EYOA 1V1PB 2CKZB 2A68D 2F0OA 1BF4A 3S1RB 4DK3C 2AMCB 5BR8Q 4PMCA 1C0AA 2PO4A 1V43A 1UE5A 4KD4A 1VQKA 1SAPA 4NZTM 3NHHA 3OMGA 4C3HB 1CHQD 5IE8A 4JI7H 1PQXA 1B9MA 4WORA 3S14B 4QIWB 4CGYB 2N55A 3NBHB 3I90A 1GHKA 3LWUA 1PH1A 4JOIC 5DM73 1F2YA 2LSSA 3V96A 5BN3A 3GTOH 1HNZQ 5GADC 5JJIA 4B8TA 2F3IA 1R4QB 3M3YB 2E5LQ 4PQXA 2F03A 1J5EH 1YNJD 3KF8A 1EZ8A 2MHVA 1RCVD 1AP0A 5C3EG 1EFWA 2K5WA 3DWQA 4H8AA 1M90C 5LMNQ 4JI1H 5BN4A 4DGZA 5M3FH 4LF7H 4FNFA 2KCCA 2KHIA 4DAPA 2CWFA 2K05A 5C5MA 1TWHB 3TRZA 1PVOA 3QB3A 4C56C 5IGBA 2HDLA 5FLMG 2OXPA 1TS3A 3KLSX 2YU9B 3UDXA 3GV3A 1AN8A 4KN4C 1G6ZA 1V9PA 5CMDA 4JV5Q 1XMQQ 1VF7A 2C9OA 1PTOD 2KVMA 5IOCA 4OXPA 3HZXA 4RFBA 2F52A 4OONA 2AWOA 1C4QA 1PH6A 1G2TA 3HOUG 4DUYH 1C9OA 2ZJPA 3HKZG 1YVCA 2F0FA 1F9RA 5T1IA 3WDNA 3FDTA 1JICA 5AJ3Q 4DR3Q 4A3JG 4OWXB 2R92B 4X64H 2KCNA 1CQVA 1CKMA 3S1MB 3JAME 3PO2B 1SN8A 2ANNA 2CW0C 2JZXA 3EBEA 5JEAJ 2KENA 2O5JC 3JAMc 1N8RC 4AIMA 4GKKH 2OF1A 1B4OA 3D8GA 4LF8H 3TP6A 3CCLA 4BWGB 2V4DA 1TIID 4LUZA 1DCZA 1A8VA 3KLWA 3KLSA 1E1OA 5KNDA 1U9RA 2WKDA 2I5HA 1PH4A 2B63H 3HOVG 1L1OA 3EIVA 3ZJYC 1NJIC 5JAVA 3HOZB 4DUZQ 4L5QA 2YQRA 1L1OC 1ZYRD 2AQ1B 1Q12A 1SE8A 2DNCA 1J6QA 1QWYA 4DV1H 1F2ZA 4ULLA 4HSVA 1V1OA 1HNXQ 4AM3A 2B2TA 1KRSA 1NUCA 4R4CA 4HEDA 1S40A 4PZ7A 2UUAQ 4LF6Q 2B2TC 4C3JH 2IPKD 1PFNA 5C44B 1HNWH 1N9WA 1VQEA 4K0KQ 4X62L 4JG2A 1D5MC 3QR8A 2TSSA 1TWFH 1PFSA 4BXXH 2YV5A 2R7ZH 4JI2Q 2SEBD 1YJ9A 1DOMA 3GTGB 4HTHA 4RHSA 2O4XA 5ELBA 4CDDC 2B8GA 2QKIC 1IBLQ 3ND8A 4YCVA 5IODA 2JA8H 2LFNA 1NE3A 4C2MB 4CBVA 4EQNA 4RMFA 2XIWA 4EQOA 3J7AF 5IT9W 2HUGA 1UWVA 2JQOA 5I6WA 1W3SA 2L9HA 4QB4A 5ELFA 1XPRA 4XYQA 4YY3Q 4IZ8A 4EX5A 1IL2A 5M5WH 3J81c 5I6YA 4GNXA 2NTSA 3CQZB 2RSOA 4B3SL 2F4VQ 2RCNA 1EOVA 2OPUA 4DK1A 4LF4L 4MN3A 2V1CC 4XQNA 4KTAA 5IWAL 1YNND 4OIJA 4N9PA 3EFXD 1XRHA 2JN4A 1HTLD 2JK8A 4LFCH 1TS5A 2OT2A 4KHPL 3FKIH 3VYRA 4XQJA 4A3EH 2Z4HA 2PPBC 4OX9L 1JC7A 4JI0Q 4DR6L 4LF5H 4KKTA 3GV6A 4A4IA 1VQJA 4J15A 1N36Q 2PT7G 1JOQA 3OETA 1B3AA 1GUTA 4MTKA 1J5EL 4FJSA 1HH2P 3VR6A 4DN4M 1QZHA 2Q2TA 2CTMA 4K6DA 1FKAH 1EYAA 1X55A 4X66Q 4JI1L 2F0EA 3MZ5A 2K5QA 2JP1A 2F0HA 2A74C 4DK6C 1CFMA 4J1MA 4OCHA 1IBMH 1JWSD 3VR5A 2A1SA 1GOZA 2O5IC 3JC66 2GN5A 2O2LD 1K28A 1HZBA 5CBAE 1EL0A 3NUCA 1BXTA 3PGZA 4HIDA 3OTOQ 5JOBA 1VQ6A 1LT4D 3SK4A 5LMUL 5I9OA 2I0QA 2PYKA 3S1NH 1JOOA 5BN5A 1SDFA 2ZM6Q 4GN3B 3QOLA 3AMUA 4FF1A 3GTLB 3T1HL 3H3VC 5JEAH 4DKAC 5CBEE 5I9PA 5C4ZA 2EXZA 4M8AA 3M4QA 4X64L 2NN6H 4HIMA 1PH7A 2ALYB 1RD9D 2CVRA 3AEVA 1DZ1A 4B9WA 5IP9H 1H9SB 3VYSA 1RTOA 4MNOA 1YI2A 2E2HB 3I2ZA 1GUGA 5M3FG 4IPGA 1DTJA 3J81W 3CCQA 2KA7A 4BY7H 4B8CD 1I50B 1N33L 4GOPA 3HEJA 1LT3D 2K4KA 5C3EB 2WFWA 3HOYH 5E1FA 1HQRD 4X6AH 3GKUA 1M1KC 5KIXA 4DV1L 2LMCB 2IY5B 4AH6A 4A3BH 3D31A 5EAYA 1PRTB 1U4MA 4HJ5A 1DONA 3RNUA 2F0SA 2UU9Q 1TWCB 4E6IA 2UUBQ 1HNWL 2ZXOA 3OW7A 2FINB 4G7ZC 4CDEC 4KJOA 1P8LA 3GTPH 3K0YA 2Q2IA 4RCOA 3EN2A 1EYGA 4X65Q 2HD3A 3MC0B 2A5HA 3KBXA 2R7DA 2K7VA 5CV9A 4JI8L 1VIGA 4LFAH 1JB3A 1H9KA 4LUOA 4JI5Q 3HOUB 2JJQA 3A5UA 3HKZB 2YTYA 4JC0A 3H15A 3H3VI 5ELDA 4GS3A 3HRZC 1U5KA 2A8VA 2EPBA 4A3JB 1Z6HA 2E2JB 2QNDA 3G7LA 1AZPA 1K3BC 1MKHA 3S1QH 3TS2A 1H95A 3MEFA 1XNQQ 2NWGA 4PG3A 1ESRA 4POGA 2B63G 1ODHA 3TS0A 1EY8A 4HCSA 3C3LA 1HFNA 3MXPA 1H9JA 2RDHA 1X3QA 3V05A 1CHPD 5EKKA 1AN7A 2WP8J 2JE6I 1Y8PB 4XDXA 5AFWA 1GJXA 2C35B 4CKCA 2EIFA 3HOVB 4LFCL 1Q86C 4A3CH 1WCMH 5IGCA 1X6OA 1K83B 1EIGA 4C3JG 5C4XH 1KD1C 1ENFA 1KL9A 1WHRA 5D14A 5FKAC 1E7ZA 2EYPA 1FGUA 1BUVT 3M7NA 4BXXG 2CTJA 2IWHA 1VQAA 2FXQA 4H13C 1B3QA 4ODGA 2R7ZG 4GLAC 1K73C 3HKZE 1K8GA 2KOLA 2XTIA 4RWSC 2FJ2A 1STHA 4DV7H 4DR4Q 2JA8G 2LXKA 3S9WA 4LF9L 1ZEQX 4LIJA 5CV4A 5M5YH 1OXVA 2RKSA 4B3TL 1B50A 1KNEA 1R9TB 3PQIA 1L0WA 1XNRH 3W1BA 3AYHB 1MD2D 4KY5A 2ZXPA 4POFA 1IBML 1XMOH 1E2VA 1M8AA 3I72A 4ZUIA 1B2TA 3I4NH 4HAEA 2UXBL 1SYCA 2K5NA 4JPBW 2CPMA 2NBFA 1N32H 2BDNA 5FO9B 3FKIG 4A3EG 2NVTH 3J80c 1QCBD 4UP9A 4ZUJA 3SGIA 4K2LA 4RHRA 4ILWA 1TUAA 2CTLA 1PH2A 1SNCA 2E74C 2ID0A 3CPFA 4CJ2C 2B2WA 2JA9A 2NZHA 2X69A 3OHXC 4DNIA 2RDFA 2JYOA 3KUPA 4GKJH 3L2PA 1NAPA 3O13A 4XYOA 2E3UA 4WALA 3KYHC 3OIPA 5IP7H 2H5XA 2OTJA 2SDFA 2F0PA 5FLXW 3W5OA 1HR0W 1TY0A 4XQQA 3MFYA 2CWHA 2LS01 2NVXH 3STBC 4DV5L 4DFAA 1WFQA 1SYFA 4Y52H 3Q8DA 1TU2B 5M5XH 1SJHD 1YEZA 3ERQA 3FP9A 2HHHQ 4KY7A 3UI2A 5D3DA 2ZTDA 5EKIA 3BZCA 1PH9A 3DEPA 1HR0H 3OYYA 1JQYD 3J81L 1ASZA 2NVQH 5JEAG 4ZCKA 3TREA 4DAMA 1VS0A 3U4VA 5EJWA 4KY6A 1BNZA 4A3LH 2DY7A 2KHSA 4AQYL 3VYTA 1I94L 2NTTA 1H9SA 2H4OA 5IP9G 1QUQB 4C3IH 1YHQA 4DV6H 4NXMQ 3OWEB 1ONLA 4H7BA 3GTOB 4OD6A 3BZKA 1BCPF 4TKOB 1RDPD 1GHJA 2R61A 4QCLA 1STBA 1WTRA 5EPJA 3GP7A 3NBIA 3W1GA 3C46A 2BE5C 4BY7G 4Q0FA 4X3KA 4L63B 3K5MA 2JA5H 4HMJA 4KHZA 3T16A 2EE1A 2Z6KA 1JE5A 2L0CA 1K3RA 3HOYG 5M3FB 3F2BA 4DV3L 4PV1C 4R9WA 4A3BG 1K83H 1PRTC 2PNHA 1EY0A 3J80W 1DYQA 3U58A 1XPUA 2XNAC 2G8YA 5C6AA 2MPMA 3D4RA 3PUYA 1HZ9A 3ULLA 3BYYB 2BOSA 3BU2A 3X3MA 2HH2A 2VQEH 3K0XA 1VQ8A 4QGUA 4AYBE 3N52A 1SRUA 4DV2Q 1WI5A 3NCVA 1RJTA 5G3LF 3BJUA 1GUWA 1DM0B 3FAUA 3R2IA 2AWNA 2F0IA 1CT1D 2K01A 1EIYB 5IWAQ 1D2BA 1Y8OB 4JI6H 1I4RA 1O78A 4WJ3M 4G7OC 2UXCH 1LTID 2R3ZA 1YJNA 2F0VA 2A68C 2EJGC 1RL2A 2OQ0A 4R4OA 1CK1A 5IGEA 4ZK9B 1BBWA 3I56A 3HFZB 4JI7Q 1Z47A 1L0XB 1PTOH 3NP8A 4R4QA 3S17H 1SXTA 5CORA 2B63B 4JK1C 4A3CG 1WCMG 4J6HA 1FD7D 4I65A 1GO3E 5C4XG 2AHOB 4B3ML 1YHBA 4ZKCB 2AXYA 1HTPA 4K5XA 2K5VA 4ME5A 1J5EQ 4YCWA 2AUJD 4KLKA 3K81C 3CRLC 3UOEA 4RGTA 1PFMA 4JYAH 3HOWG 4RKBA 1CI3M 4X62H 4JI1Q 2IX3A 2K5HA 4LF7Q 5DAUA 1W6KA 3CCEA 2OQKA 3DXJC 2PMZB 2K6AA 2L4NA 3D0FA 3MA2B 2R7ZB 5GQOA 1LV9A 4FYDA 1U4LA 5J1ZA 4O1NA 1Z9FA 3OSSD 1VQFA 5EKLA 1SE2A 2SNMA 4FXGC 5A2QW 3QOJA 2HIVA 5CV8A 3L7ZC 1SEIA 4B3SH 1FJGQ 2A6HD 4JVZA 2DY8A 3I4NG 3TMEA 3OIQA 3K80C 3Q22A 4DUYQ 5M5WB 3M4OH 1HRJA 4LF4H 4Y7NH 1D1KA 1B53A 1K8OA 1RKNA 5C3WA 5IGDA 5TSSA 5FLXL 4X64Q 1S5DD 3I4LA 1HR0L 4A3DH 3KDFB 4KKUA 4KHPH 1X65A 5EBCA 4KKSA 5IGFA 1A63A 4YHHL 1K8AC 1ZTGA 5E3FA 3TEHB 1RIPA 3FKIB 4JOIA 4OX9H 2NZOA 3M7GA 2F0TA 2PMZE 4A3EB 3DEOA 2A73B 4GKKQ 4DR6H 3NXWA 5A35A 4LF8Q 2YTVA 3OSOA 2GVBA 3S2HH 5IP7G 4DV6L 1L2FA 2IX1A 1LT5D 1OO9B 2EOTA 1PV4A 4DR2L 4C1NK 2EZVA 2WV6D 1WTOA 1G291 1MHWC 2UUCL 2EQSA 4DV1Q 2A6ED 2K28A 3RLNA 4IN3A 1DOLA 4B3RL 2ANRA 2QF7A 2VXWA 3RZOH 3ND9A 2WB1G 2MGSA 4A3FH 4FXDA 1HNWQ 4IUNA 3DM3A 1JT8A 3TZDA 3GTMH 2IHFA 4APVA 2B39A 2EY2A 3CD6A 2Q8RE 3QJYA 5IT9E 3E6ZX 1STYA 4HSPA 5LMUH 1SNMA 3I0PA 4QIWE 4A3LG 1RODA 4DR1L 3FMCA 4FXKC 2B2VA 3R93A 2C5CA 2MFIA 2F0GA 4OGQC 3P7JA 1TXYA 1QUQA 1I4PA 3S1NB 1UAPA 5FJ8H 3T1HH 2OWOA 2B2VC 4IQZA 3J7AK 2VQEL 1HJPA 2HH3A 1EU4A 2QEJC 2I46A 4C3IG 4HJ7A 2B3GA 1WTHA 2VQFQ 3CC7A 3EQLC 3J80L 1S5BD 4WJWA 1BCPD 1VIHA 4LFBH 5IGGA 3H94A 4HJ9A 4IURA 4K2KA 3QG1A 4JI6L 2JA5G 1ET9A 1VQBA 3H0GH 2IT1A 2UXCL 2P2RA 1NBWA 2I5MX 4J8QA 4LFCQ 4FJUA 2B8FA 3TQYA 3BVZA 1AEXA 3ER0A 3WOEA 1KDAA 1N33H 1YBYA 3K59A 4BY7B 2ZXRA 3DHQA 4IJLA 4LF5Q 2CWPA 2JA7H 4JI4H 2F4IA 1OXSC 1IXRA 1GUSA 1MSZA 3F2CA 4P71A 4NBQA 1VMPA 3HOYB 2DGYA 4IO9A 5COYA 2Z9HA 4A3MH 4A3BB 3TSSA 2XWBB 4E9JA 2CPQA 3HGBA 1DOKA 2ASBA 4JYAL 1A3VA 1SYEA 5T1GA 1X56A 1SMYD 3KK7A 5JJKA 5G3LD 5C0XJ 3K57A 3GTPB 5KNBA 1GUNA 4JI8H 1VQ4A 1H9MA 4IPDA 4IOAA 1SROA 1IBMQ 3K7AH 1V9NA 4PMWA 5IYDH 3GTKH 4XIGS 3FPUB 2Y3MA 4Z9CB 3D4DA 4ZKBB 1IL8A 1EUJA 1ZXTA 4H02A 3CPWA 1I4HA 4HMIA 2XN9C 4TSSA 1E2WA 1XPOA 1AH9A 3I8ZA 3S1QB 1FVIA 4YWLA 4QUFA 2AKWB 1DGSA 4N8X1 1BDOA 1Q81C 3S16H 4FF3A 3A7AB 3CKIB 3UDFA 1FNWA 3VA5A 3PUWA 2R6GA 3E0JA 3PUVA 2A69C 4X3UA 1EC6A 4Q5VA 3BYTB 4DR5L 4JW0A 4RH6A 3K5NA 2QCPX 5A2QL 3MWYW 2Q2UA 4DV0H 1TWGH 4O2DA 1WE8A 4R1JA 4NPSA 4OIKA 2M6QA 1B1ZA 1WCMB 4IPHA 2JSOA 2A1AA 2E8GA 4QF4A 5JJZA 2KBNA 1XXGA 5C4XB 2JA6H 5C4JH 3A8KE 1G2SA 1F9QA 4JI3H 4UP7A 1FL0A 2P5ZX 1K9MC 5GAGC 2CTKA 4ZYSA 4BBRH 2LY7A 3ERSX 1IKMA 1AFPA 1Y69U 2M2LA 4B9XA 4G08A 4LF9H 3HOWB 1BVSA 3JAMW 1V8QA 1T5EA 4B3TH 3PO3H 5CYUA 4I7ZC 1B44D 5M5YB 1ICWA 3IL8A 2HQLA 4NKLA 3EVQA 4DU9A 3EZJA 1V1PA 4NZRM 3ONAB 2L12A 4S3SA 3A8IE 3KDFA 5ELNA 1UEAB 3TDQA 2UXDL 1EYDA 1I3QH 1DJRD 2J7ZA 3A56A 4A3DG 2UXBH 4LF6H 4NXNL 4LFAQ 4QQBX 4CJ0B 3I4NB 1S20A 1IYJB 3H09A 1SLJA 1KDCA 3NSWA 3NBHA 1VQPA 2HDMA 1SYDA 4L5TA 3TP8A 5J39A 3I4MH 3G4SA 2GVAA 1X32A 2ZQEA 3TP5A 4IFDI 2NVTB 1LT6D 1CTMA 3TP7A 3VYUA 4RGMA 1Z7TA 2K14A 3NQTA 1KXLA 3T13A 4DV4H 1I6VC 1QILA 2JEBI 2WKCA 3RN2A 4L5RC 1HA5A 4LFBL 1KAWA 2DN8A 2FHTA 2ZTEA 3PUXA 2HT1A 1U0LA 1X54A 3R8BA 1VQLA 3G48A 5KYIA 3AB9A 3ITPA 3U9SA 4WRDA 4F8MA 1KAAA 4A3FG 3RUZA 3U4ZA 4DV5H 3LWEA 4DXGA 1ASYA 1JJCB 4CHTB 1HQMC 3SHLA 3CW2C 2F0DA 2NVXB 4HCEA 4GLXA 1YZ6A 5BR8L 4JI4L 1MJCA 4BA1I 3UE1A 2N78A 2Z0SA 3PUZA 4DV7Q 5M5XB 4UDUC 2WB1B 3CP0A 5C0XH 2NVYH 1S03G 4JI0H 2FPHX 2WAQG 3A5ZB 3I73A 5FJ8G 4CDCC 5CGKA 5FOBB 1HNZL 2G9HD 2NVQB 4DR7H 1STNA 1ZZJA 1XNRQ 1Q46A 4AQYH 1QE6A 1SEBD 4UAIA 5NUCA 2MNAA 1WTXA 1I94H 3WOFA 2K32A 4A93H 3D6CA 4MZ9A 5M3MH 1LM0A 2KECA 1XMOQ 2M9VA 1Y8NB 1HCZA 5LMNL 4ID6A 1VQIA 2G5DA 4UP8A 1EWIA 1EYCA 3CRKC 3H0GG 4N8FA 4LJZC 4C3IB 1PMRA 2I5LX 1HZAA 1N32Q 4K14A 4L6TB 4P73A 2ICEC 3RZDH 4DXFA 1STGA 1XJVA 2RHSB 1KC8C 1IYUA 2JA7G 2RSNA 4QY7A 4IOCA 2JA5B 1QNUA 4JV5L 3QIAA 4DV3H 3FRPB 3S2DH 1C48A 3NTIA 4OO1H 2EYHA 1KABA 4GKJQ 2BDOA 3VR3A 1EFID 1G8ZD 2DJGC 4A3MG 4DV0L 1KHIA 3P75A 1CZWA 5AJ3L 4DR3L 4MHEA 2KEEA 4FO2A 4O0AA 1IBKH 3BDLA 3KFUA 3PIPA 3CCMA 4M1UB 1Q90A 4JI3L 1WTJA 1BBXC 1E3PA 1G51A 1JJGA 4L8JA 2QA4A 5FO8B 3HOWH 2FFKB 5IYDG 3CC2A 3B6YA 5LHY1 4BS9A 1Y1WH 1IZ6A 2D0PA 1UNSA 2VUMH 2PW5A 3MTSA 1AZQA 4DAYB 1X4MA 2ES2A 2MP1A 5I2YA 1XX8A 1HR0Q 5C4HA 2CTFA 2NN6I 4DUZL 2NB0A 1CKOA 1A62A 1PRTF 2NUCA 3NWSA 1D1IA 4KV6A 3CCRA 2DNEA 2PQAB 1K0RA 2SOBA 1HNXL 1ICFB 3CCSA 4YWKA 1VQCA 2K52A 4BBSH 2PQEA 4LF6L 1X3GA 3F8TA 1PTOB 3JAML 4ZLTF 3CHBD 1LABA 3L9AX 1S72A 3S17B 4DV6Q 3GR5A 4B3MH 1Q3LA 1HZCA 1NSNS 4OL7A 2JA6G 4JI2L 5KYLA 1X9NA 3K5LA 4R8IA 1QJOA 1WOCA 2M00A 4DPGA 4BBRG 5CC4A 4DV4L 3K7UC 4XXEA 2CQAA 4LMQD 3PIP3 4XT1B 1PHJA 3AQQA 1XNQH 4YY3L 4A3IH 2BL5A 3PO3G 4OWTB 2F4VL 5IY0A 5J3BA 3VDYA 2D9UA 1J8IA 1NCVA 1YHAA 2QW7A 4EC5A 4LAAA 1VQ9A 3G6JB 2LRRA 4P74A 3SE0A 4FF2A 4FVMA 4X3SA 3KBGA 2F0JA 4WFN3 2VQEQ 3V2TA 3SB1A 2HCIA 5K36H 2GA4B 3RF2A 3M4OB 1J9OA 2XRQD 4Y7NB 2N3SA 3I4MG 2FMMA 4JI0L 3Q0AA 4JBWA 1EY7A 5DLQE 3V69A 1JB7A 4A3DB 4YHHH 4DR7L 4DR4H 2PNRC 4JI6Q 3SK8A 3HKSA 1Q7YC 3J7ZC 2UXCQ 3E0EA 3EA6A 1VBIA 2FMCA 4LW1A 1L0YB 4HIOA 3T1YH 2VL6A 2J4XA 3ICEA 1VQGA 4X66L 1T5XD 1FYCA 3S2HB 4DR2H 3NQIA 3SEBA 3BDOA 1EWCA 4RKLA 2K75A 2DUDA 2UUCH 1N34H 1MSGA 5ELEA 3VR4A 1MSHA 2AQ2B 2K04A 1VCIA 1ML0D 3FPPA 1Y1VH 3UDIA 4B3RH 1SNDA 2N8NA 1OTCA 2EDGA 2WIIB 3OTOL 3GTJH 3K58A 4BY1H 1DT4A 4OWWB 3RZOB 4F7XA 1GD7A 4JYAQ 5C0XG 4X62Q 4A3FB 3J81j 1PH3A 5E4XA 2K1HA 1CSPA 4DA2A 1EQVA 4RCNA 5ISRA 1YJWA 1QVCA 3GTMB 1SR3A 4DR1H 1QZGA 3NE5B 4ALPA 3GD7A 3SK6A 1IBKL 4DF7A 1EIFA 3IKJA 3K5OA 1EY5A 2RQXA 2JVZA 2CH4A 3K8AA 3W3AA 3Q24A 4A93G 2WAQB 5M3MG 1VQ5A 1FR3A 3STBD 4B3SQ 2KJXA 3CAMA 3F2DA 3L0OA 1EWHA 4LF4Q 4OELB 2A6HC 1E0BA 1DD2A 1D7QA 1S5ED 3CMAA 4H0LC 2X6LA 3VR2A 3CMEA 1SFOH 4KHPQ 1LTLA 3H0GB 3F2UA 3I7FA 1LO5D 3CCUA 1V1QA 2HQEA 4OX9Q 4OO1G 1UE6A 4DR6Q 1QVFA 5IYCH 2BA1A 4JVYA 2UU9L 2UUBL 4KD3A 2JA7B 3SK5A 2MO0A 3D6WA 4NMZA 3UE0A 3PCOB 1VQOA 5GAEC 4KK7A 5LL6S 3U9OA 4EQ5A 2WAQE 1P16A 4ZRZA 2R93H 3MHBA 4NXMH 1YNJC 1BQQT 4A3MB 2L1BA 3NELA 3ULJA 1NMGA 2LTLA 2BE5D 1MI2A 2D5DA 3CC4A 2A6EC 1Y1WG 4DAYA 4GNXB 3HG9A 5IIFA 2JEAI 2F0LA 4HIKA 2VUMG 1XNQL 4JVHA 4CKEA 4IUPA 2CQOA 2BH2A 4HJ8A 1G6PA 2B2YC 3K7AB 4KMUC 5DT9A 2PQAA 1I4GA 2Z4IA 3GTKB 5LMUQ 1PRTD 4IFDJ 1EIHA 1U4PA 2HIXA 3A74A 3PSIA 4BBSG 2LXJA 1WYDA 3ZYYX 1PTOC 3T1HQ 2EY1A 2ZT9C 2VKCA 4V0BA 2F0UA 3NK9A 5CR3A 1PYSB 2D62A 4QUCA 5KNCA 3S16B 4O42A 5EPLA 4DR5H 1AE2A 2G9DA 3W2DA 4N9TA 1SNOA 3M4YA 2Z8LA 2L11A 4DR4L 3L3OC 4QMFB 2L5TA 2VZAA 1TWGB 2IL8A 4TVAB 4H44C 1BKBA 2EYFA 1WD1A 4HR7B 3T1YL 1K0SA 3C1FA 2JA6B 1KNAA 1SYBA 4X3TA 5C4JB 4A3IG 1N33Q 1AE3A 3RR5A 1ILPA 1KDBA 3GDEA 2Y0SG 4A3KH 1UEBA 4JI4Q 3X3NA 1D8LA 4BBRB 2BA0A 2LF0A 3A7LA 1N34L 5JPNC 1JE4A 1FNUA 3S15H 1ZZKA 5I4DA 1ZYRC 1PXUA 1YNXA 1STAA 1BR9A 2F1MA 2OCEA 3E9IA 4EVOA 2PI2E 3RN5A 3PO3B 5C5LA 1LACA 5I2XA 1SSOA 2ZJQA 2F0MA 1W2BA 3D4WA 3A55A 2E2IH 5K36G 2UXDH 3CF5A 3OOCA 1K1GA 2QILA 1X3EA 1VQHA 5K5PA 4NXNH 1I3QB 3CCJA 1RF2D 2AQ3B 2PCFB 4JI8Q 2EJFC 2RDGA 2EVBA 1SMYC 2EYJA 3AEVB 1EOTA 5IT9c 4WJ4A 3K6OA 1Q1EA 1LTAD 3P20A 2K1BA 3QO2A 2DJFC 3I4MB 4CJ1B 1T9HA 2KUMA 3BVMA 1X4NA 4UHVA 5C3XA 3R3OA 1XYIA 4RGOS 4GOPB 1RHPA 2D2CC 1CUKA 1PH5A 4IPCA 1EEID 4PZ6A 5HURA 3QD7X 1B8AA 1IW7D 2IX0A 3URYA 2LTMA 1EEFD 3I3CA 1FJGH 1X3FA 3PV0A 1Y1VG 1YNNC 1UE7A 1I4QA 2HHHL 4DK0A 4BY1G 4DV0Q 4CKBA 1WTQA 1TWAH 1WVNA 5BR8H 1I6HH 2XSCA 1A3UA 4NB3A 5D3IB 4JI3Q 1R4PB 1PYWD 4GN5A 4A3GH 3D3RA 1GXDC 1HUMA 4IUQA 5LMNW 4LF9Q 2NVYB 4U673 5E4WC 1TS2A 1NXUA 2X06A 1EQRA 1X0AA 2LKVA 1HNZH 3IFTA 2BCOA 2F0NA 4B3TQ 2Q2HA 2N49A 4NXML 2E5LH 3M4PA 5FO7B 4IFDH 1KRTA 2RCFA 3TN2A 4G57A 2L15A 1Z2IA 1NNXA 1G91A 4K5WA 4IUUA 2RF4A 4KI0A 3F1ZA 3HOXH 5LMNH 1S3OA 4A93B 1Q8KA 1HA6A 5M3MB 2UXBQ 1JR0D 1TS4A 3RLOA 2KCMA 2CFMA 1FGBD 3HP3A 5KEEA 4PDBA 3A54A 3RZDB 3M9BA 1E22A 1LUZA 1SYGA 2RA4A 4GLVB 5EQ0A 5IYCG 3J7AV 2EY5A 2MUYA 4JV5H 2PZUA 2CTEA 4EQPA 1CSQA 4F88A 1XMQH 3ULPA 1O7YA 4PZ8A 3RMHA 5EGTA 4DV4Q 1VQNA 2D9IA 4K6LA 1QG7A 3I91A 3J81E 3S2DB 2R93G 1PZJD 5CV6A 3C2PA 1B7YB 2D0OA 4DR3H 1E2ZA 2VNUD 2KEDA 1JORA 4DV2L 1EQQA 2VQFH 1H9RA 1WTPA 2CW0D 4P72A 4TRDA 4GNXC 1O7ZA 1CM9A 4DV5Q 3S1RH 5M9OA 1JWUD 2JXMB 4WANA 1UG8A 2CHBD 4C3HH 2B29A 3R2TA 2K03A 3S14H 4RA8A 4B08A 2I07B 1C7YA 1Y1WB 3CCVA 1JMCA 3J80i 4JI7L 3H3VH 2VUMB 2PI2A 1CKNB 4DUZH 2EJMA 2QDLA 3M3YH 1UUPA 3GQBA 2X6GA 1YIJA 3UDGA 4DR7Q 1HNXH 1QNKA 2Z6BA 1UE1A 4AQYQ 1I94Q 1JOKA 2UUAH 3OW2A 3EJIA 4QJFA 1MBYA 3KOJA 1WD0A 2KHJA 5GAHC 4LUVA 4BBSB 2B2UA 3KJPA 4K0KH 3Q6SA 1TWHH 2EXDA 2B2UC 4FDBA 3FHWA 1VQ7A 1A3TA 4LF7L 1TR5A 4JI2H 1K8MA 1TKWB 1HHVA 1Q82C 2YU9H 1PFBA 4V190 1IBLH 1HXYD 2NYZD 3A8JE 3H6MA 1PYBA 4UPAA 4A3KG 2EYLA 2TMPA 1S5CD 4YY3H 1WTVA 1D5ZC 1NR2A 4DV3Q 1SNQA 1X9ZA 1YITA 2Z1CA 4DAVA 4CDFC 1FJGL 1B9NA 2F4VH 1SJED 4A3IB 4DUYL 1U4RA 1ILQA 2A69D 4R4IA 2R92H 1QB5D 1E24A 2Y0SB 1F9SA 3MXNB 5CV5A 4AYBG 4I7AA 3S1MH 2AUKA 5EBDA 1EY6A 2IW3A 3J7YW 4QL5A 3HS0C 5HGTA 1IBKQ 3PO2H 2IJ0A 2F0QA 3E3XA 5L37A 1I6UA 4JBMA 1EZ6A 5DM63 2BH8A 2DGRA 4ZQ3A 4GKKL 4LF8L 4K5VA 2VY3A 2XRSD 5IYBH 1GVPA 4TQUS 1STEA 1XWEA 4MIUA 3I4OA 4G7HC 2FMRA 3HOZH 1N36H 3J7A5 4RG1A 4A75A 2KQ3A 3SXHA 2E5LL 3LGJA 4YWMA 4GOPC 2FFMA 3CU7A 2PY9A 2RVLA 3MVVA 4X66H 1TQOA 1PH8A 3TZUA 1D5XC 1WJJA 5C44H 5JVG3 3SR1A 3BS1A 2Y0SE 3DUZA 4PNYA 3I70A 4IUVA 2PW7A 3RLFA 4B3MQ 4G4KA 3GTGH 3GTQB 1A2UA 2K5DA 4XT3B 2J0TD 3MAQA 4HN7A 3OTOH 4R4TA 3Q23A 4A76A 4C1NI 2WB1E 4KN7C 1Y1VB 1M4VA 4C2MH 1XMQL 2E2DC 2WACA 4A3GG 3GTJB 2ZM6H 3SDZA 3NWTA 4BY1B 2PQUA 3G71A 5FLXE 5ELCA 3PF5A 3BZDB 1QVGA 3CQZH 5FLXc 2EYMA 2F3WA 4K8JA 3NTKA 1GKHA 1RTNA 2MJHA 3NEMA 2PZWA 5JJLA 1J4WA 2Q8IB 2VQFL 4IFDG 1ET6A 1EU3A 1LTSD 4ABNA
chains in the Genus database with same CATH topology
3HOXG 1O7LA 2Q8TA 1OXUA 3A0JA 1HFGA 5IT9L 3PIOA 5LL6X 2K33A 1O80A 1VQDA 1BO0A 3NPPA 4K8IA 1J5KA 1JJ2A 1SMXA 4LF5L 2R7FA 4YHHQ 4XTCS 1SFOB 2QEXA 3KJOA 2F0KA 2ZTCA 1Q1BA 1QOHA 4R8NA 3LX0A 1C8CA 2UUAL 3EROA 3T1YQ 1PZKD 3IAYA 4K0KL 3PF4A 4DR2Q 2CWAA 1CQFA 3KF6B 3LNNA 2UUCQ 2A19A 1N34Q 1Q8IA 4DNRB 1EY9A 1SBBB 3E9HA 5JVH3 5H1SE 2MO1A 2VW9A 1VF5C 1IBLL 5C0XI 1BCPB 3N6RA 2R93B 4B3RQ 4C3HG 1A0IA 4YIJA 3J80E 1WTWA 3FEWX 4JBKA 1IHZA 1CKNA 1VMCA 2E76C 3GTLH 1XTDA 1WVLA 4OHJA 1E1TA 4L5SA 3P1HA 3U50C 2YTXA 3PIO3 1SE4A 1II3A 4UY8C 1OXTA 1KTKA 4DR1Q 1D6EC 1A2TA 2B2WC 4NP5A 4F87A 1KHMA 2E2HH 5KGUA 3DMUA 3NENA 1MIUA 3TBIB 1LTRD 3MXGA 2XWJB 4GZYC 4JCVE 1HPCA 3T4AC 1I50H 2NZ1D 1CZGA 1ENAA 2QGQA 4DNTB 3VKEA 1N36L 5JPMC 5C3EH 3IRBA 1NY4A 3KF8B 4IALA 3H91A 4OO1I 1IYVA 2HCCA 3MEHA 4ZAIA 1X3PA 2XVSA 4KJNA 4NW2A 3SVMA 3T51B 2N88A 1A6XA 5CV7A 3NTHA 5FLMH 2L55A 2MQHA 1TY2A 3G6EA 5D65A 1TWCH 3MXNA 4ME3A 1EQTA 1GUOA 1F9PA 3GTQH 2R92G 1B70B 1PTOF 4A3KB 2OPVA 1FNVA 1LTTD 1MJEA 1CA5A 2NN6G 3QWNA 3OWFA 3HOUH 3PO2G 3S15B 1TT2A 1ZKOA 5F2DA 5GROA 1SNPA 4LFAL 3RD4A 5DNFA 1JWMD 1PA6A 4A3JH 2E2JH 1A15A 3MXUA 2E75C 4RGNA 2SNSA 2ZM6L 3DWAA 2E2IB 4AYBB 1F2LA 5IYBG 5DEHA 4QMGA 5A2QE 3M85A 1I4XA 2XGTA 3HOZG 3FVQA 2ATWA 3JAMi 2KCTA 1LTBD 3AU7A 5FK9C 3T53B 3DM1A 3BVGA 1AW7A 2Z6KC 2OTLA 3HOVH 1TVXA 2F3VA 5EPKA 1KQSA 1NR4A 5C44G 3CXCA 4LWCA 1L1OB 3DWPA 3AFPA 1S5FD 1S4ZA 2VS1A 2PZTA 1JCKB 2F0WA 4BA2I 1SE3A 1F77A 2OEOA 3KLRA 1MGSA 1W6JA 4DR5Q 1NMFA 1CA6A 3DLLA 4IJHA 1VDZA 1ENCA 3PMFA 4DV7L 1HUNA 1VQMA 5J22A 3OPOA 3BDCA 5HY6A 2WINB 1R9TH 1DXMA 1TWAB 4PMBA 4HJAA 1KLUD 4FF4A 1KLGD 3MFGA 1GM5A 1I6HB 3AFQA 4GN4B 1ZZIA 1PDQA 1XNRL 2ICIA 4X65L 1F2MA 2VB3X 4A3GB 1XTCD 1KIXA 2K50A 4JI5L 1XMOL 3OMCA 1EY4A 3J81i 2IHEA 4IUTA 2CCZA 2ENBA 1O7IA 1PZID 1N32L 2QDBA 1IKLA 2B2YA 4EGVA 2UXDQ 4MTNA 3HOXB 2H1EA 4NXNQ 1I5FA 5ELOA 1LLRD 1Y14B 4JBJA 1BOSA 3GO5A 1ESFA 3C1EA 3S24A 4LK1C 4C3JB 3BG3A 3WWVA 2YYZA 4GKJL 3U1KA 5HGQA 1OXXK 3T56B 1TWFB 4U68A 1BBUA 3VA7A 5E7NA 4RAUC 3KF6A 1LTGD 2VB2X 2JA8B 1LYLA 4LFBQ 4NDXA 2ZJRA 2EY6A 5KRUA 1NTGA 3IFDA 1PLFA 1BCPC 4YCUA 2RBMA 1IW7C 4P2CB 4KHVA 4LNQA 2MJ8A 3I55A 4FP5D 2RHQB 3E5SA 4P75A 2EYOA 1V1PB 2CKZB 2A68D 2F0OA 1BF4A 3S1RB 4DK3C 2AMCB 5BR8Q 4PMCA 1C0AA 2PO4A 1V43A 1UE5A 4KD4A 1VQKA 1SAPA 3NHHA 3OMGA 4C3HB 1CHQD 5IE8A 1B9MA 4WORA 3S14B 4QIWB 4CGYB 2N55A 3I90A 1GHKA 3NBHB 3LWUA 1PH1A 4JOIC 5DM73 1F2YA 3V96A 2LSSA 5BN3A 3GTOH 1HNZQ 5GADC 5JJIA 4B8TA 2F3IA 1R4QB 3M3YB 2E5LQ 4PQXA 2F03A 1YNJD 3KF8A 1EZ8A 2MHVA 1RCVD 1AP0A 5C3EG 1EFWA 2K5WA 3DWQA 1M90C 5LMNQ 5BN4A 4DGZA 5M3FH 4FNFA 2KCCA 2KHIA 4DAPA 2K05A 5C5MA 1TWHB 3TRZA 1PVOA 3QB3A 4C56C 5IGBA 2HDLA 5FLMG 2OXPA 1TS3A 3KLSX 2YU9B 3UDXA 3GV3A 1AN8A 4KN4C 1G6ZA 5CMDA 1V9PA 4JV5Q 1XMQQ 1VF7A 2C9OA 1PTOD 2KVMA 5IOCA 4OXPA 3HZXA 4RFBA 2F52A 4OONA 2AWOA 1C4QA 1PH6A 1G2TA 3HOUG 1C9OA 2ZJPA 3HKZG 2F0FA 1YVCA 1F9RA 5T1IA 3WDNA 3FDTA 1JICA 5AJ3Q 4DR3Q 4A3JG 4OWXB 2R92B 2KCNA 1CQVA 1CKMA 3S1MB 3JAME 3PO2B 1SN8A 2ANNA 2CW0C 2JZXA 5JEAJ 3EBEA 2KENA 2O5JC 3JAMc 1N8RC 4AIMA 2OF1A 1B4OA 3D8GA 3TP6A 3CCLA 4BWGB 2V4DA 1TIID 4LUZA 1DCZA 1A8VA 5KNDA 3KLSA 1E1OA 3KLWA 1U9RA 2WKDA 2I5HA 1PH4A 2B63H 3HOVG 1L1OA 3EIVA 3ZJYC 1NJIC 5JAVA 3HOZB 4DUZQ 4L5QA 2YQRA 1L1OC 1ZYRD 2AQ1B 1Q12A 2DNCA 1SE8A 1QWYA 1J6QA 1F2ZA 4ULLA 4HSVA 1V1OA 1HNXQ 4AM3A 2B2TA 1KRSA 1NUCA 4R4CA 4HEDA 1S40A 4PZ7A 2UUAQ 4LF6Q 2B2TC 4C3JH 2IPKD 1PFNA 5C44B 1N9WA 1VQEA 4K0KQ 4X62L 4JG2A 1D5MC 2TSSA 1TWFH 1PFSA 4BXXH 2YV5A 2R7ZH 4JI2Q 2SEBD 1YJ9A 1DOMA 3GTGB 4HTHA 4RHSA 2O4XA 5ELBA 2B8GA 2QKIC 1IBLQ 3ND8A 4YCVA 5IODA 2JA8H 2LFNA 1NE3A 4C2MB 4CBVA 4EQNA 4EQOA 2XIWA 4RMFA 3J7AF 2HUGA 1UWVA 5I6WA 2JQOA 4QB4A 2L9HA 5ELFA 1W3SA 1XPRA 4XYQA 4YY3Q 4IZ8A 4EX5A 1IL2A 5M5WH 3J81c 5I6YA 4GNXA 2NTSA 3CQZB 2RSOA 4B3SL 2F4VQ 2RCNA 1EOVA 2OPUA 4DK1A 4LF4L 4MN3A 2V1CC 4XQNA 4KTAA 5IWAL 1YNND 4OIJA 4N9PA 3EFXD 1HTLD 2JK8A 1TS5A 2OT2A 4KHPL 3FKIH 3VYRA 4XQJA 4A3EH 2Z4HA 2PPBC 4OX9L 1JC7A 4JI0Q 4DR6L 4KKTA 3GV6A 4A4IA 1VQJA 4J15A 1N36Q 1JOQA 1B3AA 1GUTA 1J5EL 4DN4M 3VR6A 1HH2P 1QZHA 2Q2TA 2CTMA 4K6DA 1EYAA 1X55A 4X66Q 4JI1L 2F0EA 3MZ5A 2K5QA 2JP1A 2F0HA 2A74C 4DK6C 1CFMA 4J1MA 1JWSD 3VR5A 1GOZA 2O5IC 3JC66 2GN5A 2O2LD 1HZBA 5CBAE 1EL0A 3NUCA 1BXTA 3PGZA 4HIDA 3OTOQ 5JOBA 1VQ6A 1LT4D 3SK4A 5LMUL 5I9OA 2I0QA 2PYKA 3S1NH 1JOOA 5BN5A 1SDFA 2ZM6Q 4GN3B 3QOLA 3AMUA 4FF1A 3GTLB 3H3VC 3T1HL 5JEAH 4DKAC 5CBEE 5I9PA 5C4ZA 2EXZA 4M8AA 3M4QA 4X64L 2NN6H 4HIMA 1PH7A 2ALYB 1RD9D 2CVRA 3AEVA 1DZ1A 4B9WA 5IP9H 1H9SB 3VYSA 1RTOA 4MNOA 1YI2A 2E2HB 3I2ZA 1GUGA 5M3FG 4IPGA 1DTJA 3CCQA 2KA7A 4BY7H 1I50B 1N33L 4GOPA 3HEJA 1LT3D 2K4KA 5C3EB 2WFWA 3HOYH 5E1FA 1HQRD 4X6AH 1M1KC 5KIXA 4DV1L 2LMCB 2IY5B 4AH6A 4A3BH 3D31A 5EAYA 1PRTB 1U4MA 1DONA 4HJ5A 3RNUA 2F0SA 2UU9Q 1TWCB 4E6IA 2UUBQ 1HNWL 2ZXOA 3OW7A 2FINB 4G7ZC 3GTPH 4KJOA 1P8LA 3K0YA 4RCOA 2Q2IA 3EN2A 1EYGA 4X65Q 3MC0B 2A5HA 3KBXA 5CV9A 2K7VA 2R7DA 4JI8L 1VIGA 1JB3A 1H9KA 4LUOA 4JI5Q 3HOUB 2JJQA 3A5UA 3HKZB 2YTYA 4JC0A 3H15A 3H3VI 5ELDA 4GS3A 3HRZC 1U5KA 2A8VA 2EPBA 4A3JB 1Z6HA 2E2JB 2QNDA 3G7LA 1AZPA 1MKHA 3S1QH 3TS2A 1H95A 3MEFA 1XNQQ 2NWGA 4PG3A 1ESRA 4POGA 2B63G 3TS0A 1EY8A 4HCSA 3C3LA 1HFNA 3MXPA 1H9JA 2RDHA 1X3QA 3V05A 1CHPD 5EKKA 2WP8J 2JE6I 1Y8PB 4XDXA 5AFWA 1GJXA 2C35B 4CKCA 3HOVB 2EIFA 4LFCL 1Q86C 4A3CH 1WCMH 5IGCA 1X6OA 1K83B 1EIGA 4C3JG 5C4XH 1KD1C 1ENFA 1KL9A 5D14A 5FKAC 1E7ZA 2EYPA 1FGUA 1BUVT 3M7NA 4BXXG 2CTJA 2IWHA 4H13C 4ODGA 1VQAA 2FXQA 2R7ZG 4GLAC 1K73C 3HKZE 1K8GA 2KOLA 4RWSC 2XTIA 2FJ2A 1STHA 4DR4Q 2JA8G 3S9WA 2LXKA 4LF9L 1ZEQX 4LIJA 5CV4A 5M5YH 1OXVA 2RKSA 4B3TL 1B50A 1KNEA 1R9TB 1L0WA 3W1BA 3AYHB 1MD2D 4KY5A 2ZXPA 4POFA 1IBML 1E2VA 1M8AA 3I72A 4ZUIA 1B2TA 3I4NH 4HAEA 2UXBL 1SYCA 2K5NA 2NBFA 2BDNA 5FO9B 3FKIG 4A3EG 2NVTH 3J80c 1QCBD 4UP9A 4ZUJA 3SGIA 4K2LA 4RHRA 4ILWA 1TUAA 2CTLA 1PH2A 1SNCA 2E74C 2ID0A 4CJ2C 3CPFA 2B2WA 2JA9A 2NZHA 2X69A 3OHXC 4DNIA 2RDFA 2JYOA 3KUPA 3L2PA 1NAPA 3O13A 4XYOA 2E3UA 4WALA 3OIPA 3KYHC 5IP7H 2H5XA 2OTJA 2SDFA 2F0PA 3W5OA 1HR0W 1TY0A 4XQQA 3MFYA 2LS01 2NVXH 3STBC 4DV5L 4DFAA 1WFQA 1SYFA 4Y52H 3Q8DA 1TU2B 5M5XH 1SJHD 1YEZA 3ERQA 3FP9A 2HHHQ 4KY7A 3UI2A 5D3DA 2ZTDA 5EKIA 3BZCA 1PH9A 3DEPA 3OYYA 1JQYD 3J81L 1ASZA 2NVQH 5JEAG 3TREA 4DAMA 1VS0A 3U4VA 5EJWA 4KY6A 1BNZA 4A3LH 2DY7A 2KHSA 4AQYL 3VYTA 1I94L 2NTTA 1H9SA 2H4OA 5IP9G 1QUQB 4C3IH 1YHQA 4NXMQ 3OWEB 1ONLA 4H7BA 3GTOB 3BZKA 1BCPF 4TKOB 1RDPD 1GHJA 2R61A 4QCLA 1STBA 1WTRA 5EPJA 3GP7A 3NBIA 3W1GA 3C46A 2BE5C 4BY7G 4Q0FA 4X3KA 4L63B 3K5MA 2JA5H 4HMJA 4KHZA 3T16A 2EE1A 2Z6KA 1JE5A 2L0CA 1K3RA 3HOYG 5M3FB 3F2BA 4DV3L 4PV1C 4R9WA 4A3BG 1PRTC 1K83H 2PNHA 1EY0A 1DYQA 3U58A 1XPUA 2XNAC 5C6AA 2MPMA 3D4RA 3PUYA 1HZ9A 3ULLA 3BYYB 2BOSA 3X3MA 3BU2A 2HH2A 3K0XA 1VQ8A 4QGUA 4AYBE 3N52A 1SRUA 4DV2Q 1WI5A 1RJTA 5G3LF 3BJUA 1GUWA 1DM0B 3R2IA 2AWNA 2F0IA 1CT1D 2K01A 1EIYB 5IWAQ 1D2BA 1Y8OB 1I4RA 1O78A 4G7OC 4WJ3M 1LTID 2R3ZA 1YJNA 2F0VA 2A68C 2EJGC 1RL2A 2OQ0A 4R4OA 1CK1A 5IGEA 4ZK9B 1BBWA 3I56A 3HFZB 4JI7Q 1Z47A 1L0XB 1PTOH 3NP8A 4R4QA 3S17H 1SXTA 5CORA 2B63B 4JK1C 4A3CG 1WCMG 4J6HA 1FD7D 4I65A 1GO3E 5C4XG 2AHOB 4B3ML 1YHBA 4ZKCB 2AXYA 1HTPA 4K5XA 4ME5A 2K5VA 1J5EQ 4YCWA 2AUJD 4KLKA 3K81C 3CRLC 4RGTA 1PFMA 3HOWG 4RKBA 1CI3M 2IX3A 4JI1Q 2K5HA 4LF7Q 5DAUA 1W6KA 3CCEA 3DXJC 2OQKA 2PMZB 2K6AA 2L4NA 3D0FA 3MA2B 2R7ZB 5GQOA 1LV9A 4FYDA 1U4LA 5J1ZA 4O1NA 1Z9FA 1VQFA 5EKLA 1SE2A 2SNMA 4FXGC 3QOJA 5CV8A 2HIVA 3L7ZC 1FJGQ 2A6HD 3I4NG 2DY8A 3TMEA 3OIQA 3K80C 3Q22A 5M5WB 4DUYQ 1HRJA 3M4OH 4Y7NH 1D1KA 1B53A 1K8OA 1RKNA 5C3WA 5IGDA 5TSSA 5FLXL 4X64Q 1S5DD 3I4LA 1HR0L 4A3DH 4KKUA 3KDFB 1X65A 5EBCA 4KKSA 5IGFA 1A63A 4YHHL 1K8AC 1ZTGA 5E3FA 3TEHB 1RIPA 3FKIB 4JOIA 2NZOA 3M7GA 2F0TA 2PMZE 4A3EB 3DEOA 2A73B 4GKKQ 3NXWA 5A35A 4LF8Q 2YTVA 3OSOA 2GVBA 3S2HH 5IP7G 4DV6L 1L2FA 2IX1A 1LT5D 1OO9B 2EOTA 1PV4A 4DR2L 4C1NK 2EZVA 2WV6D 1WTOA 1G291 2UUCL 2EQSA 4DV1Q 2A6ED 2K28A 3RLNA 4IN3A 1DOLA 4B3RL 2ANRA 2QF7A 2VXWA 3RZOH 3ND9A 2WB1G 2MGSA 4FXDA 4A3FH 1HNWQ 4IUNA 3DM3A 1JT8A 3TZDA 3GTMH 2IHFA 4APVA 2B39A 2EY2A 3CD6A 2Q8RE 3QJYA 5IT9E 3E6ZX 1STYA 4HSPA 1SNMA 4QIWE 4A3LG 1RODA 4DR1L 3FMCA 4FXKC 2B2VA 3R93A 2C5CA 2MFIA 2F0GA 4OGQC 3P7JA 1TXYA 1QUQA 1I4PA 3S1NB 1UAPA 5FJ8H 2OWOA 2B2VC 4IQZA 2VQEL 1HJPA 2HH3A 1EU4A 2QEJC 2I46A 4C3IG 4HJ7A 2B3GA 2VQFQ 3CC7A 3EQLC 3J80L 1S5BD 4WJWA 1BCPD 1VIHA 5IGGA 3H94A 4HJ9A 4IURA 4K2KA 3QG1A 4JI6L 2JA5G 1ET9A 1VQBA 3H0GH 2IT1A 2UXCL 2P2RA 1NBWA 4J8QA 2I5MX 4LFCQ 2B8FA 3TQYA 3BVZA 1AEXA 3ER0A 3WOEA 1KDAA 1YBYA 3K59A 4BY7B 2ZXRA 3DHQA 4IJLA 4LF5Q 2CWPA 2JA7H 2F4IA 1OXSC 1GUSA 1IXRA 3F2CA 4P71A 4NBQA 1VMPA 3HOYB 2DGYA 4IO9A 5COYA 4A3MH 4A3BB 3TSSA 2XWBB 2CPQA 3HGBA 1DOKA 2ASBA 4JYAL 1A3VA 1SYEA 5T1GA 1X56A 1SMYD 3KK7A 5JJKA 5G3LD 5C0XJ 3K57A 3GTPB 5KNBA 1GUNA 1VQ4A 1H9MA 4IPDA 4IOAA 1SROA 1IBMQ 3K7AH 4PMWA 5IYDH 3GTKH 4XIGS 3FPUB 4Z9CB 3D4DA 4ZKBB 1IL8A 1EUJA 1ZXTA 4H02A 3CPWA 1I4HA 4HMIA 2XN9C 4TSSA 1E2WA 1XPOA 1AH9A 3I8ZA 3S1QB 4QUFA 1FVIA 4YWLA 2AKWB 1DGSA 1BDOA 1Q81C 3S16H 4FF3A 3A7AB 3CKIB 3UDFA 1FNWA 3VA5A 3PUWA 2R6GA 3E0JA 3PUVA 2A69C 4X3UA 1EC6A 4Q5VA 3BYTB 4DR5L 4RH6A 3K5NA 2QCPX 5A2QL 3MWYW 2Q2UA 1TWGH 4O2DA 1WE8A 4R1JA 4NPSA 4OIKA 1B1ZA 1WCMB 4IPHA 2JSOA 2A1AA 2E8GA 4QF4A 5JJZA 2KBNA 1XXGA 5C4XB 2JA6H 5C4JH 3A8KE 1G2SA 1F9QA 4UP7A 1FL0A 1K9MC 5GAGC 2CTKA 4ZYSA 4BBRH 2LY7A 3ERSX 1IKMA 1AFPA 1Y69U 2M2LA 4B9XA 3HOWB 1BVSA 1V8QA 1T5EA 3PO3H 5CYUA 4I7ZC 1B44D 5M5YB 1ICWA 3IL8A 4DU9A 4NKLA 3EVQA 2HQLA 1V1PA 3ONAB 2L12A 4S3SA 3A8IE 3KDFA 5ELNA 1UEAB 3TDQA 2UXDL 1EYDA 1I3QH 1DJRD 2J7ZA 3A56A 4A3DG 4NXNL 4LFAQ 4QQBX 4CJ0B 3I4NB 3H09A 1IYJB 1SLJA 1KDCA 3NSWA 3NBHA 1VQPA 2HDMA 1SYDA 4L5TA 3TP8A 5J39A 3I4MH 3G4SA 2GVAA 1X32A 3TP5A 4IFDI 2NVTB 1LT6D 1CTMA 3TP7A 3VYUA 4RGMA 1Z7TA 2K14A 3NQTA 1KXLA 3T13A 1I6VC 1QILA 2JEBI 2WKCA 3RN2A 4L5RC 1HA5A 4LFBL 1KAWA 2DN8A 2FHTA 2ZTEA 3PUXA 2HT1A 1U0LA 1X54A 3R8BA 1VQLA 3G48A 5KYIA 3AB9A 3ITPA 3U9SA 4WRDA 4F8MA 1KAAA 4A3FG 3RUZA 3U4ZA 3LWEA 4DXGA 1ASYA 1JJCB 4CHTB 1HQMC 3SHLA 3CW2C 2F0DA 2NVXB 4HCEA 4GLXA 1YZ6A 5BR8L 4JI4L 1MJCA 4BA1I 3UE1A 2N78A 3PUZA 5M5XB 2Z0SA 4DV7Q 4UDUC 2WB1B 5C0XH 3CP0A 2NVYH 2WAQG 3A5ZB 3I73A 5FJ8G 5CGKA 5FOBB 1HNZL 2G9HD 2NVQB 1STNA 1ZZJA 1XNRQ 1Q46A 1QE6A 1SEBD 4UAIA 5NUCA 2MNAA 1WTXA 3WOFA 2K32A 4A93H 3D6CA 4MZ9A 5M3MH 1LM0A 2KECA 1XMOQ 2M9VA 1Y8NB 1HCZA 5LMNL 4ID6A 1VQIA 4UP8A 1EYCA 3CRKC 4C3IB 1EWIA 4LJZC 3H0GG 1PMRA 2I5LX 1HZAA 1N32Q 4K14A 4L6TB 4P73A 2ICEC 3RZDH 4DXFA 1STGA 1XJVA 2RHSB 1KC8C 1IYUA 2JA7G 2RSNA 4QY7A 4IOCA 2JA5B 1QNUA 4JV5L 3QIAA 3FRPB 3S2DH 1C48A 3NTIA 4OO1H 2EYHA 1KABA 4GKJQ 2BDOA 3VR3A 1EFID 1G8ZD 4A3MG 4DV0L 1KHIA 3P75A 1CZWA 5AJ3L 4DR3L 4MHEA 2KEEA 4FO2A 4O0AA 3BDLA 3KFUA 3PIPA 3CCMA 4M1UB 1Q90A 4JI3L 1BBXC 1E3PA 1G51A 1JJGA 4L8JA 2QA4A 5FO8B 3HOWH 2FFKB 5IYDG 3CC2A 3B6YA 5LHY1 4BS9A 1Y1WH 1IZ6A 2D0PA 1UNSA 2VUMH 2PW5A 3MTSA 1AZQA 4DAYB 1X4MA 2ES2A 2MP1A 5I2YA 1XX8A 1HR0Q 5C4HA 2CTFA 2NN6I 4DUZL 2NB0A 1CKOA 1PRTF 2NUCA 1A62A 3NWSA 1D1IA 4KV6A 3CCRA 2DNEA 2PQAB 2SOBA 1K0RA 1HNXL 3CCSA 4YWKA 1VQCA 2K52A 4BBSH 2PQEA 4LF6L 1X3GA 3F8TA 1PTOB 3JAML 4ZLTF 3CHBD 1LABA 3L9AX 1S72A 3S17B 4DV6Q 1Q3LA 1HZCA 1NSNS 4OL7A 2JA6G 4JI2L 5KYLA 1X9NA 3K5LA 4R8IA 1QJOA 1WOCA 2M00A 5CC4A 4BBRG 4DPGA 4DV4L 3K7UC 4XXEA 2CQAA 4LMQD 3PIP3 4XT1B 1PHJA 3AQQA 4YY3L 4A3IH 2BL5A 3PO3G 4OWTB 2F4VL 5IY0A 5J3BA 3VDYA 2D9UA 1J8IA 1NCVA 1YHAA 4LAAA 1VQ9A 3G6JB 4P74A 3SE0A 4FF2A 4FVMA 4X3SA 3KBGA 2F0JA 4WFN3 2VQEQ 3V2TA 2HCIA 5K36H 2GA4B 3M4OB 1J9OA 2XRQD 4Y7NB 2N3SA 3I4MG 2FMMA 4JI0L 3Q0AA 4JBWA 1EY7A 5DLQE 3V69A 1JB7A 4A3DB 4DR7L 2PNRC 4JI6Q 3SK8A 3HKSA 1Q7YC 3J7ZC 2UXCQ 3E0EA 3EA6A 2FMCA 4LW1A 1L0YB 4HIOA 2VL6A 2J4XA 3ICEA 1VQGA 4X66L 1T5XD 1FYCA 3S2HB 3NQIA 3SEBA 3BDOA 1EWCA 4RKLA 2K75A 2DUDA 1MSGA 5ELEA 3VR4A 1MSHA 2AQ2B 2K04A 1VCIA 1ML0D 3FPPA 1Y1VH 3UDIA 1SNDA 2N8NA 1OTCA 2EDGA 2WIIB 3OTOL 3GTJH 3K58A 4BY1H 1DT4A 3RZOB 4OWWB 4F7XA 1GD7A 4JYAQ 5C0XG 4A3FB 4X62Q 3J81j 1PH3A 5E4XA 1CSPA 4DA2A 1EQVA 4RCNA 5ISRA 1YJWA 3GTMB 1QVCA 1SR3A 1QZGA 3NE5B 4ALPA 3GD7A 3SK6A 1IBKL 4DF7A 1EIFA 3IKJA 3K5OA 1EY5A 2RQXA 2JVZA 4A93G 3K8AA 3W3AA 3Q24A 2WAQB 5M3MG 1VQ5A 1FR3A 3STBD 4B3SQ 2KJXA 3CAMA 3F2DA 3L0OA 1EWHA 4LF4Q 2A6HC 1E0BA 1DD2A 1D7QA 1S5ED 3CMAA 4H0LC 2X6LA 3VR2A 3CMEA 1SFOH 4KHPQ 1LTLA 3H0GB 3F2UA 3I7FA 1LO5D 3CCUA 2HQEA 1V1QA 4OX9Q 4OO1G 1UE6A 4DR6Q 1QVFA 5IYCH 2BA1A 4JVYA 2UU9L 2UUBL 4KD3A 2JA7B 3SK5A 2MO0A 3D6WA 4NMZA 3UE0A 3PCOB 1VQOA 5GAEC 4KK7A 5LL6S 3U9OA 4EQ5A 2WAQE 1P16A 4ZRZA 2R93H 3MHBA 1YNJC 1BQQT 4A3MB 2L1BA 3NELA 3ULJA 1NMGA 2BE5D 1MI2A 2D5DA 3CC4A 2A6EC 1Y1WG 4DAYA 4GNXB 3HG9A 5IIFA 2JEAI 2F0LA 4HIKA 2VUMG 1XNQL 4JVHA 4CKEA 4IUPA 2CQOA 2BH2A 4HJ8A 1G6PA 2B2YC 3K7AB 4KMUC 2PQAA 1I4GA 2Z4IA 3GTKB 5LMUQ 1PRTD 4IFDJ 1EIHA 1U4PA 2HIXA 3A74A 3PSIA 4BBSG 2LXJA 1WYDA 3ZYYX 1PTOC 3T1HQ 2EY1A 2ZT9C 4V0BA 2F0UA 3NK9A 5CR3A 1PYSB 2D62A 4QUCA 5KNCA 3S16B 4O42A 5EPLA 1AE2A 2G9DA 3W2DA 4N9TA 1SNOA 3M4YA 2Z8LA 2L11A 4DR4L 3L3OC 4QMFB 2L5TA 2VZAA 1TWGB 2IL8A 4TVAB 4H44C 2EYFA 1WD1A 1BKBA 4HR7B 3T1YL 3C1FA 2JA6B 1KNAA 1SYBA 4X3TA 5C4JB 4A3IG 1N33Q 1AE3A 3RR5A 1ILPA 1KDBA 3GDEA 2Y0SG 4A3KH 1UEBA 4JI4Q 3X3NA 1D8LA 4BBRB 2BA0A 3A7LA 1N34L 5JPNC 1JE4A 1FNUA 3S15H 1ZZKA 5I4DA 1ZYRC 1PXUA 1YNXA 1STAA 1BR9A 2F1MA 2OCEA 4EVOA 3E9IA 3PO3B 2PI2E 3RN5A 5C5LA 1LACA 5I2XA 1SSOA 2ZJQA 2F0MA 1W2BA 3D4WA 3A55A 5K36G 2E2IH 3CF5A 3OOCA 1K1GA 2QILA 1X3EA 5K5PA 1VQHA 1I3QB 3CCJA 1RF2D 2AQ3B 2PCFB 4JI8Q 2EJFC 2RDGA 2EVBA 1SMYC 2EYJA 3AEVB 1EOTA 5IT9c 4WJ4A 3K6OA 1Q1EA 1LTAD 3P20A 2K1BA 3QO2A 3I4MB 4CJ1B 1T9HA 2KUMA 3BVMA 1X4NA 5C3XA 3R3OA 1XYIA 4RGOS 4GOPB 1RHPA 2D2CC 1CUKA 1PH5A 4IPCA 1EEID 4PZ6A 5HURA 1B8AA 1IW7D 2IX0A 3URYA 1EEFD 3I3CA 1X3FA 3PV0A 1Y1VG 1YNNC 1UE7A 1I4QA 2HHHL 4DK0A 1WTQA 4BY1G 4CKBA 4DV0Q 1TWAH 1WVNA 1I6HH 2XSCA 1A3UA 4NB3A 5D3IB 4JI3Q 1R4PB 1PYWD 4GN5A 4A3GH 3D3RA 1GXDC 1HUMA 4IUQA 5LMNW 4LF9Q 2NVYB 4U673 5E4WC 1TS2A 1EQRA 2LKVA 3IFTA 2BCOA 2F0NA 4B3TQ 2Q2HA 2N49A 4NXML 5FO7B 3M4PA 4IFDH 1KRTA 3TN2A 4G57A 2L15A 1G91A 4K5WA 4IUUA 2RF4A 4KI0A 3F1ZA 3HOXH 1S3OA 4A93B 1HA6A 1Q8KA 5M3MB 2UXBQ 1JR0D 1TS4A 3RLOA 2KCMA 2CFMA