3L7ZC

Crystal structure of the s. solfataricus archaeal exosome
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
222
structure length
222
Chain Sequence
QKIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKSGCSIFVANNGRIWATCPSRFSEEILIEAIRKIENESHIKGLTDRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the S. solfataricus archaeal exosome reveals conformational flexibility in the RNA-binding ring.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase/rna binding protein
molecule keywords Probable exosome complex exonuclease 2
total genus 37
structure length 222
sequence length 222
chains with identical sequence F, I
ec nomenclature
pdb deposition date 2009-12-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3l7zC01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3l7zC02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 3l7zC03
5IP7G 4DUZL 3T53B 3SGIA 4A3KH 4DAYB 2ZJRA 2A6EC 1OXVA 1G51A 2A1AA 4A3DH 4WJ3M 4NPSA 4JI4L 4BA1I 3HOZG 1EQRA 2VS1A 2OQ0A 4KLKA 3NE5B 2BA1A 3B6YA 3D0FA 1H9MA 3FP9A 1YJ9A 2ASBA 3RZOH 4BXXH 3D31A 2JVZA 3AQQA 2PQUA 3A7AB 4B3TQ 2OQKA 1LM0A 1A62A 1A6XA 1YNJC 4PZ6A 1VIGA 5IP9G 1GUTA 1PV4A 2MNAA 4DR5L 3FPPA 1YZ6A 2KCTA 4LUZA 4JBKA 1CSQA 5IYBG 4OX9L 4RMFA 2WB1E 5M5WH 2JA9A 1ZZJA 2NVYH 3CP0A 1GM5A 4P71A 5IT9c 1OXUA 2WAQG 4KHPL 4EQ5A 4AH6A 1E24A 5JEAJ 1G6PA 3OYYA 3GTGH 3HOWG 2DNEA 1JMCA 2K32A 1QJOA 1HTPA 4BY7H 3G48A 4IJLA 3W1BA 5IY0A 1LTLA 4X64Q 3WDNA 3K81C 4KKUA 4DKAC 1SFOH 1JB7A 3J81c 1CSPA 4JV5Q 3TQYA 1HNXL 2HIXA 4FDBA 4JI3L 1K73C 1KXLA 4G7OC 2IT1A 2E5LL 1W3SA 2NZHA 2I5MX 1IBML 1O7LA 2LXJA 3N6RA 4A3CG 4BBRH 1DTJA 2AXYA 3NEMA 1YVCA 4A3FG 4IOCA 3CC2A 1NMGA 2CPQA 1GJXA 3A0JA 4DV1L 5M3FG 1XJVA 4A3BH 1A63A 2BE5C 2VUMG 4GNXA 3M9BA 2NVTH 4POGA 4L5QA 4DR1Q 3RLNA 1J5EQ 4AQYL 1WCMH 4JI1L 4A3EH 3I4NH 2FMRA 1C0AA 3NENA 4UP7A 4LFAQ 2VY3A 1Y1VG 3GD7A 3EIVA 3H0GG 3I55A 2K75A 4LW1A 3GTJH 5LMNW 4JBMA 3I4MG 1JJ2A 5JEAG 4JI7Q 1B8AA 1X55A 1D7QA 4NXML 1K83H 2ZJQA 1YHAA 3TS0A 4LF8Q 3CW2C 2R6GA 3I56A 1K0RA 4A93H 1Q81C 1E2WA 4ME3A 1YJNA 3VR3A 4XTCS 1WOCA 1UE1A 5C0XG 3BJUA 2HHHQ 2HH3A 1IBMQ 1PVOA 1UWVA 2PNRC 1TWFH 4A3JH 3ULLA 2WFWA 3HKZG 3SE0A 3KOJA 4JI2Q 5LMNQ 3PF5A 3ULJA 2UUCL 1E1TA 4UPAA 1Z6HA 1KIXA 2B29A 3KLWA 1G291 3PUVA 1X54A 2CFMA 2JJQA 4IPHA 5GQOA 1YNXA 1AE2A 2DGRA 2HQLA 4DR7L 1EC6A 4HIDA 2OTLA 4JI6L 2K7VA 2A8VA 1QUQB 4IFDI 3PV0A 3KLRA 3F2CA 4HJ7A 2ANRA 2PCFB 5GADC 1CKNA 1HH2P 2RHQB 3PGZA 3A8KE 1SMXA 1IZ6A 2V4DA 1EWHA 3TEHB 1R9TH 2P2RA 4B3SL 2GVAA 3AFPA 4QQBX 2UXBL 4LF8L 2F52A 3J81i 1PH6A 2I5HA 4O2DA 4RCNA 1PYSB 1T9HA 1UEBA 3RN2A 3HOWH 2UXCL 1XMQL 1WI5A 1BBWA 4NBQA 1HNZL 2EJGC 1Y8NB 3QIAA 3BZKA 4JI8Q 4DR2L 4GOPA 1N36L 4LF4Q 1KHIA 1EUJA 3U4VA 2HH2A 2RCNA 4DUYL 2A69D 1N9WA 2BL5A 2YTXA 1MKHA 1HCZA 2E76C 2XTIA 2F3IA 2JQOA 1YEZA 1B7YB 1YHBA 1IBKL 4UP8A 4DNIA 4GS3A 4GOPC 1X6OA 4YHHQ 4R4IA 5IP7H 1B9MA 1XNRQ 1JT8A 3PO2G 4YWKA 1D8LA 2VQEQ 4X66L 3CRLC 2AUJD 1HR0W 2F1MA 2EDGA 1H9KA 3LNNA 1SN8A 5M5XH 1PHJA 1Q90A 1HNZQ 3RN5A 1KD1C 1VQEA 1K8MA 4HJ9A 3I4OA 4A3FH 2UU9Q 2KCMA 5GROA 2D0OA 4HJAA 2DGYA 4DV1Q 1IYUA 2AUKA 1EWIA 2KHJA 4RG1A 2R92H 4YY3L 2JA8H 1WE8A 1KRSA 1PFSA 1EQQA 4OXPA 1CKOA 3UE0A 1VS0A 1PYBA 2K14A 1VQOA 3F8TA 2ALYB 2R7FA 1Z47A 1BVSA 2CTJA 4LK1C 1L1OB 3VR4A 4X62Q 1FGUA 2MO1A 2B3GA 4KHZA 1E2ZA 2CWPA 4P72A 3CMEA 1YBYA 1M90C 1DD2A 4JOIC 3AEVB 1L1OA 2CW0C 2Q8IB 2JA5G 1CUKA 3I72A 3TS2A 4P75A 2CTFA 2MO0A 3HGBA 4X65Q 2H5XA 1VQBA 4EX5A 4G7HC 1VQPA 4JI0Q 1TWAH 3G6EA 4A3JG 5H1SE 3FKIG 2IX0A 2Q2TA 1L1OC 3SDZA 1H95A 4WANA 1KHMA 1Q12A 3E0EA 5KNCA 3CCLA 3J80c 4IFDJ 1NBWA 4DV3Q 4LNQA 2R92G 2CTEA 4PMWA 2A6ED 2CCZA 3H15A 3GTOH 4MZ9A 3T56B 4H44C 1GVPA 2K50A 4HR7B 4X6AH 2YTVA 3IFTA 1ZKOA 2YU9H 1E2VA 3CD6A 4A3CH 3VR5A 3VKEA 3T51B 4LF9L 4A4IA 1N36Q 1X9NA 3I4LA 1V8QA 5FJ8H 4DR1L 3CCQA 2AHOB 3UDIA 4AYBE 4HIKA 4OX9Q 2VZAA 5M3FH 5M3MG 4A3BG 2YYZA 1GUSA 1TWHH 1I6HH 3PSIA 4GOPB 3S24A 1AE3A 1I5FA 1IW7D 2NZOA 4DV4L 4DV5L 4HJ8A 4JI5L 4A3EG 4DV2L 3I4NG 3HOUG 3W3AA 3J81j 2XGTA 4YCUA 4OO1I 1X4MA 3UDXA 4NXNQ 1ASZA 4LF5L 2MQHA 1MJEA 1HR0L 5FLXc 5JEAH 1YITA 1GUGA 2ZM6L 4OGQC 4LF7Q 1DGSA 1XNQQ 1XPUA 1IL2A 3A8IE 3HFZB 4GN5A 2KBNA 4QY7A 4BY1H 2A68C 2EJFC 1PH9A 5BR8Q 3S17H 4WALA 3RR5A 2PI2A 3U4ZA 4YY3Q 1VQAA 3S14H 3QJYA 3G71A 2Q2IA 4DV6Q 1S40A 4DR6L 4DUZQ 3U58A 1N33Q 4OONA 1LUZA 3OOCA 3S1QH 3OPOA 1HNXQ 3E9IA 3L2PA 1P8LA 1X3FA 4LUVA 1W2BA 5IYCH 3EN2A 3PF4A 2N49A 2Z0SA 2JXMB 2B8GA 2RF4A 1CKNB 1H9RA 1GHKA 2A19A 2VL6A 3CPFA 1DCZA 4R4QA 3J80i 3F2BA 4JI8L 4DR2Q 1HZ9A 5FLMH 4UY8C 1TUAA 4QGUA 3BG3A 2OPUA 2GN5A 2NN6I 3JC66 2E3UA 1TWGH 1PMRA 3GO5A 2LSSA 2D2CC 4JI0L 3GTMH 2Z6KA 4LFAL 2IHEA 4A3MH 1EIYB 2K4KA 1ASYA 1T5EA 3ER0A 1WYDA 3WWVA 4AQYQ 5C3EG 2K5HA 5HY6A 4L5RC 2N78A 4NXMQ 1K9MC 3EBEA 2R93G 4JBWA 2AKWB 4HIMA 4TQUS 1IBLQ 5LMNL 1SE8A 4IO9A 1VQ5A 1UE6A 1Q1BA 2UU9L 2NN6G 4GZYC 3K0XA 4LF4L 4A3LH 3A74A 1Q1EA 2EJMA 2B63H 1KRTA 3ZJYC 4JI6Q 2YQRA 4A3DG 1I6VC 4DPGA 2BH2A 3HOZH 2A69C 1C9OA 5GAEC 2ZT9C 3M4YA 3PUXA 2MFIA 2CTKA 2E74C 3ICEA 4DNTB 3PO2H 4UP9A 2BE5D 4O0AA 4A75A 1O78A 2V1CC 2JA6H 4OO1H 1WCMG 1P16A 2VW9A 4DUYQ 3L0OA 2IHFA 2YTYA 4IPCA 3D4RA 1Y1VH 5IP9H 1UE5A 4POFA 3CC7A 1NTGA 3CCSA 1PH3A 4JI5Q 2JZXA 3STBD 1K8GA 4JVYA 2GVBA 1ZZKA 1GUNA 1Y14B 2E2JH 3M4OH 3T1YQ 2KA7A 1NE3A 3M85A 3KFUA 5ELNA 4BBSG 5BR8L 3DLLA 1N32Q 1DT4A 2CTLA 3HOUH 1KL9A 2A6HC 1I94Q 1QUQA 2Q2UA 1Y8OB 1I3QH 1S3OA 3ND8A 1XMQQ 1WVNA 3VDYA 1N33L 5K36G 5C44G 1HPCA 2QEXA 3MFYA 3VR6A 1VQCA 5IWAL 1Y8PB 4R4OA 3M4QA 5GAGC 1OTCA 2JA7G 3HOYG 4DR6Q 3U9SA 1HJPA 2AMCB 3ND9A 3DXJC 2C35B 3GTPH 3L7ZC 2Z6KC 3T1HQ 3T1YL 1KC8C 3F2DA 2E2IH 3CPWA 4L8JA 4LF9Q 4JI7L 2F4VL 1VQDA 1XPOA 1TKWB 3CCUA 4A3IG 3PCOB 4JG2A 1B9NA 4MTNA 3CXCA 5A35A 3V69A 1BBUA 4JV5L 2N8NA 5IYCG 4BBRG 3KYHC 4YCWA 2VQEL 2K5VA 1Y1WH 5BN4A 2UXDL 2BH8A 3U1KA 3MEFA 4IJHA 3CRKC 5KNDA 2CWAA 4QJFA 2UUAL 2LXKA 2WP8J 4GNXB 1SLJA 2KCCA 5EAYA 3AFQA 4OWTB 4DK3C 1XNQL 1YNNC 1JE5A 3TZUA 3STBC 3CCMA 1VQ7A 4A3MG 2HT1A 4NXNL 2CTMA 2QF7A 4G7ZC 1VQ8A 1VQJA 3H0GH 3U50C 2I0QA 2HIVA 4A3GG 3A5ZB 2VQFL 2CQOA 3H3VI 1X3GA 4R4TA 4ALPA 2JK8A 5C4JH 1HZCA 2OCEA 3BU2A 3Q8DA 1QVFA 3UDGA 2UXBQ 2NN6H 2WAQE 2B63G 4GKJL 3P20A 2R7ZH 5DLQE 4YWLA 3QG1A 4XIGS 3E9HA 4DR5Q 1VQ9A 1JJGA 4GN3B 4PZ8A 1XTDA 3FMCA 4BY1G 3S1MH 4TVAB 1PH5A 1K8AC 1N34Q 1PH1A 1VQLA 4GKKL 4A76A 5C4XG 4KMUC 4H0LC 1E22A 2ZTCA 4DV7L 4NB3A 3S1RH 2ES2A 3OTOQ 4C3JH 2UXDQ 1Z7TA 4DNRB 1NY4A 3M4PA 5GAHC 4KKTA 2PNHA 1KAWA 3BZCA 1VQKA 1M1KC 2R7DA 3CCJA 1EOVA 3AEVA 1ZTGA 1IYVA 3M7NA 1I94L 1X65A 3W5OA 1A8VA 1CFMA 4X66Q 1PA6A 1UE7A 3GTKH 4BBSH 4AM3A 1FVIA 1YHQA 4IOAA 4DV7Q 5LMUQ 2B8FA 5C0XH 1V9PA 4L5TA 1QZGA 1TWCH 2DN8A 4GLXA 4HJ5A 3TREA 5K36H 5C44H 2YV5A 2ZJPA 1QVGA 4LF6Q 4JYAL 2PI2E 2D0PA 4LF5Q 1CI3M 1H9SB 4GLVB 4JOIA 1VF5C 1SROA 4PZ7A 4YCVA 1VQMA 1PH7A 1KQSA 4PG3A 3RZDH 4DK0A 2ZTDA 3LGJA 1J5EL 3AB9A 4KN4C 4GKKQ 2UUBQ 1ZYRC 1GHJA 1H9SA 3RNUA 4LUOA 1WFQA 1B70B 4LFCQ 2QGQA 4IFDG 4R4CA 4DK6C 5M5YH 4A3IH 4JVHA 2A68D 1A0IA 3G4SA 3PUZA 1GO3E 3F1ZA 3PO3G 4B3TL 3GDEA 2Q2HA 4DV6L 1N32L 2UXCQ 1IXRA 3GTLH 4K0KL 1OXXK 1E7ZA 1HZAA 2EQSA 2VQFQ 2E75C 2UUBL 5M3MH 4DR4L 5LMUL 4LF7L 1IW7C 2LMCB 4C2MH 4DR3Q 4B3RL 2E2HH 2JA6G 3HOVH 1FR3A 1SMYC 1CTMA 1L2FA 4R1JA 5IYDG 2NVQH 4JYAQ 4I7ZC 1TXYA 4A3KG 4GKJQ 3I4MH 3MXUA 2UUCQ 2D5DA 4YWMA 1Q8KA 1RL2A 1GUOA 4A3GH 3K80C 4LFBQ 4DV5Q 4Y52H 3PUYA 5C0XJ 1XMOL 1TU2B 4K0KQ 3S2DH 4DR7Q 5KNBA 3IKJA 2L15A 3MXNB 4JC0A 4B3ML 1AH9A 4HIOA 1HR0Q 4QL5A 3TRZA 4IPDA 3CAMA 1PH2A 1CKMA 1C7YA 1BDOA 3S1NH 3S2HH 4AIMA 3CMAA 1IYJB 3DM3A 4DV0Q 4DV4Q 3PUWA 4AYBG 3HOXG 3K7UC 2DNCA 2F4VQ 4KN7C 2JA7H 3HOYH 1FYCA 3I73A 1XPRA 2UUAQ 1VQNA 1HNWQ 2OTJA 5C4XH 3ERSX 1K1GA 1NMFA 2N3SA 2JA8G 4TKOB 3S16H 3KDFB 3LWUA 2KENA 4B3MQ 4DK1A 4APVA 4LIJA 4KKSA 1WJJA 1J6QA 1X56A 3FHWA 1U0LA 4DR4Q 3KJPA 3CC4A 1VQHA 2IY5B 4IPGA 1JJCB 2JEBI 2K5NA 4GLAC 4X65L 4BY7G 2CKZB 4KI0A 3HKSA 4GN4B 5C3EH 4BA2I 4PV1C 4JBJA 3I7FA 5JJLA 2I5LX 2R93H 1PH4A 3CCEA 1E1OA 5IWAQ 2K52A 3I2ZA 3H94A 4X64L 3JAMc 3NBHB 3OW2A 2ID0A 1FJGL 2KHIA 4KHPQ 2O5JC 4QIWE 3J7A5 3T1HL 4A3LG 1RIPA 1VDZA 2K33A 3VR2A 2EXDA 3RLOA 5AJ3L 1VQIA 2E8GA 1S72A 4JI3Q 1SR3A 2D62A 1VQGA 2Y0SG 2ZTEA 3A5UA 2AWNA 4J15A 1SRUA 2DUDA 3NELA 1N8RC 3S15H 4QMFB 2WB1G 4BXXG 1O7IA 5JJIA 4IFDH 4P74A 2VUMH 1NJIC 4JI4Q 1K3RA 3GQBA 2FXQA 1L0WA 4B3SQ 1VF7A 2R7ZG 1E3PA 4JI1Q 4GNXC 1VCIA 2MJHA 3VA7A 3A8JE 3IRBA 4L5SA 4OO1G 4C3HH 4X62L 5FJ8G 2QNDA 1IBLL 4LWCA 4B3RQ 1QVCA 3W1GA 2E5LQ 4C3IH 1EFWA 5ELOA 1YIJA 5IYBH 1Q7YC 1J5KA 2JEAI 5BN5A 4H13C 5E7NA 1PH8A 3CCVA 1X4NA 1FL0A 1OXSC 2NVXH 5IE8A 1HQMC 3BDOA 3JAMi 1DXMA 4IQZA 1Y69U 1HZBA 4B8TA 3KDFA 4LF6L 2PY9A 4JK1C 1V1QA 3KF6A 4P73A 5HGQA 3PIPA 4DV0L 3K8AA 1Z9FA 5JJKA 2PPBC 1VQ6A 4JCVE 1VQ4A 2ATWA 1MJCA 3GTQH 2HHHL 4DV3L 2RHSB 3ULPA 1Q86C 2JA5H 1VIHA 1LABA 2JE6I 2PQAA 2Y0SE 3UE1A 4YHHL 3KF6B 3J7ZC 1YI2A 2IX1A 3M3YH 4JI2L 1HNWL 4H02A 3FKIH 2EVBA 1U5KA 3CF5A 4DAMA 1H9JA 3HOXH 2BA0A 1EIFA 3CCRA 3RLFA 1ONLA 4MNOA 1XNRL 3OTOL 3HOVG 3KJOA 4DR3L 1GKHA 3AYHB 3KF8B 4DV2Q 2OPVA 1GD7A 1Y1WG 1N34L 1VQFA 1LYLA 1LACA 2A6HD 4LFCL 2AWOA 5FLMG 3UDFA 1OXTA 2QA4A 1Q82C 1J4WA 2O5IC 4Y7NH 1V43A 2L5TA 1MIUA 2EIFA 4LFBL 2VNUD 3PO3H 5BN3A 1K8OA 2OWOA 4WJ4A 1X3EA 1FJGQ 1I50H 5J3BA 2BDOA 1BKBA 4OWWB 3PIOA 3K7AH 1Q46A 3HKZE 1EYGA 1YJWA 2PMZE 4LJZC 3H3VH 1XMOQ 1ZZIA 3CQZH 1IBKQ 2ANNA 3EQLC 1QZHA 4A93G 3OW7A 3A7LA 5AJ3Q 2PQAB 2ZM6Q 5C0XI 4OWXB 5IYDH
chains in the Genus database with same CATH superfamily
1X0AA 4CDFC 4DAYB 4WJ3M 3NPPA 4NPSA 3FP9A 4BXXH 4ZCKA 2G9DA 2MP1A 2EY6A 2Z9HA 2F0IA 1YNJC 2K03A 4PZ6A 4HEDA 4DV2H 4DR5L 2NYZD 4OX9L 3C1FA 2RSOA 2F3VA 1T5XD 1RF2D 1BO0A 4EQ5A 1RJTA 5JEAJ 1G6PA 3OYYA 3HOWG 2DNEA 1SNOA 3W1BA 1TY0A 5IY0A 4ABNA 1SBBB 1F77A 4JV5Q 3TQYA 2FFMA 1HNXL 1KXLA 4YY3H 3H6MA 2IT1A 2KHSA 1II3A 1W3SA 1EY5A 2LXJA 1DTJA 1MD2D 2RSNA 4A3FG 2K5DA 3HZXA 2VUMB 2CPQA 1GJXA 3A0JA 5M3FG 4GNXA 3M9BA 1J5EQ 4DR1Q 4OX9H 1Y1VB 1WCMH 3I4NH 2KCNA 4LFAQ 3EIVA 3GD7A 3T16A 5IGEA 3GTJH 4LW1A 5E1FA 2PO4A 1HA5A 1D7QA 2LY7A 4FVMA 1K83H 4A93H 4K2LA 2R6GA 3I56A 1HFGA 5IGBA 1Q81C 1S5FD 4ME3A 1YJNA 4XTCS 2RQXA 3AMUA 2UXBH 1TWFB 3ULLA 5C3WA 1TS4A 2CPMA 3SE0A 1E1TA 5FO7B 1KIXA 2B29A 1G291 4L63B 1X54A 5GQOA 2DGRA 4CGYB 1YNXA 3V05A 4DAYA 3BVZA 4DR7L 4HIDA 5A2QW 4BY1B 2K7VA 3C1EA 4CBVA 4HJ7A 2ANRA 1KAAA 5GADC 4C3HB 1HH2P 2V4DA 1EWHA 1EU3A 1R9TH 3TP6A 2GVAA 3AFPA 4A3BB 3V96A 1PYSB 1UEBA 4DV7H 1F2ZA 3HOWH 1BBWA 3I70A 4JI8Q 4GOPA 2A69D 2YTXA 4XT3B 1TWCB 2XTIA 3MHBA 3RZOB 1B7YB 2Y0SB 4GS3A 1WTXA 3X3NA 3PO2G 4DV0H 1D8LA 1SNDA 2EDGA 3L3OC 3LNNA 1HNZQ 1PHJA 3S14B 1VQEA 4QUFA 4A3FH 2UU9Q 3KDGA 2PZTA 5GROA 2D0OA 2CH4A 2DGYA 2Q8TA 5EQ0A 1EWIA 3S16B 1WE8A 2JA8H 4C3JG 1KRSA 1PFSA 1EQQA 4HTHA 4ME5A 3UE0A 1VS0A 2K14A 4A3MB 2ALYB 2R7FA 1BVSA 1L1OB 3VR4A 4GKJH 1LTGD 2MO1A 4KHZA 2CWPA 4P72A 4RCOA 1YBYA 1SNCA 1U4LA 5I2YA 2JA5G 3TS2A 3I72A 5A2QL 1KLUD 1PXUA 4X65Q 4K8IA 4G7HC 4A3JG 1Q3LA 3SK8A 2AQ2B 3FKIG 1L1OC 3SDZA 4JI3H 1Q12A 1NUCA 4IZ8A 3J80c 4IFDJ 1D5XC 1HNXH 2VQEH 4PMWA 4XYQA 3GTOH 4HCEA 2F4IA 4BBRB 5LHY1 1E2VA 4C56C 3NTIA 3VR5A 3VKEA 1N36Q 4DV1H 2CQAA 3CCQA 4AYBE 2NVYB 1WTHA 1S03G 1TWHH 3LWEA 4V190 3PSIA 4CDCC 5LMUH 4DN4M 3HOWB 4NXNQ 5IODA 2MQHA 2ZM6L 4OGQC 3K6OA 4JW0A 3HFZB 4QY7A 1STEA 5I6YA 5BR8Q 3S17H 4MHEA 5JJZA 3S14H 4FYDA 3BVMA 3U58A 2RCFA 3S1QH 2CW0D 4RGMA 4RHSA 3J81W 1EIHA 4LUVA 1W2BA 3PF4A 2N49A 4B3RH 3J80i 4BBSG 1DCZA 4JI8L 1A3UA 1BOSA 3BG3A 2GN5A 1AZPA 1PMRA 4JI0L 2LSSA 1ET9A 2IHEA 4A3MH 5I2XA 1WYDA 4AQYQ 1C48A 2JP1A 5FO8B 2AKWB 5DM63 2IX3A 4TQUS 5LMNL 2UU9L 4ZAIA 3CU7A 5IT9W 4GZYC 1SYEA 3A74A 1KRTA 4R8NA 2BH2A 2A73B 2WB1B 4B3TH 4UP9A 2WACA 4O0AA 1B50A 2HDLA 4FJUA 1WCMG 1P16A 4IPCA 2IHFA 4KTAA 1MSGA 3D4RA 1QB5D 5IP9H 1UE5A 3CCSA 1PH3A 1HRJA 1JICA 1K8GA 1ZZKA 1GUNA 3M85A 1N32Q 3DLLA 2EE1A 2HUGA 1I94Q 4J8QA 5E3FA 1Y8OB 1XMQQ 2O2LD 1Y8PB 4CDEC 4DR6Q 2ENBA 3MTSA 3DXJC 3NK9A 3GTPH 2F4VH 4JI7L 2F4VL 1XPOA 1ICWA 1LTAD 3GV6A 2A74C 4JG2A 2L0CA 4JV5L 2N8NA 4YCWA 2VQEL 1RTNA 2K5VA 3NBHA 3QOJA 2I46A 3MEFA 5KNDA 2UUAL 4DR4L 4OWTB 3FPUB 2X06A 2VB2X 4XQQA 5IT9L 4A3MG 2HT1A 3GTJB 2QF7A 3U50C 3I4NB 2HIVA 3A5ZB 2CQOA 2KQ3A 1SFOB 4R4TA 1BBXC 3R2IA 3FEWX 5C4JB 1BUVT 4OHJA 1VMCA 2WAQE 4YWLA 3QG1A 4Q5VA 5L37A 4DR5Q 2XWBB 3FMCA 5CV4A 4BY1G 4TVAB 5IOCA 1O7ZA 4GKKL 2R92B 3OTOQ 2AQ1B 3D6WA 4HSVA 4C3JH 1Z7TA 5GAHC 4KKTA 3AEVA 1M1KC 2R7DA 3J80W 4CDDC 1I94L 1X65A 4WJWA 3W5OA 4AM3A 4X66Q 1AN8A 4IOAA 5EKKA 1V9PA 4K0KH 1QZGA 5C44H 1QVGA 2ZJPA 4LF6Q 1NXUA 2PI2E 1PH7A 1SROA 4PQXA 4P2CB 1VQMA 1CT1D 3RZDH 5CORA 2NUCA 1BCPF 5FK9C 2QGQA 5CGKA 3PUZA 3KBGA 2F0EA 1E0BA 2SEBD 1IXRA 5DM73 3GTLH 1MI2A 4K0KL 1NCVA 4F7XA 1EFID 2VQFQ 1QG7A 5LMUL 4QIWB 1UNSA 2LMCB 4DR3Q 1PDQA 4B3RL 3HOVH 2NVQH 5IYDG 3OETA 4I7ZC 1RL2A 5DEHA 3PQIA 1TU2B 1EY4A 5KNBA 4EGVA 4OELB 2F0GA 1BDOA 1IYJB 3DM3A 4K14A 4AYBG 1AP0A 3HOXG 2JA7H 4KN7C 2BCOA 4JI1H 1HNWQ 2F03A 4OEMB 5C4XH 3ERSX 3E6ZX 2JA8G 3GTOB 3KDFB 4APVA 4KJNA 4LIJA 3FHWA 4DR4Q 1VQHA 4IPGA 1WCMB 2JEBI 4GLAC 4BY7G 4KI0A 5I6WA 4GN4B 4RGOS 1CK1A 1NR4A 4BA2I 4TSSA 1PH4A 4DV5H 3JAMc 4FF1A 1ESFA 1FJGL 2KHIA 5CYUA 2K33A 3S1NB 1PFBA 1PTOF 2Q8RE 2ZTEA 2AWNA 1I4GA 4BXXG 5I9OA 4DR5H 1L0XB 1EY0A 1K3RA 2FXQA 1E3PA 2UUAH 1SDFA 2B2UA 1W6JA 3IRBA 4X62L 2QNDA 1IBLL 1STHA 3W1GA 2HCIA 5J1ZA 1PH8A 5E7NA 2X6LA 2Z8LA 3RD4A 1HQMC 5J39A 4RKBA 1CA6A 1HZBA 4LF8H 4MN3A 4JK1C 4P73A 3KF6A 4DV0L 3PIPA 1HHVA 4FNFA 1DJRD 5IWAH 1U4MA 3BDCA 2PQAA 5FLXL 4JI2H 4B08A 3ERQA 4JI2L 3SHLA 4H02A 1BF4A 2IWHA 3O13A 1I4RA 4DAMA 1CZWA 3HOXH 2BA0A 4HN7A 4KY5A 4MNOA 1ONLA 2RA4A 3KJOA 4DV2Q 3SK4A 4JI4H 1MBYA 3OIQA 1Y1WG 1SEIA 4B3SH 1LACA 5FLMG 4LFCL 2K05A 2B2YA 4BS9A 5COYA 4LFBL 2EIFA 3PO3H 4Q0FA 4B9WA 2L12A 1CHQD 1FJGQ 4ZQ3A 5J3BA 1BKBA 2BDOA 1KLGD 3PIOA 3K7AH 2JA6B 1EEID 4AQYH 2FHTA 1I94H 3I4OA 2FFKB 3S2HB 3SGIA 3T53B 4A3KH 4HSPA 5G3LD 1KDBA 4FXKC 2HQEA 2B63B 2A1AA 3HOZG 5D65A 4GKKH 2OQ0A 3L9AX 1K3BC 1F2MA 2ASBA 3RZOH 3BZDB 2PQUA 2OQKA 2XVSA 1A6XA 2LTMA 1VIGA 5IP9G 2B2WA 1YZ6A 3FPPA 2FMCA 4JBKA 1CSQA 1SJHD 2EYMA 4O42A 2E2JB 3J7AF 4KHPL 2HD3A 1E24A 4H7BA 1KTKA 3G48A 4ILWA 2C9OA 1LTLA 3WDNA 1SFOH 3CQZB 1B1ZA 2RDHA 4G7OC 2E5LL 2NZHA 1I4PA 1O7LA 4S3SA 3N6RA 1F9PA 1JWSD 5IGGA 2ZXPA 3CC2A 2MPMA 5IIFA 2BE5C 2FJ2A 1JE4A 3OSOA 4ZRZA 5JPNC 4KY7A 4UP7A 2FINB 5LMNW 3T13A 1B8AA 1X32A 1X55A 2Z4IA 2ZJQA 4LF8Q 2R93B 2R61A 1K0RA 3C2PA 1MSZA 3VR3A 1WOCA 1UE1A 2HHHQ 3BJUA 1I6UA 1PVOA 4CKEA 2QILA 2F3WA 4A3JH 2WFWA 3HKZG 4QUCA 4UPAA 2N55A 4TRDA 3S2HH 3VA5A 2HQLA 1EY7A 3BYYB 1LTRD 1QUQB 4IFDI 4EVOA 3V2TA 3JAMW 2DJGC 2QDBA 2PYKA 2RHQB 4IUUA 3PGZA 3A8KE 2HDMA 4B3SL 4FXGC 4LF8L 4QMGA 4U68A 2F52A 1PH6A 2I5HA 4RCNA 1T9HA 4ZUIA 1XMQL 1WI5A 1HNZL 5FLXE 1HXYD 1I3QB 4RWSC 4DR2L 2F0LA 3ITPA 5HGTA 3GTMB 2BL5A 1MKHA 2F3IA 1YEZA 2NZ1D 4GOPC 4YHHQ 1HUNA 1XXGA 5IP7H 4AYBB 2VQEQ 4EC5A 4OD6A 2AUJD 2F1MA 1H9KA 1RTOA 4RHRA 4DV1Q 1IYUA 4RG1A 4H8AA 4OXPA 1X3PA 4IUVA 3W2DA 5IGFA 2UXDH 2KEDA 3K57A 2SOBA 2CTJA 4LK1C 3J7AK 1FGUA 2B3GA 3CMEA 2KVMA 3I90A 4P75A 4QCLA 3GR5A 3DMUA 4EX5A 4OL7A 4JI0Q 3T1HH 2IX0A 1IL8A 3E0EA 4DV3Q 2CTEA 1ZXTA 3H91A 3H15A 2CCZA 1EZ6A 4X6AH 2VXWA 4RAUC 1ZKOA 3T51B 4LF9L 5JVG3 3I4LA 2ZQEA 4DR1L 2O4CA 1ESRA 2AHOB 3TZDA 4OX9Q 2VZAA 4X66H 4DR1H 2M8WA 3D3RA 2YYZA 2XRSD 4C3IB 1AE3A 2IPKD 4A3EG 1FNWA 3W3AA 1LLRD 3J81j 4OO1I 5EBCA 1X4MA 1DYQA 2Y3MA 1MJEA 1B2TA 1YITA 1WHRA 1XYIA 4GN5A 2KBNA 4U673 4X65H 1PH9A 4N9PA 4XT1B 4WALA 3U4ZA 1VQAA 2Q2IA 1S40A 4DR6L 1PTOB 1LUZA 2D9IA 3TP8A 3X3MA 3TP7A 3EN2A 3I91A 2RF4A 2R3ZA 2VL6A 3R8BA 1GHKA 4C1NK 5FLMH 2OPUA 4C1NI 1D5MC 4QGUA 3K59A 1TUAA 1STAA 3FVQA 3QWNA 2NN6I 3JC66 4E9JA 3QR8A 2D2CC 1HTLD 2Z6KA 1B3AA 1EIYB 4B8CD 3C46A 3WWVA 4L5RC 5ELDA 2G9HD 2K5HA 4NXMQ 1K9MC 2R93G 2KOLA 4HIMA 4RH6A 1IBLQ 3K0XA 1Q1EA 2EJMA 2B63H 1PRTF 4JI6Q 5T1GA 2WV6D 4DPGA 3HOZH 1X3QA 5GAEC 5LL6X 2ZT9C 3M4YA 3PUXA 2CTKA 4DV6H 2E74C 3N52A 1QNKA 1OO9B 2BE5D 1Q8IA 3M7GA 1A3VA 2JA6H 4OO1H 3L0OA 4CJ0B 1ILQA 1C4QA 5CBEE 1NTGA 1FJGH 4RA8A 2GVBA 2UXDQ 2E2JH 2MJ8A 2NB0A 1NE3A 2WKCA 3KFUA 1EZ8A 1DT4A 4G57A 3HOUH 1I3QH 1S3OA 3ND8A 5KRUA 1WVNA 5C44G 1HPCA 5IWAL 1OTCA 5GAGC 3HOYG 1AZQA 3FDTA 4DAPA 4ZLTF 2OT2A 4DV4H 1G6ZA 3L7ZC 2Z6KC 5IT9E 3T1YL 2PW7A 4LF9Q 4I7AA 1TKWB 2CWFA 3CCUA 3PCOB 3V69A 3CXCA 5A35A 1WTJA 2MUYA 5IYCG 2B2UC 4DR4H 2UXDL 4DFAA 5I9PA 3U1KA 2TSSA 3R93A 4BY7B 2WP8J 1J5KA 1SLJA 4DK3C 2L1BA 1VQ7A 1U4RA 2PQEA 3T1YH 2M6QA 1RHPA 2VQFL 1U9RA 3H3VI 1V8CA 4DA2A 4NXNH 2JA7B 3BU2A 3KBXA 3UDGA 2NN6H 1EIGA 2B63G 2EYFA 4XIGS 3CKIB 1XWEA 3C3LA 5BR8H 2OEOA 4EQNA 1N34Q 5C4XG 2UXCH 4NB3A 3G7LA 3UI2A 1AFPA 2NVQB 1NY4A 3M4PA 1IKLA 2PNHA 1KAWA 4DR3H 4UDUC 3CCJA 1V1PA 5JOBA 2QEJC 5G3LF 3M7NA 5DT9A 1A8VA 1PA6A 5EKLA 4CJ2C 1EYAA 1JWUD 4DV7Q 5LMUQ 2B8FA 5CV8A 4A3GB 4GLXA 2DN8A 3J80L 4JYAL 3LX0A 3MZ5A 4LF5Q 1CI3M 4JOIA 1TT2A 4YCVA 3H3VC 4PG3A 4DK0A 1J5EL 4KY6A 4GKKQ 1ZYRC 1H9SA 2XRQD 2O4XA 1B70B 1SAPA 4KV6A 4NZRM 5M5YH 4A3IH 1PZID 2A68D 1B44D 1GO3E 3PO3G 1R4PB 4DV6L 5CC4A 3IL8A 5K5PA 2EQSA 2E75C 2H4OA 4LF7L 1IW7C 2E2HH 3PIP3 3GTQB 1DOKA 2EYOA 5D14A 4JYAQ 1EU4A 3I4MH 2UUCQ 4YWMA 1Q8KA 1GUOA 4A3GH 3K80C 3URYA 4DV5Q 1D1KA 4X64H 4DR7Q 2L15A 4B3ML 1AH9A 4KHVA 1VMPA 3CMAA 3D6CA 4DV0Q 2EYHA 1ILPA 3K7UC 2F4VQ 3UOEA 3I73A 1XPRA 1K1GA 1JQYD 3PMFA 2K01A 5CV7A 4DK1A 1QOHA 4B3MQ 4KKSA 4CJ1B 1X56A 1EY6A 2IY5B 1SNPA 3WOFA 3HKSA 1WTPA 3I7FA 1D6EC 4FF2A 5IWAQ 4ID6A 5ELBA 3J81L 1QE6A 4X64L 4JV5H 2ID0A 4XDXA 3J7A5 4KHPQ 3T1HL 1G91A 1SYBA 3VR2A 3RLOA 4JVHA 2E8GA 2ANNA 3S15H 3A5UA 4J15A 1SRUA 3NELA 2EY1A 1CQVA 4P74A 1NJIC 3K0YA 3R2TA 4GNXC 4I65A 1VCIA 3PO3B 3HS0C 4QB4A 4OO1G 3MXNA 4LWCA 2L9HA 4B3RQ 1QVCA 2E5LQ 2LKVA 5CV6A 1EYCA 3SK5A 5BN5A 1X4NA 1FL0A 2NVXH 5IE8A 1XMOH 1DXMA 5ELFA 4IALA 1Z9FA 5JJKA 1MJCA 4K5XA 1Q86C 1NR2A 1F9SA 1XTCD 2Y0SE 4YHHL 3KF6B 4YHHH 2F0QA 2EVBA 3WOEA 1H9JA 3QO2A 1XNRL 3SK6A 4DR3L 5FLXW 5KIXA 5C4XB 1LYLA 2QA4A 2AWOA 3UDFA 1LTID 1V43A 1MIUA 1KABA 4WJ4A 1X3EA 2KEEA 3E5SA 2WAQB 1EYGA 4LJZC 1XMOQ 3I3CA 5DAUA 5C3EB 1JC7A 3OW7A 4M8AA 1VQ6A 5IP7G 4DU9A 3BDLA 4O1NA 4ULLA 2ZJRA 1OXVA 1G51A 4FF3A 2VS1A 3U9OA 1SNMA 3NE5B 1KNEA 2BA1A 2F0WA 2IJ0A 3B6YA 1B4OA 3A7AB 2F0PA 3P7JA 1CHPD 3K5NA 1GUTA 2MNAA 1PRTD 3GKUA 1QWYA 3MXPA 4JI5H 2WB1E 3G6JB 2JA9A 1ZZJA 1XRHA 2NVYH 2CH4W 3CP0A 3K5OA 1GM5A 5IT9c 4AH6A 1ET6A 1JMCA 1HTPA 3I0PA 3EFXD 1XNQH 4X64Q 3J81c 1CSPA 1HR0H 1FKAH 4FDBA 5I4DA 1PFNA 1RD9D 3HKZB 1RDPD 2DY7A 2I5MX 1IBML 3NHHA 2AXYA 1LO5D 1DZ1A 1YVCA 4IUPA 4DV1L 1XJVA 2VUMG 1S5BD 3RF2A 4L5QA 4JI1L 4DXFA 3H0GB 4A3EH 1C0AA 2B2YC 3Q22A 2VY3A 1Y1VG 3H0GG 2QW7A 1PZJD 2K75A 4RFBA 3ZYYX 4JBMA 4X3UA 3I4MG 1JJ2A 4JI7Q 4LF4H 1CZGA 3TS0A 2K6AA 3DM1A 1R4QB 3R3OA 1IBMQ 5C44B 1UWVA 4A3JB 3KOJA 4JI2Q 3PF5A 5LMNQ 2UUCL 3ULJA 4FXDA 1Z6HA 4DUZH 2UUBH 3KLWA 3TSSA 2CFMA 2RKSA 1PRTC 3PV0A 4CKBA 1AEXA 1UAPA 2PCFB 4KD4A 1V9NA 2F0VA 4QQBX 3NUCA 3JAML 3J7AV 4LFAH 1BQQT 3RN2A 4NZTM 4NBQA 2NTSA 2EJGC 1Y8NB 3QIAA 3BZKA 2HH2A 1KHIA 1EUJA 2RDFA 3U4VA 4LF5H 4DR7H 1HCZA 2E76C 4XQJA 2JQOA 4IUTA 4NMZA 1YHBA 2B2VC 1IBKL 3HRZC 4R4IA 4WORA 4E6IA 4A3DB 1UUPA 1EWCA 3CRLC 5E4XA 1HR0W 2F0OA 2R7ZB 1Q90A 1V1PB 1KD1C 1JT8A 4ZK9B 1QNUA 1GOZA 4HJAA 4C3JB 2KHJA 2G5DA 4YY3L 3T4AC 1PYBA 2A5HA 3A56A 3F8TA 4X62Q 1VQOA 1DD2A 4X3KA 3AEVB 1F9RA 1S5ED 2CW0C 1CUKA 2CTFA 3E3XA 3OSSD 2H5XA 3K5MA 1VQPA 1RKNA 5H1SE 2B39A 2J0TD 2ICEC 2CWHA 2MHVA 1KHMA 1SYDA 3Q23A 1DM0B 1B3QA 1NBWA 1SYFA 4LNQA 2R92G 4G4KA 3J7YW 1DONA 3NQIA 3T56B 2K50A 4H44C 3NBIA 3S1QB 3DHQA 2YTVA 3OWFA 2LTLA 2YU9B 4A3CH 1NAPA 4A4IA 1EEFD 4K5VA 4MIUA 4HIKA 4A3BG 5M3MG 4CHTB 1GUSA 1I6HH 1I6HB 3S24A 4HJ8A 3NTHA 4DV5L 4JI5L 1JOOA 3BYTB 3HOUG 4YCUA 1ASZA 1NSNS 1HR0L 5CBAE 3HOUB 3Q6SA 5JEAH 5FLXc 1GUGA 1JB3A 2XNAC 3A8IE 4FJSA 2X6GA 1HQRD 2EJFC 3J80E 4BY1H 1PFMA 1WD1A 2PI2A 1M8AA 2IL8A 4YY3Q 4LFCH 3QJYA 2WIIB 4EQOA 1A2TA 3G71A 4DV6Q 4DUZQ 5E4WC 1N33Q 2GA4B 2RDGA 4OONA 3OOCA 1P8LA 1X3FA 5IYCH 2Z0SA 2B8GA 4R4QA 1CKNB 1H9RA 4DUYH 4XQNA 1I50B 3RUZA 4UY8C 5D3DA 1TWGH 3GO5A 5IGCA 2K4KA 1ASYA 1T5EA 3ER0A 4K6DA 1XMQH 5C3EG 3KF8A 5HY6A 4JBWA 3K7AB 1VQ5A 3FKIB 1PYWD 2NN6G 4A3LH 3TDQA 4FP5D 3ZJYC 1WTWA 3M3YB 1S5DD 2A69C 2EYJA 2MFIA 2VKCA 1V1OA 5HURA 3KDKA 1EYDA 4A75A 1O78A 3QD7X 4C3HG 3P75A 1ODHA 1STNA 2VW9A 4LF7Q 3CC7A 4POFA 1FD7D 3STBD 1TVXA 1TS3A 1YNND 4KK7A 3M4OH 1Y14B 5ELNA 5J22A 2A6HC 1QUQA 3RZDB 5AFWA 1WTQA 3MFYA 4R4OA 1PRTB 2JA7G 2AMCB 2C35B 3SEBA 4Z9CB 1KC8C 2YQRA 4L8JA 3D4DA 1VQDA 1I4HA 5M5XB 4A3IG 1B9NA 4DF7A 1TQOA 4IUNA 4BWGB 4XYOA 2TMPA 2BH8A 1ENAA 4F8MA 3CRKC 3NSWA 1EY9A 3GTLB 1SMYD 2LXKA 2KCCA 3AFQA 1YNNC 4IUQA 3TZUA 3STBC 3CCMA 2HCCA 4NXNL 1VQ8A 1O7YA 2XN9C 3H0GH 4A3EB 2I0QA 5LL6S 2P5ZX 4A3GG 4A93B 1BXTA 1F2LA 4ALPA 2JK8A 5C4JH 3HOYB 2OCEA 4DXGA 1QVFA 2UXBQ 3P20A 3KUPA 1VQ9A 3E9HA 1JJGA 2QCPX 1NNXA 4PZ8A 5C4HA 1XTDA 1HA6A 4G08A 1QCBD 1PH1A 1E22A 4H0LC 3VYRA 3PIO3 4DV7L 2Z4HA 2ES2A 2JA8B 2JN4A 2KECA 2LS01 1F0XA 3GP7A 3S1MH 1WD0A 3BZCA 1J5EH 1BCPC 2E2DC 4RKLA 2K04A 1IYVA 4PNYA 1W6KA 1CFMA 1UE7A 3GTKH 3GTKB 4FO2A 1YHQA 1SSOA 1STYA 1KNAA 1S20A 1TWCH 3TREA 5K36H 2YV5A 3GV3A 2HHHH 2F0MA 1LT3D 2OF1A 1JB7A 1CM9A 4PZ7A 4V0BA 5LMNH 5KGUA 1GHJA 3RNUA 2XWJB 4LUOA 1WFQA 1EC6A 4IFDG 4DK6C 1A0IA 2MGSA 2Z1CA 3KK7A 4B3TL 3GDEA 2UXCQ 3DEOA 5M3FB 1E7ZA 2J4XA 1HZAA 4BBSB 5M3MH 4DR2H 1I4XA 1FR3A 1M4VA 1SYGA 4A3KG 1TXYA 4ZKBB 1CQFA 1LTTD 5C0XJ 3RMHA 4K0KQ 4CKCA 3MXNB 1IBLH 3TRZA 3CAMA 3S1NH 3K58A 1TWAB 4DV4Q 2NTTA 1FYCA 2UUAQ 4NDXA 1ICFB 3NP8A 3NTKA 2L55A 1NMFA 2N3SA 5KYIA 3LWUA 2KENA 4IURA 1CA5A 5CR3A 1D5ZC 3KJPA 3CC4A 4NW2A 1JJCB 3DWPA 2K5NA 3M4OB 2NVXB 4JBJA 2XSCA 3QB3A 2JSOA 5JJLA 2I5LX 4K5WA 2R93H 5EPLA 1E1OA 4JVZA 3NBHB 2O5JC 2BDNA 1RIPA 1VDZA 2EXDA 1S72A 4POGA 4DGZA 4JI3Q 1VQIA 3DWQA 2R92H 2D62A 2Y0SG 4HCSA 1TS2A 4JPBW 4QMFB 1AW7A 4LF9H 1O7IA 4IFDH 4JI4Q 2PW5A 1N33H 1L0WA 2R7ZG 2MJHA 4JI1Q 4A3IB 3VA7A 3A8JE 5M5YB 4L5SA 4HAEA 4UAIA 5KYLA 1EFWA 5ELOA 2EPBA 2JEAI 4H13C 5F2DA 1OXSC 3I4MB 3F2UA 3FRPB 3BDOA 5IGDA 1DOMA 1TWGB 4IQZA 4A3KB 4B8TA 3HG9A 3KDFA 2PY9A 5HGQA 1KDAA 3K8AA 4JCVE 2ATWA 3DUZA 3GTQH 4DV3L 2JA5B 2RHSB 3ULPA 1VIHA 1LABA 2E2IB 2JE6I 3J7ZC 3UE1A 1YI2A 3IAYA 2NWGA 2Z6BA 3CCRA 1LTSD 1GKHA 2UU9H 1N34H 3AYHB 3KF8B 3MXGA 1YNJD 1N34L 2I07B 2A6HD 1HFNA 1OXTA 1Q82C 1K0SA 2AQ3B 4Y7NH 2VNUD 2L5TA 4QF4A 1K8OA 4LF7H 2NVTB 2A1SA 3NCVA 4N8X1 5FO9B 3HKZE 4JI8H 3CQZH 3EQLC 1QZHA 3QOLA 2PQAB 2ZM6Q 2D9UA 3MAQA 3HOVG 2UUCH 4DUZL 4LF6H 2LFNA 2A6EC 4A3DH 3EJIA 3D4WA 4BA1I 4JI4L 1EQRA 1S4ZA 2WKDA 4KLKA 3D0FA 1O80A 1H9MA 1YJ9A 2JVZA 3D31A 3AQQA 4B3TQ 1B53A 1LM0A 1A62A 1HNWH 3S1MB 1R9TB 5EJWA 1PV4A 4LUZA 2KCTA 5IYBG 4RMFA 5M5WB 1JCKB 5M5WH 4P71A 1OXUA 2WAQG 5JPMC 4WFN3 1ENFA 3GTGH 2PZUA 2K32A 1QJOA 4BY7H 3IFDA 4IJLA 1VBIA 1X9ZA 3K81C 4KKUA 4DKAC 3GTPB 2G8YA 2QDLA 2HIXA 4JI3L 1K73C 4ZYSA 2K1HA 1C8CA 1EQTA 3JAME 4A3CG 4BBRH 3NEMA 4IOCA 1NMGA 4OWXB 4A3BH 3FAUA 1A63A 2NVTH 3RLNA 2FMRA 4AQYL 3EA6A 3NENA 4RGNA 3I55A 3KLSX 1PTOD 2F0FA 5JEAG 1JR0D 2SNMA 3MEHA 4NXML 1YHAA 4L6TB 4OIKA 2NBFA 3CW2C 5C4ZA 1IKMA 1MHWC 1E2WA 2HH3A 5C0XG 2M00A 1U4PA 1TWFH 2PNRC 3NWSA 1D2BA 2P2RA 2K5WA 4IPHA 2JJQA 3PUVA 5FKAC 3SVMA 1AE2A 2OTLA 4JI6L 4A3FB 2A8VA 1FGBD 3KLRA 3F2CA 1CKNA 1SMXA 4NP5A 1IZ6A 2ZXRA 3TEHB 3S1RB 1PTOC 2UXBL 4Y7NB 3J81i 3VYSA 4O2DA 2UXCL 4JYAH 1EOTA 1UG8A 4NXMH 2X69A 5EBDA 4LF4Q 1N36L 5LL6b 4YIJA 2RCNA 1WTOA 1N9WA 3S17B 5ELEA 1K28A 2M2LA 4UP8A 4DNIA 1X6OA 1B9MA 4DV3H 1XNRQ 4YWKA 3HOXB 1PLFA 4X66L 2L11A 1SN8A 3A54A 5M5XH 3RN5A 1K8MA 4HJ9A 5DNFA 5M9OA 2KCMA 1Y1WB 2AUKA 1TWHB 1LT4D 1LV9A 1CKOA 1TS5A 1LT5D 5C5MA 1D1IA 1Z47A 5C6AA 1E2ZA 1SE3A 4ZKCB 1M90C 4JOIC 3MWYW 1L1OA 2Q8IB 2F0DA 4LAAA 2MO0A 3HGBA 5T1IA 1VQBA 1TWAH 3G6EA 1Z2IA 4PDBA 2Q2TA 1H95A 4WANA 4IN3A 5KNCA 3CCLA 1LTBD 3K5LA 2A6ED 2K1BA 2OXPA 2RBMA 4MZ9A 2F0JA 1GVPA 4B3MH 4HR7B 4K6LA 3IFTA 2YU9H 3CD6A 4ODGA 1X9NA 2K28A 1V8QA 5FJ8H 3UDIA 5C3XA 1EL0A 4C3IG 5M3FH 4GOPB 4DV4L 1I5FA 1IW7D 2NZOA 3I4NG 4DV2L 3AU7A 2XGTA 3UDXA 2WINB 4LF5L 1WTRA 5CV5A 3BVGA 3TBIB 3TN2A 2CHBD 3MA2B 4XXEA 1XNQQ 1DGSA 2N88A 1XPUA 1IL2A 5EPJA 2A68C 3S15B 1A3TA 4OCHA 3ONAB 3VYTA 3RR5A 2XIWA 3TMEA 3OIPA 1ML0D 3OMGA 3OTOH 3OPOA 1HNXQ 3E9IA 5NUCA 3SR1A 3L2PA 4LMQD 2JXMB 1N8RC 3CPFA 3F2BA 2A19A 3KLSA 2B2WC 1I4QA 1SNQA 2B2TC 4DR2Q 1HZ9A 3D8GA 2E3UA 1N32H 1TR5A 3GTMH 4LFAL 2ICIA 1BCPB 3A55A 1G8ZD 4LFBH 2N78A 2L4NA 2F0HA 2EOTA 3EBEA 4DR6H 3EVQA 1BR9A 1F9QA 1SE8A 1STBA 3OWEB 1UE6A 1Q1BA 4IO9A 4LF4L 3HEJA 3CHBD 4A3DG 1I6VC 1L0YB 1C9OA 4F87A 1BNZA 4KD3A 4F88A 3ICEA 4DNTB 2K5QA 3PO2H 1JWMD 3BS1A 1G2SA 1JOKA 2V1CC 2VQFH 2VB3X 4DUYQ 3NQTA 2E2HB 2YTYA 1Y1VH 4JI5Q 2JZXA 1SE4A 3H09A 2F0TA 3T1YQ 2KA7A 2CTLA 5BR8L 1KL9A 4N9TA 2Q2UA 5ISRA 2ZM6H 3VDYA 1N33L 2QEXA 5K36G 1VQCA 3VR6A 3M4QA 2IW3A 5EGTA 4OIJA 2KUMA 5D3IB 3U9SA 1HJPA 4MTKA 3ND9A 2EY5A 5EPKA 3T1HQ 2E2IH 3S2DB 2F0UA 3F2DA 3CPWA 2RVLA 1EY8A 3MVVA 4MTNA 1BBUA 1XX8A 4BBRG 3KYHC 3OMCA 1Y1WH 2F0SA 5BN4A 2E5LH 1UEAB 3NXWA 1A15A 4M1UB 2CWAA 4IJHA 4QJFA 3DEPA 4GNXB 1XNQL 5EAYA 3TP5A 4WRDA 1DOLA 1JE5A 3EZJA 1TY2A 2CTMA 4G7ZC 2EYPA 4JI7H 1SE2A 1VQJA 2H1EA 1FNUA 1SEBD 1X3GA 5FOBB 4KHPH 5CMDA 1HZCA 3Q24A 1IBMH 3Q8DA 2BOSA 1JOQA 4GKJL 2EZVA 2R7ZH 5DLQE 4GN3B 1PQXA 3J81E 1PH5A 1K8AC 4UHVA 1VQLA 4A76A 4KMUC 2SDFA 2ZTCA 3S1RH 4NKLA 4DNRB 1VQKA 1ZTGA 2LF0A 1EOVA 1WTVA 4K2KA 1QILA 4BBSH 1FVIA 1HUMA 4DAVA 4ZUJA 3DWAA 1IBKH 5C0XH 4J1MA 1WVLA 4L5TA 2JYOA 4HJ5A 4R9WA 1RODA 5EKIA 3VYUA 3GTGB 2M9VA 2D0PA 2FMMA 1H9SB 4GLVB 1VF5C 5CV9A 4B9XA 1KQSA 3MFGA 2ZTDA 3LGJA 3AB9A 4KN4C 2UUBQ 1GUWA 2J7ZA 1XNRH 4LFCQ 4R4CA 1S5CD 2DY8A 2F0NA 3G4SA 3F1ZA 1J9OA 1PZKD 1N32L 2Q2HA 2DJFC 4EQPA 1OXXK 5ELCA 4FF4A 2UUBL 5TSSA 5M3MB 3NWTA 4C2MH 2JA6G 1SMYC 1CTMA 1L2FA 4R1JA 5C5LA 4GKJQ 3MXUA 2D5DA 3E0JA 4Y52H 4LFBQ 3PUYA 2EXZA 1XMOL 4RGTA 3S2DH 3IKJA 4JC0A 4HIOA 1HR0Q 4QL5A 4JI0H 4IPDA 1LT6D 1SXTA 1CKMA 1PH2A 3S9WA 1C7YA 1ZYRD 4AIMA 4JI6H 3PUWA 4PMCA 3HOYH 2DNCA 2QKIC 2OTJA 1VQNA 2F0KA 4N8FA 3GABA 2CVRA 2PMZB 3SB1A 3I8ZA 4TKOB 3S16H 4HMIA 2B2TA 4X3SA 1WJJA 1J6QA 1J8IA 1U0LA 1SJED 4J6HA 4X65L 2CKZB 5JAVA 4K8JA 2KJXA 5C3EH 4PV1C 1A2UA 3CCEA 2B2VA 2K52A 3I2ZA 3H94A 3OW2A 1GXDC 4X3TA 4A3LG 4QIWE 1ENCA 5AJ3L 2FPHX 1SR3A 1VQGA 4JVYA 2DUDA 4HMJA 2WB1G 3EROA 5JJIA 2VUMH 3GQBA 2SNSA 4B3SQ 1VF7A 1ZEQX 1KDCA 3MC0B 5JVH3 4C3HH 5FJ8G 4C3IH 1RCVD 4PMBA 1N36H 4C2MB 1YIJA 1EQVA 5IYBH 1Q7YC 3CCVA 3JAMi 1Y69U 1SYCA 4LF6L 1V1QA 3P1HA 3Q0AA 2PPBC 1VQ4A 3HP3A 3HOVB 2HHHL 2JA5H 1FNVA 2EY2A 1K83B 2IX1A 3M3YH 1MSHA 1HNWL 3HOZB 1G2TA 3FKIH 1U5KA 1F2YA 1PTOH 3CF5A 1EIFA 2PT7G 1HNZH 3RLFA 2C5CA 3SXHA 3PO2B 3OTOL 5A2QE 1BCPD 1JORA 2EYLA 2OPVA 1GD7A 1VQFA 1J4WA 1STGA 2O5IC 5KEEA 4R8IA 5BN3A 1TIID 2OWOA 2ZXOA 2PZWA 1I50H 2LRRA 4OWWB 4X62H 4KJOA 1Q46A 1AN7A 1IHZA 1YJWA 2PMZE 3H3VH 1MGSA 1ZZIA 1IBKQ 4A93G 3A7LA 5AJ3Q 4DUYL 5C0XI 3OHXC 5IYDH
chains in the Genus database with same CATH topology
4DAYB 4WJ3M 3NPPA 4NPSA 3FP9A 4BXXH 2G9DA 2MP1A 2EY6A 2F0IA 1YNJC 2K03A 4PZ6A 4HEDA 4DR5L 2NYZD 4OX9L 3C1FA 2RSOA 2F3VA 1T5XD 1RF2D 1BO0A 4EQ5A 1RJTA 5JEAJ 1G6PA 3OYYA 3HOWG 2DNEA 1SNOA 3W1BA 1TY0A 5IY0A 4ABNA 1SBBB 1F77A 4JV5Q 3TQYA 1HNXL 1KXLA 3H6MA 2IT1A 2KHSA 1II3A 1W3SA 1EY5A 2LXJA 1DTJA 1MD2D 2RSNA 4A3FG 2K5DA 3HZXA 2VUMB 2CPQA 1GJXA 3A0JA 5M3FG 4GNXA 3M9BA 1J5EQ 4DR1Q 1Y1VB 1WCMH 3I4NH 2KCNA 4LFAQ 3EIVA 3GD7A 3T16A 5IGEA 3GTJH 4LW1A 5E1FA 2PO4A 1HA5A 1D7QA 2LY7A 4FVMA 1K83H 4A93H 4K2LA 2R6GA 3I56A 1HFGA 5IGBA 1Q81C 1S5FD 4ME3A 1YJNA 4XTCS 2RQXA 3AMUA 1TWFB 5C3WA 3ULLA 1TS4A 3SE0A 5FO7B 1E1TA 1KIXA 2B29A 1G291 4L63B 1X54A 5GQOA 2DGRA 4CGYB 1YNXA 3V05A 4DAYA 3BVZA 4DR7L 4HIDA 4BY1B 2K7VA 3C1EA 4CBVA 4HJ7A 2ANRA 1KAAA 5GADC 4C3HB 1HH2P 2V4DA 1EWHA 1EU3A 1R9TH 3TP6A 2GVAA 3AFPA 4A3BB 3V96A 1PYSB 1UEBA 1F2ZA 3HOWH 3I70A 1BBWA 4JI8Q 4GOPA 2A69D 2YTXA 4XT3B 1TWCB 3MHBA 3RZOB 2XTIA 1B7YB 2Y0SB 4GS3A 1WTXA 3X3NA 3PO2G 1D8LA 1SNDA 2EDGA 3L3OC 3LNNA 3S14B 1PHJA 1HNZQ 4QUFA 1VQEA 4A3FH 2UU9Q 2PZTA 5GROA 2D0OA 2DGYA 2Q8TA 5EQ0A 1EWIA 3S16B 1WE8A 2JA8H 4C3JG 1KRSA 1PFSA 1EQQA 4HTHA 4ME5A 3UE0A 1VS0A 2K14A 4A3MB 2ALYB 2R7FA 1BVSA 1L1OB 3VR4A 1LTGD 2MO1A 4KHZA 4RCOA 2CWPA 4P72A 1YBYA 1SNCA 1U4LA 5I2YA 2JA5G 3TS2A 3I72A 5A2QL 1KLUD 1PXUA 4X65Q 4K8IA 4G7HC 4A3JG 1Q3LA 3SK8A 2AQ2B 3FKIG 1L1OC 3SDZA 1Q12A 1NUCA 4IZ8A 4IFDJ 3J80c 1D5XC 4PMWA 4XYQA 3GTOH 4HCEA 2F4IA 4BBRB 5LHY1 1E2VA 4C56C 3NTIA 3VR5A 3VKEA 1N36Q 2CQAA 3CCQA 4AYBE 2NVYB 4V190 3LWEA 1TWHH 3PSIA 4DN4M 3HOWB 4NXNQ 5IODA 2MQHA 2ZM6L 4OGQC 3K6OA 3HFZB 4QY7A 1STEA 5I6YA 5BR8Q 3S17H 4MHEA 5JJZA 3S14H 4FYDA 3BVMA 3U58A 3S1QH 2CW0D 4RGMA 4RHSA 1EIHA 4LUVA 1W2BA 3PF4A 2N49A 3J80i 4BBSG 1DCZA 4JI8L 1A3UA 1BOSA 3BG3A 2GN5A 1AZPA 1PMRA 4JI0L 2LSSA 1ET9A 2IHEA 4A3MH 5I2XA 1WYDA 4AQYQ 1C48A 2JP1A 5FO8B 2AKWB 5DM63 2IX3A 4TQUS 5LMNL 2UU9L 4ZAIA 3CU7A 4GZYC 1SYEA 3A74A 1KRTA 4R8NA 2BH2A 2A73B 2WB1B 4UP9A 2WACA 4O0AA 1B50A 2HDLA 1WCMG 1P16A 4IPCA 2IHFA 4KTAA 1MSGA 3D4RA 1QB5D 1HRJA 1UE5A 5IP9H 3CCSA 1PH3A 1JICA 1K8GA 1ZZKA 1GUNA 3M85A 1N32Q 3DLLA 2EE1A 2HUGA 1I94Q 4J8QA 5E3FA 1Y8OB 1XMQQ 2O2LD 1Y8PB 4DR6Q 2ENBA 3MTSA 3DXJC 3NK9A 3GTPH 4JI7L 2F4VL 1XPOA 1ICWA 1LTAD 3GV6A 2A74C 4JG2A 2L0CA 4JV5L 2N8NA 4YCWA 2VQEL 1RTNA 2K5VA 3NBHA 3QOJA 2I46A 3MEFA 5KNDA 2UUAL 4DR4L 4OWTB 3FPUB 2VB2X 4XQQA 5IT9L 4A3MG 2HT1A 3GTJB 2QF7A 3I4NB 3U50C 2HIVA 3A5ZB 2CQOA 2KQ3A 1SFOB 1BBXC 4R4TA 3R2IA 3FEWX 5C4JB 1BUVT 4OHJA 1VMCA 2WAQE 4Q5VA 3QG1A 4YWLA 4DR5Q 2XWBB 3FMCA 5CV4A 4BY1G 5IOCA 4TVAB 1O7ZA 4GKKL 2R92B 3OTOQ 2AQ1B 3D6WA 4HSVA 4C3JH 1Z7TA 5GAHC 4KKTA 3AEVA 1M1KC 2R7DA 1I94L 4WJWA 1X65A 3W5OA 4AM3A 4X66Q 1AN8A 4IOAA 5EKKA 1V9PA 1QZGA 5C44H 1QVGA 2ZJPA 4LF6Q 2PI2E 1PH7A 4PQXA 1SROA 4P2CB 1VQMA 1CT1D 3RZDH 5CORA 2NUCA 1BCPF 5FK9C 2QGQA 5CGKA 3PUZA 3KBGA 2F0EA 1E0BA 2SEBD 5DM73 1IXRA 3GTLH 1MI2A 4K0KL 1NCVA 4F7XA 1EFID 2VQFQ 1QG7A 5LMUL 4QIWB 1UNSA 2LMCB 4DR3Q 1PDQA 4B3RL 3HOVH 2NVQH 5IYDG 4I7ZC 1RL2A 5DEHA 1TU2B 1EY4A 5KNBA 4EGVA 2F0GA 1BDOA 1IYJB 3DM3A 4K14A 4AYBG 1AP0A 3HOXG 2JA7H 4KN7C 2BCOA 1HNWQ 2F03A 5C4XH 3ERSX 3E6ZX 2JA8G 3GTOB 3KDFB 4APVA 4KJNA 4LIJA 3FHWA 4DR4Q 1VQHA 4IPGA 1WCMB 2JEBI 4GLAC 4BY7G 4KI0A 5I6WA 4RGOS 4GN4B 1CK1A 1NR4A 4BA2I 4TSSA 1PH4A 3JAMc 4FF1A 1ESFA 1FJGL 2KHIA 5CYUA 2K33A 3S1NB 1PFBA 1PTOF 2Q8RE 2ZTEA 2AWNA 1I4GA 4BXXG 5I9OA 1L0XB 1EY0A 1K3RA 2FXQA 1E3PA 1SDFA 2B2UA 1W6JA 3IRBA 4X62L 2QNDA 1IBLL 1STHA 3W1GA 2HCIA 5J1ZA 1PH8A 5E7NA 2X6LA 2Z8LA 3RD4A 1HQMC 5J39A 4RKBA 1CA6A 1HZBA 4MN3A 4JK1C 4P73A 3KF6A 4DV0L 1HHVA 3PIPA 4FNFA 1DJRD 1U4MA 3BDCA 5FLXL 2PQAA 4B08A 3ERQA 4JI2L 3SHLA 4H02A 1BF4A 2IWHA 3O13A 1I4RA 4DAMA 1CZWA 3HOXH 2BA0A 4HN7A 4KY5A 4MNOA 1ONLA 2RA4A 3KJOA 4DV2Q 3SK4A 1MBYA 3OIQA 1Y1WG 1LACA 5FLMG 4LFCL 2K05A 2B2YA 4BS9A 5COYA 4LFBL 2EIFA 3PO3H 4Q0FA 4B9WA 2L12A 1CHQD 1FJGQ 4ZQ3A 5J3BA 2BDOA 1BKBA 1KLGD 2JA6B 3K7AH 3PIOA 1EEID 2FHTA 3I4OA 2FFKB 3S2HB 3T53B 3SGIA 4A3KH 4HSPA 5G3LD 1KDBA 4FXKC 2HQEA 2B63B 2A1AA 3HOZG 5D65A 2OQ0A 3L9AX 1F2MA 2ASBA 3RZOH 3BZDB 2PQUA 2OQKA 2XVSA 1A6XA 1VIGA 5IP9G 2B2WA 3FPPA 1YZ6A 2FMCA 4JBKA 1CSQA 1SJHD 2EYMA 4O42A 2E2JB 3J7AF 4KHPL 1E24A 4H7BA 1KTKA 3G48A 4ILWA 2C9OA 1LTLA 3WDNA 1SFOH 3CQZB 1B1ZA 2RDHA 4G7OC 2E5LL 2NZHA 1I4PA 1O7LA 4S3SA 3N6RA 1F9PA 1JWSD 5IGGA 2ZXPA 3CC2A 2MPMA 5IIFA 2BE5C 2FJ2A 1JE4A 3OSOA 4ZRZA 5JPNC 4KY7A 4UP7A 2FINB 5LMNW 3T13A 1B8AA 1X32A 2Z4IA 1X55A 2ZJQA 4LF8Q 2R93B 2R61A 1K0RA 3C2PA 3VR3A 1WOCA 1UE1A 2HHHQ 3BJUA 1PVOA 4CKEA 2QILA 2F3WA 4A3JH 2WFWA 3HKZG 4QUCA 4UPAA 2N55A 4TRDA 3S2HH 3VA5A 2HQLA 1EY7A 3BYYB 1LTRD 1QUQB 4IFDI 4EVOA 3V2TA 2QDBA 2PYKA 4IUUA 2RHQB 3PGZA 3A8KE 2HDMA 4B3SL 4FXGC 4LF8L 4QMGA 4U68A 2F52A 1PH6A 2I5HA 4RCNA 1T9HA 4ZUIA 1XMQL 1WI5A 1HNZL 5FLXE 1HXYD 1I3QB 4RWSC 4DR2L 2F0LA 3ITPA 5HGTA 3GTMB 2BL5A 1MKHA 2F3IA 1YEZA 2NZ1D 4GOPC 1HUNA 4YHHQ 1XXGA 5IP7H 4AYBB 2VQEQ 2AUJD 2F1MA 1H9KA 1RTOA 4RHRA 4DV1Q 1IYUA 4RG1A 4OXPA 1X3PA 4IUVA 3W2DA 5IGFA 2KEDA 3K57A 2SOBA 2CTJA 4LK1C 1FGUA 2B3GA 3CMEA 2KVMA 3I90A 4P75A 4QCLA 3DMUA 4EX5A 4OL7A 4JI0Q 2IX0A 1IL8A 3E0EA 4DV3Q 2CTEA 1ZXTA 3H91A 3H15A 2CCZA 1EZ6A 4X6AH 2VXWA 4RAUC 1ZKOA 3T51B 4LF9L 5JVG3 3I4LA 4DR1L 1ESRA 2AHOB 3TZDA 4OX9Q 2VZAA 3D3RA 2YYZA 2XRSD 4C3IB 1AE3A 2IPKD 4A3EG 1FNWA 3W3AA 1LLRD 4OO1I 3J81j 5EBCA 1X4MA 1DYQA 1MJEA 1B2TA 1YITA 1XYIA 4GN5A 2KBNA 4U673 1PH9A 4N9PA 4XT1B 4WALA 3U4ZA 1VQAA 2Q2IA 1S40A 4DR6L 1PTOB 1LUZA 3TP8A 3X3MA 3TP7A 3EN2A 3I91A 2RF4A 2R3ZA 3R8BA 1GHKA 2VL6A 4C1NK 5FLMH 2OPUA 4C1NI 1D5MC 4QGUA 3K59A 1TUAA 1STAA 3FVQA 2NN6I 3QWNA 3JC66 2D2CC 1HTLD 2Z6KA 1B3AA 1EIYB 3C46A 3WWVA 4L5RC 5ELDA 2G9HD 2K5HA 4NXMQ 1K9MC 2R93G 2KOLA 4HIMA 4RH6A 1IBLQ 3K0XA 1Q1EA 2EJMA 2B63H 1PRTF 4JI6Q 5T1GA 2WV6D 4DPGA 3HOZH 1X3QA 5GAEC 5LL6X 2ZT9C 3M4YA 3PUXA 2CTKA 2E74C 3N52A 1QNKA 1OO9B 2BE5D 1Q8IA 3M7GA 1A3VA 2JA6H 4OO1H 3L0OA 4CJ0B 1ILQA 1C4QA 5CBEE 1NTGA 4RA8A 2GVBA 2UXDQ 2E2JH 2MJ8A 2NB0A 2WKCA 1NE3A 3KFUA 1EZ8A 1DT4A 4G57A 3HOUH 1I3QH 5KRUA 3ND8A 1S3OA 1WVNA 5C44G 1HPCA 5IWAL 1OTCA 5GAGC 3HOYG 1AZQA 3FDTA 4DAPA 4ZLTF 2OT2A 1G6ZA 3L7ZC 5IT9E 2Z6KC 3T1YL 2PW7A 4LF9Q 1TKWB 3CCUA 3PCOB 3V69A 3CXCA 5A35A 2MUYA 5IYCG 2B2UC 2UXDL 4DFAA 5I9PA 3U1KA 2TSSA 3R93A 4BY7B 2WP8J 1J5KA 1SLJA 4DK3C 2L1BA 1VQ7A 1U4RA 2PQEA 1RHPA 2VQFL 1U9RA 3H3VI 4DA2A 2JA7B 3BU2A 3KBXA 3UDGA 2NN6H 1EIGA 2B63G 2EYFA 4XIGS 3CKIB 1XWEA 3C3LA 2OEOA 4EQNA 1N34Q 5C4XG 4NB3A 3G7LA 3UI2A 1AFPA 2NVQB 1NY4A 3M4PA 1IKLA 2PNHA 1KAWA 4UDUC 3CCJA 1V1PA 5JOBA 2QEJC 5G3LF 3M7NA 1A8VA 1PA6A 5EKLA 4CJ2C 1EYAA 1JWUD 4DV7Q 5LMUQ 2B8FA 5CV8A 4A3GB 4GLXA 2DN8A 3J80L 4JYAL 3LX0A 3MZ5A 4LF5Q 1CI3M 4JOIA 1TT2A 4YCVA 3H3VC 4PG3A 4DK0A 1J5EL 4KY6A 4GKKQ 1ZYRC 1H9SA 2XRQD 2O4XA 1SAPA 4KV6A 1B70B 5M5YH 4A3IH 1PZID 2A68D 1B44D 1GO3E 3PO3G 1R4PB 4DV6L 5CC4A 3IL8A 5K5PA 2EQSA 2E75C 2H4OA 4LF7L 1IW7C 2E2HH 3PIP3 3GTQB 1DOKA 2EYOA 5D14A 4JYAQ 1EU4A 3I4MH 2UUCQ 4YWMA 1Q8KA 1GUOA 4A3GH 3K80C 3URYA 4DV5Q 1D1KA 4DR7Q 2L15A 4B3ML 1AH9A 4KHVA 1VMPA 3CMAA 3D6CA 4DV0Q 2EYHA 1ILPA 3K7UC 2F4VQ 3I73A 1XPRA 1K1GA 1JQYD 3PMFA 2K01A 5CV7A 4DK1A 1QOHA 4B3MQ 4KKSA 4CJ1B 1X56A 1EY6A 2IY5B 1SNPA 3WOFA 3HKSA 1WTPA 3I7FA 1D6EC 4FF2A 5IWAQ 4ID6A 5ELBA 3J81L 1QE6A 4X64L 2ID0A 4XDXA 3J7A5 4KHPQ 3T1HL 1G91A 1SYBA 3VR2A 3RLOA 4JVHA 2E8GA 2ANNA 3S15H 3A5UA 4J15A 1SRUA 3NELA 2EY1A 1CQVA 4P74A 1NJIC 3K0YA 3R2TA 3PO3B 4I65A 1VCIA 4GNXC 3HS0C 4QB4A 4OO1G 3MXNA 4LWCA 2L9HA 4B3RQ 1QVCA 2E5LQ 2LKVA 5CV6A 1EYCA 3SK5A 5BN5A 1X4NA 1FL0A 2NVXH 5IE8A 1DXMA 5ELFA 4IALA 1Z9FA 5JJKA 1MJCA 4K5XA 1Q86C 1NR2A 1F9SA 1XTCD 2Y0SE 4YHHL 3KF6B 2F0QA 2EVBA 3WOEA 1H9JA 3QO2A 1XNRL 3SK6A 4DR3L 5KIXA 5C4XB 1LYLA 2QA4A 2AWOA 3UDFA 1LTID 1V43A 1MIUA 1KABA 4WJ4A 1X3EA 2KEEA 3E5SA 2WAQB 1EYGA 4LJZC 1XMOQ 3I3CA 5DAUA 5C3EB 1JC7A 3OW7A 4M8AA 1VQ6A 5IP7G 4DU9A 3BDLA 4O1NA 4ULLA 2ZJRA 1OXVA 1G51A 4FF3A 2VS1A 3U9OA 1SNMA 3NE5B 1KNEA 2BA1A 2F0WA 2IJ0A 3B6YA 1B4OA 3A7AB 2F0PA 3P7JA 1CHPD 3K5NA 1GUTA 2MNAA 1PRTD 1QWYA 3MXPA 3G6JB 2WB1E 2JA9A 1ZZJA 2NVYH 3K5OA 3CP0A 1GM5A 5IT9c 4AH6A 1ET6A 1JMCA 1HTPA 3EFXD 4X64Q 3J81c 1CSPA 4FDBA 5I4DA 1PFNA 1RD9D 3HKZB 1RDPD 2DY7A 2I5MX 1IBML 3NHHA 2AXYA 1LO5D 1DZ1A 1YVCA 4IUPA 4DV1L 1XJVA 2VUMG 1S5BD 4L5QA 4DXFA 4JI1L 3H0GB 4A3EH 1C0AA 2B2YC 3Q22A 2VY3A 1Y1VG 3H0GG 4RFBA 1PZJD 2K75A 4JBMA 3ZYYX 3I4MG 4X3UA 1JJ2A 4JI7Q 1CZGA 3TS0A 2K6AA 3DM1A 1R4QB 3R3OA 1IBMQ 5C44B 1UWVA 4A3JB 3KOJA 4JI2Q 3PF5A 5LMNQ 2UUCL 4FXDA 3ULJA 1Z6HA 3KLWA 3TSSA 2RKSA 2CFMA 1PRTC 3PV0A 4CKBA 1AEXA 1UAPA 2PCFB 4KD4A 2F0VA 4QQBX 3NUCA 3JAML 3J7AV 1BQQT 3RN2A 4NBQA 2NTSA 2EJGC 1Y8NB 3QIAA 3BZKA 2HH2A 1KHIA 1EUJA 2RDFA 3U4VA 1HCZA 2E76C 4XQJA 4IUTA 2JQOA 4NMZA 1YHBA 2B2VC 1IBKL 3HRZC 4R4IA 4WORA 4E6IA 4A3DB 1UUPA 1EWCA 3CRLC 5E4XA 1HR0W 2F0OA 2R7ZB 1Q90A 1V1PB 1KD1C 1JT8A 4ZK9B 1QNUA 1GOZA 4HJAA 4C3JB 2KHJA 4YY3L 3T4AC 2A5HA 1PYBA 3A56A 3F8TA 4X62Q 1VQOA 1DD2A 4X3KA 3AEVB 1F9RA 1S5ED 2CW0C 1CUKA 2CTFA 2H5XA 3K5MA 1VQPA 1RKNA 5H1SE 2B39A 2J0TD 2ICEC 2MHVA 1KHMA 1SYDA 3Q23A 1DM0B 1SYFA 1NBWA 4LNQA 2R92G 3J7YW 4G4KA 1DONA 3NQIA 3T56B 4H44C 2K50A 3NBIA 3S1QB 3DHQA 3OWFA 2YTVA 2YU9B 4A3CH 1NAPA 4A4IA 1EEFD 4K5VA 4MIUA 4HIKA 4A3BG 5M3MG 4CHTB 1GUSA 1I6HH 1I6HB 3S24A 4HJ8A 3NTHA 4DV5L 4JI5L 1JOOA 3BYTB 3HOUG 4YCUA 1ASZA 3HOUB 1NSNS 5CBAE 1HR0L 3Q6SA 5JEAH 5FLXc 1GUGA 1JB3A 2XNAC 3A8IE 2X6GA 3J80E 1HQRD 2EJFC 4BY1H 1PFMA 1WD1A 2PI2A 1M8AA 2IL8A 4YY3Q 3QJYA 2WIIB 4EQOA 1A2TA 3G71A 4DV6Q 4DUZQ 5E4WC 1N33Q 2GA4B 2RDGA 4OONA 3OOCA 1P8LA 1X3FA 5IYCH 2Z0SA 2B8GA 4R4QA 1CKNB 1H9RA 4XQNA 1I50B 3RUZA 4UY8C 5D3DA 3GO5A 1TWGH 5IGCA 2K4KA 1ASYA 1T5EA 4K6DA 3ER0A 5C3EG 3KF8A 5HY6A 4JBWA 3K7AB 1VQ5A 3FKIB 1PYWD 2NN6G 4A3LH 3TDQA 4FP5D 1WTWA 3M3YB 3ZJYC 1S5DD 2A69C 2EYJA 2MFIA 1V1OA 5HURA 1EYDA 4A75A 1O78A 4C3HG 3P75A 1STNA 2VW9A 4LF7Q 3CC7A 4POFA 1FD7D 3STBD 1TVXA 1TS3A 1YNND 4KK7A 3M4OH 1Y14B 5ELNA 5J22A 2A6HC 3RZDB 1QUQA 5AFWA 1WTQA 3MFYA 4R4OA 1PRTB 2JA7G 2AMCB 2C35B 3SEBA 4Z9CB 1KC8C 2YQRA 4L8JA 3D4DA 1VQDA 1I4HA 5M5XB 4A3IG 1B9NA 4DF7A 1TQOA 4IUNA 4BWGB 4XYOA 2TMPA 2BH8A 1ENAA 4F8MA 3CRKC 3NSWA 1EY9A 3GTLB 1SMYD 2LXKA 2KCCA 3AFQA 1YNNC 4IUQA 3TZUA 3STBC 3CCMA 2HCCA 4NXNL 1VQ8A 1O7YA 2XN9C 4A3EB 3H0GH 2I0QA 5LL6S 4A3GG 4A93B 1BXTA 1F2LA 4ALPA 2JK8A 5C4JH 3HOYB 2OCEA 4DXGA 1QVFA 2UXBQ 3P20A 3KUPA 1VQ9A 3E9HA 1JJGA 2QCPX 4PZ8A 5C4HA 1XTDA 1HA6A 1QCBD 1PH1A 3VYRA 4H0LC 3PIO3 2JA8B 1E22A 2Z4HA 4DV7L 2ES2A 2KECA 2LS01 3GP7A 3S1MH 1WD0A 3BZCA 1BCPC 2E2DC 4RKLA 2K04A 1IYVA 4PNYA 1W6KA 1CFMA 1UE7A 3GTKH 3GTKB 4FO2A 1YHQA 1SSOA 1STYA 1KNAA 1TWCH 3TREA 5K36H 3GV3A 2YV5A 2F0MA 1LT3D 2OF1A 1JB7A 1CM9A 4V0BA 4PZ7A 5KGUA 1GHJA 3RNUA 2XWJB 4LUOA 1WFQA 1EC6A 4IFDG 4DK6C 1A0IA 2MGSA 2Z1CA 3KK7A 4B3TL 3GDEA 2UXCQ 3DEOA 5M3FB 1E7ZA 2J4XA 4BBSB 1HZAA 5M3MH 1I4XA 1FR3A 1M4VA 1SYGA 4A3KG 4ZKBB 1TXYA 1CQFA 1LTTD 5C0XJ 3RMHA 4K0KQ 4CKCA 3MXNB 3TRZA 3CAMA 3S1NH 3K58A 1TWAB 4DV4Q 2NTTA 1FYCA 2UUAQ 4NDXA 3NP8A 3NTKA 2L55A 1NMFA 2N3SA 5KYIA 3LWUA 4IURA 2KENA 1CA5A 5CR3A 1D5ZC 3KJPA 3CC4A 4NW2A 1JJCB 3DWPA 2K5NA 3M4OB 2NVXB 4JBJA 2XSCA 3QB3A 2JSOA 5JJLA 2I5LX 4K5WA 2R93H 5EPLA 1E1OA 3NBHB 2O5JC 2BDNA 1RIPA 1VDZA 2EXDA 1S72A 4POGA 4DGZA 4JI3Q 3DWQA 1VQIA 2R92H 2D62A 2Y0SG 4HCSA 1TS2A 4QMFB 1AW7A 1O7IA 4IFDH 4JI4Q 2PW5A 1L0WA 2R7ZG 2MJHA 4JI1Q 4A3IB 3VA7A 3A8JE 5M5YB 4L5SA 4HAEA 4UAIA 5KYLA 1EFWA 5ELOA 2EPBA 2JEAI 4H13C 5F2DA 1OXSC 3I4MB 3F2UA 3FRPB 5IGDA 3BDOA 1DOMA 1TWGB 4IQZA 4A3KB 4B8TA 3HG9A 3KDFA 2PY9A 5HGQA 1KDAA 3K8AA 4JCVE 2ATWA 3DUZA 3GTQH 4DV3L 2JA5B 2RHSB 3ULPA 1VIHA 1LABA 2E2IB 2JE6I 3J7ZC 3UE1A 1YI2A 3IAYA 2NWGA 3CCRA 1LTSD 1GKHA 3AYHB 3KF8B 3MXGA 1YNJD 1N34L 2I07B 2A6HD 1HFNA 1OXTA 1Q82C 2AQ3B 4Y7NH 2VNUD 2L5TA 4QF4A 1K8OA 2NVTB 5FO9B 3HKZE 3CQZH 3EQLC 1QZHA 3QOLA 2PQAB 2ZM6Q 3MAQA 2D9UA 3HOVG 4DUZL 2LFNA 2A6EC 4A3DH 3EJIA 3D4WA 4BA1I 4JI4L 1EQRA 1S4ZA 2WKDA 4KLKA 3D0FA 1O80A 1H9MA 1YJ9A 2JVZA 3D31A 3AQQA 4B3TQ 1B53A 1LM0A 1A62A 3S1MB 1R9TB 5EJWA 1PV4A 4LUZA 2KCTA 5IYBG 4RMFA 5M5WB 1JCKB 5M5WH 4P71A 1OXUA 2WAQG 5JPMC 4WFN3 1ENFA 3GTGH 2PZUA 2K32A 1QJOA 4BY7H 3IFDA 4IJLA 3K81C 4KKUA 4DKAC 3GTPB 2HIXA 4JI3L 1K73C 4ZYSA 1C8CA 1EQTA 3JAME 4A3CG 4BBRH 3NEMA 4IOCA 1NMGA 4OWXB 4A3BH 1A63A 2NVTH 3RLNA 2FMRA 4AQYL 3EA6A 4RGNA 3NENA 3I55A 3KLSX 1PTOD 2F0FA 5JEAG 1JR0D 2SNMA 3MEHA 4NXML 1YHAA 2NBFA 4L6TB 4OIKA 5C4ZA 1IKMA 3CW2C 1E2WA 2HH3A 5C0XG 2M00A 1U4PA 2PNRC 3NWSA 1TWFH 1D2BA 2P2RA 2K5WA 4IPHA 5FKAC 3PUVA 2JJQA 3SVMA 1AE2A 2OTLA 4JI6L 4A3FB 2A8VA 1FGBD 3KLRA 3F2CA 1CKNA 1SMXA 4NP5A 1IZ6A 2ZXRA 3TEHB 3S1RB 1PTOC 2UXBL 4Y7NB 3J81i 3VYSA 4O2DA 2UXCL 1EOTA 2X69A 5EBDA 4LF4Q 1N36L 4YIJA 2RCNA 1WTOA 1N9WA 3S17B 5ELEA 2M2LA 4UP8A 4DNIA 1X6OA 1B9MA 1XNRQ 4YWKA 3HOXB 1PLFA 4X66L 2L11A 3A54A 1SN8A 5M5XH 3RN5A 1K8MA 4HJ9A 5DNFA 5M9OA 2KCMA 1Y1WB 2AUKA 1TWHB 1LT4D 1LV9A 1CKOA 1TS5A 1LT5D 5C5MA 1D1IA 1Z47A 5C6AA 1E2ZA 1SE3A 4ZKCB 1M90C 4JOIC 3MWYW 1L1OA 2Q8IB 2F0DA 4LAAA 2MO0A 3HGBA 5T1IA 1VQBA 1TWAH 3G6EA 2Q2TA 1H95A 4WANA 4IN3A 5KNCA 3CCLA 1LTBD 3K5LA 2A6ED 2K1BA 2OXPA 2RBMA 4MZ9A 2F0JA 1GVPA 4HR7B 4K6LA 3IFTA 2YU9H 3CD6A 4ODGA 1X9NA 2K28A 1V8QA 5FJ8H 3UDIA 5C3XA 1EL0A 4C3IG 5M3FH 4GOPB 4DV4L 1I5FA 1IW7D 2NZOA 3I4NG 4DV2L 3AU7A 2XGTA 3UDXA 2WINB 4LF5L 1WTRA 5CV5A 3BVGA 3TBIB 3TN2A 2CHBD 3MA2B 4XXEA 1XNQQ 2N88A 1DGSA 1XPUA 1IL2A 5EPJA 2A68C 3S15B 1A3TA 3ONAB 3VYTA 3RR5A 2XIWA 3TMEA 3OIPA 1ML0D 3OMGA 3OPOA 1HNXQ 3E9IA 5NUCA 3SR1A 3L2PA 4LMQD 2JXMB 1N8RC 3CPFA 3F2BA 2A19A 3KLSA 2B2WC 1I4QA 1SNQA 2B2TC 4DR2Q 3D8GA 1HZ9A 2E3UA 1TR5A 3GTMH 4LFAL 2ICIA 1BCPB 3A55A 1G8ZD 2N78A 2L4NA 2F0HA 2EOTA 3EBEA 3EVQA 1BR9A 1F9QA 1STBA 3OWEB 1SE8A 1UE6A 1Q1BA 4IO9A 4LF4L 3HEJA 3CHBD 4A3DG 1I6VC 1L0YB 1C9OA 4F87A 1BNZA 4KD3A 4F88A 3ICEA 4DNTB 2K5QA 3PO2H 3BS1A 1JWMD 1G2SA 1JOKA 2V1CC 2VB3X 2E2HB 3NQTA 4DUYQ 2YTYA 1Y1VH 4JI5Q 2JZXA 1SE4A 3H09A 2F0TA 3T1YQ 2KA7A 2CTLA 5BR8L 4N9TA 1KL9A 2Q2UA 5ISRA 3VDYA 1N33L 5K36G 2QEXA 3VR6A 1VQCA 3M4QA 2IW3A 5EGTA 4OIJA 2KUMA 5D3IB 3U9SA 1HJPA 3ND9A 2EY5A 5EPKA 3T1HQ 3S2DB 2E2IH 2F0UA 3F2DA 3CPWA 2RVLA 1EY8A 3MVVA 4MTNA 1XX8A 1BBUA 4BBRG 3KYHC 3OMCA 1Y1WH 2F0SA 5BN4A 1UEAB 3NXWA 1A15A 4M1UB 2CWAA