3L7ZC

Crystal structure of the s. solfataricus archaeal exosome
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
222
structure length
222
Chain Sequence
b'QKIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKSGCSIFVANNGRIWATCPSRFSEEILIEAIRKIENESHIKGLTDRIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable exosome complex exonuclease 2
publication title Crystal structure of the S. solfataricus archaeal exosome reveals conformational flexibility in the RNA-binding ring.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase/rna binding protein
total genus 37
structure length 222
sequence length 222
chains with identical sequence F, I
ec nomenclature
pdb deposition date 2009-12-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3l7zC01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3l7zC02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 3l7zC03
2EVBA 1SN8A 1JT8A 1VF7A 1PVOA 2MJHA 4DR5Q 2VW9A 2CWPA 1JE5A 1H9SB 1Z9FA 5C3EG 2ZTCA 2N49A 2Z6KC 2CTMA 4A3KG 1FL0A 5FJ8G 1HR0Q 3F2DA 2N8NA 2B8FA 1XPUA 4K0KL 5GAEC 1K8MA 4DV0L 1Y14B 3STBD 1PYBA 1UEBA 2PPBC 1T5EA 3RN5A 4GOPC 4JOIC 4G7HC 3BG3A 2YTVA 1HNWQ 4JYAQ 2JXMB 1WFQA 2MO0A 5K36H 3TS2A 1HTPA 3I73A 2C35B 3M85A 3ND8A 1KRTA 4POFA 2QEXA 2KENA 3GDEA 4A3DH 3PF4A 4HIKA 1L1OA 3J81c 1HZCA 1CI3M 3BDOA 4R4IA 3CF5A 4QMFB 1GJXA 1FJGQ 4XIGS 2IT1A 1XNQL 1ZKOA 1A8VA 4JBWA 2UU9L 4JBKA 2PNRC 1YNNC 4RCNA 5GADC 4LJZC 1GD7A 1C0AA 2Q2UA 1TWAH 1VQLA 1VQ4A 4LF8Q 4DK0A 1OXSC 2MFIA 2MQHA 4DUYL 2R6GA 4TVAB 2VNUD 4B3TL 5M5WH 2LXJA 3U1KA 5IP9G 1ASZA 4HJ8A 2ID0A 1NMFA 3T1HL 1VQGA 1L0WA 4BY7G 3M4PA 5IP7G 1HNZQ 2ZM6L 1YITA 3I55A 2K5NA 4LF7L 2KBNA 1Q90A 1XMOL 1ZYRC 2BE5D 3GQBA 2E2HH 4KHPL 3G71A 2IY5B 3KDFA 4JBMA 4LFAQ 1J6QA 4NB3A 1IBMQ 5AJ3L 4P74A 2B63H 2A6HC 4DNRB 4JI8L 3F1ZA 1TWFH 5HY6A 2D5DA 3UE1A 5IYCH 4DR3Q 4PZ8A 4ALPA 5LMUQ 3PO3G 2H5XA 2BA1A 2LXKA 1PH9A 4JI5L 2PY9A 1YI2A 4IFDJ 3CCSA 4L8JA 4IJLA 1IYUA 4LF4L 1X56A 4X65Q 4K0KQ 4JG2A 4DV0Q 1YJNA 2E2JH 3VA7A 1WYDA 4H0LC 1I5FA 4YCVA 1KIXA 1K3RA 4R4OA 1Y1VH 3D4RA 1Q7YC 1X4NA 5GROA 3J80c 1QJOA 3I4NH 4GNXA 1FR3A 2A69D 1G51A 1QVCA 2VL6A 1YHBA 2DGRA 1S3OA 2AUJD 1CKOA 1HCZA 3I56A 1K0RA 2R92H 3NELA 3CD6A 2CQOA 4BY1G 1IW7C 1L1OC 3TRZA 1AH9A 4R4CA 3W1GA 2VY3A 1XNQQ 2JA7H 2D0PA 2UU9Q 3I2ZA 2NN6I 1L2FA 1X3FA 4EX5A 1OXUA 3WWVA 1CKMA 3UDGA 3HOZH 3RZOH 1EIFA 4QL5A 2HH2A 1IBLL 3GD7A 1PV4A 1XMQL 1IYJB 2YV5A 2NN6H 2GVBA 3SE0A 4YWKA 1UWVA 4A75A 4DUYQ 1I6VC 2K33A 1KRSA 4B3TQ 3CCLA 3PV0A 1EC6A 4GN3B 1E1TA 4A3DG 1W2BA 4TKOB 3CW2C 1X6OA 3T1HQ 3FPPA 1PH4A 3CMAA 2FMRA 2HQLA 5C4XH 2QA4A 2JA8H 4BA2I 2ZM6Q 2OQKA 3OOCA 4RMFA 1L1OB 3OW7A 4LF7Q 3CQZH 3FHWA 1XMOQ 4A3GH 2YTXA 1G6PA 1Q81C 4AM3A 2BDOA 2JA5H 3IFTA 3CCJA 3E9IA 4JI8Q 4O0AA 1VQIA 3RLFA 1B9MA 2K50A 4GN4B 4G7OC 1XNRL 3I4OA 3CC4A 1Q82C 4JI5Q 3HOYG 1N34L 2B29A 3A8IE 2D2CC 1I50H 1NE3A 1EQQA 2A1AA 5GAGC 4A3LG 4MZ9A 1X9NA 4B3ML 1SMYC 5JJLA 4JI4Q 1WJJA 4UP7A 2JZXA 1SE8A 1Y1WG 3CCUA 2YTYA 2I5MX 1V1QA 4GNXC 1D8LA 3KDFB 1IL2A 2K5VA 2QNDA 2HIXA 4JOIA 2A8VA 2O5IC 1WVNA 4A3IG 1K8AC 5C44H 1VQ5A 1VQ7A 4BXXH 2E2IH 1TKWB 2VQFL 1DT4A 2OCEA 1H9KA 1VQAA 4LF9Q 2CFMA 2BL5A 4UP8A 4X6AH 3IKJA 1Y1VG 3UDXA 3VR4A 3PUVA 4X64L 1T9HA 1XMQQ 1QZGA 3RLNA 5IYDG 2KA7A 1MKHA 2R7ZH 4A93G 2HT1A 2UUAL 4X62L 5JEAH 2EJFC 2EDGA 1X3EA 2HHHL 2E8GA 1KXLA 4NBQA 3A8JE 4QQBX 4PZ6A 2ATWA 1PMRA 2A68D 2JA7G 1B7YB 2EQSA 3GTQH 1VQKA 4DR4L 2N3SA 4JI0L 2JA9A 2OQ0A 5JJKA 1A0IA 2NN6G 1X55A 4WJ4A 2D0OA 1E22A 3A74A 2I5HA 1QUQA 4KKSA 2IX1A 1GUSA 1KD1C 3JAMc 2HH3A 3VKEA 1IBKL 3S2HH 1YBYA 2ZTEA 2UXCL 2OTLA 5E7NA 5C0XI 3CPFA 2MNAA 3QIAA 1DTJA 2K4KA 1K8OA 2DGYA 3L0OA 3J81j 2DNCA 3F2CA 4B3RL 3CCQA 1N34Q 3S1NH 1PHJA 1X3GA 4JV5L 1D7QA 3AFQA 3AFPA 4A3MH 3RZDH 1ASYA 2K52A 4B3MQ 4DR7L 2NVQH 2VS1A 4DV1L 3PF5A 4JK1C 1WCMH 1VIGA 3S1RH 2AWOA 1GHKA 3T1YL 3T53B 4DV2L 4JBJA 4GLAC 4P75A 3WDNA 1P8LA 5A35A 1XTDA 3S17H 1LUZA 1Y8NB 1Y8PB 2F52A 3CCVA 2VQFQ 4OX9Q 1Z47A 1MIUA 2CTFA 2UUBL 5IY0A 3KOJA 4LUVA 4A4IA 1PH3A 2Q2TA 1B8AA 1B9NA 1H95A 3I4LA 3PIOA 4KMUC 1EFWA 2IHEA 3T51B 1A6XA 4LFCL 5FLXc 3NBHB 4X64Q 4DV5L 2A6EC 4DR6L 5J3BA 3H94A 1IYVA 1HZ9A 2ZJRA 2PI2A 2PNHA 1X54A 4JI6L 2UUAQ 2KCTA 3I7FA 2VUMH 1ZZIA 4LF5Q 2HHHQ 3RNUA 4GKKL 3M3YH 4GOPB 4KN4C 1VQ9A 2AHOB 3KLWA 1ONLA 3HKSA 3K7UC 4A3JH 4IQZA 3VR5A 2F4VL 3M4YA 4PV1C 3PIPA 2E76C 3HOVG 3ULPA 1DGSA 1Q46A 4DR4Q 2CPQA 3L2PA 1CKNB 4QY7A 1HH2P 4JI0Q 1N36L 1ZZJA 1Z6HA 1VQDA 1MJCA 4NXML 1ZZKA 3AB9A 1EWIA 2ANRA 3S24A 4X66L 4DUZL 2OWOA 4PZ7A 5JEAG 2EJMA 4KN7C 4KI0A 1EWHA 1X65A 4KLKA 3EQLC 1JMCA 4KKTA 1VQBA 1XPRA 3ERSX 4P73A 1VQ8A 2UXCQ 3CP0A 1I94L 2FXQA 1E24A 3PO2H 2L5TA 1TWGH 3A7LA 2WAQG 1QVFA 4B3RQ 1BVSA 5C4JH 2UUCL 4QJFA 3RR5A 1N33L 1M90C 3KLRA 4JV5Q 4IPDA 2K32A 3M7NA 4DR7Q 4DV1Q 1PYSB 4LK1C 3GO5A 3W1BA 5BN4A 1JJGA 3AQQA 2CTJA 4GKJL 4NXNL 2I5LX 1Y69U 2Z0SA 3T1YQ 1CFMA 1FYCA 2JJQA 1QUQB 4DV2Q 4DV6L 2Q8IB 4NPSA 1TWCH 1N32L 4R1JA 4J15A 1O7IA 4OO1G 3MEFA 2RHQB 5C0XG 2AXYA 3EBEA 4IPCA 2UUBQ 1FGUA 3RN2A 2NZOA 4OWTB 1Q12A 4OONA 1VQHA 4A3MG 1U5KA 4A3FH 4L5SA 3AEVA 5IYBH 4LFCQ 3GTLH 4DV5Q 5HGQA 1NMGA 4OGQC 1S72A 4C2MH 4DR6Q 2YU9H 1AE2A 4YWMA 3PGZA 1MJEA 2VQEL 4BBRH 1LTLA 5M5XH 4DV4L 1E2VA 2WAQE 2ZJQA 4YCUA 5K36G 4GKKQ 3LWUA 1BBWA 2Q2HA 2E75C 3BZCA 5ELOA 2F4VQ 2F3IA 2R7DA 3KJPA 3T56B 4IPHA 1NY4A 2WB1G 3QJYA 1Z7TA 1N36Q 3E0EA 5M3FH 3UDFA 1PFSA 3OTOL 2YYZA 4NXMQ 3OYYA 4TQUS 4AH6A 1VF5C 3K0XA 4X66Q 1JJCB 4DUZQ 4A3CH 3F8TA 2A19A 1E3PA 2ZT9C 4IFDI 1U0LA 3U9SA 4G7ZC 1JJ2A 1I94Q 4XTCS 5LMNL 3KF6A 4KHPQ 1KQSA 3CCMA 5LMNW 5H1SE 2IHFA 2ZTDA 4A3JG 4YHHL 2KCMA 5AJ3Q 3S2DH 4IFDH 2N78A 3LGJA 1FVIA 3S16H 4KHZA 1TWHH 1N33Q 4I7ZC 2PQAA 3CRKC 2A6HD 1BDOA 2ES2A 4JVHA 3ND9A 1VIHA 1Q1BA 4A3KH 5FJ8H 4GKJQ 1O78A 2CCZA 1YNJC 4LF4Q 3CAMA 4H44C 2BH2A 4DV6Q 1N32Q 3PUZA 1LACA 2NZHA 2BH8A 2B63G 2WB1E 1VQPA 2AKWB 2R7FA 1W3SA 1IXRA 5IYCG 2CKZB 4IJHA 2JVZA 3G6EA 1GUGA 1J5KA 3GTKH 1RL2A 3STBC 4WANA 1HR0L 5FLMH 5KNCA 4HJAA 1VQOA 3GTOH 3M4OH 2VQEQ 2JEBI 1PH1A 1IW7D 3H0GH 1TXYA 1GUOA 4DR1L 3A5UA 4POGA 3I4NG 3J81i 1IBLQ 4LW1A 4BA1I 3D0FA 3SDZA 4LUZA 3VDYA 3UDIA 5IT9c 4OWWB 3LNNA 4GNXB 4WJ3M 1V8QA 4JVYA 3K81C 5GQOA 1SROA 1LM0A 2E74C 2R92G 4PMWA 4BY7H 3OTOQ 5DLQE 3ZJYC 5IP7H 1CTMA 3AEVB 4AQYL 3PUYA 3F2BA 4HIMA 1XPOA 3FP9A 4LF8L 3HOZG 2GVAA 3S1QH 4A3BH 4IOCA 2CTLA 2RHSB 3HOUH 1RIPA 1HNXL 4DAMA 5LMNQ 1S40A 1KAWA 4YHHQ 1KL9A 4Y52H 2QF7A 4IO9A 1UE5A 2D62A 3MXNB 1SMXA 3VR6A 3U50C 1VQFA 4C3JH 3U4VA 1XNRQ 4WALA 1HQMC 1HNZL 3S1MH 2AMCB 4GLVB 2AWNA 5C4XG 2JA8G 2JEAI 4A3CG 3ULJA 3ICEA 1WE8A 3TS0A 1YEZA 4A3GG 1OXTA 2NVXH 1HZAA 1J5EL 5IE8A 2JA5G 4JCVE 1UE7A 4DNIA 4YY3L 4L5QA 3MXUA 1PH5A 1A63A 1DD2A 1VQNA 4RG1A 3H3VI 4DNTB 2WFWA 5LMUL 1J4WA 1B70B 3KF8B 3S14H 3J80i 2JQOA 5KNDA 2PQAB 4UPAA 3VR3A 3BU2A 3H3VH 1EUJA 3J7ZC 1YVCA 3DXJC 3CC7A 4BY1H 4X65L 2LMCB 3K8AA 3HOWH 4LF6L 2K5HA 1A62A 2XTIA 2KHJA 1YJWA 4C3IH 1K73C 2A69C 1IZ6A 2EIFA 2UXDL 4DR1Q 3I4MH 1WI5A 3EIVA 3L7ZC 1CSPA 4L5TA 3U4ZA 3W5OA 1EYGA 1NTGA 1CSQA 4ME3A 4X62Q 4A3EH 5C44G 4DV7L 4BXXG 1GM5A 2JK8A 2JA6H 3G4SA 3RLOA 5FLMG 3DLLA 3TQYA 3E9HA 3U58A 3PCOB 4R4QA 2DN8A 1G291 4AQYQ 1GUNA 2ZJPA 4BBSH 5M5YH 1VCIA 3H0GG 3DM3A 4AIMA 2R93H 4HJ5A 4JI3L 3TREA 1EQRA 2GN5A 3P20A 2F1MA 4GN5A 1HNXQ 3Q8DA 4LUOA 2JE6I 2KCCA 2OPUA 1YNXA 2R7ZG 2IX0A 1CUKA 3JC66 4GLXA 2I0QA 3W3AA 2RCNA 4PG3A 1IBKQ 1SR3A 2E5LL 2XGTA 2KHIA 1Q8KA 1EOVA 1GO3E 1BBUA 1V43A 4JI7L 2B3GA 3CCRA 2ASBA 3HOYH 1K9MC 3EN2A 1VQMA 4A3BG 4DK1A 3MFYA 2PMZE 4A3LH 2NVYH 3HOUG 1Q86C 2QGQA 1J5EQ 1NBWA 2V4DA 3CCEA 3HKZG 1Y1WH 1VQCA 1VDZA 4YY3Q 2BA0A 5BR8L 3I72A 1I6HH 1X4MA 3IRBA 4L5RC 3N6RA 5JJIA 1TUAA 1NJIC 3AYHB 4A3IH 4P71A 2K75A 3CXCA 5M3MH 1VQ6A 4DR2L 4LFBL 3G48A 4JI2L 4B3SL 2YQRA 3HOXH 1TU2B 4LF6Q 2AUKA 3NEMA 4LIJA 4JI4L 1HZBA 5BN5A 1H9MA 2UXDQ 1WCMG 1R9TH 1DXMA 1H9RA 1PH7A 5IYDH 3FKIH 4R4TA 4DV3L 4HIOA 4KKUA 4A93H 3GTGH 2A6ED 5BN3A 1VS0A 5IWAL 4HJ9A 3TZUA 4GZYC 4JI6Q 1QVGA 4JI1L 4EQ5A 4DV7Q 1P16A 4MTNA 3GTPH 1KHIA 1N9WA 2MO1A 3HOWG 2HIVA 4LF9L 3M4QA 3HKZE 1I3QH 3H15A 1YHAA 3OW2A 1YHQA 3I4MG 4JI3Q 3NENA 1VQJA 3A0JA 3V69A 1QZHA 4YWLA 2Y0SG 2K7VA 4LNQA 2LSSA 1E2ZA 3K7AH 4A3EG 2VUMG 3PSIA 2RF4A 2JA6G 2A68C 4H13C 3CPWA 3KYHC 4HIDA 2E5LQ 2CTKA 3HGBA 4BBSG 4AYBG 4UP9A 4JI7Q 2P2RA 3JAMi 2NVTH 2R93G 5JEAJ 1N8RC 4DK6C 2UUCQ 4UY8C 2O5JC 1H9SA 1HPCA 3M9BA 4APVA 2OPVA 4C3HH 4HR7B 1LYLA 2EXDA 1GVPA 5C3EH 5BR8Q 4NXNQ 3S15H 4DPGA 1KC8C 1ZTGA 1OXXK 2UXBL 2CW0C 3PO2G 3SGIA 3TEHB 2CTEA 4QIWE 4GS3A 1AE3A 3GTMH 1KHMA 2EJGC 4DR2Q 1OXVA 4LFBQ 4JI2Q 4B3SQ 1JB7A 2K14A 1YJ9A 1K8GA 4JC0A 2ANNA 4O2DA 2Y0SE 2Z6KA 4DR5L 4FDBA 4OXPA 1SLJA 5C0XJ 2ALYB 1PH6A 2B8GA 1PH8A 1HR0W 1UE1A 1K1GA 3A7AB 1SRUA 3UE0A 4A76A 4GOPA 1H9JA 4DV3Q 1LABA 5IWAQ 4AYBE 5M3MG 4DV4Q 4JI1Q 3ULLA 3GTJH 1HNWL 4JYAL 4OX9L 4MNOA 3HOXG 1CKNA 4IPGA 4LWCA 1YZ6A 1E7ZA 2Q2IA 4DK3C 5GAHC 3KFUA 1EIYB 4OWXB 1M1KC 3QG1A 3HOVH 4A3FG 1K83H 5IYBG 5IP9H 3KJOA 2L15A 4IOAA 3A5ZB 3A8KE 3VR2A 3NE5B 1FJGL 3FKIG 4P72A 4BBRG 1GUTA 3ER0A 1YIJA 1C7YA 3CC2A 4LF5L 3J7A5 3BJUA 1E1OA 3D31A 5KNBA 2CWAA 5ELNA 1Y8OB 2WP8J 5EAYA 1O7LA 3K80C 3HFZB 1UE6A 4B8TA 3OPOA 3PUXA 1SFOH 2PI2E 4H02A 1PH2A 4DAYB 4DKAC 2PQUA 1WOCA 5M3FG 2DUDA 1OTCA 2VZAA 4Y7NH 3PO3H 2PCFB 1Q1EA 1XJVA 1GHJA 2BE5C 3B6YA 1GKHA 1C9OA 4OO1I 1BKBA 1E2WA 3BZKA 3CRLC 3FMCA 4LFAL 4YCWA 2UXBQ 1IBML 1DCZA 2DNEA 4OO1H 1VQEA 1V9PA 5C0XH 1PA6A 4IFDG 4HJ7A 2E3UA 3CMEA 3KF6B 2OTJA 3PUWA 2V1CC 4QGUA 4DR3L 1HJPA
chains in the Genus database with same CATH superfamily
2EVBA 2VB3X 1SN8A 3QOLA 1JT8A 1VF7A 1PVOA 2MJHA 1XMQH 4DR5Q 5IGGA 3J81L 2X6LA 5EQ0A 2CWPA 2VW9A 1JE5A 1H9SB 3J81W 1Z9FA 1SDFA 5C3EG 2ZTCA 2N49A 2Z6KC 2SDFA 3HOVB 2CTMA 4A3KG 1FL0A 5FJ8G 1AZQA 1HR0Q 3F2DA 2N8NA 2B8FA 1XPUA 4K0KL 5GAEC 4F88A 1K8MA 1K83B 4XQNA 4DV0L 1Y14B 3STBD 1PYBA 1UEBA 3K5LA 2VXWA 2PPBC 1T5EA 3RN5A 1R4PB 5CBEE 4GOPC 3VA5A 3I3CA 1WTVA 4JOIC 3C46A 2X6GA 5T1IA 2YTVA 3BG3A 3L3OC 4G7HC 1HNWQ 4JYAQ 4B8CD 2JXMB 1WFQA 2MO0A 5IOCA 2ZQEA 1K0SA 5K36H 1CM9A 3TS2A 4C1NI 5DT9A 2SNSA 1HTPA 2C35B 1DYQA 3I73A 1LV9A 2XSCA 4M8AA 2BOSA 3M85A 3ND8A 2B2VC 1KRTA 1Q8IA 4FO2A 4POFA 4U68A 2C9OA 2QEXA 2KENA 2MP1A 3MWYW 3GDEA 2EYHA 4A3DH 3PF4A 4HIKA 1L1OA 3J81c 2F0UA 1HZCA 3DUZA 1CI3M 5JVH3 3BDOA 4R4IA 3CF5A 1XRHA 2K5QA 4QMFB 3OMGA 1SFOB 1GJXA 1FJGQ 3F2UA 3C2PA 4XIGS 1F2YA 2IT1A 1XNQL 1ZKOA 1A8VA 4JBWA 2UU9L 3X3NA 4JBKA 3E3XA 5FO8B 2PNRC 1RKNA 1YNNC 4RCNA 3TDQA 1JOOA 4FXKC 5GADC 4LJZC 1X9ZA 1GD7A 1C0AA 2Q2UA 1TWAH 1XNRH 1VQLA 1LTRD 4Y7NB 1VQ4A 3PO3B 4LF8Q 2MUYA 3K0YA 2L0CA 4DK0A 1OXSC 4CHTB 4HCEA 2MFIA 2MQHA 4DA2A 2Z1CA 4DUYL 2R6GA 4TVAB 4V190 1N34H 2VNUD 4B3TL 3TBIB 1V8CA 5M5WH 4RWSC 1RDPD 5EGTA 2LXJA 1HRJA 3U1KA 3LX0A 5IP9G 4B3MH 1ASZA 4HJ8A 2ID0A 1NMFA 3T1HL 2LF0A 1VQGA 1L0WA 4CDDC 2DY8A 4BY7G 1B3QA 3M4PA 1M4VA 5IP7G 1W6KA 1HNZQ 2PO4A 2ZM6L 1YITA 4HMJA 3I55A 2K5NA 4LF7L 2KBNA 1Q90A 1TQOA 1XMOL 1ZYRC 2FFKB 5KEEA 2BE5D 3GQBA 4KTAA 2E2HH 4KHPL 3E0JA 3G71A 5KYLA 2IY5B 3KDFA 4JBMA 4LFAQ 1ICFB 1T5XD 4QMGA 1J6QA 2VQFH 1PTOH 4NB3A 4HAEA 3J80L 1IBMQ 1S5DD 5ELCA 5AJ3L 3J80W 1UEAB 4P74A 3HZXA 3MEHA 4E9JA 2B63H 5I2YA 2HD3A 2A6HC 4JI8L 4DNRB 2R3ZA 3F1ZA 2E2DC 2Q8TA 1TWFH 1C8CA 5HY6A 2D5DA 3UE1A 5IYCH 2D9IA 3H6MA 2R61A 4DR3Q 4PZ8A 4ALPA 2IJ0A 4I65A 4X64H 1I4HA 4FVMA 5LMUQ 3PO3G 1WTOA 2H5XA 3NUCA 2BA1A 2LXKA 1OO9B 5E1FA 1PH9A 4JI5L 2PY9A 1YI2A 4IFDJ 3T16A 3CCSA 4QCLA 1GUWA 2WB1B 4L8JA 4IJLA 2F3VA 4ZLTF 1IYUA 2RA4A 3K57A 4LF4L 1X56A 3V2TA 4X65Q 2F0QA 4K0KQ 4JG2A 4DV0Q 2A5HA 1IKMA 1YJNA 2E2JH 2UUAH 4A3DB 1K28A 3VA7A 1WYDA 4X62H 1I5FA 4H0LC 4YCVA 1SNDA 2HHHH 1KIXA 2B39A 1II3A 1K3RA 4R4OA 3D8GA 4K5XA 1Y1VH 5C5LA 3D4RA 1Q7YC 1X4NA 5GROA 3J80c 1QJOA 3I4NH 4GNXA 1FR3A 2MGSA 1JQYD 2A69D 5EPKA 1EEFD 1G51A 1TWAB 1QVCA 2VL6A 1B1ZA 3J80E 3SR1A 1PTOC 1YHBA 4DR4H 4KJOA 2DGRA 5IGCA 4JI0H 1S3OA 1SYEA 1CKOA 2AUJD 1HCZA 4K6LA 4NP5A 3BYYB 3I56A 1K0RA 2R92H 1ICWA 1JWSD 3OSSD 5I9PA 1KABA 3NELA 5M5WB 1TY2A 3CD6A 1WTWA 2CQOA 4BY1G 1IW7C 3S9WA 1L1OC 3TRZA 1AH9A 4R4CA 3W1GA 3NQTA 2VY3A 1XNQQ 2JA7H 2D0PA 2UU9Q 1EYCA 3I2ZA 4L63B 4FF1A 2NN6I 1IBKH 1L2FA 1X3FA 2XVSA 4EX5A 1OXUA 3I90A 3WWVA 1CKMA 2UXCH 1U4PA 3UDGA 3HOZH 3RZOH 1E0BA 1EIFA 1TVXA 4QL5A 1RODA 4BWGB 2HH2A 1IBLL 3GD7A 2Z9HA 1PV4A 1XMQL 1IYJB 2YV5A 2RCFA 3MXNA 2GVBA 2NN6H 3CKIB 3EA6A 3SE0A 4YWKA 1LLRD 1PZID 1UWVA 3GV6A 5C3XA 1TY0A 2BCOA 1ZEQX 4A75A 4G08A 4DUYQ 4B3RH 1I6VC 2K33A 1KRSA 1NR2A 4B3TQ 1SNPA 2E2HB 1G2SA 3TMEA 3CCLA 3PV0A 5G3LD 4JV5H 1EC6A 3UI2A 4GN3B 1PTOB 1SNOA 3TP6A 4DXFA 1E1TA 2CH4A 4H8AA 1A2UA 4A3DG 1W2BA 3NWTA 4TKOB 3CW2C 4DR7H 1X6OA 2K6AA 2B63B 3T1HQ 4ZCKA 4FJUA 4DV1H 3FPPA 1PH4A 1D1KA 1I4GA 3CMAA 1U4RA 2B2TC 2HQLA 1WTJA 2FMRA 1IHZA 2PZWA 3TP5A 1TWFB 5C4XH 3R8BA 1D1IA 3SXHA 2QA4A 2JA8H 4BA2I 5ELFA 2OQKA 3OOCA 4RMFA 2G9DA 1L1OB 2ZM6Q 3T1YH 5COYA 4S3SA 3OW7A 4KY7A 3CQZH 3FHWA 4LF7Q 2A1SA 1XWEA 4DV2H 1PZJD 2SEBD 2QCPX 1XMOQ 4A3GH 2YTXA 1G6PA 1Q81C 4AM3A 2BDOA 2JA5H 2QILA 2EYJA 4ME5A 2F0NA 3IFTA 4IALA 3CCJA 4KHVA 2E2JB 2UUBH 2EYPA 1ILPA 1O7YA 1JWMD 3E9IA 2IPKD 4CDEC 4JI8Q 3KF8A 3J7AF 1KLGD 1VQIA 4O0AA 2JSOA 3MZ5A 1Y1VB 1B9MA 2K50A 3RLFA 4GN4B 4G7OC 3I4NB 1XNRL 5ISRA 4LFCH 4DV5H 3I4OA 4DAVA 2OEOA 1SYDA 4DR6H 1PRTF 2ZXRA 3CC4A 4FF2A 4K8IA 1Q82C 4JI5Q 3HOYG 2F0FA 1N34L 1ESRA 2B29A 1BCPD 3A8IE 1QNUA 3H91A 4XQJA 3K6OA 1I50H 2D2CC 1NE3A 3NBHA 1EQQA 4JI6H 2SNMA 3EZJA 2A1AA 5GAGC 4ZKBB 4A3LG 4MZ9A 1X9NA 2R92B 1EZ6A 2JP1A 4B3ML 4HSVA 1SMYC 4ULLA 1BNZA 4JI4Q 1WJJA 5JJLA 4UP7A 2JZXA 5C4ZA 4GKKH 2NTTA 1TIID 1WTPA 1SE8A 1Y1WG 2J4XA 2JA7B 3CCUA 4L6TB 2YTYA 2I5MX 2F0SA 1V1QA 1AP0A 4GNXC 1D8LA 3KDFB 2F4VH 1IL2A 4HCSA 2K5VA 2QNDA 1A3UA 3HOZB 2PW7A 4EVOA 1F0XA 2HIXA 4OD6A 3KUPA 3WOEA 4JOIA 2A8VA 3DMUA 2O5IC 4IUPA 1WVNA 4A3IG 1K8AC 1I4PA 2GA4B 5C44H 1VQ5A 4LMQD 1VQ7A 4BXXH 1N36H 2E2IH 1F77A 2EE1A 1TKWB 2VQFL 1DT4A 4ID6A 2OCEA 3G7LA 4NXMH 1F9PA 1H9KA 3T13A 4X66H 4HN7A 4DUZH 2Z4HA 1VQAA 4LF9Q 2EY5A 1SBBB 1STNA 2CFMA 2BL5A 3BVZA 1GXDC 1ENAA 4UP8A 4X6AH 3IKJA 1IL8A 1DOLA 5JAVA 1Y1VG 5I4DA 3UDXA 4FJSA 3HEJA 3VR4A 1I94H 3PUVA 4X64L 5C4XB 1T9HA 1X3PA 2JA8B 1EQTA 1A3VA 1XMQQ 2CQAA 1I4QA 4CDFC 1QZGA 3RLNA 5J22A 4IUUA 2PQEA 3D3RA 3CQZB 5IYDG 2KA7A 4A3GB 1MKHA 3D6CA 2R7ZH 3JAML 3O13A 4A93G 5DAUA 2UUCH 2HT1A 3JAMW 1N33H 4I7AA 2UUAL 5JOBA 4X62L 5JEAH 2EJFC 3PQIA 4J8QA 2JA5B 2EDGA 1X3EA 2HHHL 4R9WA 2E8GA 1D6EC 3DEPA 2NWGA 3NTKA 1WTRA 1KXLA 1I6UA 1WTHA 3NSWA 1PRTC 4NBQA 2XNAC 2PZUA 1CK1A 3A8JE 4QQBX 3NHHA 4PZ6A 2ATWA 4JW0A 4H7BA 5FKAC 1PMRA 4GKJH 2A68D 3HS0C 1LTTD 5C3WA 2JA7G 4NXNH 1B7YB 1LO5D 2EQSA 3GTQH 1VQKA 4DR4L 4RGMA 1HFNA 2N3SA 5K5PA 4JI0L 2JA9A 1WD1A 2OQ0A 5ELEA 5EKKA 4DV6H 5JJKA 1N32H 1A0IA 4EGVA 3SEBA 3KLSA 2NN6G 1X55A 4WJ4A 2D0OA 1E22A 1I50B 3A74A 2I5HA 1SEBD 1QUQA 1LTGD 4KKSA 2IX1A 1ET6A 1GUSA 1XTCD 2H4OA 4OEMB 1KD1C 4M1UB 4XYOA 3JAMc 4ZK9B 4K8JA 2HH3A 3VKEA 3OETA 2D9UA 1NAPA 2HCIA 1IBKL 3S2HH 1YBYA 4OL7A 2ZTEA 2UXCL 4Q0FA 2OTLA 2JYOA 5E7NA 5C0XI 3CPFA 4IUQA 5EBCA 1U4MA 2MNAA 3QIAA 4MTKA 1EFID 3D4WA 3TP8A 4QB4A 2K4KA 1DTJA 2DGYA 1K8OA 3L0OA 5IODA 3J81j 2DNCA 2K04A 3F2CA 4FYDA 4B3RL 1G2TA 2CW0D 1G6ZA 3CCQA 2OT2A 1N34Q 2VQEH 3S1NH 5C44B 1PHJA 1X3GA 3SVMA 4JV5L 2E2IB 1D7QA 1DOKA 3AFQA 3QWNA 3AFPA 4WJWA 2B2WA 1AEXA 4A3MH 3RZDH 2KVMA 3IFDA 1SJED 1ASYA 2K52A 4B3MQ 4DR7L 4TSSA 2NVQH 2VS1A 4C3HG 4DV1L 3PF5A 5FLXL 4JK1C 1WCMH 1IBLH 5FLXW 2LTLA 1DONA 1VIGA 3S1RH 2KECA 2M8WA 3H0GB 1STYA 2AWOA 5KIXA 1GHKA 4FXDA 3T1YL 3T53B 2F0EA 5IGBA 4DV2L 4JBJA 4GLAC 1F9QA 4P75A 3WDNA 1P8LA 1EY9A 1XTDA 5A35A 1I4RA 5A2QL 3S17H 3VYTA 1LUZA 5A2QW 4N8X1 4RH6A 1Y8NB 1Y8PB 4F87A 2F52A 2FMMA 4DF7A 3CCVA 2VQFQ 4OX9Q 1QB5D 2R7ZB 2KEDA 4RHRA 4F8MA 3OTOH 1Z47A 1MIUA 5FO7B 2CTFA 3RD4A 5L37A 2UUBL 5IY0A 3KOJA 4LUVA 4A4IA 1HHVA 1PH3A 2Q2TA 1B8AA 1B9NA 1H95A 2BDNA 3I4LA 3PIOA 4KMUC 1EFWA 2IHEA 3T51B 1SYBA 4MN3A 4LFCL 1BF4A 1A6XA 5FLXc 3KDGA 3NBHB 4X64Q 5LMNH 2M6QA 4DV5L 1SXTA 2FHTA 2N55A 2WAQB 4U673 3GTQB 2A6EC 1SNCA 1QWYA 2XN9C 3TP7A 4DR6L 4YHHH 5J3BA 3H94A 2HDLA 2RSOA 1IYVA 1RCVD 1HZ9A 3SK8A 2ZJRA 1FD7D 2PI2A 5FLXE 1S03G 3HOUB 1RJTA 2PNHA 1X54A 4JI6L 3J81E 2M2LA 1NUCA 2UUAQ 2KCTA 3I7FA 2P5ZX 3NXWA 2VUMH 1ZZIA 4LF5Q 2HHHQ 4JPBW 3RNUA 3J7AK 2PZTA 1WTXA 5CBAE 4GKKL 3M3YH 1BCPF 4GOPB 4KN4C 1VQ9A 2AHOB 4CKEA 5A2QE 3KLWA 1ONLA 1CHQD 3HKSA 3K7UC 2RQXA 4A3JH 2QKIC 4IQZA 1SYFA 3S2HB 1XYIA 3VR5A 2F4VL 3M4YA 4PV1C 4ZUIA 3PIPA 4X3KA 2E76C 3CU7A 3HOVG 2CH4W 5D14A 1WVLA 3ULPA 1DGSA 1Q46A 1ENFA 3H3VC 4DR4Q 2CPQA 3L2PA 1CKNB 4QY7A 1HH2P 4JI0Q 4TRDA 3GABA 3RMHA 1PYWD 4UHVA 2XWBB 1N36L 4KD3A 1ZZJA 2B2TA 1VQDA 1Z6HA 5EKLA 1EY8A 1MJCA 3S1NB 4NXML 1ZZKA 3AB9A 1EWIA 2ANRA 1PLFA 3R93A 3S24A 2WKDA 4X66L 4DUZL 4P2CB 3RZDB 4A3MB 2OWOA 4PZ7A 3HRZC 5JEAG 1ZXTA 2EJMA 4KN7C 4KI0A 2NVQB 1EWHA 1X65A 4KLKA 3EQLC 4JVZA 1JMCA 1VQBA 4KKTA 1XPRA 1WCMB 3ERSX 1HUNA 4P73A 1VQ8A 1EOTA 2UXCQ 3WOFA 3CP0A 4QUCA 1I94L 2FXQA 4CBVA 3S1RB 1E24A 3PO2H 2FPHX 2L5TA 1W6JA 1EL0A 5EBDA 1TWGH 3ONAB 3DHQA 2RDHA 3A7LA 2WAQG 1HR0H 4OIJA 2Q8RE 1QVFA 4ZAIA 5ELBA 3S17B 4B3RQ 1BVSA 4PDBA 1BQQT 5C4JH 2UUCL 4QJFA 4YIJA 3RR5A 1N33L 1M90C 1JC7A 2NBFA 3KLRA 3MA2B 1S5BD 3S14B 4JV5Q 3I0PA 4IPDA 1A3TA 2K32A 1O7ZA 2NZ1D 1MBYA 2L4NA 4DR1H 3M7NA 2F03A 2B2WC 4DR7Q 2Z6BA 1JWUD 4DV1Q 4EQOA 1D5XC 1PYSB 1NSNS 4LK1C 3GO5A 5CV9A 3W1BA 5BN4A 1JJGA 5LL6S 2AQ3B 4DN4M 4C3IB 3AQQA 2G9HD 4QIWB 4GKJL 2CTJA 4NXNL 1CZWA 2I5LX 1Y69U 2Z0SA 3T1YQ 4XQQA 1CFMA 1FYCA 2JJQA 1JICA 4N8FA 1QUQB 4DV2Q 4DV6L 2Q8IB 2K01A 3BVGA 4NPSA 1TWCH 1N32L 2CPMA 3OWEB 5CYUA 4R1JA 5J39A 4J15A 1O7IA 3MEFA 4OO1G 1CT1D 2RHQB 2Y0SB 3IAYA 5C0XG 1QG7A 4KD4A 2AXYA 1KLUD 4CKCA 3EBEA 1KDBA 4IPCA 4K6DA 5E3FA 4AQYH 2UUBQ 1FGUA 1SSOA 3FPUB 2VUMB 3RN2A 2NZOA 4OWTB 1Q12A 5E4XA 4OONA 1S5FD 1VQHA 1CA6A 4A3MG 3M3YB 1U5KA 1LT4D 4LF8H 2NTSA 3Q24A 4A3FH 4L5SA 3AEVA 5IYBH 4A3JB 4LFCQ 3GTLH 2CVRA 1B53A 1MI2A 5FOBB 1HNXH 4DV5Q 5HGQA 1NMGA 1I4XA 4OGQC 2LS01 1S72A 4C2MH 4DR6Q 1PZKD 2YU9H 3GV3A 3I70A 1AE2A 4YWMA 3PGZA 1MJEA 1MD2D 2VQEL 4BBRH 1LTLA 2O2LD 4DFAA 5M5XH 4DV4L 1BR9A 1E2VA 2WAQE 2KHSA 2ZJQA 4YCUA 1TS3A 3TN2A 1YNND 4GKKQ 5K36G 1AN8A 3LWUA 3K5MA 1BBWA 2Q2HA 2E75C 2RKSA 1A15A 1F9SA 2FJ2A 4DAYA 3BZCA 2EY2A 2F0KA 2VKCA 5ELOA 2F4VQ 4K14A 4NZRM 2F3IA 2R7DA 3KJPA 3T56B 4IPHA 2PW5A 1NY4A 3PO2B 2WB1G 3QJYA 1NXUA 1TWGB 3FDTA 1UUPA 5D65A 1J5EH 1Z7TA 5D3IB 1N36Q 3E0EA 1NNXA 4QUFA 5M3FH 1QCBD 3UDFA 1PFSA 3Q23A 2IL8A 1WD0A 5C4JB 1AFPA 3OTOL 2YYZA 2MHVA 4NXMQ 3OYYA 4TQUS 4YY3H 4AH6A 1VF5C 3K0XA 5CV7A 4X66Q 1JJCB 3M7GA 4DUZQ 1B50A 2F3WA 3MVVA 4IN3A 4A3CH 1FNWA 1RTNA 5LL6b 5EKIA 3F8TA 2A19A 1LTSD 1E3PA 4RHSA 2ZT9C 2H1EA 4IFDI 1U0LA 1SJHD 3U9SA 4CKBA 4G7ZC 1JJ2A 1I94Q 4XTCS 5LMNL 3KF6A 4KHPQ 1KQSA 3CCMA 5LMNW 5H1SE 1ZYRD 1SYCA 2IHFA 2ZTDA 4A3JG 5JPNC 4YHHL 1EWCA 5I9OA 2KCMA 5AJ3Q 4X65H 1J9OA 3S2DH 2N78A 4XXEA 1TR5A 4IFDH 3LGJA 4OCHA 3QOJA 1FVIA 4KK7A 1TWCB 4HMIA 5IGFA 4LF6H 3S16H 2EYFA 2KOLA 2MJ8A 4KHZA 4C1NK 1DOMA 1TWHH 1N33Q 1BO0A 4I7ZC 1EU3A 2PQAA 2Y3MA 3CRKC 2B2YC 2A6HD 2UXDH 1BDOA 3BDCA 2ES2A 4JVHA 3ND9A 2EXZA 3FAUA 1VIHA 3NQIA 1SAPA 1L0XB 5CV8A 4IURA 1Q1BA 2F0OA 4ODGA 4B9WA 4A3KH 5FJ8H 4GKJQ 4A3FB 1O78A 1RHPA 2WIIB 2HQEA 2L12A 1GOZA 2WACA 2CCZA 1YNJC 1O80A 3GTLB 4LF4Q 3CAMA 1CQFA 4H44C 2J7ZA 2BH2A 4DV6Q 2RVLA 4DV7H 4G4KA 1F2ZA 3QB3A 1N32Q 4C2MB 5CMDA 2YU9B 1WHRA 3PUZA 3GP7A 1LACA 2NZHA 2X06A 4BBRB 3GKUA 2BH8A 4PQXA 2B63G 2WB1E 3MHBA 5M5XB 1VQPA 1HUMA 2AKWB 2F0PA 4MHEA 3URYA 2R7FA 1W3SA 5IT9L 4RFBA 1IXRA 5IYCG 2TSSA 5IT9W 2CKZB 4IJHA 2RBMA 3A56A 4EQPA 4JI3H 1STAA 2JVZA 2L9HA 3G6EA 1GUGA 1PTOD 1B4OA 1X3QA 1J5KA 3GTKH 2F0VA 1RL2A 3STBC 1MGSA 4WANA 1MHWC 1HR0L 5FLMH 4DAPA 5KNCA 1RF2D 4HJAA 1VQOA 3GTOH 3J7YW 3M4OH 2VQEQ 1ENCA 2JEBI 1UG8A 1PH1A 5M3FB 4X3SA 1IW7D 3H0GH 1CA5A 1TXYA 1GUOA 4DR1L 1STBA 1PFNA 3A5UA 1TS4A 2VB2X 4POGA 4V0BA 4K0KH 3I4NG 1SEIA 4B08A 2E5LH 3J81i 1IBLQ 4LW1A 3OMCA 5C6AA 4BA1I 1FNVA 3D0FA 4LUZA 3SDZA 3VYRA 3MTSA 5FO9B 1QOHA 4JI7H 3VDYA 4RKBA 3C3LA 1BOSA 3UDIA 5IT9c 4OWWB 3LNNA 2OF1A 3OSOA 4GNXB 4WJ3M 1V8QA 4JVYA 2CHBD 3V96A 3K81C 5GQOA 1DM0B 1SROA 2DJGC 1PXUA 1LM0A 5IT9E 2E74C 3S2DB 2R92G 1JR0D 4PMWA 4BY7H 1PFMA 3S16B 1L0YB 3OTOQ 5DLQE 3ZJYC 5IP7H 1CTMA 4OIKA 3AEVB 1TWHB 4AQYL 3PUYA 3F2BA 1JOKA 4HIMA 5BR8H 2EYOA 1XPOA 5LHY1 2O4CA 1BBXC 3FP9A 1XXGA 1D2BA 4Z9CB 4LF8L 2QDBA 3HOZG 2GVAA 5D3DA 3S1QH 2K1BA 4A3BH 4IOCA 2CTLA 3E6ZX 2RHSB 5C3EB 4K5WA 4NW2A 3HOUH 3NTIA 1RIPA 1HNXL 4DAMA 4A3KB 1LT3D 5LMNQ 2PT7G 1S40A 4DR2H 4LFBH 1KAWA 4YHHQ 2X69A 3V05A 4JI2H 4B3SH 1KL9A 2L55A 4Y52H 2LTMA 2QF7A 4IO9A 3NK9A 2KJXA 1UE5A 2D62A 3MXNB 1SMXA 3VR6A 4JI4H 3DWAA 3U50C 5JPMC 5CORA 1VQFA 4C3JH 4FF3A 4ILWA 3U4VA 5C4HA 1XNRQ 4WALA 3L9AX 3JAME 1HQMC 2I46A 2PMZB 1HNZL 3S1MH 2AMCB 4GLVB 1ML0D 2AWNA 5CR3A 5C4XG 4FXGC 2JA8G 2CWHA 2LRRA 1PRTB 1M8AA 3TZDA 1JB3A 2JEAI 4A3CG 3ULJA 3ICEA 1WE8A 4DV3H 1R4QB 2CWFA 3TS0A 4IUNA 2FFMA 1YEZA 5IWAH 1CHPD 1EYDA 4A3GG 1SNMA 1OXTA 5FK9C 2NVXH 3GTKB 1HZAA 4DV4H 4JI1H 4FNFA 1X0AA 3VYSA 1J5EL 5IE8A 2JA5G 3I8ZA 3GTOB 3M4OB 4ZYSA 5AFWA 1LT5D 4JCVE 4B9XA 1U9RA 1UE7A 4DNIA 1SMYD 5G3LF 4YY3L 1EU4A 1KTKA 1A2TA 2HUGA 3MXUA 4L5QA 2XRSD 4F7XA 1PH5A 1A63A 5NUCA 5DM73 5EPJA 1S5ED 1DD2A 3OIQA 4NKLA 1VQNA 3AU7A 4RG1A 3K59A 4LAAA 3H3VI 1STGA 4DNTB 2WFWA 5LMUL 1BUVT 2IX3A 4O42A 5EPLA 5TSSA 1J4WA 5I6WA 1PFBA 1B70B 3KF8B 1S20A 3S14H 3J80i 3H09A 2JQOA 1EY5A 5KNDA 2RDGA 5CC4A 3K5NA 2PQAB 2KUMA 4UPAA 3VR3A 3BU2A 3H3VH 1EUJA 3J7ZC 1YVCA 4RGNA 3DXJC 2JN4A 3CC7A 4BY1H 4X65L 3NTHA 2LMCB 2RSNA 3K8AA 3SK6A 3HOWH 2F0IA 4LF6L 2K5HA 1DJRD 3P1HA 1A62A 2FMCA 2Z4IA 3Q22A 2XTIA 2KHJA 3R2IA 1YJWA 4C3IH 1AZPA 1K73C 2A69C 4BY7B 1IZ6A 3VYUA 2EIFA 2UXDL 1Z2IA 2NUCA 2ICIA 2B2UC 4DR1Q 3I4MH 5CGKA 1WI5A 3EIVA 2KCNA 3L7ZC 1FKAH 3NWSA 4KJNA 1CSPA 1JCKB 4HTHA 4L5TA 1C4QA 3U4ZA 5KGUA 3W5OA 1EYGA 3S1QB 4A3BB 4XDXA 1NTGA 3FEWX 1CSQA 4ME3A 4Q5VA 1D5ZC 4X62Q 4A3EH 2EZVA 2OXPA 5C44G 4DV7L 4BXXG 3HKZB 1GM5A 2JK8A 2JA6H 3G4SA 3RLOA 5FLMG 3DLLA 3TQYA 3E9HA 2XWJB 3U58A 3PCOB 1VMCA 4R4QA 2DN8A 3RUZA 1G291 4AQYQ 1GUNA 1JORA 2ZJPA 4KY5A 4BBSH 5M5YH 4C3JB 3BDLA 1VCIA 2IW3A 1PRTD 3H0GG 2EYLA 3DM3A 4AIMA 2R93H 3TSSA 4HJ5A 3AMUA 1V1PA 3S1MB 4JI3L 1B2TA 1SNQA 1JOQA 1HA6A 3TREA 1EQRA 1QNKA 2GN5A 5J1ZA 3U9OA 2UXBH 4DU9A 3K58A 3P20A 2F1MA 3CHBD 4GN5A 1HNXQ 1F2MA 3Q8DA 4LUOA 1EY6A 2JE6I 1RTOA 3PMFA 3SB1A 1BXTA 1LTAD 2KCCA 2ZXPA 2OPUA 1YNXA 2SOBA 2R7ZG 2NVXB 2IX0A 3K5OA 1CUKA 4ABNA 3JC66 4GLXA 1HQRD 2I0QA 1PTOF 4HEDA 3DWQA 3W3AA 2RCNA 4K2LA 5I2XA 5CV4A 4PG3A 5ELDA 1IBKQ 4DXGA 1SR3A 1UNSA 4CJ2C 1KDAA 2EY1A 2E5LL 2XGTA 4DR5H 2KHIA 1Q8KA 4NZTM 1XX8A 1EOVA 1GO3E 1BBUA 1V43A 1RD9D 4JI7L 2B3GA 3CCRA 2ASBA 3HOYH 1C48A 5JJZA 1K9MC 3EN2A 1VQMA 2B2YA 4A3BG 4DK1A 3MFYA 2PMZE 1Q3LA 4A3LH 3MC0B 2NVYH 2C5CA 3QO2A 1Q86C 3HOUG 2QGQA 1HNWH 1J5EQ 4JYAH 4PNYA 4OX9H 4BY1B 1NBWA 2I07B 2V4DA 3CCEA 3HKZG 3HOWB 1Y1WH 1VQCA 5HURA 2KQ3A 3QR8A 1VDZA 5E4WC 4YY3Q 2BA0A 3Q6SA 3I72A 5BR8L 1I6HH 3NCVA 1X4MA 3IRBA 4L5RC 3P75A 3KBGA 3I4MB 4C3JG 3N6RA 3T4AC 5JJIA 1TUAA 1NJIC 3AYHB 5LL6X 4P71A 4A3IH 2K75A 3R2TA 4ZRZA 3CXCA 1BCPC 5M3MH 1VQ6A 2ICEC 3D4DA 1ESFA 4CGYB 2QEJC 4DR2L 1FJGH 4LFBL 3G48A 4JI2L 4B3SL 2YQRA 3HOXH 1B44D 1TU2B 4A3EB 4K2KA 3IL8A 4LF6Q 2F0GA 3N52A 2AUKA 4LF5H 1HA5A 2F0LA 2JA6B 3NEMA 4LIJA 5C5MA 4JI4L 2F4IA 3EFXD 2ZXOA 4XYQA 1HZBA 5BN5A 4UDUC 1H9MA 2TMPA 2UXDQ 4WFN3 1WCMG 1DZ1A 1AN7A 4BBSB 1R9TH 4AYBB 5M5YB 1LTBD 4EC5A 1DXMA 1H9RA 1PH7A 3C1FA 2R93B 5IYDH 3FKIH 3J7AV 2DY7A 4R4TA 4WORA 3R3OA 4DV3L 4HIOA 4KKUA 4RGOS 4A93H 1F9RA 2A6ED 1QE6A 5BN3A 1VS0A 3W2DA 5IWAL 4HJ9A 3GTGH 1V9NA 2MPMA 1KAAA 3TZUA 3OWFA 4JI6Q 4GZYC 5T1GA 1EIGA 4CJ1B 1QVGA 4JI1L 1VBIA 4G57A 4EQ5A 4DV7Q 1P16A 2F0TA 4MTNA 5DEHA 3GTPH 1BCPB 4N9PA 1HNZH 1TS2A 1KHIA 1N9WA 2MO1A 3HOWG 2HIVA 4LF9L 2K5WA 2HDMA 4QF4A 1S4ZA 3M4QA 1IKLA 3SK5A 4ZKCB 4C3IG 3HKZE 4CJ0B 1KNAA 1I3QH 1QILA 5DM63 3H15A 1YHAA 3OW2A 1YHQA 3I4MG 4JI3Q 3NENA 1VQJA 3A0JA 4LFAH 5JVG3 1IBMH 5DNFA 3HOYB 1SE3A 4ZUJA 3V69A 1SYGA 1QZHA 4YWLA 4ZQ3A 2LY7A 2Y0SG 1X32A 3HP3A 2QDLA 2K7VA 4LNQA 2NVYB 2LSSA 1MSZA 4KY6A 1U4LA 1LTID 3BYTB 3DM1A 1E2ZA 3K7AH 4A3EG 3NBIA 2VUMG 1LT6D 3BVMA 3PSIA 2RF4A 4DR3H 1Y1WB 2JA6G 2A68C 1EEID 5LMUH 4H13C 3CPWA 3KYHC 4HIDA 2E5LQ 1PQXA 2A74C 3KDKA 1I6HB 4PMBA 2CTKA 3HGBA 1VMPA 4XT1B 2F0JA 4BBSG 4AYBG 3Q0AA 4UP9A 5IIFA 4JI7Q 1AW7A 2P2RA 4HSPA 3OHXC 1FGBD 1MSHA 2HCCA 2M9VA 4FP5D 3JAMi 4A3IB 2NVTH 5JEAJ 2R93G 2K1HA 4IUVA 4DK6C 1N8RC 4DV0H 5M3MB 2UUCQ 5F2DA 1EY0A 4UY8C 3NPPA 4X3UA 1NCVA 3RF2A 2O5JC 1EIHA 1H9SA 2NB0A 1HPCA 3M9BA 2G8YA 4APVA 2AQ1B 4N9TA 3HOXB 2OPVA 4C3HH 1V1OA 4HR7B 2F0MA 4RA8A 4DGZA 1V1PB 3KLSX 2F0WA 1LYLA 2K05A 3NP8A 2EXDA 1GVPA 5C3EH 3HG9A 2LFNA 3EVQA 5BR8Q 4NXNQ 2EPBA 3MAQA 3S15H 4DPGA 1EY7A 1KC8C 1ZTGA 1R9TB 1SE4A 1OXXK 2ENBA 4XT3B 2UXBL 2NYZD 2CW0C 3PO2G 3D6WA 3SGIA 3TEHB 3PIO3 3FKIB 2CTEA 4QIWE 4GS3A 1AE3A 4A93B 3GTMH 3GTGB 1KHMA 2EJGC 2WINB 1OXVA 3A55A 4DR2Q 1B3AA 4LFBQ 4JI2Q 4B3SQ 1JB7A 2N88A 1XNQH 1ILQA 2K14A 2UU9H 1YJ9A 1K8GA 4JC0A 1HFGA 3GTPB 3UOEA 2PYKA 2ANNA 4O2DA 3ITPA 3G6JB 2Y0SE 1ET9A 2Z6KA 4DR5L 4FDBA 2O4XA 4OXPA 4C56C 1SLJA 3LWEA 3SHLA 1WTQA 2RDFA 3FRPB 4RKLA 4RAUC 5C0XJ 2DJFC 4DUYH 2ALYB 1I3QB 1PH6A 2B8GA 1PH8A 1HR0W 5IGEA 4B3TH 1UE1A 4R8NA 1STHA 2KEEA 3A7AB 3ZYYX 3RZOB 1K1GA 1SRUA 1STEA 3UE0A 4A76A 4GOPA 1H9JA 2A73B 4DV3Q 3BS1A 1LABA 1NR4A 5IWAQ 5HGTA 4IUTA 2B2UA 4AYBE 4PMCA 5M3MG 3PIP3 4DV4Q 4JI1Q 3ULLA 3GTJH 1HNWL 4JYAL 3T1HH 4OX9L 4MNOA 2G5DA 1JE4A 3HOXG 1CKNA 3EJIA 3GR5A 2B2VA 4IPGA 4LWCA 1YZ6A 3K7AB 2F0DA 4MIUA 2ZM6H 1E7ZA 2Q2IA 4J6HA 4DK3C 1CQVA 5GAHC 4BS9A 3KFUA 4WRDA 1EIYB 4OWXB 4LF7H 1M1KC 2F0HA 3X3MA 3QG1A 4E6IA 3HOVH 1XMOH 4A3FG 4IZ8A 1MSGA 1K83H 3QD7X 5IYBG 3KK7A 4K5VA 4KHPH 1EYAA 4J1MA 5IP9H 3KJOA 2L15A 1J8IA 4IOAA 3SK4A 2EOTA 3A5ZB 4R8IA 3A8KE 3VR2A 2AQ2B 3NE5B 5CV6A 2IWHA 4O1NA 5CV5A 1FJGL 1EQVA 4CDCC 2NVTB 1F2LA 3FKIG 1EY4A 2Z8LA 4P72A 2K5DA 3MFGA 4BBRG 1GUTA 3ER0A 1YIJA 4JI8H 1C7YA 3CC2A 4LF5L 1S5CD 3J7A5 2WKCA 3BJUA 4OELB 4C3HB 4NMZA 1E1OA 3D31A 2CWAA 3C1EA 5KNBA 5ELNA 1Y8OB 2L11A 3E5SA 3ERQA 2WP8J 5IGDA 2WV6D 3BZDB 5EAYA 1O7LA 3S15B 3K80C 4JI5H 3DWPA 2L1BA 2XRQD 1KDCA 3HFZB 3KBXA 1UE6A 4B8TA 3OPOA 4LF4H 3PUXA 1SFOH 2J0TD 2PI2E 3DEOA 4H02A 2M00A 2FINB 4NDXA 3EROA 1PH2A 4DAYB 4DKAC 3FVQA 2K03A 2PQUA 3GTMB 3P7JA 1WOCA 5M3FG 4RCOA 4X3TA 5EJWA 3I91A 4EQNA 1SE2A 2DUDA 1OTCA 1HXYD 2QW7A 1KNEA 2EY6A 2VZAA 4Y7NH 3PO3H 1ODHA 2PCFB 1EZ8A 4KV6A 1Q1EA 1XJVA 1GHJA 2BE5C 1G91A 3OIPA 1TT2A 3B6YA 1GKHA 4UAIA 5I6YA 5KYIA 1PDQA 1C9OA 4OO1I 1BKBA 3A54A 1E2WA 3BZKA 4RGTA 1TS5A 3CRLC 3FMCA 5M9OA 1HTLD 2K28A 4FF4A 1G8ZD 4LFAL 4YCWA 2UXBQ 5KRUA 1IBML 1DCZA 2DNEA 1YNJD 4OO1H 2EYMA 2LKVA 1VQEA 1V9PA 3MXPA 5C0XH 1PA6A 4IFDG 4OHJA 1K3BC 4HJ7A 2E3UA 1D5MC 2XIWA 4LF9H 3CMEA 3KF6B 3MXGA 3GTJB 2OTJA 1FNUA 2V1CC 3PUWA 1CZGA 1UAPA 4QGUA 4DR3L 1HJPA
chains in the Genus database with same CATH topology
2EVBA 2VB3X 1SN8A 3QOLA 1JT8A 1VF7A 1PVOA 2MJHA 4DR5Q 5IGGA 3J81L 2X6LA 5EQ0A 2CWPA 2VW9A 1JE5A 1H9SB 1Z9FA 1SDFA 5C3EG 2ZTCA 2N49A 2Z6KC 2SDFA 3HOVB 2CTMA 4A3KG 1FL0A 5FJ8G 1AZQA 1HR0Q 3F2DA 2N8NA 2B8FA 1XPUA 4K0KL 5GAEC 4F88A 1K8MA 1K83B 4XQNA 4DV0L 1Y14B 3STBD 1PYBA 1UEBA 3K5LA 2VXWA 2PPBC 1T5EA 3RN5A 1R4PB 5CBEE 4GOPC 3VA5A 3I3CA 1WTVA 3C46A 4JOIC 2X6GA 5T1IA 3BG3A 4G7HC 3L3OC 2YTVA 1HNWQ 4JYAQ 2JXMB 1WFQA 2MO0A 5IOCA 5K36H 1CM9A 3TS2A 4C1NI 2SNSA 1HTPA 3I73A 1DYQA 2C35B 1LV9A 2XSCA 4M8AA 2BOSA 3M85A 3ND8A 2B2VC 1KRTA 1Q8IA 4FO2A 4POFA 4U68A 2C9OA 2QEXA 2KENA 2MP1A 3MWYW 3GDEA 2EYHA 4A3DH 3PF4A 4HIKA 1L1OA 3J81c 2F0UA 3DUZA 1HZCA 1CI3M 5JVH3 3BDOA 4R4IA 3CF5A 2K5QA 4QMFB 3OMGA 1SFOB 1GJXA 1FJGQ 3F2UA 3C2PA 4XIGS 1F2YA 2IT1A 1XNQL 1ZKOA 1A8VA 4JBWA 2UU9L 3X3NA 4JBKA 5FO8B 2PNRC 1RKNA 1YNNC 4RCNA 3TDQA 1JOOA 4FXKC 5GADC 4LJZC 1GD7A 1C0AA 2Q2UA 1TWAH 1VQLA 1LTRD 4Y7NB 1VQ4A 3PO3B 4LF8Q 2MUYA 3K0YA 2L0CA 4DK0A 1OXSC 4CHTB 4HCEA 2MFIA 2MQHA 4DA2A 2Z1CA 4DUYL 2R6GA 4V190 4TVAB 2VNUD 4B3TL 3TBIB 5M5WH 4RWSC 1RDPD 5EGTA 2LXJA 1HRJA 3U1KA 3LX0A 5IP9G 1ASZA 4HJ8A 2ID0A 1NMFA 3T1HL 1VQGA 1L0WA 2DY8A 4BY7G 3M4PA 1M4VA 5IP7G 1W6KA 1HNZQ 2PO4A 2ZM6L 1YITA 4HMJA 3I55A 2K5NA 4LF7L 2KBNA 1Q90A 1TQOA 1XMOL 1ZYRC 2FFKB 5KEEA 2BE5D 3GQBA 4KTAA 2E2HH 4KHPL 3E0JA 3G71A 5KYLA 2IY5B 3KDFA 4JBMA 4LFAQ 1T5XD 4QMGA 1J6QA 1PTOH 4NB3A 4HAEA 3J80L 1IBMQ 1S5DD 5ELCA 5AJ3L 1UEAB 4P74A 3HZXA 3MEHA 2B63H 5I2YA 2A6HC 4DNRB 4JI8L 2R3ZA 1C8CA 2E2DC 2Q8TA 1TWFH 3F1ZA 5HY6A 2D5DA 3UE1A 5IYCH 3H6MA 2R61A 4DR3Q 4PZ8A 4ALPA 2IJ0A 4I65A 1I4HA 4FVMA 5LMUQ 3PO3G 1WTOA 2H5XA 3NUCA 2BA1A 2LXKA 1OO9B 5E1FA 1PH9A 4JI5L 2PY9A 1YI2A 4IFDJ 3T16A 4QCLA 3CCSA 1GUWA 2WB1B 4L8JA 4IJLA 2F3VA 4ZLTF 1IYUA 2RA4A 3K57A 4LF4L 1X56A 3V2TA 4X65Q 2F0QA 4K0KQ 4JG2A 4DV0Q 2A5HA 1IKMA 1YJNA 2E2JH 4A3DB 3VA7A 1WYDA 4H0LC 1I5FA 4YCVA 1SNDA 1KIXA 2B39A 1II3A 1K3RA 4R4OA 3D8GA 4K5XA 5C5LA 1Y1VH 3D4RA 1Q7YC 1X4NA 5GROA 3J80c 1QJOA 3I4NH 4GNXA 1FR3A 2MGSA 1JQYD 2A69D 5EPKA 1EEFD 1G51A 1TWAB 1QVCA 2VL6A 1B1ZA 3J80E 3SR1A 1PTOC 1YHBA 4KJOA 2DGRA 5IGCA 1S3OA 1SYEA 2AUJD 1CKOA 1HCZA 4K6LA 4NP5A 3BYYB 3I56A 1K0RA 2R92H 1ICWA 1JWSD 5I9PA 1KABA 3NELA 5M5WB 1TY2A 3CD6A 1WTWA 2CQOA 3S9WA 1IW7C 4BY1G 1L1OC 3TRZA 1AH9A 4R4CA 3W1GA 3NQTA 2VY3A 1XNQQ 2JA7H 2D0PA 2UU9Q 1EYCA 4L63B 4FF1A 3I2ZA 2NN6I 1L2FA 1X3FA 2XVSA 4EX5A 1OXUA 3I90A 3WWVA 1CKMA 1U4PA 3UDGA 3HOZH 3RZOH 1E0BA 1TVXA 1EIFA 4QL5A 1RODA 4BWGB 2HH2A 1IBLL 3GD7A 1PV4A 1XMQL 1IYJB 2YV5A 3MXNA 2NN6H 2GVBA 3CKIB 3EA6A 3SE0A 4YWKA 1LLRD 1PZID 1UWVA 3GV6A 5C3XA 1TY0A 2BCOA 1ZEQX 4A75A 4DUYQ 1I6VC 2K33A 1NR2A 1KRSA 4B3TQ 1SNPA 2E2HB 1G2SA 3TMEA 3CCLA 3PV0A 5G3LD 1EC6A 3UI2A 4GN3B 1PTOB 1SNOA 3TP6A 4DXFA 1E1TA 1A2UA 4A3DG 1W2BA 3NWTA 4TKOB 3CW2C 2K6AA 1X6OA 2B63B 3T1HQ 3FPPA 1PH4A 1D1KA 1I4GA 3CMAA 1U4RA 2B2TC 2HQLA 2FMRA 1IHZA 2PZWA 3TP5A 1TWFB 5C4XH 3R8BA 1D1IA 3SXHA 2QA4A 2JA8H 4BA2I 5ELFA 2OQKA 3OOCA 4RMFA 2G9DA 1L1OB 2ZM6Q 5COYA 4S3SA 3OW7A 4KY7A 3CQZH 3FHWA 4LF7Q 1XWEA 1PZJD 2SEBD 2QCPX 1XMOQ 4A3GH 2YTXA 1G6PA 1Q81C 4AM3A 2BDOA 2JA5H 2QILA 2EYJA 4ME5A 2F0NA 3IFTA 4IALA 3CCJA 4KHVA 2E2JB 2EYPA 1ILPA 1O7YA 1JWMD 3E9IA 2IPKD 4JI8Q 3KF8A 3J7AF 1KLGD 1VQIA 4O0AA 2JSOA 3MZ5A 1Y1VB 1B9MA 3RLFA 2K50A 4GN4B 4G7OC 3I4NB 1XNRL 5ISRA 3I4OA 4DAVA 2OEOA 1SYDA 1PRTF 2ZXRA 4FF2A 3CC4A 4K8IA 1Q82C 4JI5Q 3HOYG 2F0FA 1N34L 1ESRA 2B29A 1BCPD 3A8IE 1QNUA 3H91A 4XQJA 3K6OA 2D2CC 1I50H 3NBHA 1NE3A 1EQQA 2SNMA 2A1AA 5GAGC 4ZKBB 4A3LG 4MZ9A 1X9NA 2R92B 1EZ6A 2JP1A 4B3ML 4HSVA 1SMYC 4ULLA 1BNZA 4JI4Q 1WJJA 5JJLA 4UP7A 2JZXA 5C4ZA 2NTTA 1TIID 1WTPA 1SE8A 1Y1WG 2J4XA 2JA7B 3CCUA 4L6TB 2YTYA 2I5MX 2F0SA 1V1QA 1AP0A 4GNXC 1D8LA 3KDFB 1IL2A 4HCSA 2K5VA 2QNDA 1A3UA 3HOZB 2PW7A 4EVOA 2HIXA 3KUPA 3WOEA 4JOIA 2A8VA 3DMUA 2O5IC 4IUPA 1WVNA 4A3IG 1K8AC 1I4PA 2GA4B 5C44H 1VQ5A 4LMQD 1VQ7A 4BXXH 2E2IH 1F77A 2EE1A 1TKWB 2VQFL 1DT4A 4ID6A 3G7LA 2OCEA 1F9PA 1H9KA 3T13A 4HN7A 2Z4HA 1VQAA 4LF9Q 2EY5A 1SBBB 1STNA 2CFMA 2BL5A 3BVZA 1GXDC 1ENAA 4UP8A 4X6AH 3IKJA 1IL8A 1DOLA 5JAVA 1Y1VG 5I4DA 3UDXA 3HEJA 3VR4A 3PUVA 5C4XB 4X64L 1T9HA 1X3PA 2JA8B 1EQTA 1A3VA 1XMQQ 2CQAA 1I4QA 1QZGA 5J22A 3RLNA 4IUUA 2PQEA 3D3RA 3CQZB 5IYDG 2KA7A 4A3GB 1MKHA 3D6CA 2R7ZH 3JAML 3O13A 4A93G 5DAUA 2HT1A 2UUAL 5JOBA 4X62L 5JEAH 2EJFC 4J8QA 2JA5B 2EDGA 1X3EA 2HHHL 4R9WA 2E8GA 1D6EC 3DEPA 2NWGA 3NTKA 1WTRA 1KXLA 3NSWA 1PRTC 4NBQA 2XNAC 2PZUA 1CK1A 3A8JE 4QQBX 3NHHA 4PZ6A 2ATWA 4H7BA 5FKAC 1PMRA 2A68D 3HS0C 1LTTD 5C3WA 2JA7G 1B7YB 1LO5D 2EQSA 3GTQH 1VQKA 4DR4L 4RGMA 1HFNA 2N3SA 5K5PA 4JI0L 2JA9A 1WD1A 2OQ0A 5ELEA 5EKKA 5JJKA 1A0IA 4EGVA 3SEBA 3KLSA 2NN6G 1X55A 4WJ4A 2D0OA 1E22A 1I50B 3A74A 2I5HA 1SEBD 1QUQA 1LTGD 4KKSA 2IX1A 1ET6A 1GUSA 1XTCD 2H4OA 1KD1C 4M1UB 4XYOA 3JAMc 4ZK9B 4K8JA 2HH3A 3VKEA 2D9UA 1NAPA 2HCIA 1IBKL 3S2HH 1YBYA 4OL7A 2ZTEA 2UXCL 4Q0FA 2OTLA 2JYOA 5C0XI 5E7NA 4IUQA 3CPFA 5EBCA 1U4MA 2MNAA 3QIAA 1EFID 3D4WA 3TP8A 4QB4A 2K4KA 1DTJA 1K8OA 2DGYA 5IODA 3L0OA 3J81j 2DNCA 2K04A 4FYDA 3F2CA 4B3RL 1G2TA 2CW0D 1G6ZA 3CCQA 2OT2A 1N34Q 3S1NH 5C44B 1PHJA 3SVMA 1X3GA 4JV5L 2E2IB 1D7QA 1DOKA 3AFQA 3QWNA 3AFPA 4WJWA 2B2WA 1AEXA 4A3MH 3RZDH 2KVMA 3IFDA 1SJED 1ASYA 2K52A 4B3MQ 4DR7L 4TSSA 2NVQH 2VS1A 4C3HG 4DV1L 3PF5A 5FLXL 4JK1C 1WCMH 1DONA 1VIGA 3S1RH 2KECA 3H0GB 1STYA 2AWOA 5KIXA 1GHKA 4FXDA 3T1YL 3T53B 2F0EA 5IGBA 4DV2L 4JBJA 4GLAC 1F9QA 4P75A 3WDNA 1P8LA 1EY9A 5A35A 1XTDA 1I4RA 5A2QL 3S17H 3VYTA 1LUZA 4RH6A 1Y8NB 1Y8PB 4F87A 2F52A 2FMMA 4DF7A 3CCVA 2VQFQ 4OX9Q 1QB5D 2R7ZB 2KEDA 4RHRA 4F8MA 1Z47A 1MIUA 5FO7B 2CTFA 3RD4A 2UUBL 5IY0A 3KOJA 4LUVA 4A4IA 1HHVA 1PH3A 2Q2TA 1B8AA 1B9NA 1H95A 2BDNA 3I4LA 3PIOA 4KMUC 1EFWA 2IHEA 3T51B 1SYBA 4MN3A 1A6XA 1BF4A 4LFCL 5FLXc 3NBHB 4X64Q 4DV5L 1SXTA 2FHTA 2N55A 2WAQB 4U673 3GTQB 2A6EC 1SNCA 1QWYA 2XN9C 3TP7A 4DR6L 5J3BA 3H94A 2HDLA 2RSOA 1IYVA 1RCVD 1HZ9A 3SK8A 2ZJRA 1FD7D 2PI2A 5FLXE 3HOUB 1RJTA 2PNHA 1X54A 4JI6L 3J81E 2M2LA 1NUCA 2UUAQ 2KCTA 3I7FA 3NXWA 2VUMH 1ZZIA 4LF5Q 2HHHQ 3RNUA 2PZTA 1WTXA 5CBAE 4GKKL 3M3YH 1BCPF 4GOPB 4KN4C 1VQ9A 2AHOB 4CKEA 5A2QE 3KLWA 1ONLA 1CHQD 3HKSA 3K7UC 2RQXA 4A3JH 2QKIC 4IQZA 1SYFA 3S2HB 1XYIA 3VR5A 2F4VL 3M4YA 4PV1C 4ZUIA 3PIPA 4X3KA 2E76C 3CU7A 3HOVG 5D14A 1WVLA 3ULPA 1DGSA 1Q46A 1ENFA 3H3VC 4DR4Q 2CPQA 3L2PA 1CKNB 4QY7A 1HH2P 4JI0Q 4TRDA 3RMHA 1PYWD 2XWBB 1N36L 4KD3A 1ZZJA 2B2TA 1Z6HA 5EKLA 1VQDA 1EY8A 1MJCA 3S1NB 4NXML 1ZZKA 3AB9A 1EWIA 2ANRA 1PLFA 3R93A 3S24A 2WKDA 4X66L 4DUZL 4P2CB 3RZDB 4A3MB 2OWOA 4PZ7A 3HRZC 5JEAG 1ZXTA 2EJMA 4KN7C 4KI0A 2NVQB 1EWHA 1X65A 4KLKA 3EQLC 1JMCA 4KKTA 1VQBA 1XPRA 1WCMB 3ERSX 1HUNA 4P73A 1VQ8A 1EOTA 2UXCQ 3WOFA 4QUCA 3CP0A 1I94L 2FXQA 4CBVA 3S1RB 1E24A 3PO2H 2L5TA 1W6JA 1EL0A 5EBDA 1TWGH 3ONAB 3DHQA 2RDHA 3A7LA 2WAQG 4OIJA 2Q8RE 1QVFA 4ZAIA 5ELBA 3S17B 4B3RQ 1BVSA 1BQQT 5C4JH 2UUCL 4QJFA 4YIJA 3RR5A 1N33L 1M90C 1JC7A 2NBFA 3KLRA 3MA2B 1S5BD 3S14B 4JV5Q 4IPDA 1A3TA 2K32A 1O7ZA 2NZ1D 1MBYA 2L4NA 3M7NA 2F03A 2B2WC 4DR7Q 1JWUD 4DV1Q 4EQOA 1D5XC 5CV9A 1NSNS 4LK1C 3GO5A 1PYSB 3W1BA 5BN4A 1JJGA 5LL6S 2AQ3B 4DN4M 4C3IB 3AQQA 2G9HD 4QIWB 4GKJL 2CTJA 4NXNL 1CZWA 2I5LX 1Y69U 2Z0SA 3T1YQ 4XQQA 1CFMA 1FYCA 2JJQA 1JICA 1QUQB 4DV2Q 4DV6L 2Q8IB 2K01A 3BVGA 4NPSA 1TWCH 1N32L 3OWEB 5CYUA 4R1JA 5J39A 4J15A 1O7IA 4OO1G 3MEFA 1CT1D 3IAYA 2Y0SB 2RHQB 5C0XG 1QG7A 4KD4A 2AXYA 1KLUD 4CKCA 3EBEA 1KDBA 5E3FA 4K6DA 4IPCA 2UUBQ 1FGUA 1SSOA 3FPUB 2VUMB 3RN2A 2NZOA 4OWTB 1Q12A 5E4XA 4OONA 1S5FD 1VQHA 1CA6A 4A3MG 3M3YB 1U5KA 1LT4D 2NTSA 3Q24A 4A3FH 4L5SA 3AEVA 5IYBH 4A3JB 4LFCQ 3GTLH 2CVRA 1B53A 1MI2A 5FOBB 4DV5Q 5HGQA 1NMGA 1I4XA 4OGQC 2LS01 1S72A 4C2MH 4DR6Q 1PZKD 2YU9H 3GV3A 3I70A 1AE2A 4YWMA 3PGZA 1MJEA 1MD2D 2VQEL 4BBRH 2O2LD 1LTLA 4DFAA 5M5XH 4DV4L 1BR9A 1E2VA 2WAQE 2KHSA 2ZJQA 4YCUA 1TS3A 3TN2A 1YNND 5K36G 4GKKQ 1AN8A 3LWUA 3K5MA 1BBWA 2Q2HA 2E75C 2RKSA 1A15A 1F9SA 2FJ2A 4DAYA 3BZCA 2EY2A 2F0KA 5ELOA 2F4VQ 4K14A 2F3IA 2R7DA 3KJPA 3T56B 4IPHA 2PW5A 1NY4A 3PO2B 2WB1G 3QJYA 1TWGB 3FDTA 1UUPA 5D65A 1Z7TA 5D3IB 1N36Q 3E0EA 4QUFA 5M3FH 1QCBD 3UDFA 1PFSA 3Q23A 2IL8A 1WD0A 5C4JB 1AFPA 3OTOL 2YYZA 2MHVA 4NXMQ 3OYYA 4TQUS 4AH6A 1VF5C 3K0XA 5CV7A 4X66Q 3M7GA 1JJCB 4DUZQ 1B50A 2F3WA 3MVVA 4IN3A 4A3CH 1FNWA 1RTNA 5EKIA 3F8TA 2A19A 1LTSD 1E3PA 4RHSA 2ZT9C 2H1EA 4IFDI 1U0LA 1SJHD 3U9SA 4CKBA 4G7ZC 1JJ2A 1I94Q 4XTCS 5LMNL 3KF6A 4KHPQ 1KQSA 3CCMA 5LMNW 5H1SE 1ZYRD 1SYCA 2IHFA 2ZTDA 4A3JG 5JPNC 4YHHL 1EWCA 5I9OA 2KCMA 5AJ3Q 1J9OA 3S2DH 4XXEA 4IFDH 1TR5A 2N78A 3LGJA 3QOJA 1FVIA 4KK7A 1TWCB 4HMIA 5IGFA 3S16H 2EYFA 2KOLA 2MJ8A 4KHZA 4C1NK 1DOMA 1TWHH 1N33Q 1BO0A 4I7ZC 1EU3A 2PQAA 3CRKC 2B2YC 2A6HD 1BDOA 3BDCA 2ES2A 4JVHA 3ND9A 2EXZA 1VIHA 3NQIA 1SAPA 1L0XB 5CV8A 4IURA 1Q1BA 2F0OA 4ODGA 4B9WA 4A3KH 5FJ8H 4GKJQ 4A3FB 1O78A 1RHPA 2WIIB 2HQEA 2L12A 1GOZA 2WACA 2CCZA 1YNJC 1O80A 3GTLB 4LF4Q 3CAMA 1CQFA 4H44C 2J7ZA 2BH2A 4DV6Q 2RVLA 4G4KA 1F2ZA 3QB3A 1N32Q 4C2MB 5CMDA 2YU9B 3PUZA 3GP7A 1LACA 2NZHA 4BBRB 4PQXA 2BH8A 2B63G 2WB1E 3MHBA 5M5XB 1VQPA 1HUMA 2AKWB 2F0PA 4MHEA 3URYA 2R7FA 1W3SA 5IT9L 4RFBA 1IXRA 5IYCG 2TSSA 2CKZB 4IJHA 2RBMA 3A56A 4EQPA 1STAA 2JVZA 2L9HA 3G6EA 1GUGA 1PTOD 1B4OA 1X3QA 1J5KA 3GTKH 2F0VA 1RL2A 3STBC 1MGSA 4WANA 1HR0L 5FLMH 4DAPA 5KNCA 1RF2D 4HJAA 1VQOA 3GTOH 3J7YW 3M4OH 2VQEQ 1ENCA 2JEBI 1PH1A 5M3FB 4X3SA 1IW7D 3H0GH 1CA5A 1TXYA 1GUOA 4DR1L 1STBA 1PFNA 3A5UA 1TS4A 2VB2X 4POGA 4V0BA 3I4NG 4B08A 3J81i 1IBLQ 4LW1A 3OMCA 5C6AA 4BA1I 1FNVA 3D0FA 3SDZA 3VYRA 4LUZA 3MTSA 5FO9B 1QOHA 3VDYA 4RKBA 3C3LA 1BOSA 3UDIA 5IT9c 4OWWB 3LNNA 2OF1A 3OSOA 4GNXB 4WJ3M 1V8QA 4JVYA 2CHBD 3V96A 3K81C 5GQOA 1DM0B 1SROA 1PXUA 1LM0A 5IT9E 2E74C 3S2DB 2R92G 1JR0D 4PMWA 4BY7H 1PFMA 3S16B 1L0YB 3OTOQ 5DLQE 3ZJYC 5IP7H 1CTMA 4OIKA 3AEVB 1TWHB 4AQYL 3PUYA 3F2BA 1JOKA 4HIMA 2EYOA 1XPOA 5LHY1 1BBXC 3FP9A 1XXGA 1D2BA 4Z9CB 4LF8L 2QDBA 3HOZG 2GVAA 5D3DA 3S1QH 2K1BA 4A3BH 4IOCA 2CTLA 3E6ZX 2RHSB 5C3EB 4K5WA 4NW2A 3HOUH 3NTIA 1RIPA 1HNXL 4A3KB 4DAMA 1LT3D 5LMNQ 1S40A 1KAWA 4YHHQ 2X69A 3V05A 1KL9A 2L55A 4Y52H 2QF7A 4IO9A 3NK9A 2KJXA 1UE5A 2D62A 3MXNB 1SMXA 3VR6A 3DWAA 3U50C 5JPMC 5CORA 1VQFA 4FF3A 4C3JH 4ILWA 3U4VA 5C4HA 1XNRQ 4WALA 3L9AX 3JAME 1HQMC 2I46A 2PMZB 1HNZL 3S1MH 2AMCB 5CR3A 1ML0D 2AWNA 4GLVB 5C4XG 4FXGC 2JA8G 1PRTB 1M8AA 3TZDA 1JB3A 2JEAI 4A3CG 3ULJA 3ICEA 1WE8A 1R4QB 3TS0A 4IUNA 1YEZA 1CHPD 1EYDA 4A3GG 1SNMA 1OXTA 5FK9C 2NVXH 3GTKB 1HZAA 4FNFA 3VYSA 1J5EL 5IE8A 2JA5G 3I8ZA 3GTOB 3M4OB 4ZYSA 5AFWA 1LT5D 4B9XA 4JCVE 1U9RA 1UE7A 4DNIA 1SMYD 5G3LF 4YY3L 1EU4A 1KTKA 1A2TA 2HUGA 3MXUA 4L5QA 2XRSD 4F7XA 1PH5A 1A63A 5NUCA 5DM73 5EPJA 1S5ED 1DD2A 3OIQA 4NKLA 1VQNA 3AU7A 4RG1A 3K59A 4LAAA 3H3VI 1STGA 4DNTB 2WFWA 5LMUL 1BUVT 2IX3A 4O42A 5EPLA 5TSSA 1J4WA 5I6WA 1PFBA 1B70B 3KF8B 3S14H 3J80i 3H09A 2JQOA 5KNDA 1EY5A 2RDGA 5CC4A 3K5NA 2PQAB 2KUMA 4UPAA 3VR3A 3BU2A 3H3VH 1EUJA 3J7ZC 1YVCA 4RGNA 3DXJC 3CC7A 4BY1H 4X65L 3NTHA 2LMCB 3SK6A 2RSNA 3K8AA 3HOWH 2F0IA 4LF6L 2K5HA 1DJRD 3P1HA 1A62A 2FMCA 2Z4IA 3Q22A 2XTIA 2KHJA 3R2IA 1YJWA 4C3IH 1AZPA 1K73C 2A69C 4BY7B 1IZ6A 3VYUA 2EIFA 2UXDL 2NUCA 2ICIA 2B2UC 4DR1Q 3I4MH 5CGKA 1WI5A 3EIVA 2KCNA 3L7ZC 3NWSA 4KJNA 1CSPA 1JCKB 4HTHA 3S1QB 1C4QA 5KGUA 4A3BB 4L5TA 3U4ZA 3W5OA 1EYGA 4XDXA 1NTGA 3FEWX 1CSQA 4ME3A 4Q5VA 1D5ZC 4X62Q 4A3EH 2EZVA 2OXPA 5C44G 4DV7L 4BXXG 3HKZB 1GM5A 2JK8A 2JA6H 3G4SA 3RLOA 5FLMG 3DLLA 3TQYA 3E9HA 2XWJB 3U58A 3PCOB 1VMCA 4R4QA 2DN8A 3RUZA 1G291 1JORA 1GUNA 4AQYQ 2ZJPA 4KY5A 4BBSH 5M5YH 4C3JB 3BDLA 1VCIA 2IW3A 1PRTD 3H0GG 2EYLA 3DM3A 4AIMA 2R93H 3TSSA 3AMUA 4HJ5A 1V1PA 3S1MB 1B2TA 4JI3L 1SNQA 1JOQA 1HA6A 3TREA 1QNKA 5J1ZA 1EQRA 2GN5A 3U9OA 4DU9A 3K58A 3P20A 2F1MA 3CHBD 4GN5A 1HNXQ 1F2MA 3Q8DA 4LUOA 1EY6A 2JE6I 1RTOA 3PMFA 1BXTA 1LTAD 2KCCA 2ZXPA 2OPUA 1YNXA 2SOBA 2R7ZG 2NVXB 2IX0A 3K5OA 4ABNA 1CUKA 3JC66 4GLXA 1HQRD 2I0QA 1PTOF 4HEDA 3DWQA 3W3AA 2RCNA 4K2LA 5I2XA 5CV4A 4PG3A 5ELDA 1IBKQ 4DXGA 1UNSA 1SR3A 4CJ2C 1KDAA 2EY1A 2E5LL 2XGTA 2KHIA 1Q8KA 1XX8A 1EOVA 1GO3E 1BBUA 1V43A 1RD9D 4JI7L 2B3GA 3CCRA 2ASBA 3HOYH 1C48A 5JJZA 1K9MC 3EN2A 1VQMA 2B2YA 4A3BG 4DK1A 3MFYA 2PMZE 1Q3LA 4A3LH 3MC0B 2NVYH 2C5CA 3QO2A 1Q86C 3HOUG 2QGQA 1J5EQ 4PNYA 4BY1B 2I07B 1NBWA 2V4DA 3CCEA 3HKZG 3HOWB 1Y1WH 1VQCA 5HURA 2KQ3A 1VDZA 5E4WC 4YY3Q 2BA0A 3Q6SA 3I72A 5BR8L 1I6HH 1X4MA 3IRBA 4L5RC 3P75A 3KBGA 3I4MB 4C3JG 3N6RA 3T4AC 5JJIA 1TUAA 1NJIC 3AYHB 5LL6X 4P71A 4A3IH 3R2TA 2K75A 4ZRZA 3CXCA 1BCPC 5M3MH 1VQ6A 2ICEC 3D4DA 1ESFA 4CGYB 2QEJC 4DR2L 4LFBL 3G48A 4JI2L 4B3SL 2YQRA 3HOXH 1B44D 1TU2B 4A3EB 4K2KA 3IL8A 4LF6Q 2F0GA 3N52A 2AUKA 1HA5A 2F0LA 2JA6B 3NEMA 4LIJA 5C5MA 4JI4L 2F4IA 3EFXD 2ZXOA 4XYQA 1HZBA 5BN5A 4UDUC 1H9MA 2TMPA 2UXDQ 4WFN3 1WCMG 1DZ1A 4BBSB 1R9TH 4AYBB 5M5YB 1LTBD 1DXMA 1H9RA 1PH7A 3C1FA 2R93B 5IYDH 3FKIH 3J7AV 2DY7A 4WORA 4R4TA 3R3OA 4DV3L 4HIOA 4KKUA 4RGOS 4A93H 1F9RA 2A6ED 1QE6A 5BN3A 3W2DA 1VS0A 5IWAL 4HJ9A 3GTGH 2MPMA 1KAAA 3TZUA 3OWFA 4GZYC 4JI6Q 5T1GA 1EIGA 4CJ1B 1QVGA 4JI1L 4G57A 4EQ5A 4DV7Q 1P16A 2F0TA 4MTNA 5DEHA 3GTPH 1BCPB 4N9PA 1TS2A 1KHIA 1N9WA 2MO1A 3HOWG 2HIVA 4LF9L 2K5WA 2HDMA 4QF4A 1S4ZA 3M4QA 1IKLA 3SK5A 4ZKCB 4C3IG 3HKZE 4CJ0B 1KNAA 1I3QH 1QILA 5DM63 3H15A 1YHAA 3OW2A 1YHQA 3I4MG 4JI3Q 3NENA 1VQJA 3A0JA 5JVG3 5DNFA 3HOYB 1SE3A 4ZUJA 3V69A 1SYGA 1QZHA 4YWLA 4ZQ3A 2LY7A 2Y0SG 1X32A 3HP3A 2K7VA 4LNQA 2NVYB 2LSSA 4KY6A 1U4LA 1LTID 3BYTB 3DM1A 1E2ZA 3K7AH 4A3EG 3NBIA 2VUMG 1LT6D 3BVMA 3PSIA 2RF4A 1Y1WB 2JA6G 2A68C 1EEID 4H13C 3CPWA 3KYHC 4HIDA 2E5LQ 2A74C 1I6HB 4PMBA 2CTKA 3HGBA 1VMPA 4XT1B 2F0JA 4BBSG 4AYBG 3Q0AA 4UP9A 5IIFA 4JI7Q 1AW7A 2P2RA 4HSPA 3OHXC 1FGBD 1MSHA 2HCCA 2M9VA 4FP5D 4A3IB 3JAMi 2NVTH 5JEAJ 2R93G 4IUVA 4DK6C 1N8RC 5M3MB 2UUCQ 5F2DA 1EY0A 4UY8C 3NPPA 4X3UA 1NCVA 2O5JC 1EIHA 1H9SA 2NB0A 1HPCA 3M9BA 4APVA 2AQ1B 4N9TA 3HOXB 2OPVA 4C3HH 1V1OA 4HR7B 2F0MA 4RA8A 4DGZA 1V1PB 3KLSX 2F0WA 2K05A 1LYLA 3NP8A 2EXDA 1GVPA 5C3EH 3HG9A 2LFNA 3EVQA 5BR8Q 4NXNQ 2EPBA 3MAQA 3S15H 4DPGA 1EY7A 1KC8C 1ZTGA 1R9TB 1SE4A 1OXXK 2ENBA 4XT3B 2UXBL 2NYZD 2CW0C 3PO2G 3D6WA 3SGIA 3TEHB 3PIO3 3FKIB 2CTEA 4QIWE 4GS3A 1AE3A 4A93B 3GTGB 3GTMH 1KHMA 2EJGC 2WINB 1OXVA 3A55A 4DR2Q 1B3AA 4LFBQ 4JI2Q 4B3SQ 1JB7A 2N88A 1ILQA 2K14A 1YJ9A