2FFMA

X-ray crystal structure of protein sav1430 from staphylococcus aureus. northeast structural genomics consortium target zr18.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords SAV1430
publication title Crystal Structure of the Hypothetical Protein SAV1430 from Staphylococcus aureus, Northeast Structural Genomics ZR18.
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
total genus 15
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2ffmA00
2M6QA 2M8WA 1PQXA 2FFMA 2LTMA 2K1HA 2LTLA
chains in the Genus database with same CATH superfamily
3RF2A 4BA1I 1V8CA 1ZZKA 4B8TA 1FKAH 4H8AA 4B3SH 4B3RH 1IBMH 2UUCH 2M6QA 1DT4A 4FJUA 3SB1A 2JE6I 2DGRA 2M8WA 4E9JA 1IBLH 2LTMA 4B3TH 4JI8H 4B8CD 2CTKA 2JA9A 2P2RA 3UOEA 1ZZIA 4AQYH 2VQFH 4NZTM 4JVHA 2FFMA 2ZQEA 2PY9A 4JVYA 5K36G 4LF6H 5A2QW 1X9ZA 3GKUA 3GR5A 4DUZH 4DV2H 1XMOH 4LFAH 1FJGH 1J5EH 2UXCH 3AEVB 1VIHA 2LF0A 1ZZJA 4LF4H 1XNRH 5LMUH 3J7AK 1ODHA 1XNQH 3T1HH 2CTFA 2UXBH 3KDKA 4JI0H 2BL5A 3T1YH 4DV1H 3VKEA 4DR2H 5FLXW 2FMRA 4LFCH 1KHMA 2NN6G 2LTLA 1UG8A 5BR8H 4DV4H 4JI5H 4AM3A 2QNDA 2JEAI 4X62H 4DR4H 2BA0A 2ANRA 4JI1H 3L7ZC 1N33H 5LL6b 1XMQH 4X64H 2CWFA 1VBIA 1K1GA 1I94H 4JI3H 4YY3H 4DV3H 3J81W 2O4CA 2JVZA 5DT9A 4K0KH 2F4VH 2JEBI 2HHHH 3I0PA 1VIGA 4B3MH 4JV5H 1Z2IA 1WE8A 1HR0H 4DV5H 1HNZH 4JI2H 2PT7G 4NZRM 1J5KA 2CTLA 5JEAG 1N34H 4GKKH 2G8YA 1WHRA 5C0XG 4KHPH 3U1KA 3EZJA 1S20A 1PQXA 2AXYA 4DR5H 2OPVA 2CPQA 2Y3MA 2PQUA 4NXNH 1ZTGA 1HNWH 2CWHA 4OD6A 4LIJA 4OO1G 4X66H 4JI4H 4AIMA 4DUYH 5IT9W 4DV0H 4LFBH 4NXMH 3QD7X 2FPHX 4OCHA 4YHHH 1AN7A 4LF9H 1N32H 3V69A 2UU9H 4DV7H 3FAUA 4GKJH 2OPUA 5LMNH 4DR3H 2ZM6H 2LRRA 2CTMA 4DV6H 1DTJA 4DR6H 1S03G 1SEIA 1IBKH 1WTJA 2CPMA 3GABA 2HH3A 1TUAA 4QMFB 3NCVA 4LF7H 2CTJA 4PDBA 2E3UA 4JI6H 2VKCA 2A1SA 1NXUA 1EC6A 4JI7H 1X4NA 4X65H 1V9NA 4BA2I 2JZXA 4IFDG 1I6UA 3J80W 3OETA 3OSSD 4FJSA 4G08A 3JAMW 1HNXH 2YQRA 4WALA 2E5LH 1MSZA 4EC5A 5IWAH 4JYAH 2D9IA 2ANNA 1F0XA 2X06A 1WVNA 2VQEH 1N36H 4LF8H 1X4MA 1XRHA 4NBQA 1J4WA 4WANA 4DR1H 2UUAH 2UXDH 4DR7H 2HH2A 4LF5H 4OX9H 1X0AA 3OTOH 2MJHA 2UUBH 2K1HA 3KDGA 2Z0SA 2CTEA
chains in the Genus database with same CATH topology
2M6QA 2M8WA 1PQXA 2FFMA 2LTMA 2K1HA 2LTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6Q A;  2M8W A;  1PQX A;  2FFM A;  2LTM A;  2K1H A;  2LTL A; 
#chains in the Genus database with same CATH topology
 3RF2 A;  4BA1 I;  1V8C A;  1ZZK A;  4B8T A;  1FKA H;  4H8A A;  4B3S H;  4B3R H;  1IBM H;  2UUC H;  2M6Q A;  1DT4 A;  4FJU A;  3SB1 A;  2JE6 I;  2DGR A;  2M8W A;  4E9J A;  1IBL H;  2LTM A;  4B3T H;  4JI8 H;  4B8C D;  2CTK A;  2JA9 A;  2P2R A;  3UOE A;  1ZZI A;  4AQY H;  2VQF H;  4NZT M;  4JVH A;  2FFM A;  2ZQE A;  2PY9 A;  4JVY A;  5K36 G;  4LF6 H;  5A2Q W;  1X9Z A;  3GKU A;  3GR5 A;  4DUZ H;  4DV2 H;  1XMO H;  4LFA H;  1FJG H;  1J5E H;  2UXC H;  3AEV B;  1VIH A;  2LF0 A;  1ZZJ A;  4LF4 H;  1XNR H;  5LMU H;  3J7A K;  1ODH A;  1XNQ H;  3T1H H;  2CTF A;  2UXB H;  3KDK A;  4JI0 H;  2BL5 A;  3T1Y H;  4DV1 H;  3VKE A;  4DR2 H;  5FLX W;  2FMR A;  4LFC H;  1KHM A;  2NN6 G;  2LTL A;  1UG8 A;  5BR8 H;  4DV4 H;  4JI5 H;  4AM3 A;  2QND A;  2JEA I;  4X62 H;  4DR4 H;  2BA0 A;  2ANR A;  4JI1 H;  3L7Z C;  1N33 H;  5LL6 b;  1XMQ H;  4X64 H;  2CWF A;  1VBI A;  1K1G A;  1I94 H;  4JI3 H;  4YY3 H;  4DV3 H;  3J81 W;  2O4C A;  2JVZ A;  5DT9 A;  4K0K H;  2F4V H;  2JEB I;  2HHH H;  3I0P A;  1VIG A;  4B3M H;  4JV5 H;  1Z2I A;  1WE8 A;  1HR0 H;  4DV5 H;  1HNZ H;  4JI2 H;  2PT7 G;  4NZR M;  1J5K A;  2CTL A;  5JEA G;  1N34 H;  4GKK H;  2G8Y A;  1WHR A;  5C0X G;  4KHP H;  3U1K A;  3EZJ A;  1S20 A;  1PQX A;  2AXY A;  4DR5 H;  2OPV A;  2CPQ A;  2Y3M A;  2PQU A;  4NXN H;  1ZTG A;  1HNW H;  2CWH A;  4OD6 A;  4LIJ A;  4OO1 G;  4X66 H;  4JI4 H;  4AIM A;  4DUY H;  5IT9 W;  4DV0 H;  4LFB H;  4NXM H;  3QD7 X;  2FPH X;  4OCH A;  4YHH H;  1AN7 A;  4LF9 H;  1N32 H;  3V69 A;  2UU9 H;  4DV7 H;  3FAU A;  4GKJ H;  2OPU A;  5LMN H;  4DR3 H;  2ZM6 H;  2LRR A;  2CTM A;  4DV6 H;  1DTJ A;  4DR6 H;  1S03 G;  1SEI A;  1IBK H;  1WTJ A;  2CPM A;  3GAB A;  2HH3 A;  1TUA A;  4QMF B;  3NCV A;  4LF7 H;  2CTJ A;  4PDB A;  2E3U A;  4JI6 H;  2VKC A;  2A1S A;  1NXU A;  1EC6 A;  4JI7 H;  1X4N A;  4X65 H;  1V9N A;  4BA2 I;  2JZX A;  4IFD G;  1I6U A;  3J80 W;  3OET A;  3OSS D;  4FJS A;  4G08 A;  3JAM W;  1HNX H;  2YQR A;  4WAL A;  2E5L H;  1MSZ A;  4EC5 A;  5IWA H;  4JYA H;  2D9I A;  2ANN A;  1F0X A;  2X06 A;  1WVN A;  2VQE H;  1N36 H;  4LF8 H;  1X4M A;  1XRH A;  4NBQ A;  1J4W A;  4WAN A;  4DR1 H;  2UUA H;  2UXD H;  4DR7 H;  2HH2 A;  4LF5 H;  4OX9 H;  1X0A A;  3OTO H;  2MJH A;  2UUB H;  2K1H A;  3KDG A;  2Z0S A;  2CTE A; 
#chains in the Genus database with same CATH homology
 2M6Q A;  2M8W A;  1PQX A;  2FFM A;  2LTM A;  2K1H A;  2LTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...