2FFMA

X-ray crystal structure of protein sav1430 from staphylococcus aureus. northeast structural genomics consortium target zr18.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
b'MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAV1430
publication title Crystal Structure of the Hypothetical Protein SAV1430 from Staphylococcus aureus, Northeast Structural Genomics ZR18.
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Structural genomics, unknown function
total genus 15
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2ffmA00
1PQXA 2K1HA 2FFMA 2M6QA 2LTMA 2LTLA 2M8WA
chains in the Genus database with same CATH superfamily
3KDGA 4LF7H 4WANA 2E5LH 1TUAA 4NZTM 1VIHA 4B3SH 1X9ZA 4B8CD 1HNXH 4JI2H 4X65H 4DR2H 4JI7H 2CTJA 4B8TA 4NXNH 1IBLH 1N34H 5K36G 2ANRA 4FJSA 2AXYA 2UUAH 2M6QA 2JE6I 2JA9A 4X62H 4KHPH 4LF8H 3J7AK 1IBKH 4AIMA 4BA2I 2VQFH 4JI4H 4NZRM 2CWHA 2UXBH 2JEAI 1X4NA 5LL6b 2Y3MA 4NBQA 4B3MH 4DR4H 1J5KA 3GR5A 2CPMA 4OD6A 1ODHA 1DTJA 2HHHH 4X66H 2FFMA 2YQRA 2PQUA 2CWFA 2P2RA 1XNQH 3FAUA 4K0KH 2JVZA 2CTFA 2OPVA 3V69A 3T1YH 1V8CA 1X0AA 4LFAH 4OX9H 1S20A 2LRRA 2MJHA 2E3UA 3OSSD 2LTLA 4JI6H 2F4VH 4B3TH 1VBIA 3NCVA 2DGRA 4AM3A 1ZZIA 4DV0H 1WE8A 3VKEA 5LMNH 3T1HH 2FPHX 5A2QW 1I94H 3QD7X 1N33H 4JI0H 3OETA 1SEIA 3GABA 1MSZA 1UG8A 1FJGH 4B3RH 4OO1G 4DR6H 4DR7H 5LMUH 4WALA 4JI5H 2QNDA 2CTMA 1F0XA 4AQYH 4JI1H 1WTJA 4LF6H 1HNZH 4DR3H 4H8AA 5DT9A 1HR0H 4DV1H 2BA0A 1ZTGA 1PQXA 1KHMA 3GKUA 5IWAH 3EZJA 1WHRA 1J4WA 4JYAH 4DV5H 1XRHA 4X64H 4DV2H 1ZZJA 1K1GA 4JI3H 2UU9H 2A1SA 4JI8H 1DT4A 4DV4H 4DR5H 1J5EH 3JAMW 3AEVB 4PDBA 2HH3A 2VQEH 2OPUA 3SB1A 4DUYH 2PT7G 1EC6A 4LFBH 2CTKA 4NXMH 3UOEA 1X4MA 1WVNA 3J80W 4DR1H 5FLXW 2UUCH 2BL5A 3J81W 1I6UA 1VIGA 4JVYA 2K1HA 2ZQEA 4E9JA 2ANNA 3OTOH 1NXUA 3U1KA 2D9IA 2ZM6H 1AN7A 4LF4H 2NN6G 4JVHA 3KDKA 1FKAH 2O4CA 5C0XG 1N36H 2UXCH 4LF5H 4LF9H 3I0PA 4JV5H 2CPQA 4YY3H 2CTLA 4G08A 3L7ZC 2VKCA 2X06A 5IT9W 1N32H 2JZXA 1IBMH 4LFCH 5JEAG 4LIJA 4OCHA 4GKKH 2UXDH 1ZZKA 4DV6H 2HH2A 4DV3H 2LTMA 2G8YA 1V9NA 2M8WA 1Z2IA 5BR8H 1XMOH 2JEBI 2Z0SA 4GKJH 4EC5A 2LF0A 1XNRH 4DUZH 2PY9A 4YHHH 1S03G 4IFDG 4BA1I 1HNWH 4FJUA 4DV7H 4QMFB 2UUBH 2CTEA 2FMRA 1XMQH 3RF2A
chains in the Genus database with same CATH topology
1PQXA 2K1HA 2FFMA 2M6QA 2LTMA 2LTLA 2M8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PQX A;  2K1H A;  2FFM A;  2M6Q A;  2LTM A;  2LTL A;  2M8W A; 
#chains in the Genus database with same CATH topology
 3KDG A;  4LF7 H;  4WAN A;  2E5L H;  1TUA A;  4NZT M;  1VIH A;  4B3S H;  1X9Z A;  4B8C D;  1HNX H;  4JI2 H;  4X65 H;  4DR2 H;  4JI7 H;  2CTJ A;  4B8T A;  4NXN H;  1IBL H;  1N34 H;  5K36 G;  2ANR A;  4FJS A;  2AXY A;  2UUA H;  2M6Q A;  2JE6 I;  2JA9 A;  4X62 H;  4KHP H;  4LF8 H;  3J7A K;  1IBK H;  4AIM A;  4BA2 I;  2VQF H;  4JI4 H;  4NZR M;  2CWH A;  2UXB H;  2JEA I;  1X4N A;  5LL6 b;  2Y3M A;  4NBQ A;  4B3M H;  4DR4 H;  1J5K A;  3GR5 A;  2CPM A;  4OD6 A;  1ODH A;  1DTJ A;  2HHH H;  4X66 H;  2FFM A;  2YQR A;  2PQU A;  2CWF A;  2P2R A;  1XNQ H;  3FAU A;  4K0K H;  2JVZ A;  2CTF A;  2OPV A;  3V69 A;  3T1Y H;  1V8C A;  1X0A A;  4LFA H;  4OX9 H;  1S20 A;  2LRR A;  2MJH A;  2E3U A;  3OSS D;  2LTL A;  4JI6 H;  2F4V H;  4B3T H;  1VBI A;  3NCV A;  2DGR A;  4AM3 A;  1ZZI A;  4DV0 H;  1WE8 A;  3VKE A;  5LMN H;  3T1H H;  2FPH X;  5A2Q W;  1I94 H;  3QD7 X;  1N33 H;  4JI0 H;  3OET A;  1SEI A;  3GAB A;  1MSZ A;  1UG8 A;  1FJG H;  4B3R H;  4OO1 G;  4DR6 H;  4DR7 H;  5LMU H;  4WAL A;  4JI5 H;  2QND A;  2CTM A;  1F0X A;  4AQY H;  4JI1 H;  1WTJ A;  4LF6 H;  1HNZ H;  4DR3 H;  4H8A A;  5DT9 A;  1HR0 H;  4DV1 H;  2BA0 A;  1ZTG A;  1PQX A;  1KHM A;  3GKU A;  5IWA H;  3EZJ A;  1WHR A;  1J4W A;  4JYA H;  4DV5 H;  1XRH A;  4X64 H;  4DV2 H;  1ZZJ A;  1K1G A;  4JI3 H;  2UU9 H;  2A1S A;  4JI8 H;  1DT4 A;  4DV4 H;  4DR5 H;  1J5E H;  3JAM W;  3AEV B;  4PDB A;  2HH3 A;  2VQE H;  2OPU A;  3SB1 A;  4DUY H;  2PT7 G;  1EC6 A;  4LFB H;  2CTK A;  4NXM H;  3UOE A;  1X4M A;  1WVN A;  3J80 W;  4DR1 H;  5FLX W;  2UUC H;  2BL5 A;  3J81 W;  1I6U A;  1VIG A;  4JVY A;  2K1H A;  2ZQE A;  4E9J A;  2ANN A;  3OTO H;  1NXU A;  3U1K A;  2D9I A;  2ZM6 H;  1AN7 A;  4LF4 H;  2NN6 G;  4JVH A;  3KDK A;  1FKA H;  2O4C A;  5C0X G;  1N36 H;  2UXC H;  4LF5 H;  4LF9 H;  3I0P A;  4JV5 H;  2CPQ A;  4YY3 H;  2CTL A;  4G08 A;  3L7Z C;  2VKC A;  2X06 A;  5IT9 W;  1N32 H;  2JZX A;  1IBM H;  4LFC H;  5JEA G;  4LIJ A;  4OCH A;  4GKK H;  2UXD H;  1ZZK A;  4DV6 H;  2HH2 A;  4DV3 H;  2LTM A;  2G8Y A;  1V9N A;  2M8W A;  1Z2I A;  5BR8 H;  1XMO H;  2JEB I;  2Z0S A;  4GKJ H;  4EC5 A;  2LF0 A;  1XNR H;  4DUZ H;  2PY9 A;  4YHH H;  1S03 G;  4IFD G;  4BA1 I;  1HNW H;  4FJU A;  4DV7 H;  4QMF B;  2UUB H;  2CTE A;  2FMR A;  1XMQ H;  3RF2 A; 
#chains in the Genus database with same CATH homology
 1PQX A;  2K1H A;  2FFM A;  2M6Q A;  2LTM A;  2LTL A;  2M8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...