2FFMA

X-ray crystal structure of protein sav1430 from staphylococcus aureus. northeast structural genomics consortium target zr18.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
b'MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAV1430
molecule tags Structural genomics, unknown function
source organism Staphylococcus aureus subsp. aureus mu50
publication title Crystal Structure of the Hypothetical Protein SAV1430 from Staphylococcus aureus, Northeast Structural Genomics ZR18.
rcsb
total genus 15
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2ffmA00
1PQXA 2M8WA 2LTLA 2FFMA 2K1HA 2LTMA 2M6QA
chains in the Genus database with same CATH superfamily
5BR8H 1AN7A 4DV4H 2FFMA 2NN6G 4YHHH 2ZQEA 2VQEH 1V9NA 2JE6I 2YQRA 2ZM6H 4DR2H 1WHRA 4YY3H 4DUZH 1K1GA 2P2RA 1IBMH 2UXBH 4B3TH 4DR5H 5C0XG 2HHHH 3VKEA 4JI1H 1KHMA 1WE8A 1MSZA 4LIJA 5LMUH 1FJGH 1ZZKA 5K36G 3L7ZC 4JI5H 3SB1A 4DR4H 2QNDA 1XNQH 4JVHA 4BA2I 5JEAG 2BL5A 4JV5H 4B3RH 4NXNH 4X64H 4H8AA 4JI7H 2LF0A 1I6UA 3V69A 4LF9H 1DTJA 3EZJA 4LFAH 1UG8A 2E3UA 4LFCH 4DV6H 2BA0A 5IWAH 4PDBA 1NXUA 2MJHA 1ZTGA 4DV3H 2CPQA 2DGRA 2UXCH 2K1HA 2X06A 4NBQA 2D9IA 4NZRM 4DUYH 4DR7H 4OO1G 1S03G 1DT4A 3KDKA 2UU9H 4KHPH 2JEBI 4X66H 4GKJH 2HH3A 4G08A 2CWHA 3J7AK 2ANNA 2JVZA 3GABA 4NZTM 2M6QA 2JEAI 4AQYH 2VKCA 2A1SA 3OTOH 1X9ZA 2G8YA 2CTMA 3T1HH 2LRRA 4AM3A 1VIGA 1WTJA 1WVNA 1J5KA 2PQUA 2Y3MA 2JA9A 4JVYA 4JI6H 4AIMA 4LF5H 1IBLH 1TUAA 4WALA 4EC5A 4DR1H 1X4NA 4JI2H 2FMRA 3RF2A 2CTJA 4FJUA 4E9JA 4DV0H 3J80W 1X4MA 5A2QW 1ODHA 1N36H 5IT9W 4JI3H 1F0XA 4DV1H 3T1YH 2CTLA 2JZXA 4B3SH 4LF8H 2LTLA 2CTEA 2PT7G 3KDGA 1J5EH 1HNXH 2UUBH 2CPMA 2UXDH 4WANA 1J4WA 1XMQH 3I0PA 2OPUA 4X65H 4DV2H 4NXMH 4GKKH 2UUAH 1S20A 4JI4H 5LL6b 3QD7X 4OD6A 1I94H 4OX9H 2HH2A 5DT9A 1XRHA 4LFBH 3NCVA 4JI0H 3JAMW 4DV7H 5FLXW 1N34H 1X0AA 1FKAH 2F4VH 4IFDG 2FPHX 2VQFH 2E5LH 4JYAH 1V8CA 4DR6H 1HNWH 4FJSA 3OETA 3GKUA 1HR0H 2CWFA 1XNRH 2ANRA 2M8WA 1N33H 3FAUA 3U1KA 3J81W 1N32H 2AXYA 4BA1I 4JI8H 4LF6H 2Z0SA 4DR3H 3UOEA 4B3MH 4LF4H 1ZZIA 2CTFA 2O4CA 4X62H 4K0KH 4OCHA 2LTMA 2UUCH 3AEVB 4DV5H 3GR5A 2CTKA 1PQXA 4B8CD 1ZZJA 4QMFB 2OPVA 3OSSD 1Z2IA 1IBKH 1VBIA 1XMOH 4B8TA 2PY9A 1VIHA 1SEIA 5LMNH 4LF7H 1EC6A 1HNZH
chains in the Genus database with same CATH topology
1PQXA 2M8WA 2LTLA 2FFMA 2K1HA 2LTMA 2M6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PQX A;  2M8W A;  2LTL A;  2FFM A;  2K1H A;  2LTM A;  2M6Q A; 
#chains in the Genus database with same CATH topology
 5BR8 H;  1AN7 A;  4DV4 H;  2FFM A;  2NN6 G;  4YHH H;  2ZQE A;  2VQE H;  1V9N A;  2JE6 I;  2YQR A;  2ZM6 H;  4DR2 H;  1WHR A;  4YY3 H;  4DUZ H;  1K1G A;  2P2R A;  1IBM H;  2UXB H;  4B3T H;  4DR5 H;  5C0X G;  2HHH H;  3VKE A;  4JI1 H;  1KHM A;  1WE8 A;  1MSZ A;  4LIJ A;  5LMU H;  1FJG H;  1ZZK A;  5K36 G;  3L7Z C;  4JI5 H;  3SB1 A;  4DR4 H;  2QND A;  1XNQ H;  4JVH A;  4BA2 I;  5JEA G;  2BL5 A;  4JV5 H;  4B3R H;  4NXN H;  4X64 H;  4H8A A;  4JI7 H;  2LF0 A;  1I6U A;  3V69 A;  4LF9 H;  1DTJ A;  3EZJ A;  4LFA H;  1UG8 A;  2E3U A;  4LFC H;  4DV6 H;  2BA0 A;  5IWA H;  4PDB A;  1NXU A;  2MJH A;  1ZTG A;  4DV3 H;  2CPQ A;  2DGR A;  2UXC H;  2K1H A;  2X06 A;  4NBQ A;  2D9I A;  4NZR M;  4DUY H;  4DR7 H;  4OO1 G;  1S03 G;  1DT4 A;  3KDK A;  2UU9 H;  4KHP H;  2JEB I;  4X66 H;  4GKJ H;  2HH3 A;  4G08 A;  2CWH A;  3J7A K;  2ANN A;  2JVZ A;  3GAB A;  4NZT M;  2M6Q A;  2JEA I;  4AQY H;  2VKC A;  2A1S A;  3OTO H;  1X9Z A;  2G8Y A;  2CTM A;  3T1H H;  2LRR A;  4AM3 A;  1VIG A;  1WTJ A;  1WVN A;  1J5K A;  2PQU A;  2Y3M A;  2JA9 A;  4JVY A;  4JI6 H;  4AIM A;  4LF5 H;  1IBL H;  1TUA A;  4WAL A;  4EC5 A;  4DR1 H;  1X4N A;  4JI2 H;  2FMR A;  3RF2 A;  2CTJ A;  4FJU A;  4E9J A;  4DV0 H;  3J80 W;  1X4M A;  5A2Q W;  1ODH A;  1N36 H;  5IT9 W;  4JI3 H;  1F0X A;  4DV1 H;  3T1Y H;  2CTL A;  2JZX A;  4B3S H;  4LF8 H;  2LTL A;  2CTE A;  2PT7 G;  3KDG A;  1J5E H;  1HNX H;  2UUB H;  2CPM A;  2UXD H;  4WAN A;  1J4W A;  1XMQ H;  3I0P A;  2OPU A;  4X65 H;  4DV2 H;  4NXM H;  4GKK H;  2UUA H;  1S20 A;  4JI4 H;  5LL6 b;  3QD7 X;  4OD6 A;  1I94 H;  4OX9 H;  2HH2 A;  5DT9 A;  1XRH A;  4LFB H;  3NCV A;  4JI0 H;  3JAM W;  4DV7 H;  5FLX W;  1N34 H;  1X0A A;  1FKA H;  2F4V H;  4IFD G;  2FPH X;  2VQF H;  2E5L H;  4JYA H;  1V8C A;  4DR6 H;  1HNW H;  4FJS A;  3OET A;  3GKU A;  1HR0 H;  2CWF A;  1XNR H;  2ANR A;  2M8W A;  1N33 H;  3FAU A;  3U1K A;  3J81 W;  1N32 H;  2AXY A;  4BA1 I;  4JI8 H;  4LF6 H;  2Z0S A;  4DR3 H;  3UOE A;  4B3M H;  4LF4 H;  1ZZI A;  2CTF A;  2O4C A;  4X62 H;  4K0K H;  4OCH A;  2LTM A;  2UUC H;  3AEV B;  4DV5 H;  3GR5 A;  2CTK A;  1PQX A;  4B8C D;  1ZZJ A;  4QMF B;  2OPV A;  3OSS D;  1Z2I A;  1IBK H;  1VBI A;  1XMO H;  4B8T A;  2PY9 A;  1VIH A;  1SEI A;  5LMN H;  4LF7 H;  1EC6 A;  1HNZ H; 
#chains in the Genus database with same CATH homology
 1PQX A;  2M8W A;  2LTL A;  2FFM A;  2K1H A;  2LTM A;  2M6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...