2FFMA

X-ray crystal structure of protein sav1430 from staphylococcus aureus. northeast structural genomics consortium target zr18.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAV1430
publication title Crystal Structure of the Hypothetical Protein SAV1430 from Staphylococcus aureus, Northeast Structural Genomics ZR18.
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Structural genomics, unknown function
total genus 15
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2ffmA00
2M8WA 1PQXA 2LTLA 2FFMA 2K1HA 2M6QA 2LTMA
chains in the Genus database with same CATH superfamily
1N36H 2JEAI 4OX9H 4GKKH 3OETA 4DR5H 3SB1A 2FFMA 5IWAH 4WALA 3T1HH 2ANNA 3GKUA 5JEAG 4PDBA 1V8CA 2CTFA 2D9IA 3I0PA 4LF4H 1S03G 1IBLH 5A2QW 1VIHA 4DR3H 5LMNH 5LMUH 2CPMA 1HNWH 1UG8A 2ANRA 4AIMA 2UXBH 3FAUA 2A1SA 3J81W 1I6UA 1TUAA 4B3MH 1AN7A 3J80W 1J5KA 2Z0SA 4LF7H 4EC5A 4B8TA 2UXDH 2LTMA 5IT9W 3QD7X 5K36G 1WE8A 3J7AK 4JV5H 4JVHA 4DV7H 4X65H 4KHPH 3KDGA 2PT7G 3GR5A 4DV4H 4AM3A 2LF0A 2MJHA 4DR2H 2UUBH 4QMFB 1DT4A 2CWFA 4NZRM 1MSZA 4FJUA 4NXNH 4OCHA 2E5LH 4LF9H 4X62H 2P2RA 1XNRH 4NZTM 4NXMH 4DR1H 1XMOH 4DV0H 2JEBI 4JI4H 2CTMA 3U1KA 4K0KH 2CTEA 2AXYA 1FKAH 4YHHH 5LL6b 2X06A 3JAMW 1VBIA 4DV2H 2HH3A 2ZQEA 2CTJA 1ZZJA 4B3SH 2FMRA 1HNZH 2Y3MA 4LFAH 3OSSD 2CPQA 4JI8H 1Z2IA 4LFCH 1K1GA 1X4NA 1WTJA 4LIJA 2JZXA 1DTJA 1ZZKA 4H8AA 2O4CA 4DUYH 2CWHA 4DV5H 2LRRA 4BA2I 1EC6A 4LFBH 4OO1G 4FJSA 4IFDG 4DUZH 2UXCH 1SEIA 2UU9H 1XMQH 1J4WA 4DR4H 1IBKH 4WANA 4X64H 2OPUA 4DV3H 4B3RH 1I94H 4JYAH 3EZJA 1X4MA 3OTOH 5BR8H 2UUCH 4DR7H 4JI5H 4G08A 4JI6H 2FPHX 2JA9A 5C0XG 5DT9A 3L7ZC 1ZTGA 2VQEH 4E9JA 3RF2A 4LF5H 3V69A 1FJGH 1PQXA 1X9ZA 1S20A 2HH2A 3UOEA 4JI2H 4JI3H 4DV6H 1WVNA 4OD6A 1V9NA 4LF8H 4X66H 2PY9A 2M8WA 2VQFH 1KHMA 2LTLA 2E3UA 2VKCA 1VIGA 2UUAH 3AEVB 1NXUA 1X0AA 2CTKA 5FLXW 4DR6H 4JI7H 1N34H 1XNQH 2BA0A 3GABA 4YY3H 4JI0H 1N33H 4JVYA 3KDKA 2G8YA 2M6QA 4B8CD 4BA1I 1IBMH 1ODHA 2HHHH 2OPVA 1WHRA 2JVZA 1HNXH 4JI1H 1ZZIA 2QNDA 2F4VH 1F0XA 2JE6I 2PQUA 1J5EH 2K1HA 2YQRA 3NCVA 3VKEA 2CTLA 2ZM6H 4GKJH 2DGRA 4AQYH 4NBQA 2BL5A 4DV1H 1HR0H 2NN6G 3T1YH 1XRHA 4LF6H 1N32H 4B3TH
chains in the Genus database with same CATH topology
2M8WA 1PQXA 2LTLA 2FFMA 2K1HA 2M6QA 2LTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8W A;  1PQX A;  2LTL A;  2FFM A;  2K1H A;  2M6Q A;  2LTM A; 
#chains in the Genus database with same CATH topology
 1N36 H;  2JEA I;  4OX9 H;  4GKK H;  3OET A;  4DR5 H;  3SB1 A;  2FFM A;  5IWA H;  4WAL A;  3T1H H;  2ANN A;  3GKU A;  5JEA G;  4PDB A;  1V8C A;  2CTF A;  2D9I A;  3I0P A;  4LF4 H;  1S03 G;  1IBL H;  5A2Q W;  1VIH A;  4DR3 H;  5LMN H;  5LMU H;  2CPM A;  1HNW H;  1UG8 A;  2ANR A;  4AIM A;  2UXB H;  3FAU A;  2A1S A;  3J81 W;  1I6U A;  1TUA A;  4B3M H;  1AN7 A;  3J80 W;  1J5K A;  2Z0S A;  4LF7 H;  4EC5 A;  4B8T A;  2UXD H;  2LTM A;  5IT9 W;  3QD7 X;  5K36 G;  1WE8 A;  3J7A K;  4JV5 H;  4JVH A;  4DV7 H;  4X65 H;  4KHP H;  3KDG A;  2PT7 G;  3GR5 A;  4DV4 H;  4AM3 A;  2LF0 A;  2MJH A;  4DR2 H;  2UUB H;  4QMF B;  1DT4 A;  2CWF A;  4NZR M;  1MSZ A;  4FJU A;  4NXN H;  4OCH A;  2E5L H;  4LF9 H;  4X62 H;  2P2R A;  1XNR H;  4NZT M;  4NXM H;  4DR1 H;  1XMO H;  4DV0 H;  2JEB I;  4JI4 H;  2CTM A;  3U1K A;  4K0K H;  2CTE A;  2AXY A;  1FKA H;  4YHH H;  5LL6 b;  2X06 A;  3JAM W;  1VBI A;  4DV2 H;  2HH3 A;  2ZQE A;  2CTJ A;  1ZZJ A;  4B3S H;  2FMR A;  1HNZ H;  2Y3M A;  4LFA H;  3OSS D;  2CPQ A;  4JI8 H;  1Z2I A;  4LFC H;  1K1G A;  1X4N A;  1WTJ A;  4LIJ A;  2JZX A;  1DTJ A;  1ZZK A;  4H8A A;  2O4C A;  4DUY H;  2CWH A;  4DV5 H;  2LRR A;  4BA2 I;  1EC6 A;  4LFB H;  4OO1 G;  4FJS A;  4IFD G;  4DUZ H;  2UXC H;  1SEI A;  2UU9 H;  1XMQ H;  1J4W A;  4DR4 H;  1IBK H;  4WAN A;  4X64 H;  2OPU A;  4DV3 H;  4B3R H;  1I94 H;  4JYA H;  3EZJ A;  1X4M A;  3OTO H;  5BR8 H;  2UUC H;  4DR7 H;  4JI5 H;  4G08 A;  4JI6 H;  2FPH X;  2JA9 A;  5C0X G;  5DT9 A;  3L7Z C;  1ZTG A;  2VQE H;  4E9J A;  3RF2 A;  4LF5 H;  3V69 A;  1FJG H;  1PQX A;  1X9Z A;  1S20 A;  2HH2 A;  3UOE A;  4JI2 H;  4JI3 H;  4DV6 H;  1WVN A;  4OD6 A;  1V9N A;  4LF8 H;  4X66 H;  2PY9 A;  2M8W A;  2VQF H;  1KHM A;  2LTL A;  2E3U A;  2VKC A;  1VIG A;  2UUA H;  3AEV B;  1NXU A;  1X0A A;  2CTK A;  5FLX W;  4DR6 H;  4JI7 H;  1N34 H;  1XNQ H;  2BA0 A;  3GAB A;  4YY3 H;  4JI0 H;  1N33 H;  4JVY A;  3KDK A;  2G8Y A;  2M6Q A;  4B8C D;  4BA1 I;  1IBM H;  1ODH A;  2HHH H;  2OPV A;  1WHR A;  2JVZ A;  1HNX H;  4JI1 H;  1ZZI A;  2QND A;  2F4V H;  1F0X A;  2JE6 I;  2PQU A;  1J5E H;  2K1H A;  2YQR A;  3NCV A;  3VKE A;  2CTL A;  2ZM6 H;  4GKJ H;  2DGR A;  4AQY H;  4NBQ A;  2BL5 A;  4DV1 H;  1HR0 H;  2NN6 G;  3T1Y H;  1XRH A;  4LF6 H;  1N32 H;  4B3T H; 
#chains in the Genus database with same CATH homology
 2M8W A;  1PQX A;  2LTL A;  2FFM A;  2K1H A;  2M6Q A;  2LTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...