1MSZA

Solution structure of the r3h domain from human smubp-2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
GVDHFRAMIVEFMASKKMQLEFPPSLNSHDRLRVHQIAEEHGLRHDSSGEGKRRFITVSKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the R3H domain from human Smubp-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA-binding protein SMUBP-2
total genus 14
structure length 62
sequence length 62
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 1mszA00
2CPMA 3GKUA 1MSZA 2A1SA 1WHRA 2LRRA 1UG8A
chains in the Genus database with same CATH superfamily
4JVHA 2CWFA 4FJSA 3L7ZC 2UU9H 3KDKA 4B3MH 4IFDG 2P2RA 4AIMA 2X06A 1ZZJA 1WE8A 5JEAG 4YHHH 4JV5H 1Z2IA 1AN7A 1X9ZA 1N34H 4NXMH 1VIGA 1F0XA 1X4MA 4LF8H 3J81W 4LF4H 2FPHX 1NXUA 4EC5A 4B3TH 4DV7H 2CTMA 4DV6H 2CPMA 1J5KA 4LFCH 2NN6G 2VQFH 1N32H 2YQRA 1V8CA 1HNXH 4OO1G 2UUBH 2OPVA 3I0PA 1XNQH 4NZRM 1DT4A 2M6QA 1MSZA 2FFMA 3RF2A 3T1HH 1S03G 2UXCH 2UUCH 2BA0A 3JAMW 1WHRA 3OETA 5IT9W 3GABA 4BA1I 1VBIA 4DR1H 3UOEA 4G08A 4X66H 2G8YA 2Y3MA 1HR0H 4AQYH 4E9JA 2LF0A 4LIJA 3KDGA 3U1KA 2MJHA 4JI1H 4NXNH 2LRRA 1ZTGA 1ZZKA 4FJUA 1FKAH 2M8WA 4LF7H 3GR5A 2ZM6H 1S20A 2HH3A 4NZTM 2ANNA 2CTLA 3T1YH 4LF5H 4B8CD 2UXDH 2ZQEA 3AEVB 1ZZIA 1IBKH 3V69A 4JI5H 4DR5H 2JEAI 1PQXA 4DUZH 4B3SH 2JVZA 4JI6H 4K0KH 1XNRH 3VKEA 4H8AA 1FJGH 4JI8H 2CWHA 2K1HA 2CTEA 1I6UA 2AXYA 1HNWH 2OPUA 2HH2A 1EC6A 4LF6H 2PT7G 2DGRA 5A2QW 4DV2H 2LTLA 1N33H 4GKKH 4X62H 3J80W 4WANA 5DT9A 2UUAH 1XRHA 2QNDA 2VKCA 2E3UA 4JI0H 4DR4H 2F4VH 4AM3A 1IBLH 4DR2H 1XMQH 2HHHH 4DR7H 1WVNA 2PY9A 1X0AA 3GKUA 4B3RH 4DV3H 1X4NA 4DV1H 4B8TA 4LFBH 2FMRA 2LTMA 3OSSD 4QMFB 1N36H 3SB1A 4JI7H 4LF9H 4OD6A 4DR6H 4KHPH 3J7AK 1V9NA 1IBMH 4JI2H 2BL5A 3NCVA 1VIHA 4DUYH 4DV5H 4OX9H 2ANRA 1J4WA 4JI4H 2UXBH 2D9IA 4NBQA 2VQEH 2Z0SA 1TUAA 5FLXW 2E5LH 4WALA 4JYAH 4OCHA 4DV4H 4LFAH 5LL6b 4X64H 3OTOH 1XMOH 3QD7X 4YY3H 5BR8H 4JVYA 3FAUA 1KHMA 4DV0H 3EZJA 1ODHA 1HNZH 1SEIA 2O4CA 2PQUA 2JEBI 4DR3H 1J5EH 5K36G 2A1SA 2CPQA 4JI3H 5LMUH 4GKJH 1K1GA 1I94H 5C0XG 4PDBA 1UG8A 5IWAH 2JZXA 2JA9A 5LMNH 2CTKA 2CTJA 2CTFA 4X65H 1DTJA 4BA2I 1WTJA 2JE6I
chains in the Genus database with same CATH topology
2CPMA 3GKUA 1MSZA 2A1SA 1WHRA 2LRRA 1UG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPM A;  3GKU A;  1MSZ A;  2A1S A;  1WHR A;  2LRR A;  1UG8 A; 
#chains in the Genus database with same CATH topology
 4JVH A;  2CWF A;  4FJS A;  3L7Z C;  2UU9 H;  3KDK A;  4B3M H;  4IFD G;  2P2R A;  4AIM A;  2X06 A;  1ZZJ A;  1WE8 A;  5JEA G;  4YHH H;  4JV5 H;  1Z2I A;  1AN7 A;  1X9Z A;  1N34 H;  4NXM H;  1VIG A;  1F0X A;  1X4M A;  4LF8 H;  3J81 W;  4LF4 H;  2FPH X;  1NXU A;  4EC5 A;  4B3T H;  4DV7 H;  2CTM A;  4DV6 H;  2CPM A;  1J5K A;  4LFC H;  2NN6 G;  2VQF H;  1N32 H;  2YQR A;  1V8C A;  1HNX H;  4OO1 G;  2UUB H;  2OPV A;  3I0P A;  1XNQ H;  4NZR M;  1DT4 A;  2M6Q A;  1MSZ A;  2FFM A;  3RF2 A;  3T1H H;  1S03 G;  2UXC H;  2UUC H;  2BA0 A;  3JAM W;  1WHR A;  3OET A;  5IT9 W;  3GAB A;  4BA1 I;  1VBI A;  4DR1 H;  3UOE A;  4G08 A;  4X66 H;  2G8Y A;  2Y3M A;  1HR0 H;  4AQY H;  4E9J A;  2LF0 A;  4LIJ A;  3KDG A;  3U1K A;  2MJH A;  4JI1 H;  4NXN H;  2LRR A;  1ZTG A;  1ZZK A;  4FJU A;  1FKA H;  2M8W A;  4LF7 H;  3GR5 A;  2ZM6 H;  1S20 A;  2HH3 A;  4NZT M;  2ANN A;  2CTL A;  3T1Y H;  4LF5 H;  4B8C D;  2UXD H;  2ZQE A;  3AEV B;  1ZZI A;  1IBK H;  3V69 A;  4JI5 H;  4DR5 H;  2JEA I;  1PQX A;  4DUZ H;  4B3S H;  2JVZ A;  4JI6 H;  4K0K H;  1XNR H;  3VKE A;  4H8A A;  1FJG H;  4JI8 H;  2CWH A;  2K1H A;  2CTE A;  1I6U A;  2AXY A;  1HNW H;  2OPU A;  2HH2 A;  1EC6 A;  4LF6 H;  2PT7 G;  2DGR A;  5A2Q W;  4DV2 H;  2LTL A;  1N33 H;  4GKK H;  4X62 H;  3J80 W;  4WAN A;  5DT9 A;  2UUA H;  1XRH A;  2QND A;  2VKC A;  2E3U A;  4JI0 H;  4DR4 H;  2F4V H;  4AM3 A;  1IBL H;  4DR2 H;  1XMQ H;  2HHH H;  4DR7 H;  1WVN A;  2PY9 A;  1X0A A;  3GKU A;  4B3R H;  4DV3 H;  1X4N A;  4DV1 H;  4B8T A;  4LFB H;  2FMR A;  2LTM A;  3OSS D;  4QMF B;  1N36 H;  3SB1 A;  4JI7 H;  4LF9 H;  4OD6 A;  4DR6 H;  4KHP H;  3J7A K;  1V9N A;  1IBM H;  4JI2 H;  2BL5 A;  3NCV A;  1VIH A;  4DUY H;  4DV5 H;  4OX9 H;  2ANR A;  1J4W A;  4JI4 H;  2UXB H;  2D9I A;  4NBQ A;  2VQE H;  2Z0S A;  1TUA A;  5FLX W;  2E5L H;  4WAL A;  4JYA H;  4OCH A;  4DV4 H;  4LFA H;  5LL6 b;  4X64 H;  3OTO H;  1XMO H;  3QD7 X;  4YY3 H;  5BR8 H;  4JVY A;  3FAU A;  1KHM A;  4DV0 H;  3EZJ A;  1ODH A;  1HNZ H;  1SEI A;  2O4C A;  2PQU A;  2JEB I;  4DR3 H;  1J5E H;  5K36 G;  2A1S A;  2CPQ A;  4JI3 H;  5LMU H;  4GKJ H;  1K1G A;  1I94 H;  5C0X G;  4PDB A;  1UG8 A;  5IWA H;  2JZX A;  2JA9 A;  5LMN H;  2CTK A;  2CTJ A;  2CTF A;  4X65 H;  1DTJ A;  4BA2 I;  1WTJ A;  2JE6 I; 
#chains in the Genus database with same CATH homology
 2CPM A;  3GKU A;  1MSZ A;  2A1S A;  1WHR A;  2LRR A;  1UG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...