1MSZA

Solution structure of the r3h domain from human smubp-2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
b'GVDHFRAMIVEFMASKKMQLEFPPSLNSHDRLRVHQIAEEHGLRHDSSGEGKRRFITVSKRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein SMUBP-2
molecule tags Dna binding protein
source organism Homo sapiens
publication title Solution structure of the R3H domain from human Smubp-2
pubmed doi rcsb
total genus 14
structure length 62
sequence length 62
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 1mszA00
2LRRA 1WHRA 1MSZA 2CPMA 2A1SA 3GKUA 1UG8A
chains in the Genus database with same CATH superfamily
2ANRA 4KHPH 1V9NA 4OCHA 2HH2A 2JEBI 2FFMA 1N36H 4LF6H 1WTJA 4LFAH 2X06A 2Z0SA 1PQXA 4H8AA 1ZZIA 2ZM6H 4JVHA 1FJGH 2OPUA 4OX9H 4B8CD 5A2QW 1VIHA 1X4MA 2VQFH 2LTMA 3OETA 4OD6A 3J80W 2VQEH 4LF7H 4JI7H 1WE8A 4AIMA 2MJHA 4JI8H 4LFBH 1X4NA 3KDGA 3JAMW 2K1HA 2P2RA 3GABA 2PY9A 4DR6H 1IBKH 1S03G 4DV1H 2VKCA 2JEAI 3VKEA 2JE6I 4LF5H 2CPQA 2PT7G 5LMNH 1K1GA 1SEIA 1UG8A 2JZXA 3OTOH 2UUCH 5C0XG 2UU9H 4DR4H 4E9JA 4GKJH 4PDBA 4JI2H 2BL5A 2UXDH 2QNDA 2A1SA 2CTFA 4DR5H 1TUAA 4GKKH 2UUAH 4LF4H 4LF8H 2DGRA 4DV3H 2CTMA 1Z2IA 3J81W 1V8CA 2Y3MA 4DR7H 1XNRH 3SB1A 4DV2H 4WANA 1EC6A 3OSSD 1ZZJA 4X64H 4DV4H 1HNZH 4BA2I 4K0KH 2M8WA 4NZRM 3NCVA 3QD7X 5K36G 3T1HH 3T1YH 2CWFA 1J4WA 2CTKA 1N34H 1VIGA 4FJSA 4BA1I 4NZTM 5BR8H 2JVZA 4JV5H 1XNQH 3I0PA 2ANNA 1AN7A 1VBIA 4OO1G 1N32H 4B3SH 1X0AA 1XRHA 2FPHX 1I6UA 4JI4H 5FLXW 4LFCH 4B3RH 2G8YA 4DUYH 5DT9A 2NN6G 1IBLH 2PQUA 4LF9H 1NXUA 2JA9A 3GR5A 4YY3H 4YHHH 4DV5H 2CTLA 1J5EH 4X65H 1HR0H 1ZTGA 1J5KA 4JI5H 4DV6H 4JI0H 4JI1H 2LTLA 4X62H 5LL6b 4B3TH 2HH3A 4DUZH 1KHMA 2UXCH 4DV7H 5IT9W 3AEVB 5JEAG 2M6QA 2CWHA 4AQYH 2ZQEA 2OPVA 4G08A 2CTEA 4EC5A 3GKUA 1HNWH 2YQRA 1FKAH 1F0XA 1XMOH 1WHRA 2E5LH 3UOEA 2UXBH 1MSZA 3U1KA 4DR1H 4IFDG 2F4VH 2LF0A 3RF2A 4NXNH 4DR2H 4B3MH 4LIJA 2BA0A 4JYAH 2D9IA 1N33H 3EZJA 4NBQA 1ODHA 3V69A 1DTJA 4DV0H 5LMUH 4WALA 1X9ZA 4AM3A 2O4CA 2FMRA 1ZZKA 1XMQH 2CPMA 3J7AK 4FJUA 2E3UA 1I94H 5IWAH 2AXYA 3L7ZC 3KDKA 4B8TA 4DR3H 4QMFB 2LRRA 1DT4A 1WVNA 4X66H 4JI3H 4JI6H 3FAUA 4NXMH 1IBMH 2UUBH 2CTJA 2HHHH 1S20A 4JVYA 1HNXH
chains in the Genus database with same CATH topology
2LRRA 1WHRA 1MSZA 2CPMA 2A1SA 3GKUA 1UG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRR A;  1WHR A;  1MSZ A;  2CPM A;  2A1S A;  3GKU A;  1UG8 A; 
#chains in the Genus database with same CATH topology
 2ANR A;  4KHP H;  1V9N A;  4OCH A;  2HH2 A;  2JEB I;  2FFM A;  1N36 H;  4LF6 H;  1WTJ A;  4LFA H;  2X06 A;  2Z0S A;  1PQX A;  4H8A A;  1ZZI A;  2ZM6 H;  4JVH A;  1FJG H;  2OPU A;  4OX9 H;  4B8C D;  5A2Q W;  1VIH A;  1X4M A;  2VQF H;  2LTM A;  3OET A;  4OD6 A;  3J80 W;  2VQE H;  4LF7 H;  4JI7 H;  1WE8 A;  4AIM A;  2MJH A;  4JI8 H;  4LFB H;  1X4N A;  3KDG A;  3JAM W;  2K1H A;  2P2R A;  3GAB A;  2PY9 A;  4DR6 H;  1IBK H;  1S03 G;  4DV1 H;  2VKC A;  2JEA I;  3VKE A;  2JE6 I;  4LF5 H;  2CPQ A;  2PT7 G;  5LMN H;  1K1G A;  1SEI A;  1UG8 A;  2JZX A;  3OTO H;  2UUC H;  5C0X G;  2UU9 H;  4DR4 H;  4E9J A;  4GKJ H;  4PDB A;  4JI2 H;  2BL5 A;  2UXD H;  2QND A;  2A1S A;  2CTF A;  4DR5 H;  1TUA A;  4GKK H;  2UUA H;  4LF4 H;  4LF8 H;  2DGR A;  4DV3 H;  2CTM A;  1Z2I A;  3J81 W;  1V8C A;  2Y3M A;  4DR7 H;  1XNR H;  3SB1 A;  4DV2 H;  4WAN A;  1EC6 A;  3OSS D;  1ZZJ A;  4X64 H;  4DV4 H;  1HNZ H;  4BA2 I;  4K0K H;  2M8W A;  4NZR M;  3NCV A;  3QD7 X;  5K36 G;  3T1H H;  3T1Y H;  2CWF A;  1J4W A;  2CTK A;  1N34 H;  1VIG A;  4FJS A;  4BA1 I;  4NZT M;  5BR8 H;  2JVZ A;  4JV5 H;  1XNQ H;  3I0P A;  2ANN A;  1AN7 A;  1VBI A;  4OO1 G;  1N32 H;  4B3S H;  1X0A A;  1XRH A;  2FPH X;  1I6U A;  4JI4 H;  5FLX W;  4LFC H;  4B3R H;  2G8Y A;  4DUY H;  5DT9 A;  2NN6 G;  1IBL H;  2PQU A;  4LF9 H;  1NXU A;  2JA9 A;  3GR5 A;  4YY3 H;  4YHH H;  4DV5 H;  2CTL A;  1J5E H;  4X65 H;  1HR0 H;  1ZTG A;  1J5K A;  4JI5 H;  4DV6 H;  4JI0 H;  4JI1 H;  2LTL A;  4X62 H;  5LL6 b;  4B3T H;  2HH3 A;  4DUZ H;  1KHM A;  2UXC H;  4DV7 H;  5IT9 W;  3AEV B;  5JEA G;  2M6Q A;  2CWH A;  4AQY H;  2ZQE A;  2OPV A;  4G08 A;  2CTE A;  4EC5 A;  3GKU A;  1HNW H;  2YQR A;  1FKA H;  1F0X A;  1XMO H;  1WHR A;  2E5L H;  3UOE A;  2UXB H;  1MSZ A;  3U1K A;  4DR1 H;  4IFD G;  2F4V H;  2LF0 A;  3RF2 A;  4NXN H;  4DR2 H;  4B3M H;  4LIJ A;  2BA0 A;  4JYA H;  2D9I A;  1N33 H;  3EZJ A;  4NBQ A;  1ODH A;  3V69 A;  1DTJ A;  4DV0 H;  5LMU H;  4WAL A;  1X9Z A;  4AM3 A;  2O4C A;  2FMR A;  1ZZK A;  1XMQ H;  2CPM A;  3J7A K;  4FJU A;  2E3U A;  1I94 H;  5IWA H;  2AXY A;  3L7Z C;  3KDK A;  4B8T A;  4DR3 H;  4QMF B;  2LRR A;  1DT4 A;  1WVN A;  4X66 H;  4JI3 H;  4JI6 H;  3FAU A;  4NXM H;  1IBM H;  2UUB H;  2CTJ A;  2HHH H;  1S20 A;  4JVY A;  1HNX H; 
#chains in the Genus database with same CATH homology
 2LRR A;  1WHR A;  1MSZ A;  2CPM A;  2A1S A;  3GKU A;  1UG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...