1NXUA

Crystal structure of e. coli hypothetical oxidoreductase yiak northeast structural genomics consortium target er82.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
332
structure length
332
Chain Sequence
b'MKVTFEQLKAAFNRVLISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQQLENGDIIPDAQPKRITSLGAIEQWDAQRSIGNLTAKKMMDRAIELAADHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICWTNSIAVMPPWGAKECRIGTNPLIVAIPSTPITMVDMSMSMFSYGMLEVNRLAGRQLPVDGGFDDEGNLTKEPGVIEKNRRILPMGYWKGSGMSIVLDMIATLLSDGASVAEVTQDNSDEYGISQIFIAIEVDKLIDGPTRDAKLQRIMDYVTSAERADENQAIRLPGHEFTTLLAENRRNGITVDDSVWAKIQAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical oxidoreductase yiaK
molecule tags Structural genomics, oxidoreductase
source organism Escherichia coli
publication title A Novel NAD-binding Protein Revealed by the Crystal Structure of 2,3-Diketo-L-gulonate Reductase (YiaK).
pubmed doi rcsb
total genus 96
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.1.1.130: 3-dehydro-L-gulonate 2-dehydrogenase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 1nxuA01
3.30.60.50 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Hypothetical oxidoreductase yiak; domain 3 1nxuA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 1nxuA02
1X0AA 3UOEA 2CWFA 4FJSA 2X06A 1V9NA 2G8YA 1NXUA 1XRHA 1VBIA 2CWHA 1WTJA 1S20A 3I0PA 4FJUA 1Z2IA 4H8AA
chains in the Genus database with same CATH superfamily
3R5BA 4JI4H 2YQRA 4HGUA 1MJBA 2E5RA 1WTJA 3QTLD 3VKEA 1AN1I 5K36G 5FUVA 4JI3H 3QAHA 4OD6A 5LMUH 4NXMH 3J7AK 4GI3C 3QWPA 4AMLA 1VIGA 4JI0H 3TO7A 2SGPI 1J4WA 3UGDA 1S03G 4DR3H 3R5AA 2J87A 4FJUA 1Z2IA 2P6AC 1PQXA 1WVNA 2N52A 4E1PA 2A20A 1X74A 1SGPI 2WGCA 5E3RA 4JI6H 1XRHA 1M8CA 1IY5A 4DUYH 2CPMA 3NCVA 1J5EH 4LF7H 2JZXA 1K1GA 1J5KA 7WGAA 3GABA 1TURA 1Y8FA 1HEVA 3U1KA 3VDPA 1IW4A 4B3MH 1I6UA 1HNXH 1TBOA 2X06A 2D9IA 2N71A 4NXNH 5DT9A 5FUXA 2NU0I 1BUSA 4LF6H 2LRRA 2CTLA 4JI1H 3GOXA 1EC6A 1Z7KB 2JEAI 2LTMA 1ZZIA 2ANNA 1TUSA 3FSXA 2NU2I 1FAQA 4E1RA 1VIHA 1X4SA 2W0TA 4X64H 2HHHH 2NU1I 5IWAH 2NU4I 2E5LH 1HJAI 2QQ0A 1PTQA 2N17A 5FUWA 2KMRA 5IT9W 4LF8H 1NUBA 2JA9A 2ERWA 3HH2C 2M8WA 1DTJA 4BA2I 4JI2H 2CWFA 2JA1A 2RIJA 3FSYA 1KMAA 4JI5H 2UVOA 4X65H 2V1CA 2JEBI 4JVYA 2Y3MA 4A24A 2P2RA 1LR9A 2JZMA 5CCLA 1W4RA 2JW6A 4DR5H 2FFMA 4YHHH 2VQFH 5JEAG 2QPOA 3E2IA 1FARA 1V1HA 4YY3H 4DV1H 1MSZA 1V8CA 1OMTA 1RFHA 4WALA 2V1CC 1KBEA 4JV5H 1P9GA 3GKUA 2ENNA 1WKXA 2X3TA 4UXIA 2BL5A 1R0RI 1SEIA 2UUBH 2ORWA 2UUCH 5LMNH 2PQ8A 1OMUA 1XNRH 1V9NA 2B0UC 4LF4H 2YQPA 2XRCA 1Q9BA 2QQCA 2UU9H 2F3CI 3BJIA 1N34H 2WVJA 5E3QA 1VBIA 4NZRM 4OVOA 4JCVE 4L9MA 4AQYH 2OVOA 4QMFB 1ULKA 4IFDG 3UEYA 2L7XA 5EX0A 3EZJA 2K1HA 4DV5H 1XMOH 1XA6A 2CPQA 4DV4H 3KY9A 3UGLA 3OXLA 1ULNA 3E59A 4WP4A 2BUSA 1X0AA 4DV0H 2FMRA 1X4MA 3GR5A 1CT2I 2KMQA 2N1AB 2JVZA 1WGTA 5J8CA 1Y1CA 3UGIA 2UZ3A 1FY7A 2VKCA 2QNDA 3OXFA 4LF9H 4X66H 1LR7A 2VRWB 1FYBA 2JXDA 2PQUA 2AXYA 2K9HA 2WCYA 2LF0A 5DAEA 4NZTM 3OSSD 2SGFI 2FPHX 4DR2H 2SGQI 3R5DA 4GKJH 3OXGA 3RF2A 1UVFA 4DR4H 4DR7H 3I0PA 4OCHA 4JI7H 1ZZKA 1KBFA 1CGII 1PCEA 1K7TA 1SGNI 2X52A 1UVGA 1SGDI 2G8YA 2A1SA 2QQEA 2ARPF 4JYAH 4WANA 3UFFA 2MJHA 2E3UA 2B8TA 2OPUA 3FC3A 4LIJA 2LB7A 5A2QW 1TOTA 4LF5H 3TOAA 5FUYA 1N32H 2PT7G 3MEKA 1HNWH 2GVIA 1M8BA 3OETA 2QQDA 4B3TH 1PPFI 5E3PA 2FNFX 1K7UA 1UHAA 2L8EA 4DNCA 4K0KH 4SGBI 1DT4A 3VE5A 1AN7A 3TOBA 1OYVI 1CT4I 2ZM6H 1R79A 3PDNA 4UXJA 1TBQR 1TBNA 3OVOA 2ELIA 2JE6I 1YU6C 1PTRA 1OVOA 5CCMA 4FJSA 4LFCH 1UG8A 3SGBI 2CTJA 2E73A 2GKRI 2SGDI 4B3RH 2CTMA 9WGAA 5HQ8A 2CTEA 4LFBH 2UXCH 1PJUA 1DS3I 3JAMW 2CWHA 1P9ZA 1ULMA 1WHRA 3TO9A 4B8CD 4E9JA 1DS2I 4FKDA 2KCXA 2LTLA 5EX3A 1SGEI 4JVHA 1U5KA 2NN6G 3J80W 4PDBA 5C0XG 3J81W 1CGJI 5HI7A 1LR8A 2RC4A 3VDUA 1CHOI 2GKTI 1YTPA 4B6DA 3UOEA 3V69A 2OU2A 2HH2A 5J8FA 1BMOA 1ODHA 1W3SA 2M6QA 2DGRA 5BR8H 1WE8A 2PY9A 1F0XA 2UXBH 2OD1A 1S20A 2LUYA 2DB6A 4H8AA 1SGYI 4DR1H 3T1HH 1HPTA 1FKAH 4B8TA 1X9ZA 4DV3H 1K7VA 1I94H 2VQEH 2F4VH 3AEVB 4MPIA 2DIPA 1MJ9A 4NBQA 1HR0H 3D00A 1IBLH 1CT0I 1HDLA 3TJQA 4AM3A 4JI8H 2YUUA 1KHMA 2OPVA 1TUAA 2JYYA 2ENZA 3KDKA 4OO1G 2UUAH 3KDGA 3SB1A 3TO6A 1IBKH 4DR6H 4KHPH 1XBTA 1NXUA 3SGQI 4DV6H 2CTKA 4B3SH 3B4VC 1UUCA 2HH3A 3SEKC 1ZTGA 2CJSC 2DKVA 3R5CA 2ZQEA 1N36H 3RU0A 2ROWA 4GKKH 1TBRR 3OL0A 2ANRA 1MT1A 3L7ZC 4UXHA 1CE3A 2CWGA 3QD7X 1XNQH 1ZZJA 4X62H 2BA0A 4LFAH 1TGSI 1FJGH 1WGCA 2GKVA 2ODDA 5JHWC 4DV7H 2Z0SA 5FLXW 2KMPA 2NU3I 1IY6A 4OX9H 1TIHA 1HNZH 2UXDH 1X4NA 2O4CA 4DUZH 1H0ZA 1SGQI 2OZUA 4AIMA 3T1YH 1SGRI 2LEOA 2ORVA 1XMQH 1Y1BA 1VDDA 1CSOI 3FAUA 2SGEI 1N33H 2CTFA 3UEJA 4BA1I 3OTOH 2GIVA 2M5XA 2V53A 1N13A 1XX6A 4EC5A 2Y0MA 5LL6b 1V1IA 1IBMH 2KMOA 2J9RA 4G08A 1MJAA 4DV2H 3CXLA
chains in the Genus database with same CATH topology
1X0AA 3UOEA 2CWFA 4FJSA 2X06A 1V9NA 2G8YA 1NXUA 1XRHA 1VBIA 2CWHA 1WTJA 1S20A 3I0PA 4FJUA 1Z2IA 4H8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0A A;  3UOE A;  2CWF A;  4FJS A;  2X06 A;  1V9N A;  2G8Y A;  1NXU A;  1XRH A;  1VBI A;  2CWH A;  1WTJ A;  1S20 A;  3I0P A;  4FJU A;  1Z2I A;  4H8A A; 
#chains in the Genus database with same CATH topology
 3R5B A;  4JI4 H;  2YQR A;  4HGU A;  1MJB A;  2E5R A;  1WTJ A;  3QTL D;  3VKE A;  1AN1 I;  5K36 G;  5FUV A;  4JI3 H;  3QAH A;  4OD6 A;  5LMU H;  4NXM H;  3J7A K;  4GI3 C;  3QWP A;  4AML A;  1VIG A;  4JI0 H;  3TO7 A;  2SGP I;  1J4W A;  3UGD A;  1S03 G;  4DR3 H;  3R5A A;  2J87 A;  4FJU A;  1Z2I A;  2P6A C;  1PQX A;  1WVN A;  2N52 A;  4E1P A;  2A20 A;  1X74 A;  1SGP I;  2WGC A;  5E3R A;  4JI6 H;  1XRH A;  1M8C A;  1IY5 A;  4DUY H;  2CPM A;  3NCV A;  1J5E H;  4LF7 H;  2JZX A;  1K1G A;  1J5K A;  7WGA A;  3GAB A;  1TUR A;  1Y8F A;  1HEV A;  3U1K A;  3VDP A;  1IW4 A;  4B3M H;  1I6U A;  1HNX H;  1TBO A;  2X06 A;  2D9I A;  2N71 A;  4NXN H;  5DT9 A;  5FUX A;  2NU0 I;  1BUS A;  4LF6 H;  2LRR A;  2CTL A;  4JI1 H;  3GOX A;  1EC6 A;  1Z7K B;  2JEA I;  2LTM A;  1ZZI A;  2ANN A;  1TUS A;  3FSX A;  2NU2 I;  1FAQ A;  4E1R A;  1VIH A;  1X4S A;  2W0T A;  4X64 H;  2HHH H;  2NU1 I;  5IWA H;  2NU4 I;  2E5L H;  1HJA I;  2QQ0 A;  1PTQ A;  2N17 A;  5FUW A;  2KMR A;  5IT9 W;  4LF8 H;  1NUB A;  2JA9 A;  2ERW A;  3HH2 C;  2M8W A;  1DTJ A;  4BA2 I;  4JI2 H;  2CWF A;  2JA1 A;  2RIJ A;  3FSY A;  1KMA A;  4JI5 H;  2UVO A;  4X65 H;  2V1C A;  2JEB I;  4JVY A;  2Y3M A;  4A24 A;  2P2R A;  1LR9 A;  2JZM A;  5CCL A;  1W4R A;  2JW6 A;  4DR5 H;  2FFM A;  4YHH H;  2VQF H;  5JEA G;  2QPO A;  3E2I A;  1FAR A;  1V1H A;  4YY3 H;  4DV1 H;  1MSZ A;  1V8C A;  1OMT A;  1RFH A;  4WAL A;  2V1C C;  1KBE A;  4JV5 H;  1P9G A;  3GKU A;  2ENN A;  1WKX A;  2X3T A;  4UXI A;  2BL5 A;  1R0R I;  1SEI A;  2UUB H;  2ORW A;  2UUC H;  5LMN H;  2PQ8 A;  1OMU A;  1XNR H;  1V9N A;  2B0U C;  4LF4 H;  2YQP A;  2XRC A;  1Q9B A;  2QQC A;  2UU9 H;  2F3C I;  3BJI A;  1N34 H;  2WVJ A;  5E3Q A;  1VBI A;  4NZR M;  4OVO A;  4JCV E;  4L9M A;  4AQY H;  2OVO A;  4QMF B;  1ULK A;  4IFD G;  3UEY A;  2L7X A;  5EX0 A;  3EZJ A;  2K1H A;  4DV5 H;  1XMO H;  1XA6 A;  2CPQ A;  4DV4 H;  3KY9 A;  3UGL A;  3OXL A;  1ULN A;  3E59 A;  4WP4 A;  2BUS A;  1X0A A;  4DV0 H;  2FMR A;  1X4M A;  3GR5 A;  1CT2 I;  2KMQ A;  2N1A B;  2JVZ A;  1WGT A;  5J8C A;  1Y1C A;  3UGI A;  2UZ3 A;  1FY7 A;  2VKC A;  2QND A;  3OXF A;  4LF9 H;  4X66 H;  1LR7 A;  2VRW B;  1FYB A;  2JXD A;  2PQU A;  2AXY A;  2K9H A;  2WCY A;  2LF0 A;  5DAE A;  4NZT M;  3OSS D;  2SGF I;  2FPH X;  4DR2 H;  2SGQ I;  3R5D A;  4GKJ H;  3OXG A;  3RF2 A;  1UVF A;  4DR4 H;  4DR7 H;  3I0P A;  4OCH A;  4JI7 H;  1ZZK A;  1KBF A;  1CGI I;  1PCE A;  1K7T A;  1SGN I;  2X52 A;  1UVG A;  1SGD I;  2G8Y A;  2A1S A;  2QQE A;  2ARP F;  4JYA H;  4WAN A;  3UFF A;  2MJH A;  2E3U A;  2B8T A;  2OPU A;  3FC3 A;  4LIJ A;  2LB7 A;  5A2Q W;  1TOT A;  4LF5 H;  3TOA A;  5FUY A;  1N32 H;  2PT7 G;  3MEK A;  1HNW H;  2GVI A;  1M8B A;  3OET A;  2QQD A;  4B3T H;  1PPF I;  5E3P A;  2FNF X;  1K7U A;  1UHA A;  2L8E A;  4DNC A;  4K0K H;  4SGB I;  1DT4 A;  3VE5 A;  1AN7 A;  3TOB A;  1OYV I;  1CT4 I;  2ZM6 H;  1R79 A;  3PDN A;  4UXJ A;  1TBQ R;  1TBN A;  3OVO A;  2ELI A;  2JE6 I;  1YU6 C;  1PTR A;  1OVO A;  5CCM A;  4FJS A;  4LFC H;  1UG8 A;  3SGB I;  2CTJ A;  2E73 A;  2GKR I;  2SGD I;  4B3R H;  2CTM A;  9WGA A;  5HQ8 A;  2CTE A;  4LFB H;  2UXC H;  1PJU A;  1DS3 I;  3JAM W;  2CWH A;  1P9Z A;  1ULM A;  1WHR A;  3TO9 A;  4B8C D;  4E9J A;  1DS2 I;  4FKD A;  2KCX A;  2LTL A;  5EX3 A;  1SGE I;  4JVH A;  1U5K A;  2NN6 G;  3J80 W;  4PDB A;  5C0X G;  3J81 W;  1CGJ I;  5HI7 A;  1LR8 A;  2RC4 A;  3VDU A;  1CHO I;  2GKT I;  1YTP A;  4B6D A;  3UOE A;  3V69 A;  2OU2 A;  2HH2 A;  5J8F A;  1BMO A;  1ODH A;  1W3S A;  2M6Q A;  2DGR A;  5BR8 H;  1WE8 A;  2PY9 A;  1F0X A;  2UXB H;  2OD1 A;  1S20 A;  2LUY A;  2DB6 A;  4H8A A;  1SGY I;  4DR1 H;  3T1H H;  1HPT A;  1FKA H;  4B8T A;  1X9Z A;  4DV3 H;  1K7V A;  1I94 H;  2VQE H;  2F4V H;  3AEV B;  4MPI A;  2DIP A;  1MJ9 A;  4NBQ A;  1HR0 H;  3D00 A;  1IBL H;  1CT0 I;  1HDL A;  3TJQ A;  4AM3 A;  4JI8 H;  2YUU A;  1KHM A;  2OPV A;  1TUA A;  2JYY A;  2ENZ A;  3KDK A;  4OO1 G;  2UUA H;  3KDG A;  3SB1 A;  3TO6 A;  1IBK H;  4DR6 H;  4KHP H;  1XBT A;  1NXU A;  3SGQ I;  4DV6 H;  2CTK A;  4B3S H;  3B4V C;  1UUC A;  2HH3 A;  3SEK C;  1ZTG A;  2CJS C;  2DKV A;  3R5C A;  2ZQE A;  1N36 H;  3RU0 A;  2ROW A;  4GKK H;  1TBR R;  3OL0 A;  2ANR A;  1MT1 A;  3L7Z C;  4UXH A;  1CE3 A;  2CWG A;  3QD7 X;  1XNQ H;  1ZZJ A;  4X62 H;  2BA0 A;  4LFA H;  1TGS I;  1FJG H;  1WGC A;  2GKV A;  2ODD A;  5JHW C;  4DV7 H;  2Z0S A;  5FLX W;  2KMP A;  2NU3 I;  1IY6 A;  4OX9 H;  1TIH A;  1HNZ H;  2UXD H;  1X4N A;  2O4C A;  4DUZ H;  1H0Z A;  1SGQ I;  2OZU A;  4AIM A;  3T1Y H;  1SGR I;  2LEO A;  2ORV A;  1XMQ H;  1Y1B A;  1VDD A;  1CSO I;  3FAU A;  2SGE I;  1N33 H;  2CTF A;  3UEJ A;  4BA1 I;  3OTO H;  2GIV A;  2M5X A;  2V53 A;  1N13 A;  1XX6 A;  4EC5 A;  2Y0M A;  5LL6 b;  1V1I A;  1IBM H;  2KMO A;  2J9R A;  4G08 A;  1MJA A;  4DV2 H;  3CXL A; 
#chains in the Genus database with same CATH homology
 1X0A A;  3UOE A;  2CWF A;  4FJS A;  2X06 A;  1V9N A;  2G8Y A;  1NXU A;  1XRH A;  1VBI A;  2CWH A;  1WTJ A;  1S20 A;  3I0P A;  4FJU A;  1Z2I A;  4H8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...