1NXUA

Crystal structure of e. coli hypothetical oxidoreductase yiak northeast structural genomics consortium target er82.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
332
structure length
332
Chain Sequence
MKVTFEQLKAAFNRVLISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQQLENGDIIPDAQPKRITSLGAIEQWDAQRSIGNLTAKKMMDRAIELAADHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICWTNSIAVMPPWGAKECRIGTNPLIVAIPSTPITMVDMSMSMFSYGMLEVNRLAGRQLPVDGGFDDEGNLTKEPGVIEKNRRILPMGYWKGSGMSIVLDMIATLLSDGASVAEVTQDNSDEYGISQIFIAIEVDKLIDGPTRDAKLQRIMDYVTSAERADENQAIRLPGHEFTTLLAENRRNGITVDDSVWAKIQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, oxidoreductase
molecule keywords Hypothetical oxidoreductase yiaK
publication title A Novel NAD-binding Protein Revealed by the Crystal Structure of 2,3-Diketo-L-gulonate Reductase (YiaK).
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.1.1.130: 3-dehydro-L-gulonate 2-dehydrogenase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 1nxuA01
3.30.60.50 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Hypothetical oxidoreductase yiak; domain 3 1nxuA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 1nxuA02
4FJUA 1X0AA 2G8YA 1VBIA 2CWHA 1NXUA 2X06A 3UOEA 1S20A 2CWFA 4FJSA 1WTJA 1V9NA 1XRHA 3I0PA 1Z2IA 4H8AA
chains in the Genus database with same CATH superfamily
2VQFH 4GKKH 1DS2I 1K7UA 4FKDA 1ULNA 4KHPH 2GVIA 3E59A 3KY9A 2LEOA 2QQEA 3FC3A 2GKTI 4YHHH 3SGQI 1MJBA 2MJHA 2P2RA 1AN7A 4JI5H 5CCLA 2CTEA 1VDDA 1J5KA 1X4MA 1HPTA 1IBKH 3VKEA 1V1IA 3BJIA 1TURA 1AN1I 1RFHA 4FJUA 1LR7A 1XA6A 2WCYA 2L7XA 4JI4H 4JV5H 5E3PA 3SGBI 2N71A 4JI3H 4NZTM 1KMAA 5JHWC 2BA0A 2N17A 1FYBA 2F4VH 4B3SH 2UU9H 2UXCH 1CT2I 1BMOA 3TO7A 2GIVA 2AXYA 1S03G 2ERWA 1M8BA 5EX3A 4JI6H 2VRWB 1N33H 1XMOH 2JZMA 1J4WA 2PY9A 4DUZH 1CGII 1WGTA 1X4NA 1HR0H 4NZRM 1PTQA 1DTJA 2JXDA 3TJQA 4PDBA 1DS3I 3KDKA 1R79A 2KMQA 4WALA 5E3QA 2JA1A 3QAHA 1PTRA 1X4SA 2ZQEA 2UUBH 4B8CD 7WGAA 2CTKA 2OPUA 1W4RA 4UXIA 1WHRA 4DV6H 3L7ZC 4AM3A 1HJAI 1S20A 4DR3H 1OVOA 1W3SA 1HEVA 2CTLA 1WVNA 2N1AB 2SGPI 1LR9A 2RC4A 1TBOA 4JI1H 2ELIA 4G08A 2QPOA 3UOEA 2DB6A 5IWAH 4X64H 1V8CA 4JVYA 3R5AA 3TO9A 1FJGH 1DT4A 4LFBH 4LF9H 4JI8H 2SGFI 2FFMA 3EZJA 4DUYH 5JEAG 4DV2H 5EX0A 4WP4A 4DR1H 2LB7A 5K36G 2ODDA 2GKRI 4OD6A 1Q9BA 4HGUA 4DR6H 2DIPA 2V53A 1SGEI 2B8TA 3TO6A 1UHAA 1CSOI 2YQRA 1PPFI 4LIJA 1PCEA 2CTMA 4DR2H 1FKAH 1SEIA 2UXDH 4E1PA 3J81W 3R5BA 1H0ZA 2QQ0A 3OVOA 2CPMA 4B6DA 3OXFA 1LR8A 3GOXA 4JVHA 1XRHA 4BA1I 3T1YH 1CT0I 1Y8FA 4WANA 3VDUA 2Z0SA 4DV7H 2WGCA 5IT9W 4DNCA 1MSZA 5E3RA 2Y0MA 1BUSA 3E2IA 2KMOA 3FAUA 3RF2A 2LRRA 1U5KA 2NU3I 3VDPA 1CT4I 2V1CC 1YTPA 2PQUA 5DT9A 2SGEI 4YY3H 4LF4H 1SGQI 1SGPI 2D9IA 4B8TA 2ENNA 5FLXW 3SB1A 1IY6A 2GKVA 3UGLA 1J5EH 4JI2H 3FSXA 5FUXA 1X74A 1K7VA 4LF5H 3OXGA 3UEJA 4OVOA 1YU6C 2N52A 3RU0A 2WVJA 2JE6I 5CCMA 1R0RI 1TIHA 5DAEA 1FAQA 4DV5H 4B3TH 4X62H 3J7AK 4DR7H 2BUSA 2X52A 3UGIA 1CE3A 1K1GA 2VKCA 4BA2I 4X65H 3VE5A 1WGCA 2XRCA 1UG8A 4LFAH 2LTMA 1I94H 1HDLA 4DV1H 2CTJA 4GI3C 2CTFA 1VIGA 3OL0A 2KMRA 4FJSA 2LTLA 2OU2A 3KDGA 1MJ9A 1N13A 2UVOA 2A20A 3SEKC 3OTOH 2FPHX 2ORVA 4K0KH 2CPQA 1XNRH 2ROWA 2QQCA 4E1RA 3QTLD 1HNWH 4GKJH 2OPVA 3OXLA 3CXLA 5FUVA 1X9ZA 2M8WA 1UVGA 1ZZKA 5HQ8A 2JEAI 2ANNA 2K9HA 4OO1G 1TOTA 1N32H 2LUYA 3OETA 1CHOI 3B4VC 1IBLH 5LL6b 2E5LH 1CGJI 1OYVI 2E73A 4OX9H 2UUAH 1SGYI 4AIMA 1VIHA 2F3CI 2FMRA 4X66H 3TOBA 1PQXA 4NXMH 2OD1A 2ZM6H 2PQ8A 2CJSC 2L8EA 2YQPA 3U1KA 4B3MH 2KMPA 2NU1I 1N36H 1XBTA 1SGRI 1MT1A 3QWPA 1FY7A 2HH3A 2QNDA 4NBQA 1SGDI 1KHMA 3GR5A 1ULMA 2QQDA 1KBEA 1XNQH 2NU4I 1X0AA 2J87A 2O4CA 1M8CA 2YUUA 1Z2IA 4E9JA 4LF8H 1N34H 1WE8A 1WKXA 1XX6A 1IBMH 1NXUA 1K7TA 2UZ3A 2UXBH 2JW6A 1NUBA 4JI7H 4LFCH 2RIJA 1ZZIA 1MJAA 1IW4A 5BR8H 4NXNH 2M6QA 1TBNA 4JYAH 1P9ZA 3MEKA 3V69A 5FUWA 4B3RH 1HNXH 3I0PA 1OMTA 2JA9A 2KCXA 2DGRA 1TBQR 1VBIA 9WGAA 2CWFA 5J8FA 4H8AA 1TUSA 2PT7G 3UEYA 4OCHA 1FARA 3R5DA 2CWGA 2JZXA 5J8CA 3D00A 2ORWA 2ARPF 2J9RA 1Z7KB 2E3UA 1Y1BA 1EC6A 1F0XA 4DV3H 2JEBI 2JVZA 3J80W 2SGQI 3UFFA 1WTJA 1OMUA 3AEVB 2NU0I 4SGBI 2A1SA 2K1HA 1P9GA 2Y3MA 4UXJA 3T1HH 2X3TA 2V1CA 1UUCA 2G8YA 3GABA 2X06A 1TUAA 1TGSI 4UXHA 1ULKA 1V9NA 4LF6H 5A2QW 1ODHA 4DV4H 2HH2A 2ENZA 3OSSD 2M5XA 1TBRR 3TOAA 4EC5A 2CWHA 4QMFB 1KBFA 2BL5A 3GKUA 2FNFX 3QD7X 1I6UA 4L9MA 5LMUH 2OZUA 4AQYH 4LF7H 4MPIA 4IFDG 1PJUA 4DV0H 2NN6G 5C0XG 2B0UC 2NU2I 2OVOA 2W0TA 2UUCH 1SGNI 1ZTGA 3FSYA 3R5CA 5FUYA 4DR5H 2JYYA 2SGDI 2ANRA 1ZZJA 2HHHH 2VQEH 4AMLA 2DKVA 1XMQH 2P6AC 1IY5A 4JCVE 2LF0A 1HNZH 1V1HA 5LMNH 1Y1CA 2E5RA 3PDNA 3UGDA 3JAMW 4A24A 3HH2C 5HI7A 3NCVA 4JI0H 1UVFA 4DR4H
chains in the Genus database with same CATH topology
4FJUA 1X0AA 2G8YA 1VBIA 2CWHA 1NXUA 2X06A 3UOEA 1S20A 2CWFA 4FJSA 1WTJA 1V9NA 1XRHA 3I0PA 1Z2IA 4H8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJU A;  1X0A A;  2G8Y A;  1VBI A;  2CWH A;  1NXU A;  2X06 A;  3UOE A;  1S20 A;  2CWF A;  4FJS A;  1WTJ A;  1V9N A;  1XRH A;  3I0P A;  1Z2I A;  4H8A A; 
#chains in the Genus database with same CATH topology
 2VQF H;  4GKK H;  1DS2 I;  1K7U A;  4FKD A;  1ULN A;  4KHP H;  2GVI A;  3E59 A;  3KY9 A;  2LEO A;  2QQE A;  3FC3 A;  2GKT I;  4YHH H;  3SGQ I;  1MJB A;  2MJH A;  2P2R A;  1AN7 A;  4JI5 H;  5CCL A;  2CTE A;  1VDD A;  1J5K A;  1X4M A;  1HPT A;  1IBK H;  3VKE A;  1V1I A;  3BJI A;  1TUR A;  1AN1 I;  1RFH A;  4FJU A;  1LR7 A;  1XA6 A;  2WCY A;  2L7X A;  4JI4 H;  4JV5 H;  5E3P A;  3SGB I;  2N71 A;  4JI3 H;  4NZT M;  1KMA A;  5JHW C;  2BA0 A;  2N17 A;  1FYB A;  2F4V H;  4B3S H;  2UU9 H;  2UXC H;  1CT2 I;  1BMO A;  3TO7 A;  2GIV A;  2AXY A;  1S03 G;  2ERW A;  1M8B A;  5EX3 A;  4JI6 H;  2VRW B;  1N33 H;  1XMO H;  2JZM A;  1J4W A;  2PY9 A;  4DUZ H;  1CGI I;  1WGT A;  1X4N A;  1HR0 H;  4NZR M;  1PTQ A;  1DTJ A;  2JXD A;  3TJQ A;  4PDB A;  1DS3 I;  3KDK A;  1R79 A;  2KMQ A;  4WAL A;  5E3Q A;  2JA1 A;  3QAH A;  1PTR A;  1X4S A;  2ZQE A;  2UUB H;  4B8C D;  7WGA A;  2CTK A;  2OPU A;  1W4R A;  4UXI A;  1WHR A;  4DV6 H;  3L7Z C;  4AM3 A;  1HJA I;  1S20 A;  4DR3 H;  1OVO A;  1W3S A;  1HEV A;  2CTL A;  1WVN A;  2N1A B;  2SGP I;  1LR9 A;  2RC4 A;  1TBO A;  4JI1 H;  2ELI A;  4G08 A;  2QPO A;  3UOE A;  2DB6 A;  5IWA H;  4X64 H;  1V8C A;  4JVY A;  3R5A A;  3TO9 A;  1FJG H;  1DT4 A;  4LFB H;  4LF9 H;  4JI8 H;  2SGF I;  2FFM A;  3EZJ A;  4DUY H;  5JEA G;  4DV2 H;  5EX0 A;  4WP4 A;  4DR1 H;  2LB7 A;  5K36 G;  2ODD A;  2GKR I;  4OD6 A;  1Q9B A;  4HGU A;  4DR6 H;  2DIP A;  2V53 A;  1SGE I;  2B8T A;  3TO6 A;  1UHA A;  1CSO I;  2YQR A;  1PPF I;  4LIJ A;  1PCE A;  2CTM A;  4DR2 H;  1FKA H;  1SEI A;  2UXD H;  4E1P A;  3J81 W;  3R5B A;  1H0Z A;  2QQ0 A;  3OVO A;  2CPM A;  4B6D A;  3OXF A;  1LR8 A;  3GOX A;  4JVH A;  1XRH A;  4BA1 I;  3T1Y H;  1CT0 I;  1Y8F A;  4WAN A;  3VDU A;  2Z0S A;  4DV7 H;  2WGC A;  5IT9 W;  4DNC A;  1MSZ A;  5E3R A;  2Y0M A;  1BUS A;  3E2I A;  2KMO A;  3FAU A;  3RF2 A;  2LRR A;  1U5K A;  2NU3 I;  3VDP A;  1CT4 I;  2V1C C;  1YTP A;  2PQU A;  5DT9 A;  2SGE I;  4YY3 H;  4LF4 H;  1SGQ I;  1SGP I;  2D9I A;  4B8T A;  2ENN A;  5FLX W;  3SB1 A;  1IY6 A;  2GKV A;  3UGL A;  1J5E H;  4JI2 H;  3FSX A;  5FUX A;  1X74 A;  1K7V A;  4LF5 H;  3OXG A;  3UEJ A;  4OVO A;  1YU6 C;  2N52 A;  3RU0 A;  2WVJ A;  2JE6 I;  5CCM A;  1R0R I;  1TIH A;  5DAE A;  1FAQ A;  4DV5 H;  4B3T H;  4X62 H;  3J7A K;  4DR7 H;  2BUS A;  2X52 A;  3UGI A;  1CE3 A;  1K1G A;  2VKC A;  4BA2 I;  4X65 H;  3VE5 A;  1WGC A;  2XRC A;  1UG8 A;  4LFA H;  2LTM A;  1I94 H;  1HDL A;  4DV1 H;  2CTJ A;  4GI3 C;  2CTF A;  1VIG A;  3OL0 A;  2KMR A;  4FJS A;  2LTL A;  2OU2 A;  3KDG A;  1MJ9 A;  1N13 A;  2UVO A;  2A20 A;  3SEK C;  3OTO H;  2FPH X;  2ORV A;  4K0K H;  2CPQ A;  1XNR H;  2ROW A;  2QQC A;  4E1R A;  3QTL D;  1HNW H;  4GKJ H;  2OPV A;  3OXL A;  3CXL A;  5FUV A;  1X9Z A;  2M8W A;  1UVG A;  1ZZK A;  5HQ8 A;  2JEA I;  2ANN A;  2K9H A;  4OO1 G;  1TOT A;  1N32 H;  2LUY A;  3OET A;  1CHO I;  3B4V C;  1IBL H;  5LL6 b;  2E5L H;  1CGJ I;  1OYV I;  2E73 A;  4OX9 H;  2UUA H;  1SGY I;  4AIM A;  1VIH A;  2F3C I;  2FMR A;  4X66 H;  3TOB A;  1PQX A;  4NXM H;  2OD1 A;  2ZM6 H;  2PQ8 A;  2CJS C;  2L8E A;  2YQP A;  3U1K A;  4B3M H;  2KMP A;  2NU1 I;  1N36 H;  1XBT A;  1SGR I;  1MT1 A;  3QWP A;  1FY7 A;  2HH3 A;  2QND A;  4NBQ A;  1SGD I;  1KHM A;  3GR5 A;  1ULM A;  2QQD A;  1KBE A;  1XNQ H;  2NU4 I;  1X0A A;  2J87 A;  2O4C A;  1M8C A;  2YUU A;  1Z2I A;  4E9J A;  4LF8 H;  1N34 H;  1WE8 A;  1WKX A;  1XX6 A;  1IBM H;  1NXU A;  1K7T A;  2UZ3 A;  2UXB H;  2JW6 A;  1NUB A;  4JI7 H;  4LFC H;  2RIJ A;  1ZZI A;  1MJA A;  1IW4 A;  5BR8 H;  4NXN H;  2M6Q A;  1TBN A;  4JYA H;  1P9Z A;  3MEK A;  3V69 A;  5FUW A;  4B3R H;  1HNX H;  3I0P A;  1OMT A;  2JA9 A;  2KCX A;  2DGR A;  1TBQ R;  1VBI A;  9WGA A;  2CWF A;  5J8F A;  4H8A A;  1TUS A;  2PT7 G;  3UEY A;  4OCH A;  1FAR A;  3R5D A;  2CWG A;  2JZX A;  5J8C A;  3D00 A;  2ORW A;  2ARP F;  2J9R A;  1Z7K B;  2E3U A;  1Y1B A;  1EC6 A;  1F0X A;  4DV3 H;  2JEB I;  2JVZ A;  3J80 W;  2SGQ I;  3UFF A;  1WTJ A;  1OMU A;  3AEV B;  2NU0 I;  4SGB I;  2A1S A;  2K1H A;  1P9G A;  2Y3M A;  4UXJ A;  3T1H H;  2X3T A;  2V1C A;  1UUC A;  2G8Y A;  3GAB A;  2X06 A;  1TUA A;  1TGS I;  4UXH A;  1ULK A;  1V9N A;  4LF6 H;  5A2Q W;  1ODH A;  4DV4 H;  2HH2 A;  2ENZ A;  3OSS D;  2M5X A;  1TBR R;  3TOA A;  4EC5 A;  2CWH A;  4QMF B;  1KBF A;  2BL5 A;  3GKU A;  2FNF X;  3QD7 X;  1I6U A;  4L9M A;  5LMU H;  2OZU A;  4AQY H;  4LF7 H;  4MPI A;  4IFD G;  1PJU A;  4DV0 H;  2NN6 G;  5C0X G;  2B0U C;  2NU2 I;  2OVO A;  2W0T A;  2UUC H;  1SGN I;  1ZTG A;  3FSY A;  3R5C A;  5FUY A;  4DR5 H;  2JYY A;  2SGD I;  2ANR A;  1ZZJ A;  2HHH H;  2VQE H;  4AML A;  2DKV A;  1XMQ H;  2P6A C;  1IY5 A;  4JCV E;  2LF0 A;  1HNZ H;  1V1H A;  5LMN H;  1Y1C A;  2E5R A;  3PDN A;  3UGD A;  3JAM W;  4A24 A;  3HH2 C;  5HI7 A;  3NCV A;  4JI0 H;  1UVF A;  4DR4 H; 
#chains in the Genus database with same CATH homology
 4FJU A;  1X0A A;  2G8Y A;  1VBI A;  2CWH A;  1NXU A;  2X06 A;  3UOE A;  1S20 A;  2CWF A;  4FJS A;  1WTJ A;  1V9N A;  1XRH A;  3I0P A;  1Z2I A;  4H8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...