1NXUA

Crystal structure of e. coli hypothetical oxidoreductase yiak northeast structural genomics consortium target er82.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
332
structure length
332
Chain Sequence
b'MKVTFEQLKAAFNRVLISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQQLENGDIIPDAQPKRITSLGAIEQWDAQRSIGNLTAKKMMDRAIELAADHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICWTNSIAVMPPWGAKECRIGTNPLIVAIPSTPITMVDMSMSMFSYGMLEVNRLAGRQLPVDGGFDDEGNLTKEPGVIEKNRRILPMGYWKGSGMSIVLDMIATLLSDGASVAEVTQDNSDEYGISQIFIAIEVDKLIDGPTRDAKLQRIMDYVTSAERADENQAIRLPGHEFTTLLAENRRNGITVDDSVWAKIQAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical oxidoreductase yiaK
publication title A Novel NAD-binding Protein Revealed by the Crystal Structure of 2,3-Diketo-L-gulonate Reductase (YiaK).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, oxidoreductase
total genus 96
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.1.1.130: 3-dehydro-L-gulonate 2-dehydrogenase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 1nxuA01
3.30.60.50 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Hypothetical oxidoreductase yiak; domain 3 1nxuA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 1nxuA02
4H8AA 1VBIA 2X06A 3I0PA 1V9NA 1WTJA 1S20A 1X0AA 2G8YA 4FJSA 2CWFA 1Z2IA 3UOEA 2CWHA 1NXUA 4FJUA 1XRHA
chains in the Genus database with same CATH superfamily
1P9ZA 2JA9A 2LF0A 1CGII 2WCYA 2ENNA 2XRCA 1F0XA 2JYYA 2ARPF 1FYBA 1SGEI 1N34H 3B4VC 2YUUA 3D00A 1IY5A 2HH3A 4DR2H 2ANNA 3UFFA 1K7UA 2AXYA 2X3TA 1X4MA 2PQUA 4OD6A 1X74A 4X64H 5HQ8A 2LTMA 7WGAA 2Y0MA 1TBQR 1WGTA 5FUYA 1TUSA 3UGLA 5LMUH 1MJAA 1MJ9A 4FJSA 2QPOA 1ZTGA 2N52A 3E2IA 5E3RA 3UGIA 4NZTM 2LUYA 5HI7A 4DV5H 1XNQH 1KHMA 1CT4I 4B3SH 1KBEA 1W3SA 1SGDI 1UUCA 3L7ZC 2GIVA 3TO6A 4UXHA 2DIPA 5J8FA 3R5CA 2FNFX 1CT2I 2UUAH 1FKAH 1CT0I 1X4SA 4B8TA 2NU3I 5FUVA 2HH2A 4A24A 1MSZA 1SGPI 2LB7A 1N36H 1MJBA 1XMQH 2GKRI 3E59A 1BUSA 4B8CD 2L7XA 3R5DA 4G08A 3UEJA 1EC6A 3KDKA 2GKVA 2QQDA 3SGQI 4NXMH 4B3MH 2CWGA 1UVFA 1YU6C 2JVZA 4NZRM 2CJSC 1XMOH 4DR7H 2HHHH 4OO1G 3SGBI 4DNCA 1TIHA 4JI5H 2D9IA 3RU0A 2SGPI 1PTQA 2CTMA 3FSXA 4UXIA 4X66H 2B0UC 1PTRA 2FMRA 4JVHA 4LF7H 4DR5H 2F3CI 1Z2IA 4JI3H 4DV3H 1K1GA 1ULNA 2M5XA 2ERWA 1XX6A 2CWHA 1R79A 1J5EH 2RC4A 3PDNA 4SGBI 1UG8A 3TO9A 5EX0A 2O4CA 4JI6H 2CTFA 1KMAA 1AN7A 4LF8H 1W4RA 5LL6b 4DUZH 1I6UA 5JHWC 3FC3A 4B6DA 1N13A 4AM3A 2M8WA 4DR1H 1SGNI 3TOBA 2FPHX 4H8AA 3UGDA 2JEBI 1Z7KB 1ULKA 1TBRR 2RIJA 2G8YA 1XNRH 3J7AK 2OPVA 1LR9A 2CTLA 4B3TH 2JEAI 2V1CA 2VQFH 3SB1A 3OL0A 1WVNA 4AQYH 4JV5H 4HGUA 4GKKH 2UZ3A 1SEIA 4DR6H 5IT9W 1M8BA 1UHAA 4DV0H 1OYVI 2JZXA 2KCXA 5CCLA 3V69A 4DV1H 4NXNH 2BUSA 5J8CA 1XBTA 2ROWA 4L9MA 2VKCA 3GKUA 4AIMA 4DR4H 1CHOI 2N71A 2KMPA 2NN6G 1NXUA 2QQ0A 2ODDA 1VBIA 2OVOA 1X0AA 2LEOA 3VE5A 2OZUA 1SGRI 1CE3A 4GI3C 1IBMH 2UU9H 1NUBA 2CTJA 3CXLA 4JVYA 2CPMA 4MPIA 3GOXA 1V1HA 1U5KA 1S20A 4JI2H 4DV4H 3KY9A 1AN1I 1N32H 4JCVE 3OETA 1HNXH 2CTEA 2SGQI 1ULMA 2V53A 1WTJA 1VIGA 5EX3A 1TGSI 3QTLD 1LR8A 1H0ZA 4JI0H 4DR3H 3QD7X 5IWAH 2QQCA 2UVOA 1WGCA 2J9RA 1CGJI 2CPQA 2E73A 3QAHA 1HEVA 2WVJA 4DUYH 3OXLA 2W0TA 4YHHH 1FAQA 2P6AC 5LMNH 1XA6A 2N1AB 1V8CA 1UVGA 1ZZJA 2LTLA 2Y3MA 3OXGA 1CSOI 1VIHA 1Y1CA 1HPTA 2E3UA 2J87A 2YQPA 4K0KH 4PDBA 3OTOH 2ANRA 1TOTA 1OMTA 2M6QA 1OMUA 2KMQA 4NBQA 2UUCH 1Y8FA 1TBOA 2E5RA 1RFHA 1WE8A 9WGAA 1PJUA 2ORWA 3TJQA 1LR7A 2NU2I 1SGYI 4JI7H 4EC5A 1R0RI 1HNWH 4LFAH 1IY6A 2CWFA 2DGRA 1Q9BA 5E3QA 1MT1A 1BMOA 5A2QW 5C0XG 1IW4A 2SGDI 4E1RA 2UXDH 3BJIA 2PT7G 2KMRA 3FSYA 5DAEA 2ZQEA 3KDGA 3MEKA 2OPUA 2DKVA 4WALA 2A1SA 1TURA 3NCVA 1J4WA 3J81W 2B8TA 1K7VA 2K1HA 4BA1I 1WKXA 1VDDA 2JZMA 4FJUA 1TBNA 3OSSD 5FUWA 1SGQI 3OVOA 3SEKC 2JE6I 2LRRA 2NU0I 5FUXA 2P2RA 2NU4I 4LF5H 1HR0H 5DT9A 1FARA 4QMFB 4IFDG 4WANA 1V9NA 1HNZH 1X9ZA 2MJHA 2QQEA 3TOAA 2OU2A 5JEAG 4JI1H 1WHRA 4LF6H 2UXCH 1M8CA 1PQXA 4YY3H 2QNDA 2YQRA 3UEYA 1DS2I 2X06A 4LF9H 1S03G 2A20A 3T1HH 1YTPA 5E3PA 3R5BA 1X4NA 3J80W 2OD1A 2GVIA 2L8EA 2PY9A 3VDPA 4WP4A 1HDLA 3FAUA 1DTJA 2ZM6H 3TO7A 4KHPH 3GR5A 2F4VH 4AMLA 2DB6A 4LF4H 4OCHA 2WGCA 1DT4A 1ZZIA 2SGFI 1TUAA 2GKTI 2CTKA 4JYAH 1HJAI 4DV6H 1N33H 2ORVA 1P9GA 2VRWB 4LFCH 2E5LH 5CCMA 4E1PA 1I94H 4X65H 2JW6A 4E9JA 2JA1A 1DS3I 3VDUA 1IBLH 3VKEA 1K7TA 2KMOA 3GABA 2V1CC 1OVOA 3JAMW 2VQEH 3I0PA 5FLXW 1FJGH 3R5AA 4UXJA 3RF2A 2UUBH 1V1IA 1PCEA 4LFBH 2X52A 2FFMA 3AEVB 1Y1BA 4JI8H 2N17A 2Z0SA 3OXFA 4GKJH 1IBKH 5BR8H 2JXDA 4B3RH 2BL5A 1ZZKA 3QWPA 2BA0A 1XRHA 2PQ8A 4JI4H 4OVOA 1FY7A 2SGEI 4DV7H 4LIJA 1PPFI 4FKDA 4DV2H 5K36G 2K9HA 3T1YH 3UOEA 1KBFA 1J5KA 4OX9H 4BA2I 3EZJA 3HH2C 2ENZA 4X62H 1ODHA 2UXBH 3U1KA 2NU1I 2ELIA
chains in the Genus database with same CATH topology
4H8AA 1VBIA 2X06A 3I0PA 1V9NA 1WTJA 1S20A 1X0AA 2G8YA 4FJSA 2CWFA 1Z2IA 3UOEA 2CWHA 1NXUA 4FJUA 1XRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H8A A;  1VBI A;  2X06 A;  3I0P A;  1V9N A;  1WTJ A;  1S20 A;  1X0A A;  2G8Y A;  4FJS A;  2CWF A;  1Z2I A;  3UOE A;  2CWH A;  1NXU A;  4FJU A;  1XRH A; 
#chains in the Genus database with same CATH topology
 1P9Z A;  2JA9 A;  2LF0 A;  1CGI I;  2WCY A;  2ENN A;  2XRC A;  1F0X A;  2JYY A;  2ARP F;  1FYB A;  1SGE I;  1N34 H;  3B4V C;  2YUU A;  3D00 A;  1IY5 A;  2HH3 A;  4DR2 H;  2ANN A;  3UFF A;  1K7U A;  2AXY A;  2X3T A;  1X4M A;  2PQU A;  4OD6 A;  1X74 A;  4X64 H;  5HQ8 A;  2LTM A;  7WGA A;  2Y0M A;  1TBQ R;  1WGT A;  5FUY A;  1TUS A;  3UGL A;  5LMU H;  1MJA A;  1MJ9 A;  4FJS A;  2QPO A;  1ZTG A;  2N52 A;  3E2I A;  5E3R A;  3UGI A;  4NZT M;  2LUY A;  5HI7 A;  4DV5 H;  1XNQ H;  1KHM A;  1CT4 I;  4B3S H;  1KBE A;  1W3S A;  1SGD I;  1UUC A;  3L7Z C;  2GIV A;  3TO6 A;  4UXH A;  2DIP A;  5J8F A;  3R5C A;  2FNF X;  1CT2 I;  2UUA H;  1FKA H;  1CT0 I;  1X4S A;  4B8T A;  2NU3 I;  5FUV A;  2HH2 A;  4A24 A;  1MSZ A;  1SGP I;  2LB7 A;  1N36 H;  1MJB A;  1XMQ H;  2GKR I;  3E59 A;  1BUS A;  4B8C D;  2L7X A;  3R5D A;  4G08 A;  3UEJ A;  1EC6 A;  3KDK A;  2GKV A;  2QQD A;  3SGQ I;  4NXM H;  4B3M H;  2CWG A;  1UVF A;  1YU6 C;  2JVZ A;  4NZR M;  2CJS C;  1XMO H;  4DR7 H;  2HHH H;  4OO1 G;  3SGB I;  4DNC A;  1TIH A;  4JI5 H;  2D9I A;  3RU0 A;  2SGP I;  1PTQ A;  2CTM A;  3FSX A;  4UXI A;  4X66 H;  2B0U C;  1PTR A;  2FMR A;  4JVH A;  4LF7 H;  4DR5 H;  2F3C I;  1Z2I A;  4JI3 H;  4DV3 H;  1K1G A;  1ULN A;  2M5X A;  2ERW A;  1XX6 A;  2CWH A;  1R79 A;  1J5E H;  2RC4 A;  3PDN A;  4SGB I;  1UG8 A;  3TO9 A;  5EX0 A;  2O4C A;  4JI6 H;  2CTF A;  1KMA A;  1AN7 A;  4LF8 H;  1W4R A;  5LL6 b;  4DUZ H;  1I6U A;  5JHW C;  3FC3 A;  4B6D A;  1N13 A;  4AM3 A;  2M8W A;  4DR1 H;  1SGN I;  3TOB A;  2FPH X;  4H8A A;  3UGD A;  2JEB I;  1Z7K B;  1ULK A;  1TBR R;  2RIJ A;  2G8Y A;  1XNR H;  3J7A K;  2OPV A;  1LR9 A;  2CTL A;  4B3T H;  2JEA I;  2V1C A;  2VQF H;  3SB1 A;  3OL0 A;  1WVN A;  4AQY H;  4JV5 H;  4HGU A;  4GKK H;  2UZ3 A;  1SEI A;  4DR6 H;  5IT9 W;  1M8B A;  1UHA A;  4DV0 H;  1OYV I;  2JZX A;  2KCX A;  5CCL A;  3V69 A;  4DV1 H;  4NXN H;  2BUS A;  5J8C A;  1XBT A;  2ROW A;  4L9M A;  2VKC A;  3GKU A;  4AIM A;  4DR4 H;  1CHO I;  2N71 A;  2KMP A;  2NN6 G;  1NXU A;  2QQ0 A;  2ODD A;  1VBI A;  2OVO A;  1X0A A;  2LEO A;  3VE5 A;  2OZU A;  1SGR I;  1CE3 A;  4GI3 C;  1IBM H;  2UU9 H;  1NUB A;  2CTJ A;  3CXL A;  4JVY A;  2CPM A;  4MPI A;  3GOX A;  1V1H A;  1U5K A;  1S20 A;  4JI2 H;  4DV4 H;  3KY9 A;  1AN1 I;  1N32 H;  4JCV E;  3OET A;  1HNX H;  2CTE A;  2SGQ I;  1ULM A;  2V53 A;  1WTJ A;  1VIG A;  5EX3 A;  1TGS I;  3QTL D;  1LR8 A;  1H0Z A;  4JI0 H;  4DR3 H;  3QD7 X;  5IWA H;  2QQC A;  2UVO A;  1WGC A;  2J9R A;  1CGJ I;  2CPQ A;  2E73 A;  3QAH A;  1HEV A;  2WVJ A;  4DUY H;  3OXL A;  2W0T A;  4YHH H;  1FAQ A;  2P6A C;  5LMN H;  1XA6 A;  2N1A B;  1V8C A;  1UVG A;  1ZZJ A;  2LTL A;  2Y3M A;  3OXG A;  1CSO I;  1VIH A;  1Y1C A;  1HPT A;  2E3U A;  2J87 A;  2YQP A;  4K0K H;  4PDB A;  3OTO H;  2ANR A;  1TOT A;  1OMT A;  2M6Q A;  1OMU A;  2KMQ A;  4NBQ A;  2UUC H;  1Y8F A;  1TBO A;  2E5R A;  1RFH A;  1WE8 A;  9WGA A;  1PJU A;  2ORW A;  3TJQ A;  1LR7 A;  2NU2 I;  1SGY I;  4JI7 H;  4EC5 A;  1R0R I;  1HNW H;  4LFA H;  1IY6 A;  2CWF A;  2DGR A;  1Q9B A;  5E3Q A;  1MT1 A;  1BMO A;  5A2Q W;  5C0X G;  1IW4 A;  2SGD I;  4E1R A;  2UXD H;  3BJI A;  2PT7 G;  2KMR A;  3FSY A;  5DAE A;  2ZQE A;  3KDG A;  3MEK A;  2OPU A;  2DKV A;  4WAL A;  2A1S A;  1TUR A;  3NCV A;  1J4W A;  3J81 W;  2B8T A;  1K7V A;  2K1H A;  4BA1 I;  1WKX A;  1VDD A;  2JZM A;  4FJU A;  1TBN A;  3OSS D;  5FUW A;  1SGQ I;  3OVO A;  3SEK C;  2JE6 I;  2LRR A;  2NU0 I;  5FUX A;  2P2R A;  2NU4 I;  4LF5 H;  1HR0 H;  5DT9 A;  1FAR A;  4QMF B;  4IFD G;  4WAN A;  1V9N A;  1HNZ H;  1X9Z A;  2MJH A;  2QQE A;  3TOA A;  2OU2 A;  5JEA G;  4JI1 H;  1WHR A;  4LF6 H;  2UXC H;  1M8C A;  1PQX A;  4YY3 H;  2QND A;  2YQR A;  3UEY A;  1DS2 I;  2X06 A;  4LF9 H;  1S03 G;  2A20 A;  3T1H H;  1YTP A;  5E3P A;  3R5B A;  1X4N A;  3J80 W;  2OD1 A;  2GVI A;  2L8E A;  2PY9 A;  3VDP A;  4WP4 A;  1HDL A;  3FAU A;  1DTJ A;  2ZM6 H;  3TO7 A;  4KHP H;  3GR5 A;  2F4V H;  4AML A;  2DB6 A;  4LF4 H;  4OCH A;  2WGC A;  1DT4 A;  1ZZI A;  2SGF I;  1TUA A;  2GKT I;  2CTK A;  4JYA H;  1HJA I;  4DV6 H;  1N33 H;  2ORV A;  1P9G A;  2VRW B;  4LFC H;  2E5L H;  5CCM A;  4E1P A;  1I94 H;  4X65 H;  2JW6 A;  4E9J A;  2JA1 A;  1DS3 I;  3VDU A;  1IBL H;  3VKE A;  1K7T A;  2KMO A;  3GAB A;  2V1C C;  1OVO A;  3JAM W;  2VQE H;  3I0P A;  5FLX W;  1FJG H;  3R5A A;  4UXJ A;  3RF2 A;  2UUB H;  1V1I A;  1PCE A;  4LFB H;  2X52 A;  2FFM A;  3AEV B;  1Y1B A;  4JI8 H;  2N17 A;  2Z0S A;  3OXF A;  4GKJ H;  1IBK H;  5BR8 H;  2JXD A;  4B3R H;  2BL5 A;  1ZZK A;  3QWP A;  2BA0 A;  1XRH A;  2PQ8 A;  4JI4 H;  4OVO A;  1FY7 A;  2SGE I;  4DV7 H;  4LIJ A;  1PPF I;  4FKD A;  4DV2 H;  5K36 G;  2K9H A;  3T1Y H;  3UOE A;  1KBF A;  1J5K A;  4OX9 H;  4BA2 I;  3EZJ A;  3HH2 C;  2ENZ A;  4X62 H;  1ODH A;  2UXB H;  3U1K A;  2NU1 I;  2ELI A; 
#chains in the Genus database with same CATH homology
 4H8A A;  1VBI A;  2X06 A;  3I0P A;  1V9N A;  1WTJ A;  1S20 A;  1X0A A;  2G8Y A;  4FJS A;  2CWF A;  1Z2I A;  3UOE A;  2CWH A;  1NXU A;  4FJU A;  1XRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...