1NXUA

Crystal structure of e. coli hypothetical oxidoreductase yiak northeast structural genomics consortium target er82.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
332
structure length
332
Chain Sequence
MKVTFEQLKAAFNRVLISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQQLENGDIIPDAQPKRITSLGAIEQWDAQRSIGNLTAKKMMDRAIELAADHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICWTNSIAVMPPWGAKECRIGTNPLIVAIPSTPITMVDMSMSMFSYGMLEVNRLAGRQLPVDGGFDDEGNLTKEPGVIEKNRRILPMGYWKGSGMSIVLDMIATLLSDGASVAEVTQDNSDEYGISQIFIAIEVDKLIDGPTRDAKLQRIMDYVTSAERADENQAIRLPGHEFTTLLAENRRNGITVDDSVWAKIQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical oxidoreductase yiaK
publication title A Novel NAD-binding Protein Revealed by the Crystal Structure of 2,3-Diketo-L-gulonate Reductase (YiaK).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, oxidoreductase
total genus 96
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.1.1.130: 3-dehydro-L-gulonate 2-dehydrogenase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 1nxuA01
3.30.60.50 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Hypothetical oxidoreductase yiak; domain 3 1nxuA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 1nxuA02
1X0AA 2G8YA 1NXUA 3UOEA 1V9NA 2CWFA 3I0PA 4H8AA 1XRHA 1Z2IA 4FJSA 2X06A 2CWHA 4FJUA 1VBIA 1S20A 1WTJA
chains in the Genus database with same CATH superfamily
1XNQH 1OMTA 1NXUA 1BMOA 2DIPA 1VDDA 5EX3A 3FSYA 2KMRA 2V1CC 2JVZA 1IW4A 2DB6A 2CWGA 4G08A 3FC3A 1MT1A 2UXDH 4LIJA 4B8TA 3SEKC 2CWHA 3QAHA 3GOXA 3EZJA 4JVYA 1SGDI 5LMNH 1SGPI 2DKVA 2N1AB 3OXLA 4LF5H 4GKJH 1N32H 2UZ3A 2LF0A 1ULNA 1OMUA 4BA1I 1HNXH 1Y1BA 4LF8H 1FY7A 4B3RH 2GKTI 1V1IA 1HPTA 1CT0I 3J81W 3GKUA 2E5RA 4MPIA 1J4WA 1WTJA 4E1PA 3UGIA 2VQEH 3E59A 1FYBA 4OCHA 4OD6A 1TUSA 2J9RA 4DR4H 1CT4I 1VIGA 5FUVA 1X4MA 4LF4H 1X0AA 2RIJA 4DV7H 1EC6A 5DT9A 2YQRA 2HH2A 1YU6C 2B0UC 1M8CA 2JA9A 2O4CA 2LUYA 1N13A 4DV1H 1X4SA 2ELIA 2LRRA 2QQCA 1SEIA 4LFCH 1WE8A 2ANRA 2BUSA 2MJHA 4JVHA 3KY9A 1ZZKA 4K0KH 3J7AK 2KMOA 1Z7KB 1N33H 5J8CA 2FMRA 1AN1I 1UHAA 1HNZH 2UVOA 7WGAA 4KHPH 2WCYA 3FSXA 2HHHH 1XA6A 2NN6G 1XMQH 3TO7A 3OETA 1SGNI 4JI7H 3UGDA 1WGTA 3TOAA 3E2IA 2E3UA 2DGRA 3MEKA 2E73A 1TOTA 3OXFA 1Y8FA 2NU0I 1TIHA 4AMLA 2YUUA 2NU2I 4DV2H 2D9IA 2ARPF 2NU3I 1FARA 2ODDA 1DT4A 1TUAA 4DR6H 4DV6H 2ORVA 1PTRA 4JI8H 1TBNA 2BL5A 1K7VA 4AQYH 1CSOI 3T1HH 2M8WA 2P2RA 3HH2C 1UVGA 2L7XA 2QNDA 2X52A 2J87A 2JYYA 1ZZIA 1ODHA 2FPHX 1FJGH 4LFBH 1HEVA 5IWAH 1CGJI 4NZTM 2NU4I 3U1KA 2JW6A 2Y3MA 2ENZA 4SGBI 1WVNA 1R0RI 1X9ZA 4YY3H 1P9GA 2F4VH 2JEAI 4AM3A 2QPOA 1FAQA 1SGRI 2XRCA 5CCMA 1YTPA 1HDLA 2OD1A 4A24A 1XRHA 4FJSA 3VDPA 4EC5A 2UXBH 2SGPI 4NXMH 1XNRH 1UVFA 4X62H 1VBIA 1PQXA 3TO6A 3FAUA 3OVOA 1Y1CA 3L7ZC 3B4VC 4LF9H 1IY6A 1V1HA 3UEJA 4OX9H 2FNFX 1WGCA 2JZMA 4QMFB 1V9NA 4H8AA 1OYVI 3R5CA 2CTEA 1PPFI 1N36H 3GR5A 4GKKH 4UXJA 2E5LH 1I6UA 5CCLA 2PQ8A 5FUWA 1IY5A 1PCEA 1N34H 3OTOH 1ZTGA 4X65H 2BA0A 4DR7H 2KCXA 4DV5H 2OPUA 2Y0MA 3T1YH 4B3TH 2N52A 2OU2A 4OO1G 2RC4A 4JI5H 2UU9H 2ZQEA 1CHOI 1TBOA 1FKAH 1UG8A 2M6QA 1X4NA 4WANA 4IFDG 1H0ZA 1X74A 2K1HA 2QQ0A 2VQFH 9WGAA 4DR2H 1TGSI 2N71A 1MJ9A 2OZUA 2CTJA 1W3SA 1BUSA 5FUXA 2GKVA 1XBTA 2UUBH 4BA2I 4DV4H 2CTMA 1Q9BA 2KMQA 1IBKH 5C0XG 4DNCA 3OL0A 2CPMA 1PTQA 2B8TA 4FKDA 2AXYA 5IT9W 4LFAH 1WKXA 2ENNA 1UUCA 4B3SH 1XMOH 5LMUH 5HQ8A 3KDKA 3OXGA 2X3TA 3OSSD 1HR0H 2SGEI 3R5DA 1CT2I 5K36G 2V53A 1LR9A 2N17A 5HI7A 1IBLH 1WHRA 2HH3A 4JI2H 2SGFI 2CTFA 1KMAA 3V69A 3VKEA 5E3QA 1CGII 4NXNH 1TBQR 2QQEA 1S20A 2LTLA 3RU0A 3QD7X 1SGQI 4UXHA 1F0XA 3TJQA 1CE3A 5BR8H 3SB1A 5A2QW 5E3RA 4DV0H 5JEAG 2WGCA 1J5EH 1I94H 1M8BA 1ZZJA 1PJUA 2SGQI 4DUYH 4B3MH 5EX0A 2PT7G 2KMPA 1LR7A 2WVJA 3UGLA 3J80W 1KBEA 3D00A 4JI1H 3SGQI 4AIMA 5DAEA 1RFHA 2Z0SA 1MJBA 4YHHH 1AN7A 1Z2IA 4FJUA 4JCVE 2A1SA 2F3CI 1HNWH 5E3PA 3TO9A 4E9JA 1KBFA 2PY9A 1DTJA 3JAMW 2ANNA 4GI3C 2LTMA 2OVOA 3GABA 1P9ZA 2G8YA 1DS3I 3UFFA 2ORWA 2ROWA 2CJSC 4B6DA 1TBRR 1XX6A 2GKRI 1SGEI 3TOBA 4OVOA 3RF2A 4WP4A 2VKCA 2LEOA 3SGBI 2CTLA 2GVIA 2X06A 2FFMA 4DV3H 2UXCH 2M5XA 2SGDI 5FUYA 5J8FA 2ERWA 2JZXA 4X66H 3VDUA 5JHWC 2K9HA 2GIVA 2CTKA 1VIHA 4DR5H 3VE5A 1OVOA 2OPVA 2JEBI 5FLXW 4JI6H 2JE6I 4LF6H 4JI0H 4LF7H 2P6AC 4E1RA 2UUCH 2YQPA 2LB7A 1SGYI 4NZRM 1K7UA 3AEVB 4NBQA 2CWFA 4X64H 3PDNA 4JI4H 4B8CD 1ULMA 2W0TA 1NUBA 2ZM6H 2CPQA 3I0PA 1MSZA 2JA1A 2UUAH 3R5BA 3QTLD 2L8EA 4JI3H 4DR3H 1KHMA 1K7TA 2PQUA 3CXLA 3UEYA 4JV5H 1TURA 2A20A 1LR8A 2V1CA 4JYAH 1U5KA 1J5KA 3R5AA 3UOEA 1IBMH 1DS2I 3KDGA 1ULKA 2NU1I 3BJIA 4DUZH 1V8CA 2JXDA 1MJAA 3QWPA 4DR1H 4PDBA 3NCVA 1K1GA 1W4RA 4L9MA 4HGUA 4WALA 1S03G 5LL6b 1HJAI 1R79A 2VRWB 4UXIA 2QQDA
chains in the Genus database with same CATH topology
1X0AA 2G8YA 1NXUA 3UOEA 1V9NA 2CWFA 3I0PA 4H8AA 1XRHA 1Z2IA 4FJSA 2X06A 2CWHA 4FJUA 1VBIA 1S20A 1WTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0A A;  2G8Y A;  1NXU A;  3UOE A;  1V9N A;  2CWF A;  3I0P A;  4H8A A;  1XRH A;  1Z2I A;  4FJS A;  2X06 A;  2CWH A;  4FJU A;  1VBI A;  1S20 A;  1WTJ A; 
#chains in the Genus database with same CATH topology
 1XNQ H;  1OMT A;  1NXU A;  1BMO A;  2DIP A;  1VDD A;  5EX3 A;  3FSY A;  2KMR A;  2V1C C;  2JVZ A;  1IW4 A;  2DB6 A;  2CWG A;  4G08 A;  3FC3 A;  1MT1 A;  2UXD H;  4LIJ A;  4B8T A;  3SEK C;  2CWH A;  3QAH A;  3GOX A;  3EZJ A;  4JVY A;  1SGD I;  5LMN H;  1SGP I;  2DKV A;  2N1A B;  3OXL A;  4LF5 H;  4GKJ H;  1N32 H;  2UZ3 A;  2LF0 A;  1ULN A;  1OMU A;  4BA1 I;  1HNX H;  1Y1B A;  4LF8 H;  1FY7 A;  4B3R H;  2GKT I;  1V1I A;  1HPT A;  1CT0 I;  3J81 W;  3GKU A;  2E5R A;  4MPI A;  1J4W A;  1WTJ A;  4E1P A;  3UGI A;  2VQE H;  3E59 A;  1FYB A;  4OCH A;  4OD6 A;  1TUS A;  2J9R A;  4DR4 H;  1CT4 I;  1VIG A;  5FUV A;  1X4M A;  4LF4 H;  1X0A A;  2RIJ A;  4DV7 H;  1EC6 A;  5DT9 A;  2YQR A;  2HH2 A;  1YU6 C;  2B0U C;  1M8C A;  2JA9 A;  2O4C A;  2LUY A;  1N13 A;  4DV1 H;  1X4S A;  2ELI A;  2LRR A;  2QQC A;  1SEI A;  4LFC H;  1WE8 A;  2ANR A;  2BUS A;  2MJH A;  4JVH A;  3KY9 A;  1ZZK A;  4K0K H;  3J7A K;  2KMO A;  1Z7K B;  1N33 H;  5J8C A;  2FMR A;  1AN1 I;  1UHA A;  1HNZ H;  2UVO A;  7WGA A;  4KHP H;  2WCY A;  3FSX A;  2HHH H;  1XA6 A;  2NN6 G;  1XMQ H;  3TO7 A;  3OET A;  1SGN I;  4JI7 H;  3UGD A;  1WGT A;  3TOA A;  3E2I A;  2E3U A;  2DGR A;  3MEK A;  2E73 A;  1TOT A;  3OXF A;  1Y8F A;  2NU0 I;  1TIH A;  4AML A;  2YUU A;  2NU2 I;  4DV2 H;  2D9I A;  2ARP F;  2NU3 I;  1FAR A;  2ODD A;  1DT4 A;  1TUA A;  4DR6 H;  4DV6 H;  2ORV A;  1PTR A;  4JI8 H;  1TBN A;  2BL5 A;  1K7V A;  4AQY H;  1CSO I;  3T1H H;  2M8W A;  2P2R A;  3HH2 C;  1UVG A;  2L7X A;  2QND A;  2X52 A;  2J87 A;  2JYY A;  1ZZI A;  1ODH A;  2FPH X;  1FJG H;  4LFB H;  1HEV A;  5IWA H;  1CGJ I;  4NZT M;  2NU4 I;  3U1K A;  2JW6 A;  2Y3M A;  2ENZ A;  4SGB I;  1WVN A;  1R0R I;  1X9Z A;  4YY3 H;  1P9G A;  2F4V H;  2JEA I;  4AM3 A;  2QPO A;  1FAQ A;  1SGR I;  2XRC A;  5CCM A;  1YTP A;  1HDL A;  2OD1 A;  4A24 A;  1XRH A;  4FJS A;  3VDP A;  4EC5 A;  2UXB H;  2SGP I;  4NXM H;  1XNR H;  1UVF A;  4X62 H;  1VBI A;  1PQX A;  3TO6 A;  3FAU A;  3OVO A;  1Y1C A;  3L7Z C;  3B4V C;  4LF9 H;  1IY6 A;  1V1H A;  3UEJ A;  4OX9 H;  2FNF X;  1WGC A;  2JZM A;  4QMF B;  1V9N A;  4H8A A;  1OYV I;  3R5C A;  2CTE A;  1PPF I;  1N36 H;  3GR5 A;  4GKK H;  4UXJ A;  2E5L H;  1I6U A;  5CCL A;  2PQ8 A;  5FUW A;  1IY5 A;  1PCE A;  1N34 H;  3OTO H;  1ZTG A;  4X65 H;  2BA0 A;  4DR7 H;  2KCX A;  4DV5 H;  2OPU A;  2Y0M A;  3T1Y H;  4B3T H;  2N52 A;  2OU2 A;  4OO1 G;  2RC4 A;  4JI5 H;  2UU9 H;  2ZQE A;  1CHO I;  1TBO A;  1FKA H;  1UG8 A;  2M6Q A;  1X4N A;  4WAN A;  4IFD G;  1H0Z A;  1X74 A;  2K1H A;  2QQ0 A;  2VQF H;  9WGA A;  4DR2 H;  1TGS I;  2N71 A;  1MJ9 A;  2OZU A;  2CTJ A;  1W3S A;  1BUS A;  5FUX A;  2GKV A;  1XBT A;  2UUB H;  4BA2 I;  4DV4 H;  2CTM A;  1Q9B A;  2KMQ A;  1IBK H;  5C0X G;  4DNC A;  3OL0 A;  2CPM A;  1PTQ A;  2B8T A;  4FKD A;  2AXY A;  5IT9 W;  4LFA H;  1WKX A;  2ENN A;  1UUC A;  4B3S H;  1XMO H;  5LMU H;  5HQ8 A;  3KDK A;  3OXG A;  2X3T A;  3OSS D;  1HR0 H;  2SGE I;  3R5D A;  1CT2 I;  5K36 G;  2V53 A;  1LR9 A;  2N17 A;  5HI7 A;  1IBL H;  1WHR A;  2HH3 A;  4JI2 H;  2SGF I;  2CTF A;  1KMA A;  3V69 A;  3VKE A;  5E3Q A;  1CGI I;  4NXN H;  1TBQ R;  2QQE A;  1S20 A;  2LTL A;  3RU0 A;  3QD7 X;  1SGQ I;  4UXH A;  1F0X A;  3TJQ A;  1CE3 A;  5BR8 H;  3SB1 A;  5A2Q W;  5E3R A;  4DV0 H;  5JEA G;  2WGC A;  1J5E H;  1I94 H;  1M8B A;  1ZZJ A;  1PJU A;  2SGQ I;  4DUY H;  4B3M H;  5EX0 A;  2PT7 G;  2KMP A;  1LR7 A;  2WVJ A;  3UGL A;  3J80 W;  1KBE A;  3D00 A;  4JI1 H;  3SGQ I;  4AIM A;  5DAE A;  1RFH A;  2Z0S A;  1MJB A;  4YHH H;  1AN7 A;  1Z2I A;  4FJU A;  4JCV E;  2A1S A;  2F3C I;  1HNW H;  5E3P A;  3TO9 A;  4E9J A;  1KBF A;  2PY9 A;  1DTJ A;  3JAM W;  2ANN A;  4GI3 C;  2LTM A;  2OVO A;  3GAB A;  1P9Z A;  2G8Y A;  1DS3 I;  3UFF A;  2ORW A;  2ROW A;  2CJS C;  4B6D A;  1TBR R;  1XX6 A;  2GKR I;  1SGE I;  3TOB A;  4OVO A;  3RF2 A;  4WP4 A;  2VKC A;  2LEO A;  3SGB I;  2CTL A;  2GVI A;  2X06 A;  2FFM A;  4DV3 H;  2UXC H;  2M5X A;  2SGD I;  5FUY A;  5J8F A;  2ERW A;  2JZX A;  4X66 H;  3VDU A;  5JHW C;  2K9H A;  2GIV A;  2CTK A;  1VIH A;  4DR5 H;  3VE5 A;  1OVO A;  2OPV A;  2JEB I;  5FLX W;  4JI6 H;  2JE6 I;  4LF6 H;  4JI0 H;  4LF7 H;  2P6A C;  4E1R A;  2UUC H;  2YQP A;  2LB7 A;  1SGY I;  4NZR M;  1K7U A;  3AEV B;  4NBQ A;  2CWF A;  4X64 H;  3PDN A;  4JI4 H;  4B8C D;  1ULM A;  2W0T A;  1NUB A;  2ZM6 H;  2CPQ A;  3I0P A;  1MSZ A;  2JA1 A;  2UUA H;  3R5B A;  3QTL D;  2L8E A;  4JI3 H;  4DR3 H;  1KHM A;  1K7T A;  2PQU A;  3CXL A;  3UEY A;  4JV5 H;  1TUR A;  2A20 A;  1LR8 A;  2V1C A;  4JYA H;  1U5K A;  1J5K A;  3R5A A;  3UOE A;  1IBM H;  1DS2 I;  3KDG A;  1ULK A;  2NU1 I;  3BJI A;  4DUZ H;  1V8C A;  2JXD A;  1MJA A;  3QWP A;  4DR1 H;  4PDB A;  3NCV A;  1K1G A;  1W4R A;  4L9M A;  4HGU A;  4WAL A;  1S03 G;  5LL6 b;  1HJA I;  1R79 A;  2VRW B;  4UXI A;  2QQD A; 
#chains in the Genus database with same CATH homology
 1X0A A;  2G8Y A;  1NXU A;  3UOE A;  1V9N A;  2CWF A;  3I0P A;  4H8A A;  1XRH A;  1Z2I A;  4FJS A;  2X06 A;  2CWH A;  4FJU A;  1VBI A;  1S20 A;  1WTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...