1NXUA

Crystal structure of e. coli hypothetical oxidoreductase yiak northeast structural genomics consortium target er82.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
332
structure length
332
Chain Sequence
MKVTFEQLKAAFNRVLISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQQLENGDIIPDAQPKRITSLGAIEQWDAQRSIGNLTAKKMMDRAIELAADHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICWTNSIAVMPPWGAKECRIGTNPLIVAIPSTPITMVDMSMSMFSYGMLEVNRLAGRQLPVDGGFDDEGNLTKEPGVIEKNRRILPMGYWKGSGMSIVLDMIATLLSDGASVAEVTQDNSDEYGISQIFIAIEVDKLIDGPTRDAKLQRIMDYVTSAERADENQAIRLPGHEFTTLLAENRRNGITVDDSVWAKIQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel NAD-binding Protein Revealed by the Crystal Structure of 2,3-Diketo-L-gulonate Reductase (YiaK).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, oxidoreductase
molecule keywords Hypothetical oxidoreductase yiaK
total genus 96
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.1.1.130: 3-dehydro-L-gulonate 2-dehydrogenase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 1nxuA01
3.30.60.50 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Hypothetical oxidoreductase yiak; domain 3 1nxuA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 1nxuA02
1Z2IA 1XRHA 2CWHA 1WTJA 1NXUA 4FJUA 1V9NA 1S20A 2G8YA 4H8AA 1VBIA 4FJSA 1X0AA 2CWFA 2X06A 3I0PA 3UOEA
chains in the Genus database with same CATH superfamily
3RU0A 1WTJA 2M8WA 1UVGA 3VDPA 2BUSA 2ZM6H 4IFDG 3UGIA 1N36H 2PQ8A 4LF6H 2QQDA 1AN1I 3TJQA 3JAMW 4JI3H 1ULMA 4E1PA 3HH2C 4H8AA 1K7UA 1IBLH 2JYYA 4OO1G 2NU1I 4E9JA 1WHRA 1CT4I 2KMQA 4X62H 2QQEA 1PTQA 2X52A 4WALA 1PCEA 4NXMH 4EC5A 3J7AK 1IY5A 1FARA 4NZTM 1MT1A 4B6DA 2PY9A 1M8CA 2J9RA 2JEBI 5E3QA 2SGQI 2B0UC 3T1YH 1EC6A 4SGBI 2VRWB 2DGRA 2K1HA 1YU6C 1OVOA 1RFHA 2ENNA 1S20A 2Z0SA 4LFCH 2SGFI 1TURA 3OL0A 3QD7X 2GKRI 4JI6H 1SGNI 1LR8A 2HH2A 1DTJA 2CPQA 3E59A 1J5EH 1N34H 2UUAH 1I6UA 2E3UA 2UXBH 2GKVA 2UUBH 2CWGA 1HJAI 5CCMA 5E3RA 2KMPA 3FSXA 5JEAG 2UXCH 4YHHH 5FUVA 1J4WA 2CJSC 1H0ZA 4MPIA 2HH3A 3UOEA 2FMRA 2KCXA 2E73A 1UUCA 1DT4A 3RF2A 1PJUA 1N32H 2LB7A 1DS2I 1TOTA 2GKTI 1TBQR 3OXLA 2SGPI 3CXLA 3SGQI 2CWHA 5FUXA 5IT9W 1R79A 2PQUA 2NU0I 2BA0A 3OETA 2Y0MA 2CTMA 4AMLA 1FAQA 3OXGA 1N33H 1U5KA 1MSZA 1I94H 1HDLA 3OXFA 3I0PA 1TBRR 2OZUA 3KDKA 4DR5H 2CTKA 1CSOI 1LR9A 5C0XG 5EX0A 2F3CI 2JA1A 4B3MH 3UGLA 2LUYA 3TO7A 1CGII 1V1IA 4NXNH 4GI3C 2KMRA 2N1AB 2VQFH 3AEVB 2P2RA 1OYVI 1CHOI 2X3TA 1ZZJA 2L8EA 3VKEA 2QPOA 9WGAA 3NCVA 4DUZH 4LIJA 1XMOH 4DV3H 3OVOA 2ROWA 2CPMA 4BA2I 1V9NA 2GIVA 3T1HH 1SGQI 1CE3A 1ZTGA 1LR7A 4UXJA 2JE6I 1MJBA 3GR5A 1XNQH 1TGSI 3OTOH 2OPVA 1FKAH 1XA6A 4BA1I 1K7VA 1FY7A 2A20A 2CTFA 1ZZKA 4X65H 3R5CA 4JV5H 3D00A 2AXYA 1OMUA 2RC4A 1X74A 2UXDH 4JI4H 1OMTA 2UUCH 4K0KH 1ULKA 5DAEA 1KBFA 2SGEI 1K7TA 5K36G 1V1HA 1WGCA 3VE5A 2B8TA 3E2IA 2SGDI 1FJGH 1IY6A 2CTEA 4JI7H 3R5BA 5FUWA 1TBNA 4DV2H 1HEVA 4X64H 2MJHA 3FAUA 2NN6G 2BL5A 4LF8H 4B3SH 4FJSA 1ZZIA 1CT2I 2HHHH 4DR2H 1TIHA 2YUUA 1SGEI 2P6AC 2G8YA 5EX3A 1X9ZA 2ANRA 4JI1H 5DT9A 1WE8A 1WVNA 2F4VH 2V1CA 2K9HA 1MJAA 2ORWA 1N13A 3R5DA 1HNZH 2UZ3A 2VKCA 2LTLA 1KHMA 2WGCA 2UU9H 2N52A 4JYAH 4NBQA 1DS3I 4LF4H 7WGAA 1YTPA 2LTMA 4G08A 2OU2A 2QQ0A 4OVOA 2JA9A 4B3RH 2LF0A 1IBKH 3FSYA 4LF5H 1SGRI 1WKXA 3EZJA 3TO6A 4DR7H 1FYBA 2CWFA 2GVIA 1X4NA 1UHAA 3UFFA 3B4VC 4UXHA 5FLXW 2A1SA 2WCYA 2WVJA 2OVOA 1Z2IA 3UGDA 3GOXA 4UXIA 2DKVA 5FUYA 2QQCA 1KBEA 2M5XA 1W4RA 2YQRA 2JVZA 4JVYA 2ARPF 4E1RA 4JI2H 4OCHA 1TBOA 1UG8A 1ULNA 1P9GA 2PT7G 4AIMA 5LMNH 2J87A 1W3SA 1Y1CA 2NU2I 4NZRM 2NU4I 5JHWC 2NU3I 1NUBA 1BMOA 1P9ZA 3TOBA 3GABA 5E3PA 4B8TA 1PTRA 2ODDA 1NXUA 4DV0H 4LF9H 2XRCA 2DB6A 3PDNA 1CGJI 2OPUA 5HI7A 2X06A 3OSSD 3V69A 5A2QW 5LL6b 2UVOA 1Y1BA 3L7ZC 2JZMA 1CT0I 1S03G 2CTLA 2V53A 2O4CA 5J8CA 1SGYI 4A24A 3R5AA 4OX9H 1WGTA 4B3TH 4DV5H 4LF7H 1M8BA 2ANNA 4GKJH 3TOAA 3SGBI 3FC3A 1BUSA 3BJIA 5LMUH 4JI8H 3J80W 1X4SA 2N71A 2V1CC 1J5KA 2N17A 1V8CA 3QAHA 4QMFB 4HGUA 1UVFA 2FFMA 4DV7H 4WANA 3QTLD 4OD6A 1MJ9A 2VQEH 1VIHA 3UEYA 2DIPA 4B8CD 4AQYH 1Z7KB 1XNRH 5BR8H 1R0RI 1XX6A 3QWPA 3UEJA 2JW6A 1HNXH 4DUYH 2CTJA 2JXDA 2LRRA 4DV4H 1SEIA 2ELIA 4WP4A 5J8FA 2FPHX 4DV1H 1HNWH 4FJUA 4YY3H 4X66H 2ZQEA 2YQPA 4DNCA 1HR0H 4GKKH 4DV6H 4LFAH 2RIJA 4JCVE 1KMAA 1VDDA 2E5LH 2OD1A 2W0TA 3KY9A 3MEKA 1AN7A 2D9IA 4DR3H 4DR6H 1Y8FA 3SEKC 5CCLA 1IW4A 1Q9BA 1IBMH 4KHPH 4AM3A 1SGDI 3TO9A 2JZXA 1XRHA 1F0XA 2QNDA 1K1GA 1X0AA 4PDBA 1XBTA 2Y3MA 3SB1A 4FKDA 5HQ8A 3J81W 2JEAI 1HPTA 2L7XA 2KMOA 1TUAA 2ORVA 1PPFI 2LEOA 1XMQH 1TUSA 4L9MA 3KDGA 4DR1H 4JI0H 3U1KA 1VIGA 1PQXA 4LFBH 3VDUA 5IWAH 4DR4H 4JI5H 2E5RA 1ODHA 2M6QA 2ERWA 2FNFX 4JVHA 3GKUA 1VBIA 1SGPI 2ENZA 1X4MA
chains in the Genus database with same CATH topology
1Z2IA 1XRHA 2CWHA 1WTJA 1NXUA 4FJUA 1V9NA 1S20A 2G8YA 4H8AA 1VBIA 4FJSA 1X0AA 2CWFA 2X06A 3I0PA 3UOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2I A;  1XRH A;  2CWH A;  1WTJ A;  1NXU A;  4FJU A;  1V9N A;  1S20 A;  2G8Y A;  4H8A A;  1VBI A;  4FJS A;  1X0A A;  2CWF A;  2X06 A;  3I0P A;  3UOE A; 
#chains in the Genus database with same CATH topology
 3RU0 A;  1WTJ A;  2M8W A;  1UVG A;  3VDP A;  2BUS A;  2ZM6 H;  4IFD G;  3UGI A;  1N36 H;  2PQ8 A;  4LF6 H;  2QQD A;  1AN1 I;  3TJQ A;  3JAM W;  4JI3 H;  1ULM A;  4E1P A;  3HH2 C;  4H8A A;  1K7U A;  1IBL H;  2JYY A;  4OO1 G;  2NU1 I;  4E9J A;  1WHR A;  1CT4 I;  2KMQ A;  4X62 H;  2QQE A;  1PTQ A;  2X52 A;  4WAL A;  1PCE A;  4NXM H;  4EC5 A;  3J7A K;  1IY5 A;  1FAR A;  4NZT M;  1MT1 A;  4B6D A;  2PY9 A;  1M8C A;  2J9R A;  2JEB I;  5E3Q A;  2SGQ I;  2B0U C;  3T1Y H;  1EC6 A;  4SGB I;  2VRW B;  2DGR A;  2K1H A;  1YU6 C;  1OVO A;  1RFH A;  2ENN A;  1S20 A;  2Z0S A;  4LFC H;  2SGF I;  1TUR A;  3OL0 A;  3QD7 X;  2GKR I;  4JI6 H;  1SGN I;  1LR8 A;  2HH2 A;  1DTJ A;  2CPQ A;  3E59 A;  1J5E H;  1N34 H;  2UUA H;  1I6U A;  2E3U A;  2UXB H;  2GKV A;  2UUB H;  2CWG A;  1HJA I;  5CCM A;  5E3R A;  2KMP A;  3FSX A;  5JEA G;  2UXC H;  4YHH H;  5FUV A;  1J4W A;  2CJS C;  1H0Z A;  4MPI A;  2HH3 A;  3UOE A;  2FMR A;  2KCX A;  2E73 A;  1UUC A;  1DT4 A;  3RF2 A;  1PJU A;  1N32 H;  2LB7 A;  1DS2 I;  1TOT A;  2GKT I;  1TBQ R;  3OXL A;  2SGP I;  3CXL A;  3SGQ I;  2CWH A;  5FUX A;  5IT9 W;  1R79 A;  2PQU A;  2NU0 I;  2BA0 A;  3OET A;  2Y0M A;  2CTM A;  4AML A;  1FAQ A;  3OXG A;  1N33 H;  1U5K A;  1MSZ A;  1I94 H;  1HDL A;  3OXF A;  3I0P A;  1TBR R;  2OZU A;  3KDK A;  4DR5 H;  2CTK A;  1CSO I;  1LR9 A;  5C0X G;  5EX0 A;  2F3C I;  2JA1 A;  4B3M H;  3UGL A;  2LUY A;  3TO7 A;  1CGI I;  1V1I A;  4NXN H;  4GI3 C;  2KMR A;  2N1A B;  2VQF H;  3AEV B;  2P2R A;  1OYV I;  1CHO I;  2X3T A;  1ZZJ A;  2L8E A;  3VKE A;  2QPO A;  9WGA A;  3NCV A;  4DUZ H;  4LIJ A;  1XMO H;  4DV3 H;  3OVO A;  2ROW A;  2CPM A;  4BA2 I;  1V9N A;  2GIV A;  3T1H H;  1SGQ I;  1CE3 A;  1ZTG A;  1LR7 A;  4UXJ A;  2JE6 I;  1MJB A;  3GR5 A;  1XNQ H;  1TGS I;  3OTO H;  2OPV A;  1FKA H;  1XA6 A;  4BA1 I;  1K7V A;  1FY7 A;  2A20 A;  2CTF A;  1ZZK A;  4X65 H;  3R5C A;  4JV5 H;  3D00 A;  2AXY A;  1OMU A;  2RC4 A;  1X74 A;  2UXD H;  4JI4 H;  1OMT A;  2UUC H;  4K0K H;  1ULK A;  5DAE A;  1KBF A;  2SGE I;  1K7T A;  5K36 G;  1V1H A;  1WGC A;  3VE5 A;  2B8T A;  3E2I A;  2SGD I;  1FJG H;  1IY6 A;  2CTE A;  4JI7 H;  3R5B A;  5FUW A;  1TBN A;  4DV2 H;  1HEV A;  4X64 H;  2MJH A;  3FAU A;  2NN6 G;  2BL5 A;  4LF8 H;  4B3S H;  4FJS A;  1ZZI A;  1CT2 I;  2HHH H;  4DR2 H;  1TIH A;  2YUU A;  1SGE I;  2P6A C;  2G8Y A;  5EX3 A;  1X9Z A;  2ANR A;  4JI1 H;  5DT9 A;  1WE8 A;  1WVN A;  2F4V H;  2V1C A;  2K9H A;  1MJA A;  2ORW A;  1N13 A;  3R5D A;  1HNZ H;  2UZ3 A;  2VKC A;  2LTL A;  1KHM A;  2WGC A;  2UU9 H;  2N52 A;  4JYA H;  4NBQ A;  1DS3 I;  4LF4 H;  7WGA A;  1YTP A;  2LTM A;  4G08 A;  2OU2 A;  2QQ0 A;  4OVO A;  2JA9 A;  4B3R H;  2LF0 A;  1IBK H;  3FSY A;  4LF5 H;  1SGR I;  1WKX A;  3EZJ A;  3TO6 A;  4DR7 H;  1FYB A;  2CWF A;  2GVI A;  1X4N A;  1UHA A;  3UFF A;  3B4V C;  4UXH A;  5FLX W;  2A1S A;  2WCY A;  2WVJ A;  2OVO A;  1Z2I A;  3UGD A;  3GOX A;  4UXI A;  2DKV A;  5FUY A;  2QQC A;  1KBE A;  2M5X A;  1W4R A;  2YQR A;  2JVZ A;  4JVY A;  2ARP F;  4E1R A;  4JI2 H;  4OCH A;  1TBO A;  1UG8 A;  1ULN A;  1P9G A;  2PT7 G;  4AIM A;  5LMN H;  2J87 A;  1W3S A;  1Y1C A;  2NU2 I;  4NZR M;  2NU4 I;  5JHW C;  2NU3 I;  1NUB A;  1BMO A;  1P9Z A;  3TOB A;  3GAB A;  5E3P A;  4B8T A;  1PTR A;  2ODD A;  1NXU A;  4DV0 H;  4LF9 H;  2XRC A;  2DB6 A;  3PDN A;  1CGJ I;  2OPU A;  5HI7 A;  2X06 A;  3OSS D;  3V69 A;  5A2Q W;  5LL6 b;  2UVO A;  1Y1B A;  3L7Z C;  2JZM A;  1CT0 I;  1S03 G;  2CTL A;  2V53 A;  2O4C A;  5J8C A;  1SGY I;  4A24 A;  3R5A A;  4OX9 H;  1WGT A;  4B3T H;  4DV5 H;  4LF7 H;  1M8B A;  2ANN A;  4GKJ H;  3TOA A;  3SGB I;  3FC3 A;  1BUS A;  3BJI A;  5LMU H;  4JI8 H;  3J80 W;  1X4S A;  2N71 A;  2V1C C;  1J5K A;  2N17 A;  1V8C A;  3QAH A;  4QMF B;  4HGU A;  1UVF A;  2FFM A;  4DV7 H;  4WAN A;  3QTL D;  4OD6 A;  1MJ9 A;  2VQE H;  1VIH A;  3UEY A;  2DIP A;  4B8C D;  4AQY H;  1Z7K B;  1XNR H;  5BR8 H;  1R0R I;  1XX6 A;  3QWP A;  3UEJ A;  2JW6 A;  1HNX H;  4DUY H;  2CTJ A;  2JXD A;  2LRR A;  4DV4 H;  1SEI A;  2ELI A;  4WP4 A;  5J8F A;  2FPH X;  4DV1 H;  1HNW H;  4FJU A;  4YY3 H;  4X66 H;  2ZQE A;  2YQP A;  4DNC A;  1HR0 H;  4GKK H;  4DV6 H;  4LFA H;  2RIJ A;  4JCV E;  1KMA A;  1VDD A;  2E5L H;  2OD1 A;  2W0T A;  3KY9 A;  3MEK A;  1AN7 A;  2D9I A;  4DR3 H;  4DR6 H;  1Y8F A;  3SEK C;  5CCL A;  1IW4 A;  1Q9B A;  1IBM H;  4KHP H;  4AM3 A;  1SGD I;  3TO9 A;  2JZX A;  1XRH A;  1F0X A;  2QND A;  1K1G A;  1X0A A;  4PDB A;  1XBT A;  2Y3M A;  3SB1 A;  4FKD A;  5HQ8 A;  3J81 W;  2JEA I;  1HPT A;  2L7X A;  2KMO A;  1TUA A;  2ORV A;  1PPF I;  2LEO A;  1XMQ H;  1TUS A;  4L9M A;  3KDG A;  4DR1 H;  4JI0 H;  3U1K A;  1VIG A;  1PQX A;  4LFB H;  3VDU A;  5IWA H;  4DR4 H;  4JI5 H;  2E5R A;  1ODH A;  2M6Q A;  2ERW A;  2FNF X;  4JVH A;  3GKU A;  1VBI A;  1SGP I;  2ENZ A;  1X4M A; 
#chains in the Genus database with same CATH homology
 1Z2I A;  1XRH A;  2CWH A;  1WTJ A;  1NXU A;  4FJU A;  1V9N A;  1S20 A;  2G8Y A;  4H8A A;  1VBI A;  4FJS A;  1X0A A;  2CWF A;  2X06 A;  3I0P A;  3UOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...