2A1SA

Crystal structure of native parn nuclease domain
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
430
structure length
391
Chain Sequence
MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into poly(A) binding and catalytic mechanism of human PARN
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Poly(A)-specific ribonuclease PARN
total genus 112
structure length 391
sequence length 430
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2a1sA01
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 2a1sA02
4E3SA 3MXIA 4ELTA 1T03A 3OYCA 4KPYA 1S1VA 2E6MA 4FJLA 4DS4A 2X6NA 1VSKA 1RT1A 3C94A 1S6PA 5DMRA 3CQ8A 1IKWA 1SKRA 4B9UA 1WSIA 1UA1A 3RWUA 2ZQBA 1RTHA 3OYLA 3DRRA 4DG1A 1BCOA 3NDKA 3PV8A 4E7KA 1RILA 3HJFA 4B8CA 3AV9A 5J1EA 4E1MA 1Q9XA 4KRFA 3AVIA 2HHTA 4OGCA 3V1RA 5FROA 3DLHA 4NYNA 4CHOA 2Z1IA 4CJEA 2ATQA 2B5JA 1HYZA 3OYNA 3C6TA 4B9MA 4HTUA 1SKSA 1K6YA 1VSLA 2I5JA 2HNYA 4AHRA 3MEDA 3QEIA 2X6SA 2EX3A 3O3FA 1U49A 3OYJA 4BDPA 3HO1A 4LH5A 2DY4A 3NGZA 1NK9A 2FBTA 2X78A 5HROA 4RW4A 4E0DA 3D45A 1IKVA 1HNIA 4HUGA 3A2FA 3P1GA 3TANA 4M3WA 1KTQA 3OYIA 1JLAA 3M8QA 1T05A 2ITGA 1SL2A 1C0TA 3ZSQA 3OYGA 2DTUA 4B9LA 3KD5E 4DFKA 3OYBA 1NKCA 3QESA 1KLMA 2G8KA 3IAYA 2HHSA 1L3VA 2HHVA 1NK6A 3AA4A 4NCBA 3NHGA 3K59A 2KZZA 4CJ3A 3RTVA 1RDCA 4Q5VA 3RR8A 1W0HA 3SQ4A 3NFAA 1BQMA 2D0CA 3PUFA 4O5BA 4KTZA 4AHSA 4JLHA 4CJWA 3SQ0A 3SZ2A 3V9XA 4FLTA 4JRPA 4GMJB 3RMBA 2HNZA 2YKNA 2PZSA 4FZXC 4OKKA 3TAEA 1QSYA 3AVMA 4E7IA 4E7HA 3AVKA 4CJVA 4AHCA 5CYMA 4C8LA 4DTPA 1T7PA 1NJXA 3AO1A 2RKIA 3NF8A 4PQUA 4OKEA 1U04A 3SUPA 4MQ3A 3SUQA 4F2SA 3CFOA 4FJKA 2GUIA 5T7BA 5I3UA 1N6QA 4FW1A 4JRQA 4J2DA 1LWFA 4KTQA 1ASWA 4FLYA 3HK2A 1CZBA 1TGOA 1RBTA 3PX4A 4BDZA 3DOKA 1C1CA 2R7YA 3ISNC 3KLEA 3AA5X 4BDYA 1F21A 1HRHA 4M3RA 2HHUA 1KVBA 4DS5A 1I39A 4DF8A 4AHVA 4DQRA 3TAGA 3EY1A 1KLNA 3CG7A 3LPUA 4Z4GA 1ZBLA 3NGYA 5C24A 3V9UA 3DI6A 4CIFA 1SKWA 1JLGA 2O4IA 4CF2A 3B6OA 4CEFA 4M41A 1NK7A 4M3XA 1TKDA 4HCCA 4NYFA 1O1WA 1VSDA 4DTJA 4YNQA 1BGXT 2YNHA 2YHBA 2VWKA 4PA1A 3VQ7A 3KK2A 4Z4EA 4CJTA 1FXXA 4KI6A 1LAWA 3VQDA 3S3NA 2OZMA 1JXEA 1CXUA 3WNFA 3L3VA 1SV5A 4CJSA 4HCBA 4N76A 4Y1CA 2HHWA 3MEEA 1REVA 3EYZA 4FXDA 3WNGA 5KGXA 4BWMA 4PWDA 1NOZA 1VK0A 4G1QA 4CJQA 1YTUA 4E1NA 2XY5A 1D5AA 1JL1A 3WNHA 4F3OA 2D0BA 5SWMA 3RMAA 1RBVA 3KKSA 3PY8A 4Q0BA 4E7JA 4CGJA 3AA2A 3OYEA 3L2QA 4F8RA 3VA0A 4GW6A 1C6VA 1DLOA 4B9NA 2Z1GA 3ZSOA 4ZHRA 1ASUA 4I2PA 4Z0UA 3SNNA 4FJ9A 2QXFA 3AVLA 3M8RA 3M8SA 4EZ6A 3AVCA 3U3YA 4I7FA 3PX0A 1TK5A 3K5MA 1RTJA 3K57A 1BL3A 2HHQA 1KFSA 3VQPA 4CHZA 4CEZA 3OYKA 3G0ZA 3M8PA 2BGGA 4R5PA 2VG7A 1HYSA 1NK5A 1LV5A 4CHNA 2O4GA 4DTSA 4FLUA 1RTIA 3NAEA 4NCAA 4K8ZA 5CZ1A 4RW9A 5J2PA 4M42A 4N56A 1IO2A 2VG6A 3MEGA 3AVFA 1HQEA 4CHPA 2XY6A 4DSIA 1EXQA 2P1JA 4CJFA 3TAFA 4Y1DA 3LALA 2F8TA 3CM6A 1S1TA 2IDOA 3ZT1A 1KSPA 1X9WA 4DFPA 3WNEA 4BE2A 1X9MA 2HMIA 4CJPA 4CE9A 3NH0A 3DM2A 4KI4A 1B9FA 1WSEA 2HB5A 3DLGA 3I0SA 1BIZA 3BGRA 3ZT4A 4IDKA 2VWJA 4DSFA 1JL2A 3QEWA 4C8KA 4I2QA 1UG8A 1S1UA 1NK4A 1B9DA 1TV6A 4KV8A 3PX6A 5C42A 4KHSA 2DFEA 3DLRA 4LSNA 4LH4A 4CGIA 4W5RA 4FLVA 1CXQA 1Z26A 3QIPA 3ZT2A 3OVNA 1WSFA 2FC0A 1J54A 4CECA 4DQQA 3RRHA 5JS2A 1U48A 2KW4A 4CEBA 4DTOA 4CF1A 1JLCA 5C25A 3QINA 1RT5A 3ULDA 1N5YA 2BDPA 1JLBA 5FDLA 3TWHA 3P83D 4C8NA 1RBSA 4FLWA 5HP1A 1TL3A 3HL8A 3L2UA 3CM5A 4DMNA 3V4IA 4CHYA 1U4BA 3T19A 1GOCA 2P51A 3AO3A 3ITHA 3L2VA 2IAJA 3ZSRA 3QEPA 1BI4B 1L5UA 1QSLA 1EX4A 4KREA 4CJ4A 3H08A 3TARA 3TR8A 4QOZB 1TK8A 1HNVA 1GOBA 2XRIA 4CFAA 4J2BA 3VQAA 4UQGA 3SYZA 1VRUA 1A5VA 3NE6A 4CJUA 4KFBA 4FLZA 2RF2A 4I9LA 1RBUA 4J2EA 1TAQA 4O0JA 4O4GA 1D9FA 5FRNA 4FYDA 4FJHA 3O4QA 3RMDA 3AVBA 3OS2A 2CPMA 3KLIA 4GVMA 3LZIA 3CYMA 4HUEA 4BE0A 2E4LA 3MAQA 4DTNA 2IGIA 3JSMA 4DSJA 1NOYA 4CF8A 1C0UA 4MFBA 1ITGA 3T3FA 4M3UA 2G8FA 2KFNA 1XHXA 1WSJA 2EHGA 3HP6A 3HVRA 4KHUA 3ZSWA 1QTMA 4CFCA 4DQPA 3SQ2A 3HPOA 3NF7A 3NGIA 2GV9A 4TSXA 2DFFA 3KK3A 3C6UA 3VQ9A 3V6DA 1RDBA 4CEDA 2FBVA 4O0IA 3DYAA 3QNOA 2Y1IA 4CCHA 1MSZA 4ZTFA 1C1AA 1XI1A 3V9ZA 3V1QA 3LP0A 1TK0A 1CLQA 3D0PA 1LAVA 4OLBA 5E41A 2G8HA 1QS4A 3QEVA 1WHRA 1W9HA 4EZ9A 1ZBFA 4CF0A 3V9WA 1C0MA 1I3AA 4HVJA 4FM0A 1LW2A 4RG8A 2HHXA 2DFHA 1TVRA 3L3UA 2HVIA 3OYMA 4B8AB 4DTUA 3L2RA 4FZZA 2VG5A 1DTQA 1YT3A 4W5OA 4F2RA 3IRXA 4J2AA 1TKTA 2XY8A 4FLXA 1TKZA 4Z4HA 4CJKA 1RTDA 1J53A 1LWCA 1VSIA 3MECA 4CK3A 3HPHA 1Z25A 1KVCA 4ZTJA 4LSLA 2G8VA 3B6PA 4KO0A 3FFIA 4FM2A 1FKOA 4DSEA 2X74A 5K14A 3NH1A 1CZ9A 2BE2A 5J2MA 4KTWA 3I8DA 4CEOA 4ID1A 1IG9A 2YNFA 3KJVA 4B9VA 4CGFA 2OPSA 5D3GA 3HT3A 1JLQA 3AVGA 1ZBIA 3V9SA 3DLKA 3EZ5A 4C8OA 3QO9A 5KGWA 4PY5A 3HPGA 3SPYA 5HBMA 1ZYQA 1RNHA 2Z1HA 4DTRA 2NUBA 4RW7A 1NK8A 1ZBHA 4M3ZA 4OPJA 3AVJA 3E01A 1WSHA 2Z1JA 4KB1A 4BE1A 2LSNA 4IBNA 2OA8A 1A5WA 1HQUA 2D0AA 5DK5A 3O3HA 3VQQA 3K5LA 4CK2A 2XY7A 3LANA 1QSSA 4N41A 4KHYA 1HYVA 3OYFA 3HM9A 2G8UA 4FJMA 1T8EA 3KLHA 1A5XA 2IS3A 3MXJA 3LWLA 2D5RA 3ZSYA 4JS4A 2IC3A 1WAFA 4QCLA 1BIUA 2ZE2A 1UOCA 1C1BA 3DRPA 4ELUA 4CEAA 2OPPA 3HYFA 4DU4A 4H4MA 3CFPA 1MU2A 1YTAA 4IG0A 4FZYA 3L2WA 4DF4A 4FK2A 5CYQA 3O3GA 5SZTA 2FBYA 4E19A 3LDSA 4B9TA 1RBRA 4RW8A 2KTQA 4M45A 4FJXA 2AJQA 1SUQA 1J5OA 1ASVA 3U6FA 4QAGA 3LP3A 2YKMA 3IG1A 1BQNA 3T1AA 5I42A 3SI6A 4PUOA 4CGDA 3TABA 1JLFA 3SV4A 2XO7A 3DMJA 3SJJA 4DQIA 4EP4A 1R0AA 1X9SA 3CFRA 1WLJA 4BACA 1Q9YA 1IKYA 1SL1A 4W5QA 3OS1A 4AH9A 3ZT3A 2OZSA 4FW2A 1NKBA 4NCGA 3OY9A 3KLFA 5KI6A 3SUNA 2QKKA 3DLBA 3LPTA 2PYLA 2QK9A 5HRNA 3KLGA 4YFUA 3GKUA 1JLEA 1IH7A 4O55A 4WE1A 3RRGA 2P5OA 4FJ8A 2LRRA 2XHBA 4DWIA 4DSLA 3L8BA 2PY5A 4FK4A 2WONA 2E6LA 1GOAA 4KHWA 2ZD1A 4M3YA 2JGUA 4CJ5A 3BDPA 1VSEA 2BANA 5EU7A 4HHTA 3V81A 1QQCA 3AA3A 3AVNA 2G8WA 4K8XA 2A1SA 3LP1A 4W5TA 1KVAA 1NKEA 4OLAA 1TAUA 4CFBA 4HUFA 4DQSA 5JS1A 3AO5A 1TL1A 3VN5A 5KRSA 4DLEA 2HW3A 3AO4A 4OKJA 4CF9A 1EP4A 2KZMA 3I0RA 4IKFA 1QE1A 1S1WA 2ETJA 3AO2A 4N5SA 3K2PA 1WAJA 5HRSA 3SCXA 4CESA 2PYJA 1RDAA 3VQ8A 1BHLA 3LZJA 5CY4A 3HXMA 5FRMA 1U47A 4BWJA 1RDDA 3C95A 1VSHA 3LAMA 4CHQA 3SQ1A 1S5JA 3G10A 4CGHA 3MXMA 3RR7A 4FJJA 2FBXA 4FJGA 1UWBA 2Y1JA 1L3UA 4IFYA 3VQEA 4IFVA 3QEXA 1Q8IA 2IOCA 4CIEA 4L8RB 3VQCA 1RCHA 3NF6A 3ZSZA 4AHUA 4CIGA 2YNIA 3VQ5A 4B08A 4DTMA 1NJZA 3S3OA 1EKEA 5J2NA 1G15A 4H8KA 1X1PA 4CERA 3S3MA 1S1XA 3F9KA 3ZT0A 4DFJA 5KTQA 1WSGA 3LAKA 2WOMA 1J9AA 3NF9A 2G8IA 3KD1E 4FK0A 1VSJA 3DRSA 1S9GA 2F96A 3OYAA 2HNDA 3TAPA 1RT4A 3V1OA 3QNNA 1RT2A 4FJIA 4DLGA 1QHTA 5HRPA 1VSFA 3DLEA 4B9SA 4IG3A 4FCYA 1YVUA 4KHNA 2KQ2A 4I9QA 3SUOA 1NK0A 4KB0A 1B92A 1LW0A 5KRTA 2RPIA 5HLFA 3QLHA 3QERA 1XC9A 4RW6A 3K58A 1FKPA 1KCFA 4DU1A 5HRRA 3TAQA 4DU3A 4W5NA 3PO5A 4DSKA 4M3TA 4FVMA 2YV0X 3UIQA 4F3TA 3OYHA 1JXBA 1LWEA 4CGGA 1SL0A 1DTTA 1KFDA 3KIOA 3QIOA 4E7LA 2OPQA 4KHQA 4OJRA 2OPRA 3HSTB 3KTQA 3THVA 2A1RA 3NBPA 3ZSXA 2RN2A 4OPKA 1WNSA 4KKOA 1HMVA 3ASMA 3VQ4A 4EP5A 1ZBUA 3JYTA 4DFMA 3K5NA 2HVHA 4CFDA 4O44A 2OYQA 4FJNA 4DTXA 3VA3A 1WN7A 4CK1A 4AILC 2P5GA 1RT3A 4CJRA 4H4OA 4OVLA 1EETA 4OGEA 3K5OA 1IKXA 3NCIA 3OYDA 2QKBA 2W42A 1S9EA 1RT6A 2JLEA 2YHAA 4CEQA 4FM1A 3S9HA 1KRPA 3F73A 3SPZA 4ELVA 4F4KA 1HJRA 4FJ5A 3OJSA 3AVAA 4Z4IA 5J2QA 4ID5A 1JKHA 1UA0A 1BISA 3VQ6A 1D8YA 1VSMA 1FK9A 1Y97A 2B6AA 1L3TA 4B3OA 1XHZA 5CZ2A 4LD0A 3DOLA 3ZCMA 4XIUA 4JS5A 3LP2A 4LY7A 3KK1A 3ALYA 4AHTA 1S6QA 1NJWA 2GBZA 3AVHA 4N47A 2KFZA 1VRTA 4KAZA 3TI0A 3HP9A 1UAXA 3P5JA 3SV3A 2B4JA 3ZSVA 4Z4FA 1BCMA 3O4NA 3VQBA 1D9DA 3NH2A 3OJUA 3KKRA 4Z4CA 1TKXA 3PO4A 3OS0A 2YNGA 3RMCA 4FJ7A 1NJYA 3U3GA 4CEEA 1HPZA 3IS9A 4C8MA 2F8SA 3LWMA 1BI4A 3QETA 1U45A 4ICLA 2Q3SA 1RT7A 3HVTA 3TAMA 1L3SA 4E89A 1XWLA 4CJLA
chains in the Genus database with same CATH superfamily
4CBXA 4KPYA 2E6MA 4DS4A 2X6NA 3KDKA 3CQ8A 3RWUA 1RTHA 3DRRA 3I56N 1BO5O 1RILA 4B8CA 4KRFA 3AVIA 4NB4A 4MLHA 4CHOA 2F4VK 3CF5L 4JI2K 4B9MA 2HHHK 3QEIA 2X6SA 3TSQA 5IT9W 4RW4A 1JCEA 3A2FA 3P1GA 4FWKA 2ITGA 1SL2A 1C0TA 2FFMA 3CCJN 2FSJA 3QESA 2LTLA 2HHVA 3AA4A 3J80O 3RR8A 4LC9B 2P9NB 4AHSA 4KTZA 4CJWA 4DR2K 3V9XA 4M7YA 4FLTA 4GMJB 3JAMW 3E9OA 1Q7YO 4E7HA 3VESA 1IBMK 4CJVA 4DUYH 4DTPA 1NJXA 1VQ5N 1ATNA 4BRIA 1NU0A 2JZXA 3SBTA 3SUQA 3CJ7A 4F2SA 3O6WA 4YOWA 2D4WA 4B3RK 4YOUA 1N6QA 2JWKA 1T6CA 2YQRA 2FSNA 4FW1A 4JRQA 2W6KA 4J2DA 1ASWA 1RBTA 3FFKB 3CI5A 3ISNC 3KLEA 2VWBA 4BDYA 1F21A 1HRHA 4DCHA 4DS5A 4DQRA 1KLNA 4Z4GA 1ZBLA 5GIOA 5C24A 2VQEK 1EWQA 4H03B 2YJFA 1NK7A 1XRHA 2GWKA 4B3MK 4NYFA 3O4WA 4A5BA 1BGXT 4FWQA 4CJTA 4K25A 2P9NA 4A62A 3SAFA 1SV5A 1X3MA 3EN9A 2NRTA 4EC5A 4BWMA 2CTJA 1NOZA 4G1QA 3RMAA 4LF8K 3PY8A 1RBVA 3AA2A 3OYEA 4HWIA 4GKJH 5JVHL 2RHKA 3CQXA 3K9JA 4FJ9A 2QXFA 3M8RA 3M8SA 2VGMA 4I7FA 1BL3A 3BUZB 3W3DA 1YHQN 1NMDA 4R5PA 1DGKN 1NK5A 4DTSA 1NBWA 3NAEA 1X4NA 4RW9A 4CD3A 3AVFA 4A2BA 4DSIA 1EXQA 2P1JA 5AQXA 3CM6A 5DM6L 2NRRA 1S03G 4OX9H 4BE2A 4KI4A 1B9FA 1WSEA 2KZMA 3I0SA 4C8KA 4IDKA 3ID8A 1S1UA 4G08A 1NK4A 2A6AA 4KV8A 3CCMN 5C42A 1K9MO 1VQ9N 4KHSA 2P9SB 5C12A 3DLRA 3CERA 4LSNA 4LH4A 4FLVA 1CXQA 3CMEN 4DR4H 4LF7K 4YOXA 2IVNA 3O9UA 5AQIA 3HSCA 5C25A 1RT5A 3FAUA 5EVZA 3P83D 3L0QA 3KWGA 3QB0A 1ILYA 1N36H 4C8NA 1RBSA 3HL8A 4KH5A 3CM5A 4DMNA 4E9JA 1W7AA 1GOCA 2P51A 3L2VA 4KREA 3GDQA 2IAJA 3ZSRA 3ZLJA 1BI4B 3MWPA 3SMSA 4FJSA 1GLFO 5C0XG 3AAQA 1HNVA 1GOBA 1T3VA 1TK8A 2WBNA 3LL3A 3H3NO 4UQGA 1KAXA 4O4GA 1D9FA 4BVPA 4FYDA 3KLIA 4BE0A 4DTNA 3SLCA 1NOYA 2JE6I 4M3UA 2G8FA 2QWMA 2KFNA 1XHXA 1N36K 5JLHA 1QTMA 4CFCA 4WALA 3CC4N 3NF7A 2GV9A 4TSXA 2OANA 2QWRA 1RDBA 3DYAA 3ZX2A 3KVGA 4B1YB 3CJ9A 1TK0A 3D0PA 4OLBA 5AFUA 2ZGZA 4EZ9A 1ZBFA 3THXA 4HVJA 2HHXA 4K41A 4IFDG 3L7ZC 4DTUA 4FZZA 3U1KA 3SB1A 1VQPN 4W5OA 3QMLA 4F2RA 3QICA 4LF9H 3ULEB 3J80W 1NJIO 4BC5A 1YF5L 2NRVA 4FLXA 4X64H 1TKZA 1VSIA 3NCVA 3MCPA 4BREA 1XC3A 3HPHA 2J4RA 1KVCA 3IMXA 4JKGA 4ZTJA 2G8VA 4FM2A 2X74A 4I6MB 5K14A 1CZ9A 2BE2A 2KHOA 4B9VA 2WTUA 4CGFA 2OPSA 3TPQA 1HNXH 2UXBH 2CH6A 1ZBIA 4JI4K 2UYTA 1VBIA 1I94K 3QO9A 5HBMA 1ZYQA 1RNHA 4CZIA 4RW7A 2CGLA 1NK8A 4BA2I 4M3ZA 1WTJA 1S3XA 4CZHA 5KQDA 2Z1JA 4IBNA 4H5WA 3K5LA 4KHYA 3VQQA 4N41A 4H5NA 1HYVA 2G8UA 5BN9A 5AQGA 2HMPA 3ZSYA 2A41A 4FWPA 1IBLH 4QCLA 4JI3K 4B3MH 2UU9K 1D4XA 3PSIA 4JD2B 4BR7A 3HYFA 3CFPA 1MU2A 3VEXA 5CYQA 3O3GA 1NGAA 1M1KO 3LDSA 3VEOA 5BN8A 4M45A 1J5OA 1ASVA 4QS9A 2UUAK 3IG1A 1BQNA 4PUOA 4DV2H 1JLFA 3DMJA 4EP4A 3T1HH 1WLJA 1SL1A 3OS1A 4IJNA 4GV3A 2NRWA 4CZJA 1N34H 4NCGA 3OY9A 5KI6A 1X0AA 5IWAK 2V7ZA 3LPTA 4LF4K 3CCRN 1HX1A 1X3NA 2OTJN 4K43A 2E1ZA 2WONA 4KHWA 1GOAA 1HNXK 4B1WB 2BANA 5EU7A 4HHTA 3LP1A 1NKEA 3KDGA 1SAZA 4HUFA 5JS1A 5KRSA 3AO4A 1EP4A 3PIPL 2ETJA 2PYJA 1RDAA 1QQNA 1U47A 3LM9A 3SQ1A 2UUBK 1XNQK 3LDNA 3M1FA 4CGHA 4DR1H 1UWBA 2Y1JA 3RSEA 3NVMA 3VQEA 1DT9A 2QNDA 4NO7A 5AQLA 2E88A 4CIEA 4WQ4A 1KQSM 3VQCA 3NF6A 4AHUA 2YNIA 4B08A 4BC2A 1NJZA 2YCHA 5J2NA 1G15A 3S3MA 2Q0UA 4DFJA 3ZT0A 3LAKA 2WOMA 3NF9A 2VGNA 4X65K 1T44A 2QWPA 1ATSA 1NG9A 2F96A 3FZKA 5HL7L 4A59A 3V1OA 4FJIA 1VSFA 3DLEA 4ILJA 4IG3A 4C1NK 1VQ4N 1YVUA 4F9OA 3OSSD 3G25A 1KC8O 2E8AA 3SUOA 3WUHA 1B92A 4RW6A 4B9QA 5HRRA 4EIAA 4DV0K 3OETA 4DSKA 3UIQA 4LFAH 3TSUA 1JXBA 3OHRA 1Q81O 1LWEA 1DTTA 1KFDA 3KIOA 3A5MC 3HBTA 3VMFB 2D1KA 2OPRA 5AFUH 4X65H 4BR0A 3KTQA 3VGKA 3NBPA 2RN2A 4WFAL 3MN7A 4DFMA 2YHYA 3JYTA 3K5NA 2OYQA 3RVCA 4DTXA 1WN7A 4AILC 1X9ZA 1RT3A 1EETA 3KK7A 2QWOA 3OYDA 2W42A 3M6GA 1OH5A 5AQUA 4LF6K 2P9PA 4WFNL 4AQYH 1L3TA 1FK9A 1Y97A 4YOYA 3K9KA 5BPNA 4A57A 1NXUA 1V4TA 5KPTA 3F5TA 1NGEA 3C6AA 2ANNA 3ALYA 3BZKA 1NJWA 4DR5K 2KFZA 1BDGA 2W6LA 3HP9A 3SV3A 4Z4FA 3VQBA 4DV6K 3NH2A 3KKRA 3OBWA 3KWIA 3PO4A 3OS0A 3HRGA 4LFBH 5BPLA 4ICLA 2QXLA 3VTHA 2QI2A 5BRDA 3P38A 4JI5H 1YUWA 3TAMA 4B9UA 1XWLA 4E3SA 3MXIA 2AA4A 3WXJA 1VSKA 4IEEA 1SKRA 1IKWA 4GKJK 4DG1A 3MN5A 3NDKA 3TTFA 2P9IB 4IOAL 1E3MA 3AV9A 1Q9XA 4E1MA 4OGCA 3V1RA 4NYNA 3H46O 4FJUA 4DV7K 2B5JA 3C6TA 1SKSA 2HBMA 1U49A 3UE5A 3HO1A 1NK9A 4JHDA 4RTFD 1NGBA 2FBTA 2X78A 4E0DA 1HNIA 3G4SN 3FR0A 1K73O 1KTQA 4BGBA 1JLAA 3WEEA 3J7ZO 2ASPA 2ZJRL 2DTUA 5CHIA 2E2PA 4DFKA 4NXMH 3IAYA 1KLMA 2G8KA 4YHHH 1L3VA 2A42A 3K59A 4JKDA 1W0HA 4FWOA 3SQ4A 4RWTA 3NFAA 2D0CA 3PUFA 4O5BA 2RE2A 5GAEP 4JVHA 3SQ0A 5BREA 1IBKK 2PZSA 4FZXC 5ADXH 3A8YA 3J81O 4PQUA 5CYMA 3CIPA 3AO1A 4OKEA 1U04A 4ISGA 1WB9A 4OCHA 2GUIA 4M63C 1X4MA 4ILGB 1BUPA 4CJ7A 4FLYA 5GADP 4BDZA 5AQFA 3DOKA 3G71N 2R7YA 1FJGK 1OH7A 4B3SH 5I9EB 1IBMH 2O8CB 4M3RA 2HHUA 4DF8A 3VGLA 3H3OB 3EY1A 1J6ZA 4BR2A 3J7AK 3H45C 2E5LK 2O4IA 4CF2A 1M90O 1TUYA 1TKDA 1O1WA 2YI1A 4DTJA 4YNQA 4FWSA 2YHBA 2VWKA 3KK2A 4Z4EA 2O8FA 1JCGA 3S3NA 2OZMA 1JXEA 3T1YH 1HJOA 2BUPA 3O80A 4N76A 4Y1CA 3MEEA 3R9PA 5KGXA 4IOCL 4E1NA 4X66K 1Z05A 1BWFO 1D5AA 2NRXA 4F3OA 1ESVA 5SWMA 4Q0BA 3KKSA 4CGJA 3L2QA 4F8RA 4IFEA 2CTKA 1C6VA 4DR7H 4B9NA 3ZSOA 4I2PA 1NNEA 3PX0A 1LCUA 2HHQA 3VPZA 3VQPA 5CE3A 4CEZA 4IEIA 2BGGA 3OW2M 4X62K 5AQHA 2PT7G 2UUBH 3T1YK 2UUCK 4N56A 1IO2A 3MEGA 3AARA 1HQEA 2GEMA 1S1TA 2IDOA 3A5NC 4DFPA 3WNEA 1K8KA 3NH0A 3DLGA 4AM3A 4BR9A 5LMNK 3VF2A 3O9SA 4JEPA 4DR7K 3ZEUB 4WFBL 1B9DA 2OCEA 3AEVB 3CJBA 2DFEA 1Y64A 3MN9A 3QFUA 4QS7A 4GKKK 3OVNA 4IO9L 1J54A 4DQQA 1IBLK 3QBWA 4DTOA 4WQ5A 4JAXA 1N5YA 5BR8K 4KHPH 1JLBA 2NNWA 5FDLA 3TTDA 2HBLA 2PBDA 3UB5A 3HOTA 4FLWA 4BA1I 1K8AO 5M1NA 3T19A 3QEPA 4DV6H 3LDPA 4JI6K 1QSLA 1L5UA 4BC3A 2W41A 5AQTA 3H08A 3R6MA 4CJ4A 3WXKA 2X06A 4QOZB 4J2BA 3NE6A 1Q82O 3GL1A 2FLOA 3ZETB 4I9LA 4WANA 1NGDA 3B8AX 2ASOA 4FJHA 3O4QA 2WUSA 1HPMA 4LFCH 1QHAA 1VQNN 4LFBK 4DV5K 2CTMA 4H5RA 3KZBA 1WSJA 2ZQEA 4JI5K 4OPHA 4KHUA 4DQPA 3NGIA 3KK3A 3V6DA 4O0IA 3FGUA 3VEZA 4CCHA 1MSZA 4JYAH 3LP0A 4YOVA 1LAVA 1QS4A 2O8EB 2NRZA 4A61A 4FM0A 1LW2A 3ATUA 4RG8A 3OYMA 1HLUA 3I0PA 2VCPA 2VG5A 3D2FA 3IDHA 1RTDA 4DUZH 4CK3A 4NXNH 1GLCG 3B6PA 4R79A 1WBBA 5J2MA 1HR0H 5LY3A 4KTWA 1IG9A 1XQSC 5BPMA 3HT3A 4LIJA 3AVGA 1BA1A 5GAGP 2DGRA 3EE8A 4H0XB 5KGWA 4PY5A 3SPYA 4AF1A 1VQON 4DTRA 2NUBA 2H3GX 3E9LA 3CCSN 3AVJA 3E01A 4JKFA 4DV3K 1WSHA 1A5WA 3O3HA 4M3XA 2XY7A 3LANA 3DXKA 3OYFA 3HM9A 4FJMA 3L6QA 2YHXA 3KLHA 3LWLA 3MXJA 2D5RA 1WAFA 1UOCA 4XH1A 1IV0A 3DRPA 4ELUA 4H4MA 3P4IA 4DF4A 4JKEA 3SAHA 3TTCA 4B3TK 2FBYA 2E3UA 4E19A 4LF5K 4NLCA 2E5LH 3GE1A 4FJXA 4AM6A 4B1ZA 2AJQA 4NBQA 3P39A 3LP3A 5AQKA 4PKHA 2XO7A 2FMRA 3MN6A 1Q9YA 1IKYA 2OZSA 4AH9A 3ZT3A 2YX6A 3D6RA 3O1WA 1NKBA 1OKJA 5AQOA 3SUNA 4V19S 2CTFA 2PYLA 3GKUA 4YFUA 1JLEA 3EL2A 4FSVA 3T7ZA 3RRGA 2P5OA 2LRRA 4DR3H 2E2QA 2XHBA 4DWIA 1DKGD 3L8BA 4BG8A 2PY5A 4FK4A 4M3YA 2ZD1A 4XEIA 4NZRM 3BDPA 3OBYA 2G8WA 4K8XA 4QMFB 4CFBA 4DQSA 3VF6A 4DLEA 3FZHA 1QE1A 4N5SA 3K2PA 1WAJA 3VQ8A 5CY4A 5DT9A 1E4GT 3C95A 2UUCH 3G10A 3FZMA 3MXMA 3WQUA 2FBXA 4FJGA 1Q8IA 4DTMA 1RCHA 3ZSZA 4CIGA 2CGJA 1G99A 4H5VA 1X1PA 4YORA 2IIRA 3RSEB 3KD1E 4CZEA 4FK0A 1S9GA 3OYAA 4YDUA 1RGIA 4H0VB 2ITMA 4DLGA 5AQQA 1GLJO 2UUAH 1N32H 4FCYA 2Q31A 4JI0H 3H1VX 3G6EN 3N4QA 3MK6A 4DV4K 3MWTA 3QERA 2VQEH 1FKPA 1KCFA 3UKRB 2Q2RA 4DR2H 4W5NA 1ZZJA 4M3TA 2YV0X 1SL0A 1VAZA 4CZGA 4E7LA 4WF9L 4IXCA 2OPQA 2QTDA 3ENOA 3UKUB 1RFQA 1Q18A 3HSTB 4WYBA 3THVA 3ZSXA 2A1RA 1WNSA 5AQVA 4B3RH 3K0SA 1HMVA 3ASMA 1I6UA 2CH5A 3JAMO 2HVHA 4FJNA 2VYPA 4LFCK 4DUYK 1HKCA 3TSPA 4CJRA 4OGEA 5JICA 3K5OA 3MX2A 1IKXA 3NCIA 4OD6A 2YHAA 4FM1A 1KRPA 4F4KA 4FJ5A 3A0IX 3MX5A 3AVAA 2W40A 3VETA 5EOYA 1UA0A 3VQ6A 1D8YA 2B6AA 4B3OA 1J5KA 3CETA 4QS8A 4AHTA 1BOTO 1S6QA 3BEXA 1YI2N 2HF3A 1HNZH 3ZX3A 3CQYA 3TI0A 1VQ8N 4ISEA 4I6MA 2B4JA 3MMVA 2BL5A 3O4NA 1D9DA 4BQZA 3N4PA 4Z4CA 1TKXA 2UXDK 3RMCA 1ZBSA 3LWMA 4DV5H 3QETA 4NLBA 3HVTA 1F0XA 1L3SA 1QQOA 4HTUA 4BR4A 4ELTA 1T03A 2M8WA 1S1VA 4LF7H 4FJLA 5LMUH 3C94A 2F4VH 2E2NA 1S6PA 1UA1A 2ZQBA 4BRNA 2FXUA 4FWMA 3PLAA 3ENBA 5FPEA 1BCOA 2I7NA 1VQLN 3PV8A 4E7KA 4BRLA 3HJFA 4IJAA 2JEAI 2HHTA 3DLHA 3HZ6A 4BRCA 2BTFA 4GVEA 1HYZA 4K42A 1XUPO 1VSLA 4H0OA 2EX3A 3O3FA 4BDPA 3OYJA 1WBDA 4PL8A 2GELA 5HOOA 1IKVA 4JI1K 2ZM6H 1MWMA 3VKEA 2YJEA 4HUGA 2D0OA 3M8QA 4DV7H 2O8EA 4DQ8A 5K36G 5EX5A 5LJVA 3OYBA 2HHSA 3BF1A 3Q7BA 4KH4A 3NHGA 2KZZA 1RDCA 2HBJA 2PQUA 4OO1J 4B3TH 4BRPA 4BRGA 3THWB 4JLHA 3QBXA 3SZ2A 4A5AA 5ADXA 2HNZA 2YKNA 4OKKA 3TAEA 1QSYA 4FL9A 3AVKA 1T7PA 3NF8A 1YVNA 3SUPA 4DHYA 4JK8A 1HNWH 3CFOA 1BG3A 2VQFH 4BG9A 4K0KH 2FPHX 3VOVA 3PX4A 5C2DA 1C1CA 3ZYYX 3VF4A 5GAHP 3U9ZA 3VTIA 5AQMA 1GLAG 3TAGA 1QZ5A 2E1YA 3LPUA 5ELZA 4JI8H 4CIFA 5LL6Z 2NZTA 1JLGA 3B6OA 3LDQA 4M41A 5AZJB 1VSDA 4PA1A 3VQ7A 1S72N 2I7PA 2YHWA 5GINA 3VQDA 3WNFA 2P9SA 3L3VA 2HHWA 4CJSA 3F9MA 3WNGA 3CJCA 4PWDA 4CJQA 1YTUA 4UY8O 2XY5A 1GLLO 2F9WA 5AQRA 4BVOA 1DLOA 3F2KA 3UOEA 1IJJA 1ASUA 4Z0UA 2ZF5O 4O8KA 2LF0A 4JKBA 1KFSA 3OYKA 4PKGA 3G0ZA 3M8PA 5H1SQ 3CCUN 2UU9H 4JKGB 4CZKA 1LV5A 4CHNA 2P9IA 1RTIA 4NCAA 3QD7X 1NGCA 1EQYA 1Q86O 5CZ1A 3PSFA 5J2PA 3D2EB 3GBTA 2XY6A 3TAFA 2F8TA 1KSPA 4DB3A 3ZT1A 1X9WA 2EWSA 1X9MA 2HMIA 4CJPA 4CE9A 3DM2A 4MO5A 5AZJA 2HB5A 4E1JA 3SJHA 1UG8A 4I2QA 4IOXA 1TV6A 3CMAN 3PX6A 4WQ5C 4CGIA 1NGHA 3BF3A 3ZT2A 2GX9A 4CECA 3RRHA 4JI0K 5JS2A 1JLCA 3QINA 3SBGA 2BDPA 4BRAA 3TWHA 1S22A 4EHTA 3WT0A 3UKUA 1WUAA 3L2UA 3PIOL 1U4BA 3ITHA 3MCAB 1ZZKA 3TARA 1U2VB 2F7TA 4BRFA 3NMUA 2XRIA 4CFAA 4U7BA 3I55N 5IT9O 1ODHA 1A5VA 1IG8A 4H8AA 1TYQA 4M7XA 2RF2A 1RBUA 4PHTX 4O0JA 5FRNA 5AQPA 3RMDA 4FOEA 2MJHA 3AVBA 2ZJPL 2CPMA 1R59O 3LZIA 5LMUK 4HUEA 2E4LA 4MDBA 3V69A 2IGIA 3JSMA 4CF8A 1YAGA 1C0UA 3T3FA 1ITGA 3CJ1A 4KBOA 3CJAA 5EY4A 3HP6A 3ZSWA 1WE8A 5IWAH 2JA9A 3VQ9A 5AQWA 1NLVA 4CEDA 2Y1IA 4DR3K 2JVZA 3IKMA 3J81W 3V1QA 3UKRA 3R8EA 1CLQA 3FE1A 3L4IA 5E41A 2G8HA 1W9HA 3H6EA 1SEIA 3KHYA 3V9WA 1NGIA 1I3AA 2HVIA 4DV0H 1TVRA 3L3UA 4B8AB 3VERA 1OVYA 4MO4A 2O8DB 1T6DA 1FJGH 3ID6A 3DJCA 4YHHK 1X9JA 5FPNA 2KLAA 4J2AA 4Z4HA 5M1PA 1J53A 3MECA 3DLLL 1TYQB 5E84A 2QK9A 1IBKH 3NH1A 1GLEG 2Z0SA 3I8DA 4CEOA 5JEAG 2A3ZA 2YNFA 3KJVA 5D3GA 1JLQA 1ZTGA 4CBUA 3EZ5A 4C8OA 3CD6N 1ZBHA 1HKGA 5LL6b 1BA0A 3CC2N 3C7NB 4JNEA 4KB1A 2OA8A 4B8CD 1HQUA 2D0AA 4CK2A 2NLXA 5AQNA 1T8EA 2IS3A 2VKCA 2ANRA 1XMQH 4JS4A 4JV5H 5AQSA 2ZE2A 4JYAK 4CEAA 2GUPA 4JVYA 4FZYA 2QM1A 1H1VA 1N8RO 1E4FT 3I8BA 5C0YA 4PL7A 3VGMA 1V8CA 4B9TA 4LF6H 4QAGA 2YKMA 1MDUB 3TABA 4XH5A 4DQIA 3SV4A 1KD1O 2CWFA 3SJJA 1R0AA 3CFRA 1K1GA 2P9LA 3W0LA 2O8BB 4FW2A 3KLFA 2A5XA 2QKKA 3CPEA 5C15A 5HRNA 3KLGA 1IH7A 2QW9A 3WQTA 4O55A 4WE1A 5LJWA 4FJ8A 2Q36A 2JGUA 3DXKB 1VSEA 4FO0A 3AA3A 1TAUA 3SAGA 2A1SA 3AO5A 1NM1A 2HW3A 4PDBA 4CF9A 3I0RA 1AN7A 4IKFA 1S1WA 2V51B 2JEBI 4ILHA 3SCXA 1KXPA 4CESA 5LMNH 1BHLA 3LZJA 5JVGL 3HXMA 5FRMA 2QWLA 3OTOH 4BWJA 3LAMA 5FLXO 1VSHA 4LF9K 1S5JA 3RR7A 3THXB 3DXMB 3NVKA 3AGRA 4AIMA 4DV1K 1WVNA 3D2EA 4NZTM 4EFHA 5FPDA 3ULEA 2FF6A 4CERA 1S1XA 4HTLA 4CBWA 1J9AA 3CHWA 1VQKN 3DRSA 2D0PA 2ZM6K 3TAPA 1RT4A 3GOIA 1RT2A 4K8ZA 4B3SK 3I33A 4ISFA 3THYB 4KHNA 3M3ZA 1KAZA 3GABA 5KRTA 2RPIA 1SZ2A 5HLFA 3QLHA 1XC9A 1OH8A 3WXIA 4C23A 3TAQA 2CPQA 1O13A 4B1XB 3DWLA 2FSKA 1Z2IA 1J5EK 4CGGA 3QIOA 4OJRA 4IO8A 5F2RA 4OPKA 4KKOA 1VIHA 4JK9A 4EHUA 4EP5A 3LDOA 2OPUA 1ZBUA 1P90A 4OX9K 3U4LA 4CFDA 4O44A 4LFAK 1ATRA 4CZFA 4CK1A 4B1UB 3OTOK 1RDWX 4H4OA 1OVQA 1DT4A 3D7EO 1KAYA 5B8HA 3ZETA 1W97L 4CEQA 4O8UA 4Z4IA 5KPZA 3SPZA 1HJRA 3OJSA 4YY3K 5J2QA 2ZWHA 4DR4K 4ID5A 1JKHA 4WQ4C 1BISA 3A5OC 3THYA 1J5EH 1XHZA 5CZ2A 4LD0A 3ZCMA 5M1OA 5DM7L 4JS5A 4BR5A 3LP2A 4LY7A 3AY9A 4N47A 1YJ9N 1ZXOA 4GY2B 1UAXA 3P5JA 1V4SA 3ZSVA 3U9DA 4FJ7A 2M6QA 1WOQA 1XMOK 4C8MA 2F8SA 4MDAA 1TUAA 5M1FA 1RT7A 2PFUA 3BY5A 4E89A 3ZSQA 1VRTA 3SQ2A 1RDUA 2DPNA 3OYCA 5DMRA 1RT1A 2Y3MA 4CZMA 4IZ9A 2WFBA 1WSIA 5AQZA 5EXWA 3R3LA 3OYLA 3FZFA 4DV2K 4CI6A 3VEWA 3VEYA 4B1VA 5J1EA 2HBKA 2BA0A 1N34K 5FROA 4U67L 3CCVN 1ZC6A 1FKAH 2Z1IA 4CJEA 2ATQA 2F9TA 3OYNA 1V9NA 1K6YA 2I5JA 4H0PA 2HNYA 4AHRA 3MEDA 2DY4A 1EC6A 4LH5A 3NGZA 3QFPA 5HROA 2HH3A 5JMVA 3D45A 1NMNA 3SK3A 3TANA 4YY3H 4M3WA 3OYIA 1T05A 5TKWA 2Q1NA 3OYGA 3IFRA 4FPBA 4B9LA 1YJWN 3KD5E 4GKKH 1NKCA 3M5RA 3ATVA 1NK6A 4NCBA 4CJ3A 3RTVA 4Q5VA 4X64K 1SS6A 1BQMA 4WCEL 3JS6A 3O5BA 4JRPA 3RMBA 3O08A 3AVMA 4E7IA 1VQ6N 4GV9A 4G9ZA 4AHCA 4BC4A 4C8LA 5A2QW 3O8MA 2RKIA 3RF2A 4MQ3A 2GWJA 4FJKA 2O8CA 5T7BA 5I3UA 2CGKA 3LM2A 1LWFA 4KTQA 3HK2A 1CZBA 1TGOA 2LTMA 4H0TB 3AA5X 3SMPA 3R1XA 4FWLA 1KVBA 3IUCA 1I39A 1NWKA 4AHVA 3C0BA 2UXCH 3CG7A 3C6HA 3NGYA 2V7YA 3V9UA 3DI6A 1SKWA 4K0KK 4DR6H 4B8TA 4CEFA 1HR0K 5AR0A 3A5LC 4HCCA 4DV1H 1JCFA 1N33H 2YNHA 1XNRK 2QWNA 3CCEN 1FXXA 4KI6A 1LAWA 4O5FA 1CXUA 3E9PA 4BRMA 5E26A 4HCBA 3MDQA 1REVA 3EYZA 4FXDA 1VK0A 1GLBG 3JXUA 2BH1A 4FOIA 1JL1A 3WNHA 2D0BA 3BZCA 4E7JA 5M1QA 5C2FA 2P9UB 4GW6A 3VA0A 3DXMA 2O8DA 2Z1GA 4ZHRA 4OO1G 3SNNA 1P8ZA 3AVLA 4DKWA 4EZ6A 3AVCA 3U3YA 2UXCK 1TK5A 3K5MA 1RTJA 3K57A 1HUXA 4CHZA 3CCQN 2VG7A 4H5TA 2PY9A 1HYSA 3BP8A 4JI2H 2O4GA 2P9PB 4FLUA 4JKAA 4M42A 2VG6A 2K1HA 3DAWA 4CHPA 4CJFA 4Y1DA 3LALA 4CW7B 5FPMA 2CTLA 4BQLA 1NK0A 4DSFA 1VIGA 3TU5A 1BIZA 3BGRA 3ZT4A 2VWJA 3QEWA 2AXYA 1JL2A 2O8BA 4MLEA 5A2QO 1VQMN 4GV6A 4JI8K 1YJNN 1YXQA 2QWQA 5KPRA 3P31A 4W5RA 4LF4H 1Z26A 3QIPA 4NXMK 5AZIB 1WSFA 2FC0A 1U48A 4IDHA 4JV5K 2KW4A 4CEBA 4CF1A 2AP1A 3ULDA 4EAHD 2NRHA 1J4WA 3FLCO 5HP1A 1TL3A 4PKIA 3V4IA 2P9KB 4CHYA 3AO3A 1EX4A 2IVPA 2QA4N 4JI7K 1XMOH 3TR8A 2NN6G 1MA9B 2E2OA 3VQAA 3SYZA 1VRUA 4CJUA 4KFBA 4FLZA 2UXBK 4J2EA 3WXLA 4JK7A 1TAQA 4A2AA 1I94H 3OS2A 4GVMA 2WC9A 3CYMA 3FZLA 3LDLA 2HH2A 3MAQA 4DSJA 3WEEB 4MFBA 1OH6A 3AAPA 2HF4A 5GIPA 3CCLN 2EHGA 3HVRA 3S41A 4J8FA 2OTLN 5JLFA 3HPOA 2DFFA 3C6UA 2FBVA 4XH4A 3QNOA 3C7NA 4ZTFA 5AZIA 1C1AA 1XI1A 3V9ZA 1CZAN 1QVFM 4LF8H 5AQYA 2GTDA 4YOTA 4RCHA 3O1BA 1HKBA 3D2FB 3EKUA 3QEVA 1WHRA 4CF0A 1C0MA 2DFHA 4AM7A 2VQFK 4AQYK 4CVNE 3L2RA 1DTQA 1YT3A 1C0GA 2P9UA 3IRXA 1U6ZA 1PQXA 1TKTA 2XY8A 4CJKA 1LWCA 3C65A 1Z25A 4X62H 4LSLA 4F3TA 4KO0A 3FFIA 4BROA 1FKOA 4DSEA 4ID1A 4DV3H 1NGFA 3ZX0A 2OPVA 3V9SA 3DLKA 3HPGA 1TUUA 4NXNK 3J8AA 2Z1HA 5AJ3K 2HHHH 3T69A 4OPJA 1DEJA 5CR4A 4BE1A 3T1HK 2LSNA 5DK5A 1QSSA 4KHPK 5BR8H 3H1QA 1QZ6A 4DR1K 4LF5H 1A5XA 2E20A 4KH6A 2IC3A 2UXDH 1BIUA 1QVGM 1C1BA 2ZJQL 2OPPA 4DU4A 1YTAA 4IG0A 3L2WA 3EZWA 4FK2A 4FPAA 3O9RA 3QDKA 5SZTA 5AQJA 5BRHA 1RBRA 4RW8A 2KTQA 1XMQK 1SUQA 4OPAA 3U6FA 1U2VA 3T1AA 5I42A 2V52B 3SI6A 4CGDA 3GR5A 4FWRA 1ZZIA 1X9SA 4BACA 2QEXN 4GNIA 3ZEUA 3HI0A 4W5QA 5TKYA 3DLBA 4BY9C 4H0YB 3O9TA 1FW6A 4DSLA 1KHMA 4FWNA 4Y0WA 2KKZA 2E6LA 1Z6RA 5FLXW 4CJ5A 1HNZK 3V81A 1QQCA 3AVNA 4OLAA 3GG4A 4W5TA 1KVAA 1C0FA 2IVOA 4C1NI 2Q0RA 1TL1A 3VN5A 5BR9A 2D9IA 3OA9A 4OKJA 1QQMA 3AO2A 5HRSA 1NGJA 3CC7N 1XNRH 3ENHA 2A40A 4JKHA 2HSTA 2JWLA 1RDDA 4CHQA 3EZJA 5F1XA 1NGGA 3THWA 4FJJA 3HOSA 4Z94A 1L3UA 4IFYA 4IFVA 3QEXA 4L8RB 2IOCA 5BRFA 3VQ5A 1N32K 2FF3B 3J7YP 3EEQA 4JN4A 3S3OA 1EKEA 4H8KA 5M1KA 5MLCQ 3F9KA 3VEVA 5KTQA 1WSGA 1EWRA 4DUZK 2G8IA 1DTJA 4DV4H 2O8FB 1VSJA 4JI4H 2HNDA 4JKCA 4L3QA 3QNNA 4YDUC 1QHTA 5HRPA 1S20A 4B9SA 2KQ2A 4I9QA 4JI7H 3J7AP 4KB0A 1LW0A 2CTEA 1SQKA 5F0XA 4JI1H 3E1YA 3K58A 2ZGYA 4DU1A 4BRKA 1BU6O 4DU3A 2P2RA 3E66A 3PO5A 3U8XA 3O9QA 4FVMA 3OYHA 1JJ2M 4BRDA 4KHQA 1W2BM 2O4CA 1MWKA 4DR5H 1LOTB 2P9KA 3WXMB 1YIJN 3VENA 2CWHA 3L4QA 3VQ4A 4BRQA 4X66H 4JI3H 4JD2A 1GLDG 4IWVA 1EO1A 3HM8A 3VA3A 2HOEA 4FVUA 2P5GA 3CPWM 1HNWK 4OVLA 5C10A 2ASMA 2QKBA 3EKSA 1S9EA 1RT6A 2JLEA 3CXCM 3S9HA 3F73A 4BGAA 4ELVA 3AGKA 5KQ8A 1VHXA 3EO3A 4CD1A 1VSMA 2P9LB 3DOLA 4BRHA 4JHDB 4XIUA 1N33K 3KK1A 2GBZA 1YITN 3AVHA 1K8KB 2G8YA 4KAZA 4DR6K 4CZLA 3HTVA 1BCMA 3OJUA 4JI6H 2Q97A 2PAVA 3EE9A 2YNGA 1NJYA 3U3GA 4CEEA 1HPZA 3IS9A 1BI4A 1U45A 3Q7CA 2Q3SA 1VQ7N 1XNQH 4CJLA
chains in the Genus database with same CATH topology
4E3SA 3MXIA 4ELTA 1T03A 3OYCA 4KPYA 1S1VA 2E6MA 4FJLA 4DS4A 2X6NA 1VSKA 1RT1A 3C94A 1S6PA 5DMRA 3CQ8A 1IKWA 1SKRA 4B9UA 1WSIA 1UA1A 3RWUA 2ZQBA 1RTHA 3OYLA 3DRRA 4DG1A 1BCOA 3NDKA 3PV8A 4E7KA 1RILA 3HJFA 4B8CA 3AV9A 5J1EA 4E1MA 1Q9XA 4KRFA 3AVIA 2HHTA 4OGCA 3V1RA 5FROA 3DLHA 4NYNA 4CHOA 2Z1IA 4CJEA 2ATQA 2B5JA 1HYZA 3OYNA 3C6TA 4B9MA 4HTUA 1SKSA 1K6YA 1VSLA 2I5JA 2HNYA 4AHRA 3MEDA 3QEIA 2X6SA 2EX3A 3O3FA 1U49A 3OYJA 4BDPA 3HO1A 4LH5A 2DY4A 3NGZA 1NK9A 2FBTA 2X78A 5HROA 4RW4A 4E0DA 3D45A 1IKVA 1HNIA 4HUGA 3A2FA 3P1GA 3TANA 4M3WA 1KTQA 3OYIA 1JLAA 3M8QA 1T05A 2ITGA 1SL2A 1C0TA 3ZSQA 3OYGA 2DTUA 4B9LA 3KD5E 4DFKA 3OYBA 1NKCA 3QESA 1KLMA 2G8KA 3IAYA 2HHSA 1L3VA 2HHVA 1NK6A 3AA4A 4NCBA 3NHGA 3K59A 2KZZA 4CJ3A 3RTVA 1RDCA 4Q5VA 3RR8A 1W0HA 3SQ4A 3NFAA 1BQMA 2D0CA 3PUFA 4O5BA 4KTZA 4AHSA 4JLHA 4CJWA 3SQ0A 3SZ2A 3V9XA 4FLTA 4JRPA 4GMJB 3RMBA 2HNZA 2YKNA 2PZSA 4FZXC 4OKKA 3TAEA 1QSYA 3AVMA 4E7IA 4E7HA 3AVKA 4CJVA 4AHCA 5CYMA 4C8LA 4DTPA 1T7PA 1NJXA 3AO1A 2RKIA 3NF8A 4PQUA 4OKEA 1U04A 3SUPA 4MQ3A 3SUQA 4F2SA 3CFOA 4FJKA 2GUIA 5T7BA 5I3UA 1N6QA 4FW1A 4JRQA 4J2DA 1LWFA 4KTQA 1ASWA 4FLYA 3HK2A 1CZBA 1TGOA 1RBTA 3PX4A 4BDZA 3DOKA 1C1CA 2R7YA 3ISNC 3KLEA 3AA5X 4BDYA 1F21A 1HRHA 4M3RA 2HHUA 1KVBA 4DS5A 1I39A 4DF8A 4AHVA 4DQRA 3TAGA 3EY1A 1KLNA 3CG7A 3LPUA 4Z4GA 1ZBLA 3NGYA 5C24A 3V9UA 3DI6A 4CIFA 1SKWA 1JLGA 2O4IA 4CF2A 3B6OA 4CEFA 4M41A 1NK7A 4M3XA 1TKDA 4HCCA 4NYFA 1O1WA 1VSDA 4DTJA 4YNQA 1BGXT 2YNHA 2YHBA 2VWKA 4PA1A 3VQ7A 3KK2A 4Z4EA 4CJTA 1FXXA 4KI6A 1LAWA 3VQDA 3S3NA 2OZMA 1JXEA 1CXUA 3WNFA 3L3VA 1SV5A 4CJSA 4HCBA 4N76A 4Y1CA 2HHWA 3MEEA 1REVA 3EYZA 4FXDA 3WNGA 5KGXA 4BWMA 4PWDA 1NOZA 1VK0A 4G1QA 4CJQA 1YTUA 4E1NA 2XY5A 1D5AA 1JL1A 3WNHA 4F3OA 2D0BA 5SWMA 3RMAA 1RBVA 3KKSA 3PY8A 4Q0BA 4E7JA 4CGJA 3AA2A 3OYEA 3L2QA 4F8RA 3VA0A 4GW6A 1C6VA 1DLOA 4B9NA 2Z1GA 3ZSOA 4ZHRA 1ASUA 4I2PA 4Z0UA 3SNNA 4FJ9A 2QXFA 3AVLA 3M8RA 3M8SA 4EZ6A 3AVCA 3U3YA 4I7FA 3PX0A 1TK5A 3K5MA 1RTJA 3K57A 1BL3A 2HHQA 1KFSA 3VQPA 4CHZA 4CEZA 3OYKA 3G0ZA 3M8PA 2BGGA 4R5PA 2VG7A 1HYSA 1NK5A 1LV5A 4CHNA 2O4GA 4DTSA 4FLUA 1RTIA 3NAEA 4NCAA 4K8ZA 5CZ1A 4RW9A 5J2PA 4M42A 4N56A 1IO2A 2VG6A 3MEGA 3AVFA 1HQEA 4CHPA 2XY6A 4DSIA 1EXQA 2P1JA 4CJFA 3TAFA 4Y1DA 3LALA 2F8TA 3CM6A 1S1TA 2IDOA 3ZT1A 1KSPA 1X9WA 4DFPA 3WNEA 4BE2A 1X9MA 2HMIA 4CJPA 4CE9A 3NH0A 3DM2A 4KI4A 1B9FA 1WSEA 2HB5A 3DLGA 3I0SA 1BIZA 3BGRA 3ZT4A 4IDKA 2VWJA 4DSFA 1JL2A 3QEWA 4C8KA 4I2QA 1UG8A 1S1UA 1NK4A 1B9DA 1TV6A 4KV8A 3PX6A 5C42A 4KHSA 2DFEA 3DLRA 4LSNA 4LH4A 4CGIA 4W5RA 4FLVA 1CXQA 1Z26A 3QIPA 3ZT2A 3OVNA 1WSFA 2FC0A 1J54A 4CECA 4DQQA 3RRHA 5JS2A 1U48A 2KW4A 4CEBA 4DTOA 4CF1A 1JLCA 5C25A 3QINA 1RT5A 3ULDA 1N5YA 2BDPA 1JLBA 5FDLA 3TWHA 3P83D 4C8NA 1RBSA 4FLWA 5HP1A 1TL3A 3HL8A 3L2UA 3CM5A 4DMNA 3V4IA 4CHYA 1U4BA 3T19A 1GOCA 2P51A 3AO3A 3ITHA 3L2VA 2IAJA 3ZSRA 3QEPA 1BI4B 1L5UA 1QSLA 1EX4A 4KREA 4CJ4A 3H08A 3TARA 3TR8A 4QOZB 1TK8A 1HNVA 1GOBA 2XRIA 4CFAA 4J2BA 3VQAA 4UQGA 3SYZA 1VRUA 1A5VA 3NE6A 4CJUA 4KFBA 4FLZA 2RF2A 4I9LA 1RBUA 4J2EA 1TAQA 4O0JA 4O4GA 1D9FA 5FRNA 4FYDA 4FJHA 3O4QA 3RMDA 3AVBA 3OS2A 2CPMA 3KLIA 4GVMA 3LZIA 3CYMA 4HUEA 4BE0A 2E4LA 3MAQA 4DTNA 2IGIA 3JSMA 4DSJA 1NOYA 4CF8A 1C0UA 4MFBA 1ITGA 3T3FA 4M3UA 2G8FA 2KFNA 1XHXA 1WSJA 2EHGA 3HP6A 3HVRA 4KHUA 3ZSWA 1QTMA 4CFCA 4DQPA 3SQ2A 3HPOA 3NF7A 3NGIA 2GV9A 4TSXA 2DFFA 3KK3A 3C6UA 3VQ9A 3V6DA 1RDBA 4CEDA 2FBVA 4O0IA 3DYAA 3QNOA 2Y1IA 4CCHA 1MSZA 4ZTFA 1C1AA 1XI1A 3V9ZA 3V1QA 3LP0A 1TK0A 1CLQA 3D0PA 1LAVA 4OLBA 5E41A 2G8HA 1QS4A 3QEVA 1WHRA 1W9HA 4EZ9A 1ZBFA 4CF0A 3V9WA 1C0MA 1I3AA 4HVJA 4FM0A 1LW2A 4RG8A 2HHXA 2DFHA 1TVRA 3L3UA 2HVIA 3OYMA 4B8AB 4DTUA 3L2RA 4FZZA 2VG5A 1DTQA 1YT3A 4W5OA 4F2RA 3IRXA 4J2AA 1TKTA 2XY8A 4FLXA 1TKZA 4Z4HA 4CJKA 1RTDA 1J53A 1LWCA 1VSIA 3MECA 4CK3A 3HPHA 1Z25A 1KVCA 4ZTJA 4LSLA 2G8VA 3B6PA 4KO0A 3FFIA 4FM2A 1FKOA 4DSEA 2X74A 5K14A 3NH1A 1CZ9A 2BE2A 5J2MA 4KTWA 3I8DA 4CEOA 4ID1A 1IG9A 2YNFA 3KJVA 4B9VA 4CGFA 2OPSA 5D3GA 3HT3A 1JLQA 3AVGA 1ZBIA 3V9SA 3DLKA 3EZ5A 4C8OA 3QO9A 5KGWA 4PY5A 3HPGA 3SPYA 5HBMA 1ZYQA 1RNHA 2Z1HA 4DTRA 2NUBA 4RW7A 1NK8A 1ZBHA 4M3ZA 4OPJA 3AVJA 3E01A 1WSHA 2Z1JA 4KB1A 4BE1A 2LSNA 4IBNA 2OA8A 1A5WA 1HQUA 2D0AA 5DK5A 3O3HA 3VQQA 3K5LA 4CK2A 2XY7A 3LANA 1QSSA 4N41A 4KHYA 1HYVA 3OYFA 3HM9A 2G8UA 4FJMA 1T8EA 3KLHA 1A5XA 2IS3A 3MXJA 3LWLA 2D5RA 3ZSYA 4JS4A 2IC3A 1WAFA 4QCLA 1BIUA 2ZE2A 1UOCA 1C1BA 3DRPA 4ELUA 4CEAA 2OPPA 3HYFA 4DU4A 4H4MA 3CFPA 1MU2A 1YTAA 4IG0A 4FZYA 3L2WA 4DF4A 4FK2A 5CYQA 3O3GA 5SZTA 2FBYA 4E19A 3LDSA 4B9TA 1RBRA 4RW8A 2KTQA 4M45A 4FJXA 2AJQA 1SUQA 1J5OA 1ASVA 3U6FA 4QAGA 3LP3A 2YKMA 3IG1A 1BQNA 3T1AA 5I42A 3SI6A 4PUOA 4CGDA 3TABA 1JLFA 3SV4A 2XO7A 3DMJA 3SJJA 4DQIA 4EP4A 1R0AA 1X9SA 3CFRA 1WLJA 4BACA 1Q9YA 1IKYA 1SL1A 4W5QA 3OS1A 4AH9A 3ZT3A 2OZSA 4FW2A 1NKBA 4NCGA 3OY9A 3KLFA 5KI6A 3SUNA 2QKKA 3DLBA 3LPTA 2PYLA 2QK9A 5HRNA 3KLGA 4YFUA 3GKUA 1JLEA 1IH7A 4O55A 4WE1A 3RRGA 2P5OA 4FJ8A 2LRRA 2XHBA 4DWIA 4DSLA 3L8BA 2PY5A 4FK4A 2WONA 2E6LA 1GOAA 4KHWA 2ZD1A 4M3YA 2JGUA 4CJ5A 3BDPA 1VSEA 2BANA 5EU7A 4HHTA 3V81A 1QQCA 3AA3A 3AVNA 2G8WA 4K8XA 2A1SA 3LP1A 4W5TA 1KVAA 1NKEA 4OLAA 1TAUA 4CFBA 4HUFA 4DQSA 5JS1A 3AO5A 1TL1A 3VN5A 5KRSA 4DLEA 2HW3A 3AO4A 4OKJA 4CF9A 1EP4A 2KZMA 3I0RA 4IKFA 1QE1A 1S1WA 2ETJA 3AO2A 4N5SA 3K2PA 1WAJA 5HRSA 3SCXA 4CESA 2PYJA 1RDAA 3VQ8A 1BHLA 3LZJA 5CY4A 3HXMA 5FRMA 1U47A 4BWJA 1RDDA 3C95A 1VSHA 3LAMA 4CHQA 3SQ1A 1S5JA 3G10A 4CGHA 3MXMA 3RR7A 4FJJA 2FBXA 4FJGA 1UWBA 2Y1JA 1L3UA 4IFYA 3VQEA 4IFVA 3QEXA 1Q8IA 2IOCA 4CIEA 4L8RB 3VQCA 1RCHA 3NF6A 3ZSZA 4AHUA 4CIGA 2YNIA 3VQ5A 4B08A 4DTMA 1NJZA 3S3OA 1EKEA 5J2NA 1G15A 4H8KA 1X1PA 4CERA 3S3MA 1S1XA 3F9KA 3ZT0A 4DFJA 5KTQA 1WSGA 3LAKA 2WOMA 1J9AA 3NF9A 2G8IA 3KD1E 4FK0A 1VSJA 3DRSA 1S9GA 2F96A 3OYAA 2HNDA 3TAPA 1RT4A 3V1OA 3QNNA 1RT2A 4FJIA 4DLGA 1QHTA 5HRPA 1VSFA 3DLEA 4B9SA 4IG3A 4FCYA 1YVUA 4KHNA 2KQ2A 4I9QA 3SUOA 1NK0A 4KB0A 1B92A 1LW0A 5KRTA 2RPIA 5HLFA 3QLHA 3QERA 1XC9A 4RW6A 3K58A 1FKPA 1KCFA 4DU1A 5HRRA 3TAQA 4DU3A 4W5NA 3PO5A 4DSKA 4M3TA 4FVMA 2YV0X 3UIQA 4F3TA 3OYHA 1JXBA 1LWEA 4CGGA 1SL0A 1DTTA 1KFDA 3KIOA 3QIOA 4E7LA 2OPQA 4KHQA 4OJRA 2OPRA 3HSTB 3KTQA 3THVA 2A1RA 3NBPA 3ZSXA 2RN2A 4OPKA 1WNSA 4KKOA 1HMVA 3ASMA 3VQ4A 4EP5A 1ZBUA 3JYTA 4DFMA 3K5NA 2HVHA 4CFDA 4O44A 2OYQA 4FJNA 4DTXA 3VA3A 1WN7A 4CK1A 4AILC 2P5GA 1RT3A 4CJRA 4H4OA 4OVLA 1EETA 4OGEA 3K5OA 1IKXA 3NCIA 3OYDA 2QKBA 2W42A 1S9EA 1RT6A 2JLEA 2YHAA 4CEQA 4FM1A 3S9HA 1KRPA 3F73A 3SPZA 4ELVA 4F4KA 1HJRA 4FJ5A 3OJSA 3AVAA 4Z4IA 5J2QA 4ID5A 1JKHA 1UA0A 1BISA 3VQ6A 1D8YA 1VSMA 1FK9A 1Y97A 2B6AA 1L3TA 4B3OA 1XHZA 5CZ2A 4LD0A 3DOLA 3ZCMA 4XIUA 4JS5A 3LP2A 4LY7A 3KK1A 3ALYA 4AHTA 1S6QA 1NJWA 2GBZA 3AVHA 4N47A 2KFZA 1VRTA 4KAZA 3TI0A 3HP9A 1UAXA 3P5JA 3SV3A 2B4JA 3ZSVA 4Z4FA 1BCMA 3O4NA 3VQBA 1D9DA 3NH2A 3OJUA 3KKRA 4Z4CA 1TKXA 3PO4A 3OS0A 2YNGA 3RMCA 4FJ7A 1NJYA 3U3GA 4CEEA 1HPZA 3IS9A 4C8MA 2F8SA 3LWMA 1BI4A 3QETA 1U45A 4ICLA 2Q3SA 1RT7A 3HVTA 3TAMA 1L3SA 4E89A 1XWLA 4CJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E3S A;  3MXI A;  4ELT A;  1T03 A;  3OYC A;  4KPY A;  1S1V A;  2E6M A;  4FJL A;  4DS4 A;  2X6N A;  1VSK A;  1RT1 A;  3C94 A;  1S6P A;  5DMR A;  3CQ8 A;  1IKW A;  1SKR A;  4B9U A;  1WSI A;  1UA1 A;  3RWU A;  2ZQB A;  1RTH A;  3OYL A;  3DRR A;  4DG1 A;  1BCO A;  3NDK A;  3PV8 A;  4E7K A;  1RIL A;  3HJF A;  4B8C A;  3AV9 A;  5J1E A;  4E1M A;  1Q9X A;  4KRF A;  3AVI A;  2HHT A;  4OGC A;  3V1R A;  5FRO A;  3DLH A;  4NYN A;  4CHO A;  2Z1I A;  4CJE A;  2ATQ A;  2B5J A;  1HYZ A;  3OYN A;  3C6T A;  4B9M A;  4HTU A;  1SKS A;  1K6Y A;  1VSL A;  2I5J A;  2HNY A;  4AHR A;  3MED A;  3QEI A;  2X6S A;  2EX3 A;  3O3F A;  1U49 A;  3OYJ A;  4BDP A;  3HO1 A;  4LH5 A;  2DY4 A;  3NGZ A;  1NK9 A;  2FBT A;  2X78 A;  5HRO A;  4RW4 A;  4E0D A;  3D45 A;  1IKV A;  1HNI A;  4HUG A;  3A2F A;  3P1G A;  3TAN A;  4M3W A;  1KTQ A;  3OYI A;  1JLA A;  3M8Q A;  1T05 A;  2ITG A;  1SL2 A;  1C0T A;  3ZSQ A;  3OYG A;  2DTU A;  4B9L A;  3KD5 E;  4DFK A;  3OYB A;  1NKC A;  3QES A;  1KLM A;  2G8K A;  3IAY A;  2HHS A;  1L3V A;  2HHV A;  1NK6 A;  3AA4 A;  4NCB A;  3NHG A;  3K59 A;  2KZZ A;  4CJ3 A;  3RTV A;  1RDC A;  4Q5V A;  3RR8 A;  1W0H A;  3SQ4 A;  3NFA A;  1BQM A;  2D0C A;  3PUF A;  4O5B A;  4KTZ A;  4AHS A;  4JLH A;  4CJW A;  3SQ0 A;  3SZ2 A;  3V9X A;  4FLT A;  4JRP A;  4GMJ B;  3RMB A;  2HNZ A;  2YKN A;  2PZS A;  4FZX C;  4OKK A;  3TAE A;  1QSY A;  3AVM A;  4E7I A;  4E7H A;  3AVK A;  4CJV A;  4AHC A;  5CYM A;  4C8L A;  4DTP A;  1T7P A;  1NJX A;  3AO1 A;  2RKI A;  3NF8 A;  4PQU A;  4OKE A;  1U04 A;  3SUP A;  4MQ3 A;  3SUQ A;  4F2S A;  3CFO A;  4FJK A;  2GUI A;  5T7B A;  5I3U A;  1N6Q A;  4FW1 A;  4JRQ A;  4J2D A;  1LWF A;  4KTQ A;  1ASW A;  4FLY A;  3HK2 A;  1CZB A;  1TGO A;  1RBT A;  3PX4 A;  4BDZ A;  3DOK A;  1C1C A;  2R7Y A;  3ISN C;  3KLE A;  3AA5 X;  4BDY A;  1F21 A;  1HRH A;  4M3R A;  2HHU A;  1KVB A;  4DS5 A;  1I39 A;  4DF8 A;  4AHV A;  4DQR A;  3TAG A;  3EY1 A;  1KLN A;  3CG7 A;  3LPU A;  4Z4G A;  1ZBL A;  3NGY A;  5C24 A;  3V9U A;  3DI6 A;  4CIF A;  1SKW A;  1JLG A;  2O4I A;  4CF2 A;  3B6O A;  4CEF A;  4M41 A;  1NK7 A;  4M3X A;  1TKD A;  4HCC A;  4NYF A;  1O1W A;  1VSD A;  4DTJ A;  4YNQ A;  1BGX T;  2YNH A;  2YHB A;  2VWK A;  4PA1 A;  3VQ7 A;  3KK2 A;  4Z4E A;  4CJT A;  1FXX A;  4KI6 A;  1LAW A;  3VQD A;  3S3N A;  2OZM A;  1JXE A;  1CXU A;  3WNF A;  3L3V A;  1SV5 A;  4CJS A;  4HCB A;  4N76 A;  4Y1C A;  2HHW A;  3MEE A;  1REV A;  3EYZ A;  4FXD A;  3WNG A;  5KGX A;  4BWM A;  4PWD A;  1NOZ A;  1VK0 A;  4G1Q A;  4CJQ A;  1YTU A;  4E1N A;  2XY5 A;  1D5A A;  1JL1 A;  3WNH A;  4F3O A;  2D0B A;  5SWM A;  3RMA A;  1RBV A;  3KKS A;  3PY8 A;  4Q0B A;  4E7J A;  4CGJ A;  3AA2 A;  3OYE A;  3L2Q A;  4F8R A;  3VA0 A;  4GW6 A;  1C6V A;  1DLO A;  4B9N A;  2Z1G A;  3ZSO A;  4ZHR A;  1ASU A;  4I2P A;  4Z0U A;  3SNN A;  4FJ9 A;  2QXF A;  3AVL A;  3M8R A;  3M8S A;  4EZ6 A;  3AVC A;  3U3Y A;  4I7F A;  3PX0 A;  1TK5 A;  3K5M A;  1RTJ A;  3K57 A;  1BL3 A;  2HHQ A;  1KFS A;  3VQP A;  4CHZ A;  4CEZ A;  3OYK A;  3G0Z A;  3M8P A;  2BGG A;  4R5P A;  2VG7 A;  1HYS A;  1NK5 A;  1LV5 A;  4CHN A;  2O4G A;  4DTS A;  4FLU A;  1RTI A;  3NAE A;  4NCA A;  4K8Z A;  5CZ1 A;  4RW9 A;  5J2P A;  4M42 A;  4N56 A;  1IO2 A;  2VG6 A;  3MEG A;  3AVF A;  1HQE A;  4CHP A;  2XY6 A;  4DSI A;  1EXQ A;  2P1J A;  4CJF A;  3TAF A;  4Y1D A;  3LAL A;  2F8T A;  3CM6 A;  1S1T A;  2IDO A;  3ZT1 A;  1KSP A;  1X9W A;  4DFP A;  3WNE A;  4BE2 A;  1X9M A;  2HMI A;  4CJP A;  4CE9 A;  3NH0 A;  3DM2 A;  4KI4 A;  1B9F A;  1WSE A;  2HB5 A;  3DLG A;  3I0S A;  1BIZ A;  3BGR A;  3ZT4 A;  4IDK A;  2VWJ A;  4DSF A;  1JL2 A;  3QEW A;  4C8K A;  4I2Q A;  1UG8 A;  1S1U A;  1NK4 A;  1B9D A;  1TV6 A;  4KV8 A;  3PX6 A;  5C42 A;  4KHS A;  2DFE A;  3DLR A;  4LSN A;  4LH4 A;  4CGI A;  4W5R A;  4FLV A;  1CXQ A;  1Z26 A;  3QIP A;  3ZT2 A;  3OVN A;  1WSF A;  2FC0 A;  1J54 A;  4CEC A;  4DQQ A;  3RRH A;  5JS2 A;  1U48 A;  2KW4 A;  4CEB A;  4DTO A;  4CF1 A;  1JLC A;  5C25 A;  3QIN A;  1RT5 A;  3ULD A;  1N5Y A;  2BDP A;  1JLB A;  5FDL A;  3TWH A;  3P83 D;  4C8N A;  1RBS A;  4FLW A;  5HP1 A;  1TL3 A;  3HL8 A;  3L2U A;  3CM5 A;  4DMN A;  3V4I A;  4CHY A;  1U4B A;  3T19 A;  1GOC A;  2P51 A;  3AO3 A;  3ITH A;  3L2V A;  2IAJ A;  3ZSR A;  3QEP A;  1BI4 B;  1L5U A;  1QSL A;  1EX4 A;  4KRE A;  4CJ4 A;  3H08 A;  3TAR A;  3TR8 A;  4QOZ B;  1TK8 A;  1HNV A;  1GOB A;  2XRI A;  4CFA A;  4J2B A;  3VQA A;  4UQG A;  3SYZ A;  1VRU A;  1A5V A;  3NE6 A;  4CJU A;  4KFB A;  4FLZ A;  2RF2 A;  4I9L A;  1RBU A;  4J2E A;  1TAQ A;  4O0J A;  4O4G A;  1D9F A;  5FRN A;  4FYD A;  4FJH A;  3O4Q A;  3RMD A;  3AVB A;  3OS2 A;  2CPM A;  3KLI A;  4GVM A;  3LZI A;  3CYM A;  4HUE A;  4BE0 A;  2E4L A;  3MAQ A;  4DTN A;  2IGI A;  3JSM A;  4DSJ A;  1NOY A;  4CF8 A;  1C0U A;  4MFB A;  1ITG A;  3T3F A;  4M3U A;  2G8F A;  2KFN A;  1XHX A;  1WSJ A;  2EHG A;  3HP6 A;  3HVR A;  4KHU A;  3ZSW A;  1QTM A;  4CFC A;  4DQP A;  3SQ2 A;  3HPO A;  3NF7 A;  3NGI A;  2GV9 A;  4TSX A;  2DFF A;  3KK3 A;  3C6U A;  3VQ9 A;  3V6D A;  1RDB A;  4CED A;  2FBV A;  4O0I A;  3DYA A;  3QNO A;  2Y1I A;  4CCH A;  1MSZ A;  4ZTF A;  1C1A A;  1XI1 A;  3V9Z A;  3V1Q A;  3LP0 A;  1TK0 A;  1CLQ A;  3D0P A;  1LAV A;  4OLB A;  5E41 A;  2G8H A;  1QS4 A;  3QEV A;  1WHR A;  1W9H A;  4EZ9 A;  1ZBF A;  4CF0 A;  3V9W A;  1C0M A;  1I3A A;  4HVJ A;  4FM0 A;  1LW2 A;  4RG8 A;  2HHX A;  2DFH A;  1TVR A;  3L3U A;  2HVI A;  3OYM A;  4B8A B;  4DTU A;  3L2R A;  4FZZ A;  2VG5 A;  1DTQ A;  1YT3 A;  4W5O A;  4F2R A;  3IRX A;  4J2A A;  1TKT A;  2XY8 A;  4FLX A;  1TKZ A;  4Z4H A;  4CJK A;  1RTD A;  1J53 A;  1LWC A;  1VSI A;  3MEC A;  4CK3 A;  3HPH A;  1Z25 A;  1KVC A;  4ZTJ A;  4LSL A;  2G8V A;  3B6P A;  4KO0 A;  3FFI A;  4FM2 A;  1FKO A;  4DSE A;  2X74 A;  5K14 A;  3NH1 A;  1CZ9 A;  2BE2 A;  5J2M A;  4KTW A;  3I8D A;  4CEO A;  4ID1 A;  1IG9 A;  2YNF A;  3KJV A;  4B9V A;  4CGF A;  2OPS A;  5D3G A;  3HT3 A;  1JLQ A;  3AVG A;  1ZBI A;  3V9S A;  3DLK A;  3EZ5 A;  4C8O A;  3QO9 A;  5KGW A;  4PY5 A;  3HPG A;  3SPY A;  5HBM A;  1ZYQ A;  1RNH A;  2Z1H A;  4DTR A;  2NUB A;  4RW7 A;  1NK8 A;  1ZBH A;  4M3Z A;  4OPJ A;  3AVJ A;  3E01 A;  1WSH A;  2Z1J A;  4KB1 A;  4BE1 A;  2LSN A;  4IBN A;  2OA8 A;  1A5W A;  1HQU A;  2D0A A;  5DK5 A;  3O3H A;  3VQQ A;  3K5L A;  4CK2 A;  2XY7 A;  3LAN A;  1QSS A;  4N41 A;  4KHY A;  1HYV A;  3OYF A;  3HM9 A;  2G8U A;  4FJM A;  1T8E A;  3KLH A;  1A5X A;  2IS3 A;  3MXJ A;  3LWL A;  2D5R A;  3ZSY A;  4JS4 A;  2IC3 A;  1WAF A;  4QCL A;  1BIU A;  2ZE2 A;  1UOC A;  1C1B A;  3DRP A;  4ELU A;  4CEA A;  2OPP A;  3HYF A;  4DU4 A;  4H4M A;  3CFP A;  1MU2 A;  1YTA A;  4IG0 A;  4FZY A;  3L2W A;  4DF4 A;  4FK2 A;  5CYQ A;  3O3G A;  5SZT A;  2FBY A;  4E19 A;  3LDS A;  4B9T A;  1RBR A;  4RW8 A;  2KTQ A;  4M45 A;  4FJX A;  2AJQ A;  1SUQ A;  1J5O A;  1ASV A;  3U6F A;  4QAG A;  3LP3 A;  2YKM A;  3IG1 A;  1BQN A;  3T1A A;  5I42 A;  3SI6 A;  4PUO A;  4CGD A;  3TAB A;  1JLF A;  3SV4 A;  2XO7 A;  3DMJ A;  3SJJ A;  4DQI A;  4EP4 A;  1R0A A;  1X9S A;  3CFR A;  1WLJ A;  4BAC A;  1Q9Y A;  1IKY A;  1SL1 A;  4W5Q A;  3OS1 A;  4AH9 A;  3ZT3 A;  2OZS A;  4FW2 A;  1NKB A;  4NCG A;  3OY9 A;  3KLF A;  5KI6 A;  3SUN A;  2QKK A;  3DLB A;  3LPT A;  2PYL A;  2QK9 A;  5HRN A;  3KLG A;  4YFU A;  3GKU A;  1JLE A;  1IH7 A;  4O55 A;  4WE1 A;  3RRG A;  2P5O A;  4FJ8 A;  2LRR A;  2XHB A;  4DWI A;  4DSL A;  3L8B A;  2PY5 A;  4FK4 A;  2WON A;  2E6L A;  1GOA A;  4KHW A;  2ZD1 A;  4M3Y A;  2JGU A;  4CJ5 A;  3BDP A;  1VSE A;  2BAN A;  5EU7 A;  4HHT A;  3V81 A;  1QQC A;  3AA3 A;  3AVN A;  2G8W A;  4K8X A;  2A1S A;  3LP1 A;  4W5T A;  1KVA A;  1NKE A;  4OLA A;  1TAU A;  4CFB A;  4HUF A;  4DQS A;  5JS1 A;  3AO5 A;  1TL1 A;  3VN5 A;  5KRS A;  4DLE A;  2HW3 A;  3AO4 A;  4OKJ A;  4CF9 A;  1EP4 A;  2KZM A;  3I0R A;  4IKF A;  1QE1 A;  1S1W A;  2ETJ A;  3AO2 A;  4N5S A;  3K2P A;  1WAJ A;  5HRS A;  3SCX A;  4CES A;  2PYJ A;  1RDA A;  3VQ8 A;  1BHL A;  3LZJ A;  5CY4 A;  3HXM A;  5FRM A;  1U47 A;  4BWJ A;  1RDD A;  3C95 A;  1VSH A;  3LAM A;  4CHQ A;  3SQ1 A;  1S5J A;  3G10 A;  4CGH A;  3MXM A;  3RR7 A;  4FJJ A;  2FBX A;  4FJG A;  1UWB A;  2Y1J A;  1L3U A;  4IFY A;  3VQE A;  4IFV A;  3QEX A;  1Q8I A;  2IOC A;  4CIE A;  4L8R B;  3VQC A;  1RCH A;  3NF6 A;  3ZSZ A;  4AHU A;  4CIG A;  2YNI A;  3VQ5 A;  4B08 A;  4DTM A;  1NJZ A;  3S3O A;  1EKE A;  5J2N A;  1G15 A;  4H8K A;  1X1P A;  4CER A;  3S3M A;  1S1X A;  3F9K A;  3ZT0 A;  4DFJ A;  5KTQ A;  1WSG A;  3LAK A;  2WOM A;  1J9A A;  3NF9 A;  2G8I A;  3KD1 E;  4FK0 A;  1VSJ A;  3DRS A;  1S9G A;  2F96 A;  3OYA A;  2HND A;  3TAP A;  1RT4 A;  3V1O A;  3QNN A;  1RT2 A;  4FJI A;  4DLG A;  1QHT A;  5HRP A;  1VSF A;  3DLE A;  4B9S A;  4IG3 A;  4FCY A;  1YVU A;  4KHN A;  2KQ2 A;  4I9Q A;  3SUO A;  1NK0 A;  4KB0 A;  1B92 A;  1LW0 A;  5KRT A;  2RPI A;  5HLF A;  3QLH A;  3QER A;  1XC9 A;  4RW6 A;  3K58 A;  1FKP A;  1KCF A;  4DU1 A;  5HRR A;  3TAQ A;  4DU3 A;  4W5N A;  3PO5 A;  4DSK A;  4M3T A;  4FVM A;  2YV0 X;  3UIQ A;  4F3T A;  3OYH A;  1JXB A;  1LWE A;  4CGG A;  1SL0 A;  1DTT A;  1KFD A;  3KIO A;  3QIO A;  4E7L A;  2OPQ A;  4KHQ A;  4OJR A;  2OPR A;  3HST B;  3KTQ A;  3THV A;  2A1R A;  3NBP A;  3ZSX A;  2RN2 A;  4OPK A;  1WNS A;  4KKO A;  1HMV A;  3ASM A;  3VQ4 A;  4EP5 A;  1ZBU A;  3JYT A;  4DFM A;  3K5N A;  2HVH A;  4CFD A;  4O44 A;  2OYQ A;  4FJN A;  4DTX A;  3VA3 A;  1WN7 A;  4CK1 A;  4AIL C;  2P5G A;  1RT3 A;  4CJR A;  4H4O A;  4OVL A;  1EET A;  4OGE A;  3K5O A;  1IKX A;  3NCI A;  3OYD A;  2QKB A;  2W42 A;  1S9E A;  1RT6 A;  2JLE A;  2YHA A;  4CEQ A;  4FM1 A;  3S9H A;  1KRP A;  3F73 A;  3SPZ A;  4ELV A;  4F4K A;  1HJR A;  4FJ5 A;  3OJS A;  3AVA A;  4Z4I A;  5J2Q A;  4ID5 A;  1JKH A;  1UA0 A;  1BIS A;  3VQ6 A;  1D8Y A;  1VSM A;  1FK9 A;  1Y97 A;  2B6A A;  1L3T A;  4B3O A;  1XHZ A;  5CZ2 A;  4LD0 A;  3DOL A;  3ZCM A;  4XIU A;  4JS5 A;  3LP2 A;  4LY7 A;  3KK1 A;  3ALY A;  4AHT A;  1S6Q A;  1NJW A;  2GBZ A;  3AVH A;  4N47 A;  2KFZ A;  1VRT A;  4KAZ A;  3TI0 A;  3HP9 A;  1UAX A;  3P5J A;  3SV3 A;  2B4J A;  3ZSV A;  4Z4F A;  1BCM A;  3O4N A;  3VQB A;  1D9D A;  3NH2 A;  3OJU A;  3KKR A;  4Z4C A;  1TKX A;  3PO4 A;  3OS0 A;  2YNG A;  3RMC A;  4FJ7 A;  1NJY A;  3U3G A;  4CEE A;  1HPZ A;  3IS9 A;  4C8M A;  2F8S A;  3LWM A;  1BI4 A;  3QET A;  1U45 A;  4ICL A;  2Q3S A;  1RT7 A;  3HVT A;  3TAM A;  1L3S A;  4E89 A;  1XWL A;  4CJL A; 
#chains in the Genus database with same CATH topology
 4CBX A;  4KPY A;  2E6M A;  4DS4 A;  2X6N A;  3KDK A;  3CQ8 A;  3RWU A;  1RTH A;  3DRR A;  3I56 N;  1BO5 O;  1RIL A;  4B8C A;  4KRF A;  3AVI A;  4NB4 A;  4MLH A;  4CHO A;  2F4V K;  3CF5 L;  4JI2 K;  4B9M A;  2HHH K;  3QEI A;  2X6S A;  3TSQ A;  5IT9 W;  4RW4 A;  1JCE A;  3A2F A;  3P1G A;  4FWK A;  2ITG A;  1SL2 A;  1C0T A;  2FFM A;  3CCJ N;  2FSJ A;  3QES A;  2LTL A;  2HHV A;  3AA4 A;  3J80 O;  3RR8 A;  4LC9 B;  2P9N B;  4AHS A;  4KTZ A;  4CJW A;  4DR2 K;  3V9X A;  4M7Y A;  4FLT A;  4GMJ B;  3JAM W;  3E9O A;  1Q7Y O;  4E7H A;  3VES A;  1IBM K;  4CJV A;  4DUY H;  4DTP A;  1NJX A;  1VQ5 N;  1ATN A;  4BRI A;  1NU0 A;  2JZX A;  3SBT A;  3SUQ A;  3CJ7 A;  4F2S A;  3O6W A;  4YOW A;  2D4W A;  4B3R K;  4YOU A;  1N6Q A;  2JWK A;  1T6C A;  2YQR A;  2FSN A;  4FW1 A;  4JRQ A;  2W6K A;  4J2D A;  1ASW A;  1RBT A;  3FFK B;  3CI5 A;  3ISN C;  3KLE A;  2VWB A;  4BDY A;  1F21 A;  1HRH A;  4DCH A;  4DS5 A;  4DQR A;  1KLN A;  4Z4G A;  1ZBL A;  5GIO A;  5C24 A;  2VQE K;  1EWQ A;  4H03 B;  2YJF A;  1NK7 A;  1XRH A;  2GWK A;  4B3M K;  4NYF A;  3O4W A;  4A5B A;  1BGX T;  4FWQ A;  4CJT A;  4K25 A;  2P9N A;  4A62 A;  3SAF A;  1SV5 A;  1X3M A;  3EN9 A;  2NRT A;  4EC5 A;  4BWM A;  2CTJ A;  1NOZ A;  4G1Q A;  3RMA A;  4LF8 K;  3PY8 A;  1RBV A;  3AA2 A;  3OYE A;  4HWI A;  4GKJ H;  5JVH L;  2RHK A;  3CQX A;  3K9J A;  4FJ9 A;  2QXF A;  3M8R A;  3M8S A;  2VGM A;  4I7F A;  1BL3 A;  3BUZ B;  3W3D A;  1YHQ N;  1NMD A;  4R5P A;  1DGK N;  1NK5 A;  4DTS A;  1NBW A;  3NAE A;  1X4N A;  4RW9 A;  4CD3 A;  3AVF A;  4A2B A;  4DSI A;  1EXQ A;  2P1J A;  5AQX A;  3CM6 A;  5DM6 L;  2NRR A;  1S03 G;  4OX9 H;  4BE2 A;  4KI4 A;  1B9F A;  1WSE A;  2KZM A;  3I0S A;  4C8K A;  4IDK A;  3ID8 A;  1S1U A;  4G08 A;  1NK4 A;  2A6A A;  4KV8 A;  3CCM N;  5C42 A;  1K9M O;  1VQ9 N;  4KHS A;  2P9S B;  5C12 A;  3DLR A;  3CER A;  4LSN A;  4LH4 A;  4FLV A;  1CXQ A;  3CME N;  4DR4 H;  4LF7 K;  4YOX A;  2IVN A;  3O9U A;  5AQI A;  3HSC A;  5C25 A;  1RT5 A;  3FAU A;  5EVZ A;  3P83 D;  3L0Q A;  3KWG A;  3QB0 A;  1ILY A;  1N36 H;  4C8N A;  1RBS A;  3HL8 A;  4KH5 A;  3CM5 A;  4DMN A;  4E9J A;  1W7A A;  1GOC A;  2P51 A;  3L2V A;  4KRE A;  3GDQ A;  2IAJ A;  3ZSR A;  3ZLJ A;  1BI4 B;  3MWP A;  3SMS A;  4FJS A;  1GLF O;  5C0X G;  3AAQ A;  1HNV A;  1GOB A;  1T3V A;  1TK8 A;  2WBN A;  3LL3 A;  3H3N O;  4UQG A;  1KAX A;  4O4G A;  1D9F A;  4BVP A;  4FYD A;  3KLI A;  4BE0 A;  4DTN A;  3SLC A;  1NOY A;  2JE6 I;  4M3U A;  2G8F A;  2QWM A;  2KFN A;  1XHX A;  1N36 K;  5JLH A;  1QTM A;  4CFC A;  4WAL A;  3CC4 N;  3NF7 A;  2GV9 A;  4TSX A;  2OAN A;  2QWR A;  1RDB A;  3DYA A;  3ZX2 A;  3KVG A;  4B1Y B;  3CJ9 A;  1TK0 A;  3D0P A;  4OLB A;  5AFU A;  2ZGZ A;  4EZ9 A;  1ZBF A;  3THX A;  4HVJ A;  2HHX A;  4K41 A;  4IFD G;  3L7Z C;  4DTU A;  4FZZ A;  3U1K A;  3SB1 A;  1VQP N;  4W5O A;  3QML A;  4F2R A;  3QIC A;  4LF9 H;  3ULE B;  3J80 W;  1NJI O;  4BC5 A;  1YF5 L;  2NRV A;  4FLX A;  4X64 H;  1TKZ A;  1VSI A;  3NCV A;  3MCP A;  4BRE A;  1XC3 A;  3HPH A;  2J4R A;  1KVC A;  3IMX A;  4JKG A;  4ZTJ A;  2G8V A;  4FM2 A;  2X74 A;  4I6M B;  5K14 A;  1CZ9 A;  2BE2 A;  2KHO A;  4B9V A;  2WTU A;  4CGF A;  2OPS A;  3TPQ A;  1HNX H;  2UXB H;  2CH6 A;  1ZBI A;  4JI4 K;  2UYT A;  1VBI A;  1I94 K;  3QO9 A;  5HBM A;  1ZYQ A;  1RNH A;  4CZI A;  4RW7 A;  2CGL A;  1NK8 A;  4BA2 I;  4M3Z A;  1WTJ A;  1S3X A;  4CZH A;  5KQD A;  2Z1J A;  4IBN A;  4H5W A;  3K5L A;  4KHY A;  3VQQ A;  4N41 A;  4H5N A;  1HYV A;  2G8U A;  5BN9 A;  5AQG A;  2HMP A;  3ZSY A;  2A41 A;  4FWP A;  1IBL H;  4QCL A;  4JI3 K;  4B3M H;  2UU9 K;  1D4X A;  3PSI A;  4JD2 B;  4BR7 A;  3HYF A;  3CFP A;  1MU2 A;  3VEX A;  5CYQ A;  3O3G A;  1NGA A;  1M1K O;  3LDS A;  3VEO A;  5BN8 A;  4M45 A;  1J5O A;  1ASV A;  4QS9 A;  2UUA K;  3IG1 A;  1BQN A;  4PUO A;  4DV2 H;  1JLF A;  3DMJ A;  4EP4 A;  3T1H H;  1WLJ A;  1SL1 A;  3OS1 A;  4IJN A;  4GV3 A;  2NRW A;  4CZJ A;  1N34 H;  4NCG A;  3OY9 A;  5KI6 A;  1X0A A;  5IWA K;  2V7Z A;  3LPT A;  4LF4 K;  3CCR N;  1HX1 A;  1X3N A;  2OTJ N;  4K43 A;  2E1Z A;  2WON A;  4KHW A;  1GOA A;  1HNX K;  4B1W B;  2BAN A;  5EU7 A;  4HHT A;  3LP1 A;  1NKE A;  3KDG A;  1SAZ A;  4HUF A;  5JS1 A;  5KRS A;  3AO4 A;  1EP4 A;  3PIP L;  2ETJ A;  2PYJ A;  1RDA A;  1QQN A;  1U47 A;  3LM9 A;  3SQ1 A;  2UUB K;  1XNQ K;  3LDN A;  3M1F A;  4CGH A;  4DR1 H;  1UWB A;  2Y1J A;  3RSE A;  3NVM A;  3VQE A;  1DT9 A;  2QND A;  4NO7 A;  5AQL A;  2E88 A;  4CIE A;  4WQ4 A;  1KQS M;  3VQC A;  3NF6 A;  4AHU A;  2YNI A;  4B08 A;  4BC2 A;  1NJZ A;  2YCH A;  5J2N A;  1G15 A;  3S3M A;  2Q0U A;  4DFJ A;  3ZT0 A;  3LAK A;  2WOM A;  3NF9 A;  2VGN A;  4X65 K;  1T44 A;  2QWP A;  1ATS A;  1NG9 A;  2F96 A;  3FZK A;  5HL7 L;  4A59 A;  3V1O A;  4FJI A;  1VSF A;  3DLE A;  4ILJ A;  4IG3 A;  4C1N K;  1VQ4 N;  1YVU A;  4F9O A;  3OSS D;  3G25 A;  1KC8 O;  2E8A A;  3SUO A;  3WUH A;  1B92 A;  4RW6 A;  4B9Q A;  5HRR A;  4EIA A;  4DV0 K;  3OET A;  4DSK A;  3UIQ A;  4LFA H;  3TSU A;  1JXB A;  3OHR A;  1Q81 O;  1LWE A;  1DTT A;  1KFD A;  3KIO A;  3A5M C;  3HBT A;  3VMF B;  2D1K A;  2OPR A;  5AFU H;  4X65 H;  4BR0 A;  3KTQ A;  3VGK A;  3NBP A;  2RN2 A;  4WFA L;  3MN7 A;  4DFM A;  2YHY A;  3JYT A;  3K5N A;  2OYQ A;  3RVC A;  4DTX A;  1WN7 A;  4AIL C;  1X9Z A;  1RT3 A;  1EET A;  3KK7 A;  2QWO A;  3OYD A;  2W42 A;  3M6G A;  1OH5 A;  5AQU A;  4LF6 K;  2P9P A;  4WFN L;  4AQY H;  1L3T A;  1FK9 A;  1Y97 A;  4YOY A;  3K9K A;  5BPN A;  4A57 A;  1NXU A;  1V4T A;  5KPT A;  3F5T A;  1NGE A;  3C6A A;  2ANN A;  3ALY A;  3BZK A;  1NJW A;  4DR5 K;  2KFZ A;  1BDG A;  2W6L A;  3HP9 A;  3SV3 A;  4Z4F A;  3VQB A;  4DV6 K;  3NH2 A;  3KKR A;  3OBW A;  3KWI A;  3PO4 A;  3OS0 A;  3HRG A;  4LFB H;  5BPL A;  4ICL A;  2QXL A;  3VTH A;  2QI2 A;  5BRD A;  3P38 A;  4JI5 H;  1YUW A;  3TAM A;  4B9U A;  1XWL A;  4E3S A;  3MXI A;  2AA4 A;  3WXJ A;  1VSK A;  4IEE A;  1SKR A;  1IKW A;  4GKJ K;  4DG1 A;  3MN5 A;  3NDK A;  3TTF A;  2P9I B;  4IOA L;  1E3M A;  3AV9 A;  1Q9X A;  4E1M A;  4OGC A;  3V1R A;  4NYN A;  3H46 O;  4FJU A;  4DV7 K;  2B5J A;  3C6T A;  1SKS A;  2HBM A;  1U49 A;  3UE5 A;  3HO1 A;  1NK9 A;  4JHD A;  4RTF D;  1NGB A;  2FBT A;  2X78 A;  4E0D A;  1HNI A;  3G4S N;  3FR0 A;  1K73 O;  1KTQ A;  4BGB A;  1JLA A;  3WEE A;  3J7Z O;  2ASP A;  2ZJR L;  2DTU A;  5CHI A;  2E2P A;  4DFK A;  4NXM H;  3IAY A;  1KLM A;  2G8K A;  4YHH H;  1L3V A;  2A42 A;  3K59 A;  4JKD A;  1W0H A;  4FWO A;  3SQ4 A;  4RWT A;  3NFA A;  2D0C A;  3PUF A;  4O5B A;  2RE2 A;  5GAE P;  4JVH A;  3SQ0 A;  5BRE A;  1IBK K;  2PZS A;  4FZX C;  5ADX H;  3A8Y A;  3J81 O;  4PQU A;  5CYM A;  3CIP A;  3AO1 A;  4OKE A;  1U04 A;  4ISG A;  1WB9 A;  4OCH A;  2GUI A;  4M63 C;  1X4M A;  4ILG B;  1BUP A;  4CJ7 A;  4FLY A;  5GAD P;  4BDZ A;  5AQF A;  3DOK A;  3G71 N;  2R7Y A;  1FJG K;  1OH7 A;  4B3S H;  5I9E B;  1IBM H;  2O8C B;  4M3R A;  2HHU A;  4DF8 A;  3VGL A;  3H3O B;  3EY1 A;  1J6Z A;  4BR2 A;  3J7A K;  3H45 C;  2E5L K;  2O4I A;  4CF2 A;  1M90 O;  1TUY A;  1TKD A;  1O1W A;  2YI1 A;  4DTJ A;  4YNQ A;  4FWS A;  2YHB A;  2VWK A;  3KK2 A;  4Z4E A;  2O8F A;  1JCG A;  3S3N A;  2OZM A;  1JXE A;  3T1Y H;  1HJO A;  2BUP A;  3O80 A;  4N76 A;  4Y1C A;  3MEE A;  3R9P A;  5KGX A;  4IOC L;  4E1N A;  4X66 K;  1Z05 A;  1BWF O;  1D5A A;  2NRX A;  4F3O A;  1ESV A;  5SWM A;  4Q0B A;  3KKS A;  4CGJ A;  3L2Q A;  4F8R A;  4IFE A;  2CTK A;  1C6V A;  4DR7 H;  4B9N A;  3ZSO A;  4I2P A;  1NNE A;  3PX0 A;  1LCU A;  2HHQ A;  3VPZ A;  3VQP A;  5CE3 A;  4CEZ A;  4IEI A;  2BGG A;  3OW2 M;  4X62 K;  5AQH A;  2PT7 G;  2UUB H;  3T1Y K;  2UUC K;  4N56 A;  1IO2 A;  3MEG A;  3AAR A;  1HQE A;  2GEM A;  1S1T A;  2IDO A;  3A5N C;  4DFP A;  3WNE A;  1K8K A;  3NH0 A;  3DLG A;  4AM3 A;  4BR9 A;  5LMN K;  3VF2 A;  3O9S A;  4JEP A;  4DR7 K;  3ZEU B;  4WFB L;  1B9D A;  2OCE A;  3AEV B;  3CJB A;  2DFE A;  1Y64 A;  3MN9 A;  3QFU A;  4QS7 A;  4GKK K;  3OVN A;  4IO9 L;  1J54 A;  4DQQ A;  1IBL K;  3QBW A;  4DTO A;  4WQ5 A;  4JAX A;  1N5Y A;  5BR8 K;  4KHP H;  1JLB A;  2NNW A;  5FDL A;  3TTD A;  2HBL A;  2PBD A;  3UB5 A;  3HOT A;  4FLW A;  4BA1 I;  1K8A O;  5M1N A;  3T19 A;  3QEP A;  4DV6 H;  3LDP A;  4JI6 K;  1QSL A;  1L5U A;  4BC3 A;  2W41 A;  5AQT A;  3H08 A;  3R6M A;  4CJ4 A;  3WXK A;  2X06 A;  4QOZ B;  4J2B A;  3NE6 A;  1Q82 O;  3GL1 A;  2FLO A;  3ZET B;  4I9L A;  4WAN A;  1NGD A;  3B8A X;  2ASO A;  4FJH A;  3O4Q A;  2WUS A;  1HPM A;  4LFC H;  1QHA A;  1VQN N;  4LFB K;  4DV5 K;  2CTM A;  4H5R A;  3KZB A;  1WSJ A;  2ZQE A;  4JI5 K;  4OPH A;  4KHU A;  4DQP A;  3NGI A;  3KK3 A;  3V6D A;  4O0I A;  3FGU A;  3VEZ A;  4CCH A;  1MSZ A;  4JYA H;  3LP0 A;  4YOV A;  1LAV A;  1QS4 A;  2O8E B;  2NRZ A;  4A61 A;  4FM0 A;  1LW2 A;  3ATU A;  4RG8 A;  3OYM A;  1HLU A;  3I0P A;  2VCP A;  2VG5 A;  3D2F A;  3IDH A;  1RTD A;  4DUZ H;  4CK3 A;  4NXN H;  1GLC G;  3B6P A;  4R79 A;  1WBB A;  5J2M A;  1HR0 H;  5LY3 A;  4KTW A;  1IG9 A;  1XQS C;  5BPM A;  3HT3 A;  4LIJ A;  3AVG A;  1BA1 A;  5GAG P;  2DGR A;  3EE8 A;  4H0X B;  5KGW A;  4PY5 A;  3SPY A;  4AF1 A;  1VQO N;  4DTR A;  2NUB A;  2H3G X;  3E9L A;  3CCS N;  3AVJ A;  3E01 A;  4JKF A;  4DV3 K;  1WSH A;  1A5W A;  3O3H A;  4M3X A;  2XY7 A;  3LAN A;  3DXK A;  3OYF A;  3HM9 A;  4FJM A;  3L6Q A;  2YHX A;  3KLH A;  3LWL A;  3MXJ A;  2D5R A;  1WAF A;  1UOC A;  4XH1 A;  1IV0 A;  3DRP A;  4ELU A;  4H4M A;  3P4I A;  4DF4 A;  4JKE A;  3SAH A;  3TTC A;  4B3T K;  2FBY A;  2E3U A;  4E19 A;  4LF5 K;  4NLC A;  2E5L H;  3GE1 A;  4FJX A;  4AM6 A;  4B1Z A;  2AJQ A;  4NBQ A;  3P39 A;  3LP3 A;  5AQK A;  4PKH A;  2XO7 A;  2FMR A;  3MN6 A;  1Q9Y A;  1IKY A;  2OZS A;  4AH9 A;  3ZT3 A;  2YX6 A;  3D6R A;  3O1W A;  1NKB A;  1OKJ A;  5AQO A;  3SUN A;  4V19 S;  2CTF A;  2PYL A;  3GKU A;  4YFU A;  1JLE A;  3EL2 A;  4FSV A;  3T7Z A;  3RRG A;  2P5O A;  2LRR A;  4DR3 H;  2E2Q A;  2XHB A;  4DWI A;  1DKG D;  3L8B A;  4BG8 A;  2PY5 A;  4FK4 A;  4M3Y A;  2ZD1 A;  4XEI A;  4NZR M;  3BDP A;  3OBY A;  2G8W A;  4K8X A;  4QMF B;  4CFB A;  4DQS A;  3VF6 A;  4DLE A;  3FZH A;  1QE1 A;  4N5S A;  3K2P A;  1WAJ A;  3VQ8 A;  5CY4 A;  5DT9 A;  1E4G T;  3C95 A;  2UUC H;  3G10 A;  3FZM A;  3MXM A;  3WQU A;  2FBX A;  4FJG A;  1Q8I A;  4DTM A;  1RCH A;  3ZSZ A;  4CIG A;  2CGJ A;  1G99 A;  4H5V A;  1X1P A;  4YOR A;  2IIR A;  3RSE B;  3KD1 E;  4CZE A;  4FK0 A;  1S9G A;  3OYA A;  4YDU A;  1RGI A;  4H0V B;  2ITM A;  4DLG A;  5AQQ A;  1GLJ O;  2UUA H;  1N32 H;  4FCY A;  2Q31 A;  4JI0 H;  3H1V X;  3G6E N;  3N4Q A;  3MK6 A;  4DV4 K;  3MWT A;  3QER A;  2VQE H;  1FKP A;  1KCF A;  3UKR B;  2Q2R A;  4DR2 H;  4W5N A;  1ZZJ A;  4M3T A;  2YV0 X;  1SL0 A;  1VAZ A;  4CZG A;  4E7L A;  4WF9 L;  4IXC A;  2OPQ A;  2QTD A;  3ENO A;  3UKU B;  1RFQ A;  1Q18 A;  3HST B;  4WYB A;  3THV A;  3ZSX A;  2A1R A;  1WNS A;  5AQV A;  4B3R H;  3K0S A;  1HMV A;  3ASM A;  1I6U A;  2CH5 A;  3JAM O;  2HVH A;  4FJN A;  2VYP A;  4LFC K;  4DUY K;  1HKC A;  3TSP A;  4CJR A;  4OGE A;  5JIC A;  3K5O A;  3MX2 A;  1IKX A;  3NCI A;  4OD6 A;  2YHA A;  4FM1 A;  1KRP A;  4F4K A;  4FJ5 A;  3A0I X;  3MX5 A;  3AVA A;  2W40 A;  3VET A;  5EOY A;  1UA0 A;  3VQ6 A;  1D8Y A;  2B6A A;  4B3O A;  1J5K A;  3CET A;  4QS8 A;  4AHT A;  1BOT O;  1S6Q A;  3BEX A;  1YI2 N;  2HF3 A;  1HNZ H;  3ZX3 A;  3CQY A;  3TI0 A;  1VQ8 N;  4ISE A;  4I6M A;  2B4J A;  3MMV A;  2BL5 A;  3O4N A;  1D9D A;  4BQZ A;  3N4P A;  4Z4C A;  1TKX A;  2UXD K;  3RMC A;  1ZBS A;  3LWM A;  4DV5 H;  3QET A;  4NLB A;  3HVT A;  1F0X A;  1L3S A;  1QQO A;  4HTU A;  4BR4 A;  4ELT A;  1T03 A;  2M8W A;  1S1V A;  4LF7 H;  4FJL A;  5LMU H;  3C94 A;  2F4V H;  2E2N A;  1S6P A;  1UA1 A;  2ZQB A;  4BRN A;  2FXU A;  4FWM A;  3PLA A;  3ENB A;  5FPE A;  1BCO A;  2I7N A;  1VQL N;  3PV8 A;  4E7K A;  4BRL A;  3HJF A;  4IJA A;  2JEA I;  2HHT A;  3DLH A;  3HZ6 A;  4BRC A;  2BTF A;  4GVE A;  1HYZ A;  4K42 A;  1XUP O;  1VSL A;  4H0O A;  2EX3 A;  3O3F A;  4BDP A;  3OYJ A;  1WBD A;  4PL8 A;  2GEL A;  5HOO A;  1IKV A;  4JI1 K;  2ZM6 H;  1MWM A;  3VKE A;  2YJE A;  4HUG A;  2D0O A;  3M8Q A;  4DV7 H;  2O8E A;  4DQ8 A;  5K36 G;  5EX5 A;  5LJV A;  3OYB A;  2HHS A;  3BF1 A;  3Q7B A;  4KH4 A;  3NHG A;  2KZZ A;  1RDC A;  2HBJ A;  2PQU A;  4OO1 J;  4B3T H;  4BRP A;  4BRG A;  3THW B;  4JLH A;  3QBX A;  3SZ2 A;  4A5A A;  5ADX A;  2HNZ A;  2YKN A;  4OKK A;  3TAE A;  1QSY A;  4FL9 A;  3AVK A;  1T7P A;  3NF8 A;  1YVN A;  3SUP A;  4DHY A;  4JK8 A;  1HNW H;  3CFO A;  1BG3 A;  2VQF H;  4BG9 A;  4K0K H;  2FPH X;  3VOV A;  3PX4 A;  5C2D A;  1C1C A;  3ZYY X;  3VF4 A;  5GAH P;  3U9Z A;  3VTI A;  5AQM A;  1GLA G;  3TAG A;  1QZ5 A;  2E1Y A;  3LPU A;  5ELZ A;  4JI8 H;  4CIF A;  5LL6 Z;  2NZT A;  1JLG A;  3B6O A;  3LDQ A;  4M41 A;  5AZJ B;  1VSD A;  4PA1 A;  3VQ7 A;  1S72 N;  2I7P A;  2YHW A;  5GIN A;  3VQD A;  3WNF A;  2P9S A;  3L3V A;  2HHW A;  4CJS A;  3F9M A;  3WNG A;  3CJC A;  4PWD A;  4CJQ A;  1YTU A;  4UY8 O;  2XY5 A;  1GLL O;  2F9W A;  5AQR A;  4BVO A;  1DLO A;  3F2K A;  3UOE A;  1IJJ A;  1ASU A;  4Z0U A;  2ZF5 O;  4O8K A;  2LF0 A;  4JKB A;  1KFS A;  3OYK A;  4PKG A;  3G0Z A;  3M8P A;  5H1S Q;  3CCU N;  2UU9 H;  4JKG B;  4CZK A;  1LV5 A;  4CHN A;  2P9I A;  1RTI A;  4NCA A;  3QD7 X;  1NGC A;  1EQY A;  1Q86 O;  5CZ1 A;  3PSF A;  5J2P A;  3D2E B;  3GBT A;  2XY6 A;  3TAF A;  2F8T A;  1KSP A;  4DB3 A;  3ZT1 A;  1X9W A;  2EWS A;  1X9M A;  2HMI A;  4CJP A;  4CE9 A;  3DM2 A;  4MO5 A;  5AZJ A;  2HB5 A;  4E1J A;  3SJH A;  1UG8 A;  4I2Q A;  4IOX A;  1TV6 A;  3CMA N;  3PX6 A;  4WQ5 C;  4CGI A;  1NGH A;  3BF3 A;  3ZT2 A;  2GX9 A;  4CEC A;  3RRH A;  4JI0 K;  5JS2 A;  1JLC A;  3QIN A;  3SBG A;  2BDP A;  4BRA A;  3TWH A;  1S22 A;  4EHT A;  3WT0 A;  3UKU A;  1WUA A;  3L2U A;  3PIO L;  1U4B A;  3ITH A;  3MCA B;  1ZZK A;  3TAR A;  1U2V B;  2F7T A;  4BRF A;  3NMU A;  2XRI A;  4CFA A;  4U7B A;  3I55 N;  5IT9 O;  1ODH A;  1A5V A;  1IG8 A;  4H8A A;  1TYQ A;  4M7X A;  2RF2 A;  1RBU A;  4PHT X;  4O0J A;  5FRN A;  5AQP A;  3RMD A;  4FOE A;  2MJH A;  3AVB A;  2ZJP L;  2CPM A;  1R59 O;  3LZI A;  5LMU K;  4HUE A;  2E4L A;  4MDB A;  3V69 A;  2IGI A;  3JSM A;  4CF8 A;  1YAG A;  1C0U A;  3T3F A;  1ITG A;  3CJ1 A;  4KBO A;  3CJA A;  5EY4 A;  3HP6 A;  3ZSW A;  1WE8 A;  5IWA H;  2JA9 A;  3VQ9 A;  5AQW A;  1NLV A;  4CED A;  2Y1I A;  4DR3 K;  2JVZ A;  3IKM A;  3J81 W;  3V1Q A;  3UKR A;  3R8E A;  1CLQ A;  3FE1 A;  3L4I A;  5E41 A;  2G8H A;  1W9H A;  3H6E A;  1SEI A;  3KHY A;  3V9W A;  1NGI A;  1I3A A;  2HVI A;  4DV0 H;  1TVR A;  3L3U A;  4B8A B;  3VER A;  1OVY A;  4MO4 A;  2O8D B;  1T6D A;  1FJG H;  3ID6 A;  3DJC A;  4YHH K;  1X9J A;  5FPN A;  2KLA A;  4J2A A;  4Z4H A;  5M1P A;  1J53 A;  3MEC A;  3DLL L;  1TYQ B;  5E84 A;  2QK9 A;  1IBK H;  3NH1 A;  1GLE G;  2Z0S A;  3I8D A;  4CEO A;  5JEA G;  2A3Z A;  2YNF A;  3KJV A;  5D3G A;  1JLQ A;  1ZTG A;  4CBU A;  3EZ5 A;  4C8O A;  3CD6 N;  1ZBH A;  1HKG A;  5LL6 b;  1BA0 A;  3CC2 N;  3C7N B;  4JNE A;  4KB1 A;  2OA8 A;  4B8C D;  1HQU A;  2D0A A;  4CK2 A;  2NLX A;  5AQN A;  1T8E A;  2IS3 A;  2VKC A;  2ANR A;  1XMQ H;  4JS4 A;  4JV5 H;  5AQS A;  2ZE2 A;  4JYA K;  4CEA A;  2GUP A;  4JVY A;  4FZY A;  2QM1 A;  1H1V A;  1N8R O;  1E4F T;  3I8B A;  5C0Y A;  4PL7 A;  3VGM A;  1V8C A;  4B9T A;  4LF6 H;  4QAG A;  2YKM A;  1MDU B;  3TAB A;  4XH5 A;  4DQI A;  3SV4 A;  1KD1 O;  2CWF A;  3SJJ A;  1R0A A;  3CFR A;  1K1G A;  2P9L A;  3W0L A;  2O8B B;  4FW2 A;  3KLF A;  2A5X A;  2QKK A;  3CPE A;  5C15 A;  5HRN A;  3KLG A;  1IH7 A;  2QW9 A;  3WQT A;  4O55 A;  4WE1 A;  5LJW A;  4FJ8 A;  2Q36 A;  2JGU A;  3DXK B;  1VSE A;  4FO0 A;  3AA3 A;  1TAU A;  3SAG A;  2A1S A;  3AO5 A;  1NM1 A;  2HW3 A;  4PDB A;  4CF9 A;  3I0R A;  1AN7 A;  4IKF A;  1S1W A;  2V51 B;  2JEB I;  4ILH A;  3SCX A;  1KXP A;  4CES A;  5LMN H;  1BHL A;  3LZJ A;  5JVG L;  3HXM A;  5FRM A;  2QWL A;  3OTO H;  4BWJ A;  3LAM A;  5FLX O;  1VSH A;  4LF9 K;  1S5J A;  3RR7 A;  3THX B;  3DXM B;  3NVK A;  3AGR A;  4AIM A;  4DV1 K;  1WVN A;  3D2E A;  4NZT M;  4EFH A;  5FPD A;  3ULE A;  2FF6 A;  4CER A;  1S1X A;  4HTL A;  4CBW A;  1J9A A;  3CHW A;  1VQK N;  3DRS A;  2D0P A;  2ZM6 K;  3TAP A;  1RT4 A;  3GOI A;  1RT2 A;  4K8Z A;  4B3S K;  3I33 A;  4ISF A;  3THY B;  4KHN A;  3M3Z A;  1KAZ A;  3GAB A;  5KRT A;  2RPI A;  1SZ2 A;  5HLF A;  3QLH A;  1XC9 A;  1OH8 A;  3WXI A;  4C23 A;  3TAQ A;  2CPQ A;  1O13 A;  4B1X B;  3DWL A;  2FSK A;  1Z2I A;  1J5E K;  4CGG A;  3QIO A;  4OJR A;  4IO8 A;  5F2R A;  4OPK A;  4KKO A;  1VIH A;  4JK9 A;  4EHU A;  4EP5 A;  3LDO A;  2OPU A;  1ZBU A;  1P90 A;  4OX9 K;  3U4L A;  4CFD A;  4O44 A;  4LFA K;  1ATR A;  4CZF A;  4CK1 A;  4B1U B;  3OTO K;  1RDW X;  4H4O A;  1OVQ A;  1DT4 A;  3D7E O;  1KAY A;  5B8H A;  3ZET A;  1W97 L;  4CEQ A;  4O8U A;  4Z4I A;  5KPZ A;  3SPZ A;  1HJR A;  3OJS A;  4YY3 K;  5J2Q A;  2ZWH A;  4DR4 K;  4ID5 A;  1JKH A;  4WQ4 C;  1BIS A;  3A5O C;  3THY A;  1J5E H;  1XHZ A;  5CZ2 A;  4LD0 A;  3ZCM A;  5M1O A;  5DM7 L;  4JS5 A;  4BR5 A;  3LP2 A;  4LY7 A;  3AY9 A;  4N47 A;  1YJ9 N;  1ZXO A;  4GY2 B;  1UAX A;  3P5J A;  1V4S A;  3ZSV A;  3U9D A;  4FJ7 A;  2M6Q A;  1WOQ A;  1XMO K;  4C8M A;  2F8S A;  4MDA A;  1TUA A;  5M1F A;  1RT7 A;  2PFU A;  3BY5 A;  4E89 A;  3ZSQ A;  1VRT A;  3SQ2 A;  1RDU A;  2DPN A;  3OYC A;  5DMR A;  1RT1 A;  2Y3M A;  4CZM A;  4IZ9 A;  2WFB A;  1WSI A;  5AQZ A;  5EXW A;  3R3L A;  3OYL A;  3FZF A;  4DV2 K;  4CI6 A;  3VEW A;  3VEY A;  4B1V A;  5J1E A;  2HBK A;  2BA0 A;  1N34 K;  5FRO A;  4U67 L;  3CCV N;  1ZC6 A;  1FKA H;  2Z1I A;  4CJE A;  2ATQ A;  2F9T A;  3OYN A;  1V9N A;  1K6Y A;  2I5J A;  4H0P A;  2HNY A;  4AHR A;  3MED A;  2DY4 A;  1EC6 A;  4LH5 A;  3NGZ A;  3QFP A;  5HRO A;  2HH3 A;  5JMV A;  3D45 A;  1NMN A;  3SK3 A;  3TAN A;  4YY3 H;  4M3W A;  3OYI A;  1T05 A;  5TKW A;  2Q1N A;  3OYG A;  3IFR A;  4FPB A;  4B9L A;  1YJW N;  3KD5 E;  4GKK H;  1NKC A;  3M5R A;  3ATV A;  1NK6 A;  4NCB A;  4CJ3 A;  3RTV A;  4Q5V A;  4X64 K;  1SS6 A;  1BQM A;  4WCE L;  3JS6 A;  3O5B A;  4JRP A;  3RMB A;  3O08 A;  3AVM A;  4E7I A;  1VQ6 N;  4GV9 A;  4G9Z A;  4AHC A;  4BC4 A;  4C8L A;  5A2Q W;  3O8M A;  2RKI A;  3RF2 A;  4MQ3 A;  2GWJ A;  4FJK A;  2O8C A;  5T7B A;  5I3U A;  2CGK A;  3LM2 A;  1LWF A;  4KTQ A;  3HK2 A;  1CZB A;  1TGO A;  2LTM A;  4H0T B;  3AA5 X;  3SMP A;  3R1X A;  4FWL A;  1KVB A;  3IUC A;  1I39 A;  1NWK A;  4AHV A;  3C0B A;  2UXC H;  3CG7 A;  3C6H A;  3NGY A;  2V7Y A;  3V9U A;  3DI6 A;  1SKW A;  4K0K K;  4DR6 H;  4B8T A;  4CEF A;  1HR0 K;  5AR0 A;  3A5L C;  4HCC A;  4DV1 H;  1JCF A;  1N33 H;  2YNH A;  1XNR K;  2QWN A;  3CCE N;  1FXX A;  4KI6 A;  1LAW A;  4O5F A;  1CXU A;  3E9P A;  4BRM A;  5E26 A;  4HCB A;  3MDQ A;  1REV A;  3EYZ A;  4FXD A;  1VK0 A;  1GLB G;  3JXU A;  2BH1 A;  4FOI A;  1JL1 A;  3WNH A;  2D0B A;  3BZC A;  4E7J A;  5M1Q A;  5C2F A;  2P9U B;  4GW6 A;  3VA0 A;  3DXM A;  2O8D A;  2Z1G A;  4ZHR A;  4OO1 G;  3SNN A;  1P8Z A;  3AVL A;  4DKW A;  4EZ6 A;  3AVC A;  3U3Y A;  2UXC K;  1TK5 A;  3K5M A;  1RTJ A;  3K57 A;  1HUX A;  4CHZ A;  3CCQ N;  2VG7 A;  4H5T A;  2PY9 A;  1HYS A;  3BP8 A;  4JI2 H;  2O4G A;  2P9P B;  4FLU A;  4JKA A;  4M42 A;  2VG6 A;  2K1H A;  3DAW A;  4CHP A;  4CJF A;  4Y1D A;  3LAL A;  4CW7 B;  5FPM A;  2CTL A;  4BQL A;  1NK0 A;  4DSF A;  1VIG A;  3TU5 A;  1BIZ A;  3BGR A;  3ZT4 A;  2VWJ A;  3QEW A;  2AXY A;  1JL2 A;  2O8B A;  4MLE A;  5A2Q O;  1VQM N;  4GV6 A;  4JI8 K;  1YJN N;  1YXQ A;  2QWQ A;  5KPR A;  3P31 A;  4W5R A;  4LF4 H;  1Z26 A;  3QIP A;  4NXM K;  5AZI B;  1WSF A;  2FC0 A;  1U48 A;  4IDH A;  4JV5 K;  2KW4 A;  4CEB A;  4CF1 A;  2AP1 A;  3ULD A;  4EAH D;  2NRH A;  1J4W A;  3FLC O;  5HP1 A;  1TL3 A;  4PKI A;  3V4I A;  2P9K B;  4CHY A;  3AO3 A;  1EX4 A;  2IVP A;  2QA4 N;  4JI7 K;  1XMO H;  3TR8 A;  2NN6 G;  1MA9 B;  2E2O A;  3VQA A;  3SYZ A;  1VRU A;  4CJU A;  4KFB A;  4FLZ A;  2UXB K;  4J2E A;  3WXL A;  4JK7 A;  1TAQ A;  4A2A A;  1I94 H;  3OS2 A;  4GVM A;  2WC9 A;  3CYM A;  3FZL A;  3LDL A;  2HH2 A;  3MAQ A;  4DSJ A;  3WEE B;  4MFB A;  1OH6 A;  3AAP A;  2HF4 A;  5GIP A;  3CCL N;  2EHG A;  3HVR A;  3S41 A;  4J8F A;  2OTL N;  5JLF A;  3HPO A;  2DFF A;  3C6U A;  2FBV A;  4XH4 A;  3QNO A;  3C7N A;  4ZTF A;  5AZI A;  1C1A A;  1XI1 A;  3V9Z A;  1CZA N;  1QVF M;  4LF8 H;  5AQY A;  2GTD A;  4YOT A;  4RCH A;  3O1B A;  1HKB A;  3D2F B;  3EKU A;  3QEV A;  1WHR A;  4CF0 A;  1C0M A;  2DFH A;  4AM7 A;  2VQF K;  4AQY K;  4CVN E;  3L2R A;  1DTQ A;  1YT3 A;  1C0G A;  2P9U A;  3IRX A;  1U6Z A;  1PQX A;  1TKT A;  2XY8 A;  4CJK A;  1LWC A;  3C65 A;  1Z25 A;  4X62 H;  4LSL A;  4F3T A;  4KO0 A;  3FFI A;  4BRO A;  1FKO A;  4DSE A;  4ID1 A;  4DV3 H;  1NGF A;  3ZX0 A;  2OPV A;  3V9S A;  3DLK A;  3HPG A;  1TUU A;  4NXN K;  3J8A A;  2Z1H A;  5AJ3 K;  2HHH H;  3T69 A;  4OPJ A;  1DEJ A;  5CR4 A;  4BE1 A;  3T1H K;  2LSN A;  5DK5 A;  1QSS A;  4KHP K;  5BR8 H;  3H1Q A;  1QZ6 A;  4DR1 K;  4LF5 H;  1A5X A;  2E20 A;  4KH6 A;  2IC3 A;  2UXD H;  1BIU A;  1QVG M;  1C1B A;  2ZJQ L;  2OPP A;  4DU4 A;  1YTA A;  4IG0 A;  3L2W A;  3EZW A;  4FK2 A;  4FPA A;  3O9R A;  3QDK A;  5SZT A;  5AQJ A;  5BRH A;  1RBR A;  4RW8 A;  2KTQ A;  1XMQ K;  1SUQ A;  4OPA A;  3U6F A;  1U2V A;  3T1A A;  5I42 A;  2V52 B;  3SI6 A;  4CGD A;  3GR5 A;  4FWR A;  1ZZI A;  1X9S A;  4BAC A;  2QEX N;  4GNI A;  3ZEU A;  3HI0 A;  4W5Q A;  5TKY A;  3DLB A;  4BY9 C;  4H0Y B;  3O9T A;  1FW6 A;  4DSL A;  1KHM A;  4FWN A;  4Y0W A;  2KKZ A;  2E6L A;  1Z6R A;  5FLX W;  4CJ5 A;  1HNZ K;  3V81 A;  1QQC A;  3AVN A;  4OLA A;  3GG4 A;  4W5T A;  1KVA A;  1C0F A;  2IVO A;  4C1N I;  2Q0R A;  1TL1 A;  3VN5 A;  5BR9 A;  2D9I A;  3OA9 A;  4OKJ A;  1QQM A;  3AO2 A;  5HRS A;  1NGJ A;  3CC7 N;  1XNR H;  3ENH A;  2A40 A;  4JKH A;  2HST A;  2JWL A;  1RDD A;  4CHQ A;  3EZJ A;  5F1X A;  1NGG A;  3THW A;  4FJJ A;  3HOS A;  4Z94 A;  1L3U A;  4IFY A;  4IFV A;  3QEX A;  4L8R B;  2IOC A;  5BRF A;  3VQ5 A;  1N32 K;  2FF3 B;  3J7Y P;  3EEQ A;  4JN4 A;  3S3O A;  1EKE A;  4H8K A;  5M1K A;  5MLC Q;  3F9K A;  3VEV A;  5KTQ A;  1WSG A;  1EWR A;  4DUZ K;  2G8I A;  1DTJ A;  4DV4 H;  2O8F B;  1VSJ A;  4JI4 H;  2HND A;  4JKC A;  4L3Q A;  3QNN A;  4YDU C;  1QHT A;  5HRP A;  1S20 A;  4B9S A;  2KQ2 A;  4I9Q A;  4JI7 H;  3J7A P;  4KB0 A;  1LW0 A;  2CTE A;  1SQK A;  5F0X A;  4JI1 H;  3E1Y A;  3K58 A;  2ZGY A;  4DU1 A;  4BRK A;  1BU6 O;  4DU3 A;  2P2R A;  3E66 A;  3PO5 A;  3U8X A;  3O9Q A;  4FVM A;  3OYH A;  1JJ2 M;  4BRD A;  4KHQ A;  1W2B M;  2O4C A;  1MWK A;  4DR5 H;  1LOT B;  2P9K A;  3WXM B;  1YIJ N;  3VEN A;  2CWH A;  3L4Q A;  3VQ4 A;  4BRQ A;  4X66 H;  4JI3 H;  4JD2 A;  1GLD G;  4IWV A;  1EO1 A;  3HM8 A;  3VA3 A;  2HOE A;  4FVU A;  2P5G A;  3CPW M;  1HNW K;  4OVL A;  5C10 A;  2ASM A;  2QKB A;  3EKS A;  1S9E A;  1RT6 A;  2JLE A;  3CXC M;  3S9H A;  3F73 A;  4BGA A;  4ELV A;  3AGK A;  5KQ8 A;  1VHX A;  3EO3 A;  4CD1 A;  1VSM A;  2P9L B;  3DOL A;  4BRH A;  4JHD B;  4XIU A;  1N33 K;  3KK1 A;  2GBZ A;  1YIT N;  3AVH A;  1K8K B;  2G8Y A;  4KAZ A;  4DR6 K;  4CZL A;  3HTV A;  1BCM A;  3OJU A;  4JI6 H;  2Q97 A;  2PAV A;  3EE9 A;  2YNG A;  1NJY A;  3U3G A;  4CEE A;  1HPZ A;  3IS9 A;  1BI4 A;  1U45 A;  3Q7C A;  2Q3S A;  1VQ7 N;  1XNQ H;  4CJL A; 
#chains in the Genus database with same CATH homology
 4E3S A;  3MXI A;  4ELT A;  1T03 A;  3OYC A;  4KPY A;  1S1V A;  2E6M A;  4FJL A;  4DS4 A;  2X6N A;  1VSK A;  1RT1 A;  3C94 A;  1S6P A;  5DMR A;  3CQ8 A;  1IKW A;  1SKR A;  4B9U A;  1WSI A;  1UA1 A;  3RWU A;  2ZQB A;  1RTH A;  3OYL A;  3DRR A;  4DG1 A;  1BCO A;  3NDK A;  3PV8 A;  4E7K A;  1RIL A;  3HJF A;  4B8C A;  3AV9 A;  5J1E A;  4E1M A;  1Q9X A;  4KRF A;  3AVI A;  2HHT A;  4OGC A;  3V1R A;  5FRO A;  3DLH A;  4NYN A;  4CHO A;  2Z1I A;  4CJE A;  2ATQ A;  2B5J A;  1HYZ A;  3OYN A;  3C6T A;  4B9M A;  4HTU A;  1SKS A;  1K6Y A;  1VSL A;  2I5J A;  2HNY A;  4AHR A;  3MED A;  3QEI A;  2X6S A;  2EX3 A;  3O3F A;  1U49 A;  3OYJ A;  4BDP A;  3HO1 A;  4LH5 A;  2DY4 A;  3NGZ A;  1NK9 A;  2FBT A;  2X78 A;  5HRO A;  4RW4 A;  4E0D A;  3D45 A;  1IKV A;  1HNI A;  4HUG A;  3A2F A;  3P1G A;  3TAN A;  4M3W A;  1KTQ A;  3OYI A;  1JLA A;  3M8Q A;  1T05 A;  2ITG A;  1SL2 A;  1C0T A;  3ZSQ A;  3OYG A;  2DTU A;  4B9L A;  3KD5 E;  4DFK A;  3OYB A;  1NKC A;  3QES A;  1KLM A;  2G8K A;  3IAY A;  2HHS A;  1L3V A;  2HHV A;  1NK6 A;  3AA4 A;  4NCB A;  3NHG A;  3K59 A;  2KZZ A;  4CJ3 A;  3RTV A;  1RDC A;  4Q5V A;  3RR8 A;  1W0H A;  3SQ4 A;  3NFA A;  1BQM A;  2D0C A;  3PUF A;  4O5B A;  4KTZ A;  4AHS A;  4JLH A;  4CJW A;  3SQ0 A;  3SZ2 A;  3V9X A;  4FLT A;  4JRP A;  4GMJ B;  3RMB A;  2HNZ A;  2YKN A;  2PZS A;  4FZX C;  4OKK A;  3TAE A;  1QSY A;  3AVM A;  4E7I A;  4E7H A;  3AVK A;  4CJV A;  4AHC A;  5CYM A;  4C8L A;  4DTP A;  1T7P A;  1NJX A;  3AO1 A;  2RKI A;  3NF8 A;  4PQU A;  4OKE A;  1U04 A;  3SUP A;  4MQ3 A;  3SUQ A;  4F2S A;  3CFO A;  4FJK A;  2GUI A;  5T7B A;  5I3U A;  1N6Q A;  4FW1 A;  4JRQ A;  4J2D A;  1LWF A;  4KTQ A;  1ASW A;  4FLY A;  3HK2 A;  1CZB A;  1TGO A;  1RBT A;  3PX4 A;  4BDZ A;  3DOK A;  1C1C A;  2R7Y A;  3ISN C;  3KLE A;  3AA5 X;  4BDY A;  1F21 A;  1HRH A;  4M3R A;  2HHU A;  1KVB A;  4DS5 A;  1I39 A;  4DF8 A;  4AHV A;  4DQR A;  3TAG A;  3EY1 A;  1KLN A;  3CG7 A;  3LPU A;  4Z4G A;  1ZBL A;  3NGY A;  5C24 A;  3V9U A;  3DI6 A;  4CIF A;  1SKW A;  1JLG A;  2O4I A;  4CF2 A;  3B6O A;  4CEF A;  4M41 A;  1NK7 A;  4M3X A;  1TKD A;  4HCC A;  4NYF A;  1O1W A;  1VSD A;  4DTJ A;  4YNQ A;  1BGX T;  2YNH A;  2YHB A;  2VWK A;  4PA1 A;  3VQ7 A;  3KK2 A;  4Z4E A;  4CJT A;  1FXX A;  4KI6 A;  1LAW A;  3VQD A;  3S3N A;  2OZM A;  1JXE A;  1CXU A;  3WNF A;  3L3V A;  1SV5 A;  4CJS A;  4HCB A;  4N76 A;  4Y1C A;  2HHW A;  3MEE A;  1REV A;  3EYZ A;  4FXD A;  3WNG A;  5KGX A;  4BWM A;  4PWD A;  1NOZ A;  1VK0 A;  4G1Q A;  4CJQ A;  1YTU A;  4E1N A;  2XY5 A;  1D5A A;  1JL1 A;  3WNH A;  4F3O A;  2D0B A;  5SWM A;  3RMA A;  1RBV A;  3KKS A;  3PY8 A;  4Q0B A;  4E7J A;  4CGJ A;  3AA2 A;  3OYE A;  3L2Q A;  4F8R A;  3VA0 A;  4GW6 A;  1C6V A;  1DLO A;  4B9N A;  2Z1G A;  3ZSO A;  4ZHR A;  1ASU A;  4I2P A;  4Z0U A;  3SNN A;  4FJ9 A;  2QXF A;  3AVL A;  3M8R A;  3M8S A;  4EZ6 A;  3AVC A;  3U3Y A;  4I7F A;  3PX0 A;  1TK5 A;  3K5M A;  1RTJ A;  3K57 A;  1BL3 A;  2HHQ A;  1KFS A;  3VQP A;  4CHZ A;  4CEZ A;  3OYK A;  3G0Z A;  3M8P A;  2BGG A;  4R5P A;  2VG7 A;  1HYS A;  1NK5 A;  1LV5 A;  4CHN A;  2O4G A;  4DTS A;  4FLU A;  1RTI A;  3NAE A;  4NCA A;  4K8Z A;  5CZ1 A;  4RW9 A;  5J2P A;  4M42 A;  4N56 A;  1IO2 A;  2VG6 A;  3MEG A;  3AVF A;  1HQE A;  4CHP A;  2XY6 A;  4DSI A;  1EXQ A;  2P1J A;  4CJF A;  3TAF A;  4Y1D A;  3LAL A;  2F8T A;  3CM6 A;  1S1T A;  2IDO A;  3ZT1 A;  1KSP A;  1X9W A;  4DFP A;  3WNE A;  4BE2 A;  1X9M A;  2HMI A;  4CJP A;  4CE9 A;  3NH0 A;  3DM2 A;  4KI4 A;  1B9F A;  1WSE A;  2HB5 A;  3DLG A;  3I0S A;  1BIZ A;  3BGR A;  3ZT4 A;  4IDK A;  2VWJ A;  4DSF A;  1JL2 A;  3QEW A;  4C8K A;  4I2Q A;  1UG8 A;  1S1U A;  1NK4 A;  1B9D A;  1TV6 A;  4KV8 A;  3PX6 A;  5C42 A;  4KHS A;  2DFE A;  3DLR A;  4LSN A;  4LH4 A;  4CGI A;  4W5R A;  4FLV A;  1CXQ A;  1Z26 A;  3QIP A;  3ZT2 A;  3OVN A;  1WSF A;  2FC0 A;  1J54 A;  4CEC A;  4DQQ A;  3RRH A;  5JS2 A;  1U48 A;  2KW4 A;  4CEB A;  4DTO A;  4CF1 A;  1JLC A;  5C25 A;  3QIN A;  1RT5 A;  3ULD A;  1N5Y A;  2BDP A;  1JLB A;  5FDL A;  3TWH A;  3P83 D;  4C8N A;  1RBS A;  4FLW A;  5HP1 A;  1TL3 A;  3HL8 A;  3L2U A;  3CM5 A;  4DMN A;  3V4I A;  4CHY A;  1U4B A;  3T19 A;  1GOC A;  2P51 A;  3AO3 A;  3ITH A;  3L2V A;  2IAJ A;  3ZSR A;  3QEP A;  1BI4 B;  1L5U A;  1QSL A;  1EX4 A;  4KRE A;  4CJ4 A;  3H08 A;  3TAR A;  3TR8 A;  4QOZ B;  1TK8 A;  1HNV A;  1GOB A;  2XRI A;  4CFA A;  4J2B A;  3VQA A;  4UQG A;  3SYZ A;  1VRU A;  1A5V A;  3NE6 A;  4CJU A;  4KFB A;  4FLZ A;  2RF2 A;  4I9L A;  1RBU A;  4J2E A;  1TAQ A;  4O0J A;  4O4G A;  1D9F A;  5FRN A;  4FYD A;  4FJH A;  3O4Q A;  3RMD A;  3AVB A;  3OS2 A;  2CPM A;  3KLI A;  4GVM A;  3LZI A;  3CYM A;  4HUE A;  4BE0 A;  2E4L A;  3MAQ A;  4DTN A;  2IGI A;  3JSM A;  4DSJ A;  1NOY A;  4CF8 A;  1C0U A;  4MFB A;  1ITG A;  3T3F A;  4M3U A;  2G8F A;  2KFN A;  1XHX A;  1WSJ A;  2EHG A;  3HP6 A;  3HVR A;  4KHU A;  3ZSW A;  1QTM A;  4CFC A;  4DQP A;  3SQ2 A;  3HPO A;  3NF7 A;  3NGI A;  2GV9 A;  4TSX A;  2DFF A;  3KK3 A;  3C6U A;  3VQ9 A;  3V6D A;  1RDB A;  4CED A;  2FBV A;  4O0I A;  3DYA A;  3QNO A;  2Y1I A;  4CCH A;  1MSZ A;  4ZTF A;  1C1A A;  1XI1 A;  3V9Z A;  3V1Q A;  3LP0 A;  1TK0 A;  1CLQ A;  3D0P A;  1LAV A;  4OLB A;  5E41 A;  2G8H A;  1QS4 A;  3QEV A;  1WHR A;  1W9H A;  4EZ9 A;  1ZBF A;  4CF0 A;  3V9W A;  1C0M A;  1I3A A;  4HVJ A;  4FM0 A;  1LW2 A;  4RG8 A;  2HHX A;  2DFH A;  1TVR A;  3L3U A;  2HVI A;  3OYM A;  4B8A B;  4DTU A;  3L2R A;  4FZZ A;  2VG5 A;  1DTQ A;  1YT3 A;  4W5O A;  4F2R A;  3IRX A;  4J2A A;  1TKT A;  2XY8 A;  4FLX A;  1TKZ A;  4Z4H A;  4CJK A;  1RTD A;  1J53 A;  1LWC A;  1VSI A;  3MEC A;  4CK3 A;  3HPH A;  1Z25 A;  1KVC A;  4ZTJ A;  4LSL A;  2G8V A;  3B6P A;  4KO0 A;  3FFI A;  4FM2 A;  1FKO A;  4DSE A;  2X74 A;  5K14 A;  3NH1 A;  1CZ9 A;  2BE2 A;  5J2M A;  4KTW A;  3I8D A;  4CEO A;  4ID1 A;  1IG9 A;  2YNF A;  3KJV A;  4B9V A;  4CGF A;  2OPS A;  5D3G A;  3HT3 A;  1JLQ A;  3AVG A;  1ZBI A;  3V9S A;  3DLK A;  3EZ5 A;  4C8O A;  3QO9 A;  5KGW A;  4PY5 A;  3HPG A;  3SPY A;  5HBM A;  1ZYQ A;  1RNH A;  2Z1H A;  4DTR A;  2NUB A;  4RW7 A;  1NK8 A;  1ZBH A;  4M3Z A;  4OPJ A;  3AVJ A;  3E01 A;  1WSH A;  2Z1J A;  4KB1 A;  4BE1 A;  2LSN A;  4IBN A;  2OA8 A;  1A5W A;  1HQU A;  2D0A A;  5DK5 A;  3O3H A;  3VQQ A;  3K5L A;  4CK2 A;  2XY7 A;  3LAN A;  1QSS A;  4N41 A;  4KHY A;  1HYV A;  3OYF A;  3HM9 A;  2G8U A;  4FJM A;  1T8E A;  3KLH A;  1A5X A;  2IS3 A;  3MXJ A;  3LWL A;  2D5R A;  3ZSY A;  4JS4 A;  2IC3 A;  1WAF A;  4QCL A;  1BIU A;  2ZE2 A;  1UOC A;  1C1B A;  3DRP A;  4ELU A;  4CEA A;  2OPP A;  3HYF A;  4DU4 A;  4H4M A;  3CFP A;  1MU2 A;  1YTA A;  4IG0 A;  4FZY A;  3L2W A;  4DF4 A;  4FK2 A;  5CYQ A;  3O3G A;  5SZT A;  2FBY A;  4E19 A;  3LDS A;  4B9T A;  1RBR A;  4RW8 A;  2KTQ A;  4M45 A;  4FJX A;  2AJQ A;  1SUQ A;  1J5O A;  1ASV A;  3U6F A;  4QAG A;  3LP3 A;  2YKM A;  3IG1 A;  1BQN A;  3T1A A;  5I42 A;  3SI6 A;  4PUO A;  4CGD A;  3TAB A;  1JLF A;  3SV4 A;  2XO7 A;  3DMJ A;  3SJJ A;  4DQI A;  4EP4 A;  1R0A A;  1X9S A;  3CFR A;  1WLJ A;  4BAC A;  1Q9Y A;  1IKY A;  1SL1 A;  4W5Q A;  3OS1 A;  4AH9 A;  3ZT3 A;  2OZS A;  4FW2 A;  1NKB A;  4NCG A;  3OY9 A;  3KLF A;  5KI6 A;  3SUN A;  2QKK A;  3DLB A;  3LPT A;  2PYL A;  2QK9 A;  5HRN A;  3KLG A;  4YFU A;  3GKU A;  1JLE A;  1IH7 A;  4O55 A;  4WE1 A;  3RRG A;  2P5O A;  4FJ8 A;  2LRR A;  2XHB A;  4DWI A;  4DSL A;  3L8B A;  2PY5 A;  4FK4 A;  2WON A;  2E6L A;  1GOA A;  4KHW A;  2ZD1 A;  4M3Y A;  2JGU A;  4CJ5 A;  3BDP A;  1VSE A;  2BAN A;  5EU7 A;  4HHT A;  3V81 A;  1QQC A;  3AA3 A;  3AVN A;  2G8W A;  4K8X A;  2A1S A;  3LP1 A;  4W5T A;  1KVA A;  1NKE A;  4OLA A;  1TAU A;  4CFB A;  4HUF A;  4DQS A;  5JS1 A;  3AO5 A;  1TL1 A;  3VN5 A;  5KRS A;  4DLE A;  2HW3 A;  3AO4 A;  4OKJ A;  4CF9 A;  1EP4 A;  2KZM A;  3I0R A;  4IKF A;  1QE1 A;  1S1W A;  2ETJ A;  3AO2 A;  4N5S A;  3K2P A;  1WAJ A;  5HRS A;  3SCX A;  4CES A;  2PYJ A;  1RDA A;  3VQ8 A;  1BHL A;  3LZJ A;  5CY4 A;  3HXM A;  5FRM A;  1U47 A;  4BWJ A;  1RDD A;  3C95 A;  1VSH A;  3LAM A;  4CHQ A;  3SQ1 A;  1S5J A;  3G10 A;  4CGH A;  3MXM A;  3RR7 A;  4FJJ A;  2FBX A;  4FJG A;  1UWB A;  2Y1J A;  1L3U A;  4IFY A;  3VQE A;  4IFV A;  3QEX A;  1Q8I A;  2IOC A;  4CIE A;  4L8R B;  3VQC A;  1RCH A;  3NF6 A;  3ZSZ A;  4AHU A;  4CIG A;  2YNI A;  3VQ5 A;  4B08 A;  4DTM A;  1NJZ A;  3S3O A;  1EKE A;  5J2N A;  1G15 A;  4H8K A;  1X1P A;  4CER A;  3S3M A;  1S1X A;  3F9K A;  3ZT0 A;  4DFJ A;  5KTQ A;  1WSG A;  3LAK A;  2WOM A;  1J9A A;  3NF9 A;  2G8I A;  3KD1 E;  4FK0 A;  1VSJ A;  3DRS A;  1S9G A;  2F96 A;  3OYA A;  2HND A;  3TAP A;  1RT4 A;  3V1O A;  3QNN A;  1RT2 A;  4FJI A;  4DLG A;  1QHT A;  5HRP A;  1VSF A;  3DLE A;  4B9S A;  4IG3 A;  4FCY A;  1YVU A;  4KHN A;  2KQ2 A;  4I9Q A;  3SUO A;  1NK0 A;  4KB0 A;  1B92 A;  1LW0 A;  5KRT A;  2RPI A;  5HLF A;  3QLH A;  3QER A;  1XC9 A;  4RW6 A;  3K58 A;  1FKP A;  1KCF A;  4DU1 A;  5HRR A;  3TAQ A;  4DU3 A;  4W5N A;  3PO5 A;  4DSK A;  4M3T A;  4FVM A;  2YV0 X;  3UIQ A;  4F3T A;  3OYH A;  1JXB A;  1LWE A;  4CGG A;  1SL0 A;  1DTT A;  1KFD A;  3KIO A;  3QIO A;  4E7L A;  2OPQ A;  4KHQ A;  4OJR A;  2OPR A;  3HST B;  3KTQ A;  3THV A;  2A1R A;  3NBP A;  3ZSX A;  2RN2 A;  4OPK A;  1WNS A;  4KKO A;  1HMV A;  3ASM A;  3VQ4 A;  4EP5 A;  1ZBU A;  3JYT A;  4DFM A;  3K5N A;  2HVH A;  4CFD A;  4O44 A;  2OYQ A;  4FJN A;  4DTX A;  3VA3 A;  1WN7 A;  4CK1 A;  4AIL C;  2P5G A;  1RT3 A;  4CJR A;  4H4O A;  4OVL A;  1EET A;  4OGE A;  3K5O A;  1IKX A;  3NCI A;  3OYD A;  2QKB A;  2W42 A;  1S9E A;  1RT6 A;  2JLE A;  2YHA A;  4CEQ A;  4FM1 A;  3S9H A;  1KRP A;  3F73 A;  3SPZ A;  4ELV A;  4F4K A;  1HJR A;  4FJ5 A;  3OJS A;  3AVA A;  4Z4I A;  5J2Q A;  4ID5 A;  1JKH A;  1UA0 A;  1BIS A;  3VQ6 A;  1D8Y A;  1VSM A;  1FK9 A;  1Y97 A;  2B6A A;  1L3T A;  4B3O A;  1XHZ A;  5CZ2 A;  4LD0 A;  3DOL A;  3ZCM A;  4XIU A;  4JS5 A;  3LP2 A;  4LY7 A;  3KK1 A;  3ALY A;  4AHT A;  1S6Q A;  1NJW A;  2GBZ A;  3AVH A;  4N47 A;  2KFZ A;  1VRT A;  4KAZ A;  3TI0 A;  3HP9 A;  1UAX A;  3P5J A;  3SV3 A;  2B4J A;  3ZSV A;  4Z4F A;  1BCM A;  3O4N A;  3VQB A;  1D9D A;  3NH2 A;  3OJU A;  3KKR A;  4Z4C A;  1TKX A;  3PO4 A;  3OS0 A;  2YNG A;  3RMC A;  4FJ7 A;  1NJY A;  3U3G A;  4CEE A;  1HPZ A;  3IS9 A;  4C8M A;  2F8S A;  3LWM A;  1BI4 A;  3QET A;  1U45 A;  4ICL A;  2Q3S A;  1RT7 A;  3HVT A;  3TAM A;  1L3S A;  4E89 A;  1XWL A;  4CJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...