2A1SA

Crystal structure of native parn nuclease domain
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
430
structure length
391
Chain Sequence
MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A)-specific ribonuclease PARN
publication title Structural insight into poly(A) binding and catalytic mechanism of human PARN
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 112
structure length 391
sequence length 430
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2a1sA01
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 2a1sA02
3QNOA 2FC0A 1Z26A 4J2AA 1BI4A 1WSIA 3PX0A 4ZTFA 2B6AA 3S3NA 1EP4A 4KTWA 4FK0A 1IG9A 1QSSA 1TKXA 3OYKA 4HUGA 3B6OA 4O0IA 1N5YA 1GOCA 4KB0A 1ITGA 4FZYA 1S9GA 5HRPA 4AILC 3CFOA 1B92A 1RTHA 4CK3A 2E6MA 3OYBA 2ATQA 5CY4A 3ZSVA 3K5LA 5HRRA 3CFPA 4IG3A 5DMRA 4CEAA 4FW2A 3IRXA 4JS5A 1XI1A 1D9DA 3ASMA 3PUFA 4OKEA 4AHRA 3WNGA 2ZD1A 4W5RA 2ZQBA 4DTOA 4AH9A 3QERA 3IG1A 1SL0A 1ZBHA 2HHWA 2RF2A 1U47A 4B08A 1JXBA 4HVJA 4KPYA 1RT7A 1GOAA 2YV0X 4DSEA 1WN7A 4KHQA 3RWUA 3MXIA 2HVIA 3BGRA 3OS1A 2YNIA 4FLZA 4FLXA 3SQ2A 3CYMA 1FXXA 4DSJA 3L8BA 3ZT1A 1NK4A 4FJ8A 2HHUA 2R7YA 3HK2A 4PY5A 4I2PA 3GKUA 1S5JA 4BE1A 2Y1JA 1KLNA 3RRGA 4HUFA 2HMIA 4FK2A 1BQNA 4M42A 2PYLA 3ZSRA 1SUQA 1QS4A 1NOZA 4RW7A 4IBNA 3I0RA 3U6FA 3G0ZA 3ZT0A 1ZBFA 3DLHA 1JLAA 3DLEA 3MECA 1U49A 4KV8A 4FZZA 3MEGA 3PV8A 4DSIA 1HYVA 4CJEA 1HNVA 4CEOA 1YTUA 3RMDA 4Q0BA 4DU1A 4LH5A 4KKOA 2PY5A 4W5NA 2IAJA 2HNDA 3OYLA 4DFMA 1T05A 3RMCA 4ELUA 2FBTA 4LSLA 2O4IA 1TKZA 2XRIA 3OYFA 2KZZA 4KHNA 5FROA 3TAQA 4M41A 1X9MA 3LP2A 2IC3A 1EXQA 3L2VA 3THVA 1LW2A 3VA0A 3SI6A 4FJ9A 1TK8A 4E7JA 4UQGA 3NE6A 4HUEA 1TK5A 1NOYA 3O4NA 4M45A 4FVMA 1D5AA 4CHPA 4HCCA 3NH2A 4C8KA 1I3AA 3FFIA 3NGZA 1ZBLA 3LP0A 3PY8A 4GMJB 4LY7A 4DWIA 1KRPA 1HPZA 4FJ7A 1WLJA 4BE0A 3QEVA 2HNZA 1IKXA 2IGIA 3SV3A 3AVLA 4E7KA 4QCLA 4FW1A 1RBTA 1LWEA 1VSFA 4CJUA 1G15A 4CF9A 5KRTA 1NK6A 3V1QA 5SZTA 3KTQA 1NK8A 5HRSA 1ASUA 3A2FA 4FK4A 2HB5A 1XHZA 1WSGA 4CK2A 4CJKA 1MSZA 3HO1A 1EX4A 1VRTA 5CYQA 4AHVA 5C42A 2X6NA 1X1PA 4BE2A 3RRHA 3D45A 3V9ZA 1RT3A 4KREA 5C24A 4E1MA 4B9TA 4EP4A 2HHVA 4CGIA 3OYHA 3V6DA 4M3UA 3UIQA 1HYSA 3D0PA 4KHUA 4DFKA 4AHTA 1QSLA 3LPUA 2X6SA 1L3UA 3LP3A 3PO4A 3HVRA 4CEQA 4E1NA 5KGXA 3DLRA 1J9AA 3S3MA 3DOKA 2G8IA 3KK3A 1RTIA 3SQ4A 2EHGA 1C6VA 3AVGA 3ZSXA 1U48A 4O55A 4O5BA 1QTMA 4DSFA 4FM1A 1S1XA 3NHGA 4FJKA 4BWMA 3S9HA 2D0BA 1BL3A 5FDLA 4BDPA 1U04A 2LRRA 1RILA 1HJRA 3TABA 1BHLA 3QLHA 3SPZA 2HNYA 1X9WA 3P5JA 1IKVA 4RW9A 2Z1IA 3OYEA 1NKBA 2HHSA 3AO5A 4M3WA 4G1QA 1VSKA 4CEEA 4DMNA 3HXMA 3TWHA 1B9DA 1KVCA 2D0CA 1S9EA 4CJ4A 4Q5VA 1JKHA 3VQ6A 4AHCA 4OLBA 4OVLA 4J2EA 1UWBA 4CGGA 4LH4A 3K5MA 1VSIA 4B8AB 4CFDA 4DTSA 3OYCA 3ZSYA 4FJ5A 4KHSA 4B9UA 3LWLA 1VSDA 4DTRA 1L3VA 4M3TA 4B3OA 1IKYA 4CEDA 4DSKA 3HPGA 1RBVA 3SUQA 4O0JA 3MEDA 4Z0UA 2OPSA 1UA0A 1JLFA 4C8OA 4GW6A 2KFZA 1KLMA 1WSHA 3TAFA 2VWJA 5J2NA 1A5VA 4DTUA 4NYNA 4CCHA 4FJLA 2XY6A 2OPPA 3V1OA 3MAQA 4J2DA 3TANA 3LWMA 3TR8A 3LAMA 3NBPA 1NK0A 2XY8A 3M8QA 1DTTA 3KLFA 4OPKA 3VN5A 4KHYA 4FJNA 2KFNA 1C0UA 1TVRA 2FBXA 3EYZA 1BI4B 3U3GA 3KJVA 3AA5X 4CEBA 3K58A 3LP1A 1F21A 4FJXA 2WONA 3KK2A 4DLEA 4DTXA 3E01A 1L3TA 1TKTA 1WSFA 4H4MA 3JYTA 1QSYA 4CEFA 4DS4A 4CFBA 3KIOA 3HSTB 4C8MA 3AA3A 4K8ZA 3ZT4A 2YKMA 3QEWA 3V81A 1NJXA 2YNFA 3NGIA 4HHTA 3HM9A 1TGOA 1CZBA 3O4QA 4DU4A 2W42A 4CJTA 2G8WA 3ZT2A 4M3YA 3ZSQA 3L2UA 3DYAA 3KLEA 3CM6A 2PYJA 1NJZA 4B8CA 3T3FA 2QXFA 5HRNA 3AVHA 2IDOA 1ZYQA 5JS2A 3VA3A 4DFJA 5HP1A 1LAVA 3AVIA 3QEPA 2KW4A 2OYQA 4DU3A 3OYAA 1KFSA 4EZ9A 1S1TA 4WE1A 4CECA 2YNHA 3LANA 3HPOA 1FKOA 4ICLA 2X74A 3KLIA 1DTQA 1JLBA 3QEIA 4ZTJA 3OYDA 1YVUA 1CZ9A 2XHBA 2G8KA 1REVA 2GV9A 3SUPA 3K5OA 1NK9A 4C8LA 1D8YA 4RG8A 3OJSA 4FLTA 1LWFA 1TL3A 3MXJA 2DY4A 5CZ1A 4LD0A 3LZJA 4CHQA 3L2RA 2QK9A 4KAZA 3NGYA 3S3OA 1VSEA 4DS5A 1RDCA 3AV9A 3HP9A 1ASVA 3OJUA 3NDKA 4DLGA 5E41A 3SZ2A 4FXDA 1DLOA 3P1GA 1IH7A 1W9HA 3K59A 3NFAA 4E3SA 4CHYA 3DM2A 2Q3SA 3L2WA 3AO3A 5HROA 4CJFA 2FBVA 1RBSA 1SL1A 1RNHA 3P83D 4ID1A 1RTDA 1UOCA 1IKWA 4CHNA 4DTJA 3OYJA 3TAEA 4J2BA 3L2QA 2YHAA 1ZBUA 3LDSA 1Q9XA 4ELTA 4KTQA 3PX6A 1WAJA 1O1WA 1TAQA 2OPQA 4EP5A 1KSPA 3DLBA 4BDYA 5I3UA 4HCBA 1T7PA 3TAMA 4Z4EA 1JLEA 1J53A 4OJRA 4Y1CA 1BQMA 3O3GA 1WSJA 4FLWA 3SV4A 4YNQA 3V9XA 4CGDA 4H8KA 4RW6A 1FK9A 3CQ8A 1S6PA 1BCMA 3F73A 4JRQA 3QETA 4KI6A 3MXMA 4Z4GA 4E0DA 1LWCA 1ASWA 1I39A 3CM5A 3KKSA 3LZIA 2PZSA 4I7FA 4IG0A 3DLGA 4IFYA 4BWJA 1VSJA 1HNIA 3QINA 4FJGA 5SWMA 3AVKA 3ZSZA 3CG7A 1LW0A 4OLAA 1JL2A 3NF7A 3HJFA 3QEXA 4NCBA 1RTJA 1HRHA 1C1AA 1U45A 2G8VA 4L8RB 4M3ZA 2F8SA 3VQAA 3HL8A 4CIEA 3QO9A 1JLQA 4QAGA 4Z4IA 1L5UA 4CK1A 3QESA 1Q8IA 1SKRA 3OYNA 1QE1A 5JS1A 3JSMA 1WHRA 4FLYA 3AVMA 3QIOA 3KKRA 2P1JA 3RTVA 1HQUA 4F3TA 5T7BA 2DFHA 4KFBA 3VQ5A 4OPJA 1RDBA 3C6TA 5HBMA 3OS0A 4CEZA 1N6QA 1RDAA 3G10A 1S1UA 4NYFA 3AVAA 3K57A 3LALA 3DMJA 1ZBIA 3PX4A 4PQUA 4CJSA 2F8TA 3EY1A 2P51A 4Z4FA 5DK5A 5KGWA 3SYZA 4DTPA 4W5OA 5J1EA 3VQDA 3CFRA 3SNNA 2JGUA 2AJQA 4B9MA 4F4KA 4LSNA 4CF1A 4W5QA 4FJHA 2HHXA 4IDKA 3AVCA 1SKSA 2HHTA 4QOZB 1KVBA 1XWLA 1SL2A 3V4IA 3T1AA 2F96A 4OGCA 3VQ7A 2KTQA 5KI6A 1J5OA 3AO4A 4CHOA 1EETA 4B9VA 4K8XA 1UA1A 1T03A 2ITGA 3HVTA 2Z1JA 3AO1A 3EZ5A 1JLGA 3NAEA 2LSNA 2HHQA 2DFEA 4EZ6A 4F8RA 1CXQA 1RT1A 1BIZA 4FYDA 1C1CA 3OVNA 4BACA 5J2MA 4CFAA 1UAXA 2NUBA 3AA4A 2RPIA 1QQCA 4MFBA 3QIPA 3TI0A 1X9SA 1D9FA 4B9SA 3KLHA 1VSLA 3BDPA 1TAUA 4CJVA 2DFFA 1C0TA 4DSLA 3VQPA 4DG1A 4CHZA 1NKEA 1VK0A 2B5JA 4DQRA 1Q9YA 3NF8A 3M8SA 3AO2A 3C95A 1BIUA 2ZE2A 1Y97A 2BANA 4E7LA 4CIGA 4DQSA 3O3HA 2GBZA 5CZ2A 5CYMA 4Z4HA 3OS2A 4KB1A 4FJMA 4CIFA 4FLUA 3V9UA 2VG5A 1IO2A 2GUIA 1KFDA 1RCHA 3C6UA 2BGGA 1YTAA 2KQ2A 3O3FA 3K2PA 4FM2A 1TKDA 2HVHA 1WSEA 1VSHA 3V1RA 5EU7A 1JXEA 4CF8A 1RT6A 4YFUA 3SQ0A 4CJPA 1RDDA 2VG6A 4CJRA 4DTNA 1NKCA 4DQPA 4ID5A 4F3OA 3TAPA 3VQ9A 1W0HA 4NCAA 5C25A 2CPMA 4FCYA 3SJJA 2Z1HA 4FJJA 4N41A 1WAFA 5FRNA 3F9KA 1EKEA 4PA1A 1JLCA 2ETJA 3VQQA 1RT4A 3AVJA 1C1BA 3U3YA 3DRPA 4I9LA 3WNFA 1TL1A 3NH0A 2XY5A 3ZT3A 4MQ3A 3ZSOA 2JLEA 2RN2A 3OY9A 1NK5A 2B4JA 2D0AA 4DQIA 2YNGA 3VQEA 1GOBA 1KVAA 4KTZA 3WNEA 3H08A 3NH1A 4BDZA 5J2QA 1HYZA 3SUOA 4CJ3A 1XC9A 4JLHA 3M8PA 3HP6A 4PUOA 1T8EA 3TAGA 4KO0A 3SCXA 4PWDA 3V9SA 4KRFA 2VWKA 4CF0A 1TK0A 1CLQA 2E4LA 1RT5A 4N5SA 2D5RA 4RW8A 4CJ5A 3V9WA 3DI6A 4CE9A 2G8UA 3C94A 3RR7A 3ZSWA 4H4OA 2Z1GA 4E19A 2BDPA 1C0MA 3LAKA 2DTUA 3MEEA 3WNHA 3ISNC 3SQ1A 4TSXA 4R5PA 3I8DA 3T19A 1RBRA 1VRUA 4Y1DA 3M8RA 4RW4A 3OYIA 4FM0A 1KCFA 4CJWA 4KI4A 1S6QA 1RT2A 3NF9A 4JRPA 1B9FA 2FBYA 3KD5E 1Z25A 3IS9A 4E7IA 4F2RA 1WNSA 3DLKA 4XIUA 4M3XA 2I5JA 1LV5A 1S1VA 4N47A 3OYMA 4DQQA 1L3SA 2A1SA 2OPRA 3HPHA 3ZCMA 3HT3A 2P5OA 3L3UA 3AA2A 2VG7A 1S1WA 4IKFA 4DF4A 4F2SA 5K14A 4CFCA 3VQCA 1SV5A 3I0SA 2RKIA 4CGHA 3KK1A 5J2PA 4ZHRA 2OA8A 4B9NA 4FJIA 4KHWA 1VSMA 5KTQA 4CESA 3KLGA 2EX3A 4OKJA 5FRMA 4DF8A 3ULDA 3VQ8A 3RMAA 1U4BA 4N76A 4I2QA 5KRSA 4DFPA 2G8FA 1R0AA 1J54A 2X78A 2XY7A 3DRSA 1BCOA 1MU2A 4CGFA 2IS3A 2YHBA 1HMVA 3DRRA 4Z4CA 2O4GA 2A1RA 1K6YA 3KD1E 1CXUA 1BISA 2XO7A 2BE2A 3NCIA 3SPYA 3DOLA 5D3GA 4OGEA 3PO5A 4CGJA 4ELVA 3TARA 4OKKA 1KTQA 4GVMA 4M3RA 1YT3A 1A5WA 4CJQA 4CERA 4AHUA 4JS4A 4C8NA 1NJWA 2QKKA 1QHTA 3RR8A 2WOMA 2OZSA 3VQ4A 3HYFA 2P5GA 1RBUA 1NK7A 1BGXT 2G8HA 4DTMA 3OYGA 4I9QA 4HTUA 1JL1A 1A5XA 1HQEA 1XHXA 3ALYA 3AVBA 4O4GA 1UG8A 3RMBA 3IAYA 3K5NA 1NJYA 2QKBA 1TV6A 2YKNA 4N56A 4FZXC 2IOCA 3NF6A 3AVNA 4O44A 4E7HA 2Y1IA 3VQBA 5I42A 4E89A 1SKWA 4B9LA 4CJLA 2OZMA 2HW3A 3L3VA 3QNNA 1LAWA 2E6LA 3B6PA 4AHSA 3SUNA 3AVFA 4W5TA 5HLFA 2KZMA 3LPTA 4NCGA 3ITHA 4FLVA 4CF2A 1FKPA 4IFVA
chains in the Genus database with same CATH superfamily
3ATUA 2E3UA 3PX0A 5TKWA 4KTWA 1QSSA 4O0IA 3P31A 2O8DA 1GOCA 3D7EO 1ITGA 4H03B 4FZYA 1K8AO 3CFOA 3OYBA 2ATQA 3VEOA 4F8RA 1XI1A 2YJFA 1D9DA 1Y64A 3ASMA 4W5RA 4AHRA 4O8UA 3WNGA 3PLAA 3QERA 3T1HH 1XUPO 4B08A 3R6MA 1ODHA 3C6HA 4DV2K 2YV0X 1WN7A 4QS9A 4NLCA 4JI0H 3CYMA 4DSJA 1U6ZA 1NK4A 4FJ8A 3WQTA 1EC6A 2Y1JA 1KLNA 1VQ7N 4HUFA 1BQNA 3WQUA 5TKYA 3ZSRA 1NOZA 4RW7A 4IBNA 2A42A 2QWMA 3K0SA 3ZT0A 3JXUA 4H5TA 1U49A 4KV8A 3AGKA 1HYVA 4DSIA 4U67L 4KKOA 2PY5A 3QICA 3OYLA 4DFMA 4YY3K 3CQYA 2FBTA 3KWIA 1NM1A 2QWQA 3LP2A 2IC3A 3VA0A 4HCCA 3FFIA 3PIPL 2UXCH 4BE0A 3QEVA 1HKGA 3A0IX 3M6GA 1PQXA 1TUUA 4M7YA 4YOXA 2F4VK 2PQUA 4FW1A 4GKJK 1T6DA 1XMQK 4FK4A 2Q0RA 1OH8A 5BR9A 1Q86O 1MSZA 5LJVA 3K9JA 5C24A 4ILJA 3O9RA 2I7PA 2FSNA 1WVNA 3SJHA 5KPRA 3CCRN 3UIQA 1GLJO 4KHPK 3DAWA 5AZJB 5H1SQ 2ZJPL 4AHTA 2X6SA 1XC3A 1L3UA 4YDUC 3ZEUA 4H5RA 4E1NA 2G8IA 3CJ7A 4BRNA 3SQ4A 2EHGA 3I33A 3CMEN 5C2DA 1S1XA 2O8CB 3J80O 3P39A 3S9HA 1IBLH 1X0AA 1HJRA 3CC4N 5I9EB 1X9WA 1N32K 1WBDA 3OYEA 3WXLA 2HHSA 5DT9A 1N8RO 2D0CA 1KVCA 4Q5VA 1S9EA 4H5NA 4B3SK 5AJ3K 5AQZA 3GABA 4A5BA 4CGGA 2ZF5O 2P9LB 1ATSA 3ZSYA 4B9UA 3LWLA 1L3VA 4JI7H 4DSKA 4WCEL 1KC8O 4Z0UA 4X64K 4GW6A 1KLMA 3RF2A 5CE3A 5B8HA 4CCHA 2XY6A 3U8XA 4LFBH 4PL7A 3AARA 3TR8A 4A61A 1YJ9N 2E88A 4NZTM 4OPKA 2Q97A 3SAFA 2KFNA 3VEXA 1C0UA 3GG4A 2BTFA 3GDQA 3U3GA 1BUPA 3LP1A 4FJXA 1KAXA 4GVEA 3KK2A 4DTXA 3E01A 1GLAG 1TKTA 4FWSA 5BRHA 3KIOA 4WFAL 3CCEN 4C8MA 3AA3A 5LMUH 4DR5K 3E9LA 1ZBSA 3V81A 3VKEA 1TGOA 1CZBA 2M6QA 3MN5A 4M3YA 4AF1A 2PT7G 2PYJA 4LF6H 4B1XB 2YQRA 5GIPA 1NNEA 4B1ZA 5JS2A 2HH3A 2CWFA 4WQ4A 4EZ9A 3LANA 4EAHD 1NGCA 1FKOA 4EHTA 4DR4H 3L4QA 4EHUA 1E3MA 4ZTJA 1V9NA 1YVUA 4DV5H 4FOIA 3SBTA 3L0QA 5AQNA 1NGFA 2BA0A 4RG8A 4BC2A 4LF4K 2JWKA 4CD1A 4A57A 2DY4A 4IFEA 1EWRA 2ZGZA 4CHQA 3V69A 4B8TA 3S3OA 1VSEA 5GAEP 3AEVB 3HP9A 3OJUA 4DLGA 5E41A 3P1GA 3CCMN 5JLHA 1VQ5N 4CBUA 2NRWA 3DM2A 4CJFA 1I94K 2AXYA 1IKWA 4B3MK 4DR6K 3L2QA 2P9PB 4ELTA 1SAZA 5LMNH 3QD7X 3SB1A 4LF9K 5JVGL 2A3ZA 2ZGYA 4B3TH 4NXMH 2NRZA 4DV1K 4CZJA 1T7PA 4B1VA 4DR2H 4YNQA 3VENA 2NRXA 3VPZA 3CQ8A 2OCEA 4X65H 2P2RA 4BR9A 4IG0A 4BWJA 4IFYA 4YORA 2CWHA 4CZKA 5SWMA 4ISEA 3AVKA 5JVHL 1JL2A 2UUBK 2ITMA 1HRHA 2G8VA 2CTEA 3I8BA 3EN9A 3MX5A 2UUCK 1JLQA 2W41A 3M3ZA 1Q8IA 3JSMA 3QIOA 4DB3A 2QWNA 4F3TA 4OPJA 3A8YA 1XNQK 3TPQA 3C6TA 4CEZA 3G10A 4NYFA 4XH4A 1U2VA 3PX4A 1YJNN 4CJSA 2F8TA 4DTPA 5J1EA 3SNNA 4JKCA 4BC3A 1H1VA 1VBIA 4B9MA 5F1XA 4FJHA 2P9IA 4QOZB 1XWLA 2V7YA 3U4LA 3I56N 4WALA 4CD3A 5KI6A 3AO4A 3I55N 4B9VA 1MWKA 2Z1JA 3AO1A 1ATRA 1YVNA 1NGEA 2HHQA 2JEAI 2DFEA 5AFUH 3UOEA 4FWOA 3P4IA 2Q2RA 1C1CA 3OVNA 4BACA 4CFAA 1UAXA 2NUBA 2RPIA 2D4WA 2YHWA 3KLHA 3DXKA 1NKEA 4CHZA 2FMRA 1HX1A 1X3NA 1YAGA 3C95A 1DGKN 4CIGA 3O3HA 5CZ2A 2KLAA 4KB1A 4FLUA 3V9UA 2HMPA 1OH6A 1YTAA 1WSEA 1VSHA 3FE1A 3V1RA 4YFUA 1NKCA 2VG6A 4BRLA 3VQ9A 1J6ZA 5FRNA 1WAFA 4PA1A 3VQQA 2ETJA 4B3RH 4JI4K 3VGMA 4AQYK 3VF2A 1LCUA 2ASMA 3O9QA 3ZSOA 1NK5A 4JKGA 1HPMA 1KVAA 1LOTB 4B9QA 1VHXA 4DV0K 1C0GA 2FF6A 3HP6A 4PWDA 3V9SA 1YHQN 4LFAK 2VWKA 4CF0A 3ZLJA 1CLQA 4N5SA 3JS6A 4YHHK 2D5RA 4CJ5A 3M5RA 3V9WA 3DI6A 2E2QA 5EOYA 3JAMO 3RR7A 3ZSWA 2Z1GA 4E19A 5DM6L 2DTUA 2HH2A 2YHXA 3SAGA 4R5PA 4Y1DA 4RW4A 1WBBA 3OYIA 4DR3K 4XH5A 2UUAH 4KI4A 1RT2A 3FGUA 4JRPA 1B9FA 2FBYA 2HBJA 3IS9A 1VQKN 4M3XA 4XIUA 5EY4A 1YUWA 5K36G 1QQNA 1S1VA 1QQMA 3OHRA 4GY2B 3HBTA 4N47A 3TTCA 3ZCMA 2P5OA 3L3UA 1X4MA 2VG7A 3MX2A 3OW2M 4F2SA 2VQFH 4KHQA 2RKIA 3OTOH 3LDLA 4Z94A 4ZHRA 1J5KA 1U4BA 3VQ8A 5AQRA 2O8FB 3KVGA 2CGJA 4DUYK 2X78A 1NMDA 1HMVA 2YHBA 3DRRA 4JD2A 1X9JA 3KD1E 1BG3A 2DPNA 3UKRA 1BISA 5GAGP 3NCIA 2E8AA 1N33K 4GKKK 3DOLA 2O8EA 3AGRA 3L4IA 4ELVA 3TARA 4I6MA 1A5WA 3AAQA 2O4CA 1RBUA 4BR7A 1BGXT 2FFMA 5M1QA 1JL1A 3AVBA 2UU9H 2I7NA 3IAYA 3NF6A 1SKWA 3AVNA 3CCLN 2QM1A 4E89A 2OZMA 1LAWA 3A5OC 3B6PA 4FPAA 4AHSA 3THWA 5EX5A 4EC5A 2KZMA 4NCGA 3L7ZC 4JVHA 4LF8K 1FKPA 1Q81O 4BRIA 4J2AA 3VF6A 3S3NA 2VCPA 4MO4A 1TKXA 3OYKA 2FXUA 3B6OA 2CTFA 3EEQA 1IBKH 1OVQA 2W40A 1S9GA 5HRPA 1NGJA 1VIGA 2E6MA 4DR1H 3ID6A 4JS5A 5HRRA 3EKUA 4CEAA 5CHIA 2ZD1A 4DTOA 3J80W 3IG1A 4OO1J 3O1WA 1U47A 2V51B 1JXBA 5EXWA 1GOAA 1TYQA 4DSEA 3RWUA 2O8DB 3OS1A 2YNIA 3BEXA 5ADXA 3ZT1A 1TUYA 3O1BA 3HK2A 3GKUA 1RGIA 4BE1A 3T1YK 2OPUA 3A5MC 1SUQA 3FAUA 1ZZIA 4BRFA 3U6FA 3HZ6A 2IIRA 3DLEA 3MECA 4FZZA 5A2QO 4LF7K 1YJWN 3RMDA 4W5NA 1KQSM 1T05A 2O4IA 2GTDA 4BGBA 2E5LH 2XRIA 4JKBA 4KHNA 4H0VB 1ZTGA 5FROA 1X9MA 3L2VA 1LW2A 4FJ9A 2KTQA 1TK8A 4E7JA 1TK5A 1NOYA 4PDBA 3O4NA 4FVMA 4CHPA 4LF5K 3NH2A 2ZM6K 4C8KA 2QW9A 3PY8A 4GMJB 4LY7A 1S22A 1KRPA 3GE1A 1HKBA 1WLJA 2UXDK 1IKXA 3SV3A 4QCLA 3VOVA 2HOEA 1VSFA 3WEEA 5KRTA 1NK6A 5SZTA 2E20A 5HRSA 1ASUA 2HB5A 3LDPA 5BR8H 1EX4A 5C42A 3UKUA 3QFPA 3A5NC 3D45A 5AQTA 4YOWA 1RT3A 1GLLO 4J8FA 2YCHA 3E9PA 2K1HA 1HYSA 2YI1A 4H0TB 3OBWA 4DV6H 2QI2A 2BH1A 3CPWM 3ZX2A 1N36H 4UY8O 3S3MA 2LTMA 4H0PA 3KK3A 4JK9A 1RTIA 4OX9H 2UXBH 1C6VA 2NRHA 4BQLA 5FDLA 5AQYA 4DV2H 1RILA 4JKEA 3P5JA 5AQWA 3TTFA 2Z1IA 1TUAA 3CXCM 3AO5A 4M3WA 3R1XA 3ZEUB 2QWOA 4CJ4A 3D6RA 1JKHA 4AHCA 4LH4A 3HOSA 1QVFM 4FOEA 4B8AB 4DTSA 4AIMA 3ID8A 1RBVA 3KWGA 1GLEG 2OPSA 1UA0A 2KFZA 1WSHA 1GLCG 3TAFA 1XNRH 2VWJA 5J2NA 2OPPA 4J2DA 5JEAG 1M1KO 3LWMA 2F7TA 3NBPA 3D2FA 4YY3H 1OKJA 4F9OA 3KLFA 4KHYA 1MA9B 4BC4A 2AA4A 3RSEB 4CW7B 2FBXA 3EYZA 1K8KA 2OANA 1BI4B 3J81O 2O8BA 3KJVA 4IO8A 2VQEK 1HKCA 2WONA 4DLEA 2HHUA 3CI5A 1VQLN 3H1VX 4CFBA 1BWFO 4JI2K 3O9SA 3HSTB 4H0YB 3EE8A 4K8ZA 3ZT4A 4ISFA 2F4VH 3QEWA 1NJXA 4HHTA 4MLEA 3O4QA 3J8AA 4DU4A 4CJTA 1XMQH 3BF3A 3H3OB 3ZSQA 1R59O 4DV4K 4JI1K 4OD6A 2HF4A 1NJZA 2QXFA 5HRNA 4JYAK 3AVHA 2IDOA 2NRRA 5HP1A 1ZZKA 1LAVA 3QEPA 4X66K 2KW4A 3E9OA 3MMVA 3OYAA 1KFSA 1S1TA 5AQMA 2YNHA 4O8KA 4KHPH 4K0KK 3W3DA 2X74A 2Q0UA 2WFBA 3C0BA 2FPHX 3QEIA 2XHBA 1CZ9A 4Y0WA 2G8KA 1REVA 2VGNA 5AQQA 1NK9A 4C8LA 1QZ5A 3OJSA 5C12A 5AQXA 3LZJA 2CTLA 3VF4A 2Y3MA 4DS5A 4OPHA 4GV6A 1ASVA 4FXDA 1W9HA 4BRCA 2H3GX 3NFAA 4E3SA 2D9IA 4B3SH 4CHYA 3L2WA 4NLBA 2FBVA 5LY3A 1SL1A 1CZAN 1YITN 3T1HK 3W0LA 2M8WA 4JAXA 4CHNA 4J2BA 4G08A 4B8CD 1NG9A 2Q36A 4OPAA 3CCSN 4X64H 1KSPA 4EP5A 3DLBA 3MN7A 4BDYA 4JI0K 1VQ4N 3R3LA 4HCBA 2MJHA 3TAMA 4NXNK 3O3GA 1BQMA 2QKKA 1WSJA 4FLWA 1ILYA 4CGDA 1SZ2A 1FK9A 2D0PA 4KI6A 3F73A 4Z4GA 3MXMA 3AY9A 3MDQA 1I39A 5AQOA 1HNIA 3VTIA 3RVCA 1LW0A 3NF7A 5C10A 4NCBA 3HJFA 4NB4A 1U45A 1C1AA 4M3ZA 4CZGA 2F8SA 3TSUA 4BR0A 4WYBA 2D0OA 4CIEA 3QO9A 5AQHA 4QS7A 3JAMW 4QAGA 4Z4IA 4CK1A 2GWJA 2HBKA 1SKRA 3OYNA 2CTJA 2JE6I 2PFUA 1WHRA 4FLYA 4WQ4C 2QXLA 2P1JA 3DXMA 4H5VA 2DFHA 3VQ5A 4DV7K 3KDKA 3OS0A 3VGLA 1N6QA 1RDAA 4A2BA 1S1UA 1QQOA 3C7NB 3DMJA 2UXCK 5JLFA 4DUZH 2P51A 4Z4FA 5KGWA 1XQSC 1J5EK 4F4KA 4CF1A 4W5QA 2HHXA 1SKSA 3ZYYX 2HHTA 1KVBA 3FZLA 1SL2A 1YXQA 3P38A 2NLXA 1G99A 4CZMA 2F96A 3VQ7A 3KDGA 4CHOA 1U2VB 2QWRA 1UA1A 2ITGA 3HVTA 1KD1O 1JLGA 4FWQA 4EZ6A 3HOTA 4JK8A 1CXQA 1BIZA 4JKAA 5KPTA 4CZHA 3AA4A 4MFBA 1QQCA 3QIPA 1X9SA 2CTKA 2P9IB 4BR5A 4B9SA 1NXUA 1VSLA 2HHHK 3VQPA 3NF8A 3QBXA 2BANA 4DQSA 5CYMA 1IBLK 2OTLN 1KFDA 3HRGA 5GINA 2HVHA 2KQ2A 1MWMA 1TKDA 5EU7A 1JXEA 4DTNA 1WB9A 3CJBA 4NCAA 3BF1A 4XEIA 4FJJA 2Z1HA 3DXKB 2ANNA 4IEIA 2FSJA 4BRDA 1S3XA 5EVZA 1S20A 2FLOA 4DQ8A 3WNFA 4I9LA 3THXB 1TL1A 4BRQA 4JI7K 3NMUA 2RN2A 4A2AA 2YNGA 1GOBA 3NH1A 5J2QA 3H08A 3SUOA 1HYZA 1XC9A 4JLHA 3LM2A 4KO0A 3QB0A 2F9TA 3ZETA 4H4OA 1C0MA 3MEEA 2PAVA 3ISNC 5C2FA 3SQ1A 5E26A 1VRUA 3PIOL 4JKGB 4FM0A 1BA1A 1D4XA 4F2RA 4WFNL 1GLBG 1Z25A 4E7IA 1LV5A 3LDQA 2ANRA 2A1SA 2OPRA 3HPHA 5LMUK 2X06A 3AA2A 4R79A 1S1WA 4KBOA 1Z2IA 5K14A 4B9TA 3VQCA 4JHDA 4LF6K 3FZHA 1T6CA 5KTQA 4PHTX 3J7AK 2IVPA 4AM6A 4OKJA 2E2OA 4DF8A 5KRSA 1W97L 4DFPA 2G8FA 1R0AA 3IUCA 1J54A 5KQDA 1MU2A 4CGFA 1K6YA 3PSFA 2PY9A 2JVZA 4A62A 4LFCH 4FWKA 4WF9L 5D3GA 3D2EA 3C6AA 4CGJA 1ZC6A 4M3RA 2P9LA 4AHUA 1NJWA 3WT0A 2OZSA 1QHTA 2WOMA 1AN7A 1NGBA 2P9NB 3HYFA 3ZX0A 1NK7A 2P5GA 4LIJA 4DTMA 2RE2A 3IMXA 4HTUA 4I9QA 3ALYA 4JI8K 4JD2B 3UKRB 2YKNA 2LF0A 4O44A 2O8EB 5AQVA 3L3VA 3QNNA 3U1KA 2E6LA 1HNXK 4I6MB 4X62H 4JI4H 5HLFA 4JKHA 3ITHA 4CF2A 4V19S 5C15A 1D8YA 4G9ZA 1Z26A 5LMNK 4ZTFA 2B6AA 3PSIA 4B3TK 1K73O 1EP4A 3J7ZO 5AQPA 2A41A 5F0XA 1N5YA 4YHHH 4KB0A 5M1FA 4DR2K 3F5TA 4AILC 4X65K 4CK3A 3THWB 1SS6A 3BY5A 1F0XA 5CY4A 3K5LA 3CFPA 5DMRA 4BROA 3IRXA 3PUFA 3LL3A 2P9UB 4AH9A 1ZBHA 1SL0A 3R8EA 1KHMA 5IT9O 2QTDA 5JMVA 4DR3H 4HVJA 1RT7A 3MXIA 3BGRA 4BVPA 4FLXA 3SQ2A 1FXXA 3L8BA 4PY5A 1KAZA 2HMIA 4FK2A 3OETA 4FWMA 1VQ8N 1Q18A 3U9DA 1QS4A 4BRPA 1VQNN 4XH1A 2BUPA 3WXKA 4DV3K 1ZBFA 3CC2N 1Q7YO 4JV5K 3PV8A 4BRAA 4CJEA 1HNVA 3Q7BA 3O80A 1YTUA 4Q0BA 4WANA 4LH5A 1NGGA 3ULEB 2HNDA 3TSPA 1N33H 1QVGM 3N4QA 4M41A 5AZIA 3J81W 3THVA 3SI6A 4UQGA 4HUEA 1D5AA 4DR7K 3UE5A 3LP0A 5JICA 4DWIA 2P9KA 4YOYA 4IDHA 2CTMA 4JVYA 3AVLA 2EWSA 1RBTA 1LWEA 1O13A 4CJUA 4CF9A 3KTQA 5IWAH 3GOIA 3V1QA 1WSGA 4CK2A 4CJKA 1RFQA 3HO1A 2IVNA 2WUSA 1HNZH 2X6NA 3VESA 1X1PA 3HM8A 4WFBL 4BE2A 3RRHA 3V9ZA 4E1MA 4K43A 1IV0A 2V7ZA 5LL6Z 4A59A 3CF5L 4EP4A 1NGIA 2GELA 4CGIA 3M1FA 3V6DA 4M3UA 5BPMA 4DFKA 4BREA 3WEEB 1QSLA 3LPUA 4BR4A 4PKGA 5FLXO 3T7ZA 5M1KA 4B3RK 1J9AA 3DOKA 5LJWA 3UKUB 2IVOA 1U48A 4O55A 4O5BA 1QTMA 4EIAA 4FM1A 4FJKA 4BWMA 2LRRA 2PBDA 1BL3A 4BDPA 1U04A 3TABA 3SPZA 3EO3A 1IKVA 3O4WA 4MDBA 4CJ7A 4G1QA 4DMNA 2QWLA 3TWHA 4JI5K 1N34H 2W6LA 3VGKA 1P8ZA 5BPNA 5AQLA 3T1YH 4J2EA 1UWBA 3VETA 4CFDA 4IFDG 1IKYA 4CEDA 2UUAK 4O0JA 3CJAA 3MEDA 4JI6H 4C8OA 4WQ5A 2D1KA 3MCAB 1ESVA 4JNEA 4IOCL 4LF7H 1A5VA 4NYNA 4IO9L 3U9ZA 1JCFA 3V1OA 3MAQA 1FW6A 3LAMA 2XY8A 3EL2A 4H8AA 2CH5A 2ASOA 3VN5A 3OTOK 1K9MO 4FJNA 4O5FA 1I6UA 3MN9A 4CZIA 1IBMK 3AA5X 4BG9A 5ADXH 3K58A 2CH6A 4NO7A 1F21A 1QSYA 3ENHA 4H4MA 3JYTA 4JI3H 4CEFA 4DS4A 4IEEA 3D2FB 1XMOH 2YKMA 2YNFA 3NGIA 3HM9A 4CZFA 4U7BA 2W42A 3BZCA 2G8WA 3ZT2A 3F2KA 3DYAA 1IG8A 3OBYA 3H46O 3KLEA 3L2UA 2ZQEA 3T3FA 1NLVA 2O8BB 1ZYQA 1BOTO 1VQ6N 4MO5A 4DU3A 3R9PA 4GV3A 2UU9K 3HPOA 2WTUA 4BRKA 4ICLA 1SQKA 2FF3B 2HBMA 4BRGA 3CCVN 3Q7CA 5BREA 1JLBA 2GV9A 3SUPA 1WUAA 3MK6A 3K5OA 3VEVA 3UB5A 4FLTA 1LWFA 1TL3A 5CZ1A 3HTVA 4JK7A 2HF3A 3L2RA 1K1GA 1WOQA 4DCHA 1RDCA 3HI0A 3AV9A 1IBKK 3MWPA 3SZ2A 1DLOA 3CPEA 1IH7A 3K59A 1DKGD 2QWPA 4IOXA 3BUZB 2Q3SA 4OCHA 3AO3A 2VWBA 3SLCA 4CBWA 1RBSA 2Q31A 2LTLA 1RNHA 3P83D 4DKWA 4ID1A 1RTDA 3SMPA 1QHAA 3E1YA 4FPBA 4DTJA 1ZBUA 3LDSA 1Q9XA 3EKSA 5AQFA 1HNWK 4OO1G 3A5LC 5HOOA 5I3UA 4Z4EA 2A40A 1J53A 4H8KA 4RW6A 2G8YA 1ASWA 3LZIA 3CM5A 4PL8A 4QS8A 2PZSA 4I7FA 3DLGA 3QINA 3ZSZA 3QEXA 4NZRM 2VQEH 3ATVA 3CETA 3HL8A 1OVYA 1VQ9N 3QESA 5JS1A 2E5LK 3AVMA 3LM9A 3O8MA 3CCUN 3RTVA 1X4NA 1HQUA 4H0OA 3I0PA 4FWNA 4JI1H 4GNIA 5HBMA 1OH5A 4JYAH 3GR5A 3K57A 3AVAA 4X66H 1NGDA 1ZBIA 1V4TA 3LDNA 4PQUA 3KK7A 1HR0K 1FJGK 4BC5A 4W5OA 2FSKA 4FWRA 4IDKA 3AVCA 1JCGA 1BU6O 3ZX3A 4GV9A 3CIPA 3T1AA 1WE8A 5BR8K 5KPZA 4OGCA 1KXPA 1J5OA 3VEZA 4K8XA 5AR0A 3IDHA 5FPDA 3NAEA 2LSNA 3THYA 4FYDA 5J2MA 2QK9A 4DV6K 1NGHA 1ZZJA 4BRMA 1N36K 4CJVA 1TAUA 4GKJH 1C0TA 4DSLA 4DG1A 2B5JA 4OX9K 2UXBK 3FZKA 4ISGA 1BIUA 2ZE2A 1Y97A 4E7LA 5E84A 2GBZA 3MWTA 4Z4HA 3OS2A 3EZJA 1IO2A 2GUIA 4JN4A 3O3FA 1RT6A 4CJPA 4CJRA 4F3OA 4ID5A 3TAPA 1W0HA 2CPMA 5C25A 4NXNH 3EE9A 4FCYA 1DEJA 3F9KA 1EKEA 1RT4A 3S41A 1C1BA 3U3YA 3DRPA 4BRHA 3NH0A 2CPQA 3ZT3A 1EO1A 5C0XG 4DQIA 2B4JA 2D0AA 3VQEA 4KTZA 4CJ3A 3M8PA 4PUOA 3TAGA 3SCXA 1XNRK 4KRFA 1TK0A 1N32H 2E4LA 1QZ6A 3TSQA 4CE9A 3CCJN 2VYPA 4CZEA 3CHWA 3C94A 3LAKA 3WNHA 4E9JA 5IT9W 1RBRA 4DV7H 3M8RA 1VIHA 1KCFA 2OTJN 5KQ8A 3ZETB 3OYMA 1L3SA 1NGAA 3HT3A 1J5EH 4IKFA 2GUPA 3KK1A 5J2PA 3I0SA 2OA8A 4EFHA 2CGLA 1VSMA 5BRFA 4CESA 3MCPA 1P90A 2EX3A 2NZTA 3ULDA 4DHYA 2XY7A 4FVUA 4FWLA 2IS3A 2A1RA 1NJIO 2O4GA 2XO7A 4B1UB 3VEWA 4DR5H 1YI2N 3FLCO 2P9SA 1NMNA 2HHHH 4JHDB 3WXJA 1KTQA 3DLLL 5AQGA 4CJQA 5AQUA 3O9UA 4CERA 4C8NA 5BRDA 4JS4A 3RR8A 4KPYA 2HBLA 1NBWA 3VQ4A 2BL5A 4IJNA 1HQEA 1XHXA 3J7AP 4O4GA 1UG8A 3RMBA 3K5NA 1NJYA 2QKBA 3NCVA 1X9ZA 4CZLA 4N56A 2IOCA 4H5WA 4E7HA 1E4GT 4MDAA 1JCEA 4B9LA 3D2EB 4CJLA 3AVFA 4W5TA 1EQYA 1RDWX 3CD6N 2DGRA 3I8DA 2V52B 3QNOA 2FC0A 4LF4H 3RSEA 1BI4A 1WSIA 1W2BM 3WXMB 3E66A 1VQON 4FK0A 1IG9A 4RTFD 3SAHA 4HUGA 4JEPA 5FLXW 1M90O 5GAHP 3TU5A 4PKHA 1B92A 1RTHA 2YX6A 3ZSVA 4BY9C 2E1ZA 3O9TA 4IG3A 4FW2A 4OKEA 1I94H 2ZQBA 1KAYA 4BVOA 1Z05A 2HHWA 2RF2A 4B3MH 4DR6H 4YDUA 1X3MA 4LF9H 1ZXOA 4QMFB 2HVIA 2QA4N 4FLZA 4DV1H 2KHOA 3SK3A 2R7YA 4I2PA 1S5JA 3RRGA 5C0YA 4KH5A 4M42A 2PYLA 3QBWA 4IWVA 3EZWA 3ENBA 3FFKB 3I0RA 3WUHA 3G0ZA 1OH7A 3DLHA 2CGKA 1JLAA 2UUBH 4JKFA 3MEGA 2ZJQL 4DUZK 4CEOA 4LFBK 2UUCH 4DU1A 1BA0A 2IAJA 2W6KA 2NN6G 3RMCA 4A5AA 1ATNA 4ELUA 4LSLA 1TKZA 4C23A 3OYFA 2KZZA 3TAQA 1EXQA 1VQMN 1XNQH 2F9WA 1RDUA 3NE6A 2E2PA 4M45A 1I3AA 3NGZA 1ZBLA 3DWLA 3SBGA 4FJ7A 1HPZA 3IFRA 1T44A 2HNZA 3H3NO 2E1YA 3FZFA 4JI8H 4YOTA 2IGIA 3G6EN 4E7KA 1XRHA 2JEBI 5AZJA 1G15A 1NK8A 3A2FA 5AZIB 1XHZA 1HNXH 3IKMA 4IZ9A 4BQZA 2WC9A 1VRTA 5CYQA 4AHVA 3H45C 5GIOA 5A2QW 4FWPA 2Z0SA 2JZXA 4KREA 2P9KB 2O8CA 2HHVA 3OYHA 5BN9A 5AQJA 1DT9A 3D0PA 4KHUA 4DR4K 4DV5K 3LP3A 3PO4A 3HVRA 4CEQA 3OA9A 2GWKA 3DLRA 5KGXA 1T3VA 5FPMA 2QNDA 3ZSXA 3AVGA 4PKIA 3G25A 3QDKA 4DSFA 3NHGA 2D0BA 2J4RA 3C7NA 1BHLA 3QLHA 2HNYA 4RW9A 1NKBA 2AP1A 1NU0A 1VAZA 1VSKA 4CEEA 3HXMA 1B9DA 3GBTA 4K42A 3VERA 3NVMA 3VQ6A 4OLBA 4ILGB 1YF5L 4OVLA 1DTJA 3K5MA 1VSIA 4AQYH 3OYCA 4FJ5A 4KHSA 1VSDA 4DTRA 4M3TA 4B3OA 3HPGA 3SUQA 5AQIA 4DV3H 4DV0H 1JLFA 3O6WA 4NXMK 2JA9A 4JV5H 4DTUA 5CR4A 3MN6A 4FJLA 4LFAH 5ELZA 1SEIA 3TANA 4CBXA 1NK0A 3M8QA 5AQKA 1DTTA 4FJUA 3DJCA 1TVRA 5M1PA 2KKZA 4CEBA 4DR7H 4BR2A 4YOUA 1L3TA 1WSFA 5DM7L 3G71N 4ILHA 3CMAN 2NRTA 1JJ2M 4LFCK 5AFUA 3T69A 5MLCQ 2UYTA 5LL6b 1YIJN 3WXIA 3CM6A 4B8CA 3THXA 3VA3A 4DFJA 3CC7N 3AVIA 1TYQB 2OYQA 2ZWHA 4JKDA 4WE1A 4CECA 4IOAL 1MDUB 4DUYH 3ENOA 3KLIA 3HSCA 1DTQA 1S72N 4GKKH 3OYDA 4X62K 4NBQA 1Q82O 3CCQN 3MXJA 4LD0A 5M1OA 2P9PA 4KAZA 3FR0A 3NGYA 3CJ9A 5M1NA 3L6QA 3NDKA 4JI5H 4WQ5C 5HROA 4BA2I 1UOCA 2HSTA 4LF8H 3OYJA 2GEMA 3TAEA 2RHKA 2YHAA 4KTQA 3PX6A 1WAJA 3GL1A 1O1WA 1TAQA 2OPQA 4FJSA 5FPNA 1JLEA 4Y1CA 4OJRA 3O5BA 5BPLA 3SV4A 3V9XA 4JRQA 1S6PA 1BCMA 3QETA 4E0DA 1LWCA 3KKSA 3F9MA 5HL7L 1VSJA 4FJGA 1Z6RA 4H0XB 4OLAA 3CG7A 4B1WB 2OPVA 4LC9B 1IBMH 1RTJA 2P9NA 4L8RB 3VQAA 4HTLA 3SMSA 1S03G 1L5UA 1QE1A 4BG8A 3KKRA 2ASPA 1HJOA 4C1NI 5T7BA 4KFBA 2Q1NA 1HUXA 3H1QA 1RDBA 3VMFB 4BGAA 2NNWA 2ZJRL 3LALA 3EY1A 4L3QA 5DK5A 3SYZA 3BP8A 4E1JA 1GLDG 3VQDA 3CFRA 2AJQA 2JGUA 2VKCA 4LSNA 5IWAK 5F2RA 5AQSA 2VQFK 3V4IA 4RWTA 1HNZK 1E4FT 4RCHA 2P9UA 1EETA 1T03A 1V4SA 4LF5H 3TTDA 2ZM6H 3EZ5A 3AAPA 1RT1A 2UXDH 1GLFO 1D9FA 3TI0A 4K41A 1NWKA 4AM3A 4BA1I 3BDPA 2DFFA 3N4PA 1FKAH 3NVKA 1VK0A 4DQRA 1Q9YA 3M8SA 3AO2A 1K8KB 4HWIA 1BDGA 4M63C 4FJMA 4CIFA 2VG5A 3C6UA 1RCHA 4CVNE 3THYB 2BGGA 3O08A 1HNWH 4FM2A 3K2PA 2YHYA 1IJJA 4CF8A 3SQ0A 3KZBA 4N76A 4IJAA 4DQPA 1RDDA 1N34K 3ULEA 3SJJA 4N41A 1JLCA 1EWQA 2E2NA 3AVJA 3BZKA 4IXCA 3CJCA 4KH4A 1C0FA 4YOVA 2XY5A 4MQ3A 2JLEA 3OY9A 3J7YP 3WNEA 4JI6K 4BDZA 3KHYA 1T8EA 1RT5A 4RW8A 4FL9A 2G8UA 1DT4A 2QEXN 4DR1K 2JWLA 2BDPA 3OSSD 4M7XA 1J4WA 4TSXA 3T19A 2YJEA 3FZMA 4CJWA 1S6QA 3NF9A 1W7AA 3KD5E 1VQPN 1WNSA 3DLKA 2I5JA 3LDOA 4JI3K 5GADP 2O8FA 1HR0H 1FJGH 4DQQA 1XMOK 1BO5O 4DF4A 4CFCA 4CGHA 1SV5A 4FJIA 4B9NA 3C65A 4K25A 4KHWA 3H6EA 3KLGA 3QFUA 3VTHA 5FRMA 2NRVA 2WBNA 3RMAA 2VGMA 3G4SN 4I2QA 4KH6A 3DRSA 1BCOA 4Z4CA 3QMLA 3K9KA 4FSVA 4JI2H 1CXUA 2BE2A 4CI6A 3SPYA 3CQXA 2A6AA 2A5XA 4AM7A 5FPEA 4OGEA 4FO0A 3PO5A 4OKKA 4DV4H 4GVMA 1YT3A 1V8CA 3CJ1A 3B8AX 4B1YB 2G8HA 5BN8A 3OYGA 1WTJA 1A5XA 1TV6A 4FZXC 4K0KH 3CERA 2P9SB 2Y1IA 5I42A 4MLHA 3VQBA 2HW3A 3DXMB 3SUNA 3VEYA 3LPTA 4C1NK 1HLUA 4FLVA 2GX9A 4IFVA
chains in the Genus database with same CATH topology
3QNOA 2FC0A 1Z26A 4J2AA 1BI4A 1WSIA 3PX0A 4ZTFA 2B6AA 3S3NA 1EP4A 4KTWA 4FK0A 1IG9A 1QSSA 1TKXA 3OYKA 4HUGA 3B6OA 4O0IA 1N5YA 1GOCA 4KB0A 1ITGA 4FZYA 1S9GA 5HRPA 4AILC 3CFOA 1B92A 1RTHA 4CK3A 2E6MA 3OYBA 2ATQA 5CY4A 3ZSVA 3K5LA 5HRRA 3CFPA 4IG3A 5DMRA 4CEAA 4FW2A 3IRXA 4JS5A 1XI1A 1D9DA 3ASMA 3PUFA 4OKEA 4AHRA 3WNGA 2ZD1A 4W5RA 2ZQBA 4DTOA 4AH9A 3QERA 3IG1A 1SL0A 1ZBHA 2HHWA 2RF2A 1U47A 4B08A 1JXBA 4HVJA 4KPYA 1RT7A 1GOAA 2YV0X 4DSEA 1WN7A 4KHQA 3RWUA 3MXIA 2HVIA 3BGRA 3OS1A 2YNIA 4FLZA 4FLXA 3SQ2A 3CYMA 1FXXA 4DSJA 3L8BA 3ZT1A 1NK4A 4FJ8A 2HHUA 2R7YA 3HK2A 4PY5A 4I2PA 3GKUA 1S5JA 4BE1A 2Y1JA 1KLNA 3RRGA 4HUFA 2HMIA 4FK2A 1BQNA 4M42A 2PYLA 3ZSRA 1SUQA 1QS4A 1NOZA 4RW7A 4IBNA 3I0RA 3U6FA 3G0ZA 3ZT0A 1ZBFA 3DLHA 1JLAA 3DLEA 3MECA 1U49A 4KV8A 4FZZA 3MEGA 3PV8A 4DSIA 1HYVA 4CJEA 1HNVA 4CEOA 1YTUA 3RMDA 4Q0BA 4DU1A 4LH5A 4KKOA 2PY5A 4W5NA 2IAJA 2HNDA 3OYLA 4DFMA 1T05A 3RMCA 4ELUA 2FBTA 4LSLA 2O4IA 1TKZA 2XRIA 3OYFA 2KZZA 4KHNA 5FROA 3TAQA 4M41A 1X9MA 3LP2A 2IC3A 1EXQA 3L2VA 3THVA 1LW2A 3VA0A 3SI6A 4FJ9A 1TK8A 4E7JA 4UQGA 3NE6A 4HUEA 1TK5A 1NOYA 3O4NA 4M45A 4FVMA 1D5AA 4CHPA 4HCCA 3NH2A 4C8KA 1I3AA 3FFIA 3NGZA 1ZBLA 3LP0A 3PY8A 4GMJB 4LY7A 4DWIA 1KRPA 1HPZA 4FJ7A 1WLJA 4BE0A 3QEVA 2HNZA 1IKXA 2IGIA 3SV3A 3AVLA 4E7KA 4QCLA 4FW1A 1RBTA 1LWEA 1VSFA 4CJUA 1G15A 4CF9A 5KRTA 1NK6A 3V1QA 5SZTA 3KTQA 1NK8A 5HRSA 1ASUA 3A2FA 4FK4A 2HB5A 1XHZA 1WSGA 4CK2A 4CJKA 1MSZA 3HO1A 1EX4A 1VRTA 5CYQA 4AHVA 5C42A 2X6NA 1X1PA 4BE2A 3RRHA 3D45A 3V9ZA 1RT3A 4KREA 5C24A 4E1MA 4B9TA 4EP4A 2HHVA 4CGIA 3OYHA 3V6DA 4M3UA 3UIQA 1HYSA 3D0PA 4KHUA 4DFKA 4AHTA 1QSLA 3LPUA 2X6SA 1L3UA 3LP3A 3PO4A 3HVRA 4CEQA 4E1NA 5KGXA 3DLRA 1J9AA 3S3MA 3DOKA 2G8IA 3KK3A 1RTIA 3SQ4A 2EHGA 1C6VA 3AVGA 3ZSXA 1U48A 4O55A 4O5BA 1QTMA 4DSFA 4FM1A 1S1XA 3NHGA 4FJKA 4BWMA 3S9HA 2D0BA 1BL3A 5FDLA 4BDPA 1U04A 2LRRA 1RILA 1HJRA 3TABA 1BHLA 3QLHA 3SPZA 2HNYA 1X9WA 3P5JA 1IKVA 4RW9A 2Z1IA 3OYEA 1NKBA 2HHSA 3AO5A 4M3WA 4G1QA 1VSKA 4CEEA 4DMNA 3HXMA 3TWHA 1B9DA 1KVCA 2D0CA 1S9EA 4CJ4A 4Q5VA 1JKHA 3VQ6A 4AHCA 4OLBA 4OVLA 4J2EA 1UWBA 4CGGA 4LH4A 3K5MA 1VSIA 4B8AB 4CFDA 4DTSA 3OYCA 3ZSYA 4FJ5A 4KHSA 4B9UA 3LWLA 1VSDA 4DTRA 1L3VA 4M3TA 4B3OA 1IKYA 4CEDA 4DSKA 3HPGA 1RBVA 3SUQA 4O0JA 3MEDA 4Z0UA 2OPSA 1UA0A 1JLFA 4C8OA 4GW6A 2KFZA 1KLMA 1WSHA 3TAFA 2VWJA 5J2NA 1A5VA 4DTUA 4NYNA 4CCHA 4FJLA 2XY6A 2OPPA 3V1OA 3MAQA 4J2DA 3TANA 3LWMA 3TR8A 3LAMA 3NBPA 1NK0A 2XY8A 3M8QA 1DTTA 3KLFA 4OPKA 3VN5A 4KHYA 4FJNA 2KFNA 1C0UA 1TVRA 2FBXA 3EYZA 1BI4B 3U3GA 3KJVA 3AA5X 4CEBA 3K58A 3LP1A 1F21A 4FJXA 2WONA 3KK2A 4DLEA 4DTXA 3E01A 1L3TA 1TKTA 1WSFA 4H4MA 3JYTA 1QSYA 4CEFA 4DS4A 4CFBA 3KIOA 3HSTB 4C8MA 3AA3A 4K8ZA 3ZT4A 2YKMA 3QEWA 3V81A 1NJXA 2YNFA 3NGIA 4HHTA 3HM9A 1TGOA 1CZBA 3O4QA 4DU4A 2W42A 4CJTA 2G8WA 3ZT2A 4M3YA 3ZSQA 3L2UA 3DYAA 3KLEA 3CM6A 2PYJA 1NJZA 4B8CA 3T3FA 2QXFA 5HRNA 3AVHA 2IDOA 1ZYQA 5JS2A 3VA3A 4DFJA 5HP1A 1LAVA 3AVIA 3QEPA 2KW4A 2OYQA 4DU3A 3OYAA 1KFSA 4EZ9A 1S1TA 4WE1A 4CECA 2YNHA 3LANA 3HPOA 1FKOA 4ICLA 2X74A 3KLIA 1DTQA 1JLBA 3QEIA 4ZTJA 3OYDA 1YVUA 1CZ9A 2XHBA 2G8KA 1REVA 2GV9A 3SUPA 3K5OA 1NK9A 4C8LA 1D8YA 4RG8A 3OJSA 4FLTA 1LWFA 1TL3A 3MXJA 2DY4A 5CZ1A 4LD0A 3LZJA 4CHQA 3L2RA 2QK9A 4KAZA 3NGYA 3S3OA 1VSEA 4DS5A 1RDCA 3AV9A 3HP9A 1ASVA 3OJUA 3NDKA 4DLGA 5E41A 3SZ2A 4FXDA 1DLOA 3P1GA 1IH7A 1W9HA 3K59A 3NFAA 4E3SA 4CHYA 3DM2A 2Q3SA 3L2WA 3AO3A 5HROA 4CJFA 2FBVA 1RBSA 1SL1A 1RNHA 3P83D 4ID1A 1RTDA 1UOCA 1IKWA 4CHNA 4DTJA 3OYJA 3TAEA 4J2BA 3L2QA 2YHAA 1ZBUA 3LDSA 1Q9XA 4ELTA 4KTQA 3PX6A 1WAJA 1O1WA 1TAQA 2OPQA 4EP5A 1KSPA 3DLBA 4BDYA 5I3UA 4HCBA 1T7PA 3TAMA 4Z4EA 1JLEA 1J53A 4OJRA 4Y1CA 1BQMA 3O3GA 1WSJA 4FLWA 3SV4A 4YNQA 3V9XA 4CGDA 4H8KA 4RW6A 1FK9A 3CQ8A 1S6PA 1BCMA 3F73A 4JRQA 3QETA 4KI6A 3MXMA 4Z4GA 4E0DA 1LWCA 1ASWA 1I39A 3CM5A 3KKSA 3LZIA 2PZSA 4I7FA 4IG0A 3DLGA 4IFYA 4BWJA 1VSJA 1HNIA 3QINA 4FJGA 5SWMA 3AVKA 3ZSZA 3CG7A 1LW0A 4OLAA 1JL2A 3NF7A 3HJFA 3QEXA 4NCBA 1RTJA 1HRHA 1C1AA 1U45A 2G8VA 4L8RB 4M3ZA 2F8SA 3VQAA 3HL8A 4CIEA 3QO9A 1JLQA 4QAGA 4Z4IA 1L5UA 4CK1A 3QESA 1Q8IA 1SKRA 3OYNA 1QE1A 5JS1A 3JSMA 1WHRA 4FLYA 3AVMA 3QIOA 3KKRA 2P1JA 3RTVA 1HQUA 4F3TA 5T7BA 2DFHA 4KFBA 3VQ5A 4OPJA 1RDBA 3C6TA 5HBMA 3OS0A 4CEZA 1N6QA 1RDAA 3G10A 1S1UA 4NYFA 3AVAA 3K57A 3LALA 3DMJA 1ZBIA 3PX4A 4PQUA 4CJSA 2F8TA 3EY1A 2P51A 4Z4FA 5DK5A 5KGWA 3SYZA 4DTPA 4W5OA 5J1EA 3VQDA 3CFRA 3SNNA 2JGUA 2AJQA 4B9MA 4F4KA 4LSNA 4CF1A 4W5QA 4FJHA 2HHXA 4IDKA 3AVCA 1SKSA 2HHTA 4QOZB 1KVBA 1XWLA 1SL2A 3V4IA 3T1AA 2F96A 4OGCA 3VQ7A 2KTQA 5KI6A 1J5OA 3AO4A 4CHOA 1EETA 4B9VA 4K8XA 1UA1A 1T03A 2ITGA 3HVTA 2Z1JA 3AO1A 3EZ5A 1JLGA 3NAEA 2LSNA 2HHQA 2DFEA 4EZ6A 4F8RA 1CXQA 1RT1A 1BIZA 4FYDA 1C1CA 3OVNA 4BACA 5J2MA 4CFAA 1UAXA 2NUBA 3AA4A 2RPIA 1QQCA 4MFBA 3QIPA 3TI0A 1X9SA 1D9FA 4B9SA 3KLHA 1VSLA 3BDPA 1TAUA 4CJVA 2DFFA 1C0TA 4DSLA 3VQPA 4DG1A 4CHZA 1NKEA 1VK0A 2B5JA 4DQRA 1Q9YA 3NF8A 3M8SA 3AO2A 3C95A 1BIUA 2ZE2A 1Y97A 2BANA 4E7LA 4CIGA 4DQSA 3O3HA 2GBZA 5CZ2A 5CYMA 4Z4HA 3OS2A 4KB1A 4FJMA 4CIFA 4FLUA 3V9UA 2VG5A 1IO2A 2GUIA 1KFDA 1RCHA 3C6UA 2BGGA 1YTAA 2KQ2A 3O3FA 3K2PA 4FM2A 1TKDA 2HVHA 1WSEA 1VSHA 3V1RA 5EU7A 1JXEA 4CF8A 1RT6A 4YFUA 3SQ0A 4CJPA 1RDDA 2VG6A 4CJRA 4DTNA 1NKCA 4DQPA 4ID5A 4F3OA 3TAPA 3VQ9A 1W0HA 4NCAA 5C25A 2CPMA 4FCYA 3SJJA 2Z1HA 4FJJA 4N41A 1WAFA 5FRNA 3F9KA 1EKEA 4PA1A 1JLCA 2ETJA 3VQQA 1RT4A 3AVJA 1C1BA 3U3YA 3DRPA 4I9LA 3WNFA 1TL1A 3NH0A 2XY5A 3ZT3A 4MQ3A 3ZSOA 2JLEA 2RN2A 3OY9A 1NK5A 2B4JA 2D0AA 4DQIA 2YNGA 3VQEA 1GOBA 1KVAA 4KTZA 3WNEA 3H08A 3NH1A 4BDZA 5J2QA 1HYZA 3SUOA 4CJ3A 1XC9A 4JLHA 3M8PA 3HP6A 4PUOA 1T8EA 3TAGA 4KO0A 3SCXA 4PWDA 3V9SA 4KRFA 2VWKA 4CF0A 1TK0A 1CLQA 2E4LA 1RT5A 4N5SA 2D5RA 4RW8A 4CJ5A 3V9WA 3DI6A 4CE9A 2G8UA 3C94A 3RR7A 3ZSWA 4H4OA 2Z1GA 4E19A 2BDPA 1C0MA 3LAKA 2DTUA 3MEEA 3WNHA 3ISNC 3SQ1A 4TSXA 4R5PA 3I8DA 3T19A 1RBRA 1VRUA 4Y1DA 3M8RA 4RW4A 3OYIA 4FM0A 1KCFA 4CJWA 4KI4A 1S6QA 1RT2A 3NF9A 4JRPA 1B9FA 2FBYA 3KD5E 1Z25A 3IS9A 4E7IA 4F2RA 1WNSA 3DLKA 4XIUA 4M3XA 2I5JA 1LV5A 1S1VA 4N47A 3OYMA 4DQQA 1L3SA 2A1SA 2OPRA 3HPHA 3ZCMA 3HT3A 2P5OA 3L3UA 3AA2A 2VG7A 1S1WA 4IKFA 4DF4A 4F2SA 5K14A 4CFCA 3VQCA 1SV5A 3I0SA 2RKIA 4CGHA 3KK1A 5J2PA 4ZHRA 2OA8A 4B9NA 4FJIA 4KHWA 1VSMA 5KTQA 4CESA 3KLGA 2EX3A 4OKJA 5FRMA 4DF8A 3ULDA 3VQ8A 3RMAA 1U4BA 4N76A 4I2QA 5KRSA 4DFPA 2G8FA 1R0AA 1J54A 2X78A 2XY7A 3DRSA 1BCOA 1MU2A 4CGFA 2IS3A 2YHBA 1HMVA 3DRRA 4Z4CA 2O4GA 2A1RA 1K6YA 3KD1E 1CXUA 1BISA 2XO7A 2BE2A 3NCIA 3SPYA 3DOLA 5D3GA 4OGEA 3PO5A 4CGJA 4ELVA 3TARA 4OKKA 1KTQA 4GVMA 4M3RA 1YT3A 1A5WA 4CJQA 4CERA 4AHUA 4JS4A 4C8NA 1NJWA 2QKKA 1QHTA 3RR8A 2WOMA 2OZSA 3VQ4A 3HYFA 2P5GA 1RBUA 1NK7A 1BGXT 2G8HA 4DTMA 3OYGA 4I9QA 4HTUA 1JL1A 1A5XA 1HQEA 1XHXA 3ALYA 3AVBA 4O4GA 1UG8A 3RMBA 3IAYA 3K5NA 1NJYA 2QKBA 1TV6A 2YKNA 4N56A 4FZXC 2IOCA 3NF6A 3AVNA 4O44A 4E7HA 2Y1IA 3VQBA 5I42A 4E89A 1SKWA 4B9LA 4CJLA 2OZMA 2HW3A 3L3VA 3QNNA 1LAWA 2E6LA 3B6PA 4AHSA 3SUNA 3AVFA 4W5TA 5HLFA 2KZMA 3LPTA 4NCGA 3ITHA 4FLVA 4CF2A 1FKPA 4IFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QNO A;  2FC0 A;  1Z26 A;  4J2A A;  1BI4 A;  1WSI A;  3PX0 A;  4ZTF A;  2B6A A;  3S3N A;  1EP4 A;  4KTW A;  4FK0 A;  1IG9 A;  1QSS A;  1TKX A;  3OYK A;  4HUG A;  3B6O A;  4O0I A;  1N5Y A;  1GOC A;  4KB0 A;  1ITG A;  4FZY A;  1S9G A;  5HRP A;  4AIL C;  3CFO A;  1B92 A;  1RTH A;  4CK3 A;  2E6M A;  3OYB A;  2ATQ A;  5CY4 A;  3ZSV A;  3K5L A;  5HRR A;  3CFP A;  4IG3 A;  5DMR A;  4CEA A;  4FW2 A;  3IRX A;  4JS5 A;  1XI1 A;  1D9D A;  3ASM A;  3PUF A;  4OKE A;  4AHR A;  3WNG A;  2ZD1 A;  4W5R A;  2ZQB A;  4DTO A;  4AH9 A;  3QER A;  3IG1 A;  1SL0 A;  1ZBH A;  2HHW A;  2RF2 A;  1U47 A;  4B08 A;  1JXB A;  4HVJ A;  4KPY A;  1RT7 A;  1GOA A;  2YV0 X;  4DSE A;  1WN7 A;  4KHQ A;  3RWU A;  3MXI A;  2HVI A;  3BGR A;  3OS1 A;  2YNI A;  4FLZ A;  4FLX A;  3SQ2 A;  3CYM A;  1FXX A;  4DSJ A;  3L8B A;  3ZT1 A;  1NK4 A;  4FJ8 A;  2HHU A;  2R7Y A;  3HK2 A;  4PY5 A;  4I2P A;  3GKU A;  1S5J A;  4BE1 A;  2Y1J A;  1KLN A;  3RRG A;  4HUF A;  2HMI A;  4FK2 A;  1BQN A;  4M42 A;  2PYL A;  3ZSR A;  1SUQ A;  1QS4 A;  1NOZ A;  4RW7 A;  4IBN A;  3I0R A;  3U6F A;  3G0Z A;  3ZT0 A;  1ZBF A;  3DLH A;  1JLA A;  3DLE A;  3MEC A;  1U49 A;  4KV8 A;  4FZZ A;  3MEG A;  3PV8 A;  4DSI A;  1HYV A;  4CJE A;  1HNV A;  4CEO A;  1YTU A;  3RMD A;  4Q0B A;  4DU1 A;  4LH5 A;  4KKO A;  2PY5 A;  4W5N A;  2IAJ A;  2HND A;  3OYL A;  4DFM A;  1T05 A;  3RMC A;  4ELU A;  2FBT A;  4LSL A;  2O4I A;  1TKZ A;  2XRI A;  3OYF A;  2KZZ A;  4KHN A;  5FRO A;  3TAQ A;  4M41 A;  1X9M A;  3LP2 A;  2IC3 A;  1EXQ A;  3L2V A;  3THV A;  1LW2 A;  3VA0 A;  3SI6 A;  4FJ9 A;  1TK8 A;  4E7J A;  4UQG A;  3NE6 A;  4HUE A;  1TK5 A;  1NOY A;  3O4N A;  4M45 A;  4FVM A;  1D5A A;  4CHP A;  4HCC A;  3NH2 A;  4C8K A;  1I3A A;  3FFI A;  3NGZ A;  1ZBL A;  3LP0 A;  3PY8 A;  4GMJ B;  4LY7 A;  4DWI A;  1KRP A;  1HPZ A;  4FJ7 A;  1WLJ A;  4BE0 A;  3QEV A;  2HNZ A;  1IKX A;  2IGI A;  3SV3 A;  3AVL A;  4E7K A;  4QCL A;  4FW1 A;  1RBT A;  1LWE A;  1VSF A;  4CJU A;  1G15 A;  4CF9 A;  5KRT A;  1NK6 A;  3V1Q A;  5SZT A;  3KTQ A;  1NK8 A;  5HRS A;  1ASU A;  3A2F A;  4FK4 A;  2HB5 A;  1XHZ A;  1WSG A;  4CK2 A;  4CJK A;  1MSZ A;  3HO1 A;  1EX4 A;  1VRT A;  5CYQ A;  4AHV A;  5C42 A;  2X6N A;  1X1P A;  4BE2 A;  3RRH A;  3D45 A;  3V9Z A;  1RT3 A;  4KRE A;  5C24 A;  4E1M A;  4B9T A;  4EP4 A;  2HHV A;  4CGI A;  3OYH A;  3V6D A;  4M3U A;  3UIQ A;  1HYS A;  3D0P A;  4KHU A;  4DFK A;  4AHT A;  1QSL A;  3LPU A;  2X6S A;  1L3U A;  3LP3 A;  3PO4 A;  3HVR A;  4CEQ A;  4E1N A;  5KGX A;  3DLR A;  1J9A A;  3S3M A;  3DOK A;  2G8I A;  3KK3 A;  1RTI A;  3SQ4 A;  2EHG A;  1C6V A;  3AVG A;  3ZSX A;  1U48 A;  4O55 A;  4O5B A;  1QTM A;  4DSF A;  4FM1 A;  1S1X A;  3NHG A;  4FJK A;  4BWM A;  3S9H A;  2D0B A;  1BL3 A;  5FDL A;  4BDP A;  1U04 A;  2LRR A;  1RIL A;  1HJR A;  3TAB A;  1BHL A;  3QLH A;  3SPZ A;  2HNY A;  1X9W A;  3P5J A;  1IKV A;  4RW9 A;  2Z1I A;  3OYE A;  1NKB A;  2HHS A;  3AO5 A;  4M3W A;  4G1Q A;  1VSK A;  4CEE A;  4DMN A;  3HXM A;  3TWH A;  1B9D A;  1KVC A;  2D0C A;  1S9E A;  4CJ4 A;  4Q5V A;  1JKH A;  3VQ6 A;  4AHC A;  4OLB A;  4OVL A;  4J2E A;  1UWB A;  4CGG A;  4LH4 A;  3K5M A;  1VSI A;  4B8A B;  4CFD A;  4DTS A;  3OYC A;  3ZSY A;  4FJ5 A;  4KHS A;  4B9U A;  3LWL A;  1VSD A;  4DTR A;  1L3V A;  4M3T A;  4B3O A;  1IKY A;  4CED A;  4DSK A;  3HPG A;  1RBV A;  3SUQ A;  4O0J A;  3MED A;  4Z0U A;  2OPS A;  1UA0 A;  1JLF A;  4C8O A;  4GW6 A;  2KFZ A;  1KLM A;  1WSH A;  3TAF A;  2VWJ A;  5J2N A;  1A5V A;  4DTU A;  4NYN A;  4CCH A;  4FJL A;  2XY6 A;  2OPP A;  3V1O A;  3MAQ A;  4J2D A;  3TAN A;  3LWM A;  3TR8 A;  3LAM A;  3NBP A;  1NK0 A;  2XY8 A;  3M8Q A;  1DTT A;  3KLF A;  4OPK A;  3VN5 A;  4KHY A;  4FJN A;  2KFN A;  1C0U A;  1TVR A;  2FBX A;  3EYZ A;  1BI4 B;  3U3G A;  3KJV A;  3AA5 X;  4CEB A;  3K58 A;  3LP1 A;  1F21 A;  4FJX A;  2WON A;  3KK2 A;  4DLE A;  4DTX A;  3E01 A;  1L3T A;  1TKT A;  1WSF A;  4H4M A;  3JYT A;  1QSY A;  4CEF A;  4DS4 A;  4CFB A;  3KIO A;  3HST B;  4C8M A;  3AA3 A;  4K8Z A;  3ZT4 A;  2YKM A;  3QEW A;  3V81 A;  1NJX A;  2YNF A;  3NGI A;  4HHT A;  3HM9 A;  1TGO A;  1CZB A;  3O4Q A;  4DU4 A;  2W42 A;  4CJT A;  2G8W A;  3ZT2 A;  4M3Y A;  3ZSQ A;  3L2U A;  3DYA A;  3KLE A;  3CM6 A;  2PYJ A;  1NJZ A;  4B8C A;  3T3F A;  2QXF A;  5HRN A;  3AVH A;  2IDO A;  1ZYQ A;  5JS2 A;  3VA3 A;  4DFJ A;  5HP1 A;  1LAV A;  3AVI A;  3QEP A;  2KW4 A;  2OYQ A;  4DU3 A;  3OYA A;  1KFS A;  4EZ9 A;  1S1T A;  4WE1 A;  4CEC A;  2YNH A;  3LAN A;  3HPO A;  1FKO A;  4ICL A;  2X74 A;  3KLI A;  1DTQ A;  1JLB A;  3QEI A;  4ZTJ A;  3OYD A;  1YVU A;  1CZ9 A;  2XHB A;  2G8K A;  1REV A;  2GV9 A;  3SUP A;  3K5O A;  1NK9 A;  4C8L A;  1D8Y A;  4RG8 A;  3OJS A;  4FLT A;  1LWF A;  1TL3 A;  3MXJ A;  2DY4 A;  5CZ1 A;  4LD0 A;  3LZJ A;  4CHQ A;  3L2R A;  2QK9 A;  4KAZ A;  3NGY A;  3S3O A;  1VSE A;  4DS5 A;  1RDC A;  3AV9 A;  3HP9 A;  1ASV A;  3OJU A;  3NDK A;  4DLG A;  5E41 A;  3SZ2 A;  4FXD A;  1DLO A;  3P1G A;  1IH7 A;  1W9H A;  3K59 A;  3NFA A;  4E3S A;  4CHY A;  3DM2 A;  2Q3S A;  3L2W A;  3AO3 A;  5HRO A;  4CJF A;  2FBV A;  1RBS A;  1SL1 A;  1RNH A;  3P83 D;  4ID1 A;  1RTD A;  1UOC A;  1IKW A;  4CHN A;  4DTJ A;  3OYJ A;  3TAE A;  4J2B A;  3L2Q A;  2YHA A;  1ZBU A;  3LDS A;  1Q9X A;  4ELT A;  4KTQ A;  3PX6 A;  1WAJ A;  1O1W A;  1TAQ A;  2OPQ A;  4EP5 A;  1KSP A;  3DLB A;  4BDY A;  5I3U A;  4HCB A;  1T7P A;  3TAM A;  4Z4E A;  1JLE A;  1J53 A;  4OJR A;  4Y1C A;  1BQM A;  3O3G A;  1WSJ A;  4FLW A;  3SV4 A;  4YNQ A;  3V9X A;  4CGD A;  4H8K A;  4RW6 A;  1FK9 A;  3CQ8 A;  1S6P A;  1BCM A;  3F73 A;  4JRQ A;  3QET A;  4KI6 A;  3MXM A;  4Z4G A;  4E0D A;  1LWC A;  1ASW A;  1I39 A;  3CM5 A;  3KKS A;  3LZI A;  2PZS A;  4I7F A;  4IG0 A;  3DLG A;  4IFY A;  4BWJ A;  1VSJ A;  1HNI A;  3QIN A;  4FJG A;  5SWM A;  3AVK A;  3ZSZ A;  3CG7 A;  1LW0 A;  4OLA A;  1JL2 A;  3NF7 A;  3HJF A;  3QEX A;  4NCB A;  1RTJ A;  1HRH A;  1C1A A;  1U45 A;  2G8V A;  4L8R B;  4M3Z A;  2F8S A;  3VQA A;  3HL8 A;  4CIE A;  3QO9 A;  1JLQ A;  4QAG A;  4Z4I A;  1L5U A;  4CK1 A;  3QES A;  1Q8I A;  1SKR A;  3OYN A;  1QE1 A;  5JS1 A;  3JSM A;  1WHR A;  4FLY A;  3AVM A;  3QIO A;  3KKR A;  2P1J A;  3RTV A;  1HQU A;  4F3T A;  5T7B A;  2DFH A;  4KFB A;  3VQ5 A;  4OPJ A;  1RDB A;  3C6T A;  5HBM A;  3OS0 A;  4CEZ A;  1N6Q A;  1RDA A;  3G10 A;  1S1U A;  4NYF A;  3AVA A;  3K57 A;  3LAL A;  3DMJ A;  1ZBI A;  3PX4 A;  4PQU A;  4CJS A;  2F8T A;  3EY1 A;  2P51 A;  4Z4F A;  5DK5 A;  5KGW A;  3SYZ A;  4DTP A;  4W5O A;  5J1E A;  3VQD A;  3CFR A;  3SNN A;  2JGU A;  2AJQ A;  4B9M A;  4F4K A;  4LSN A;  4CF1 A;  4W5Q A;  4FJH A;  2HHX A;  4IDK A;  3AVC A;  1SKS A;  2HHT A;  4QOZ B;  1KVB A;  1XWL A;  1SL2 A;  3V4I A;  3T1A A;  2F96 A;  4OGC A;  3VQ7 A;  2KTQ A;  5KI6 A;  1J5O A;  3AO4 A;  4CHO A;  1EET A;  4B9V A;  4K8X A;  1UA1 A;  1T03 A;  2ITG A;  3HVT A;  2Z1J A;  3AO1 A;  3EZ5 A;  1JLG A;  3NAE A;  2LSN A;  2HHQ A;  2DFE A;  4EZ6 A;  4F8R A;  1CXQ A;  1RT1 A;  1BIZ A;  4FYD A;  1C1C A;  3OVN A;  4BAC A;  5J2M A;  4CFA A;  1UAX A;  2NUB A;  3AA4 A;  2RPI A;  1QQC A;  4MFB A;  3QIP A;  3TI0 A;  1X9S A;  1D9F A;  4B9S A;  3KLH A;  1VSL A;  3BDP A;  1TAU A;  4CJV A;  2DFF A;  1C0T A;  4DSL A;  3VQP A;  4DG1 A;  4CHZ A;  1NKE A;  1VK0 A;  2B5J A;  4DQR A;  1Q9Y A;  3NF8 A;  3M8S A;  3AO2 A;  3C95 A;  1BIU A;  2ZE2 A;  1Y97 A;  2BAN A;  4E7L A;  4CIG A;  4DQS A;  3O3H A;  2GBZ A;  5CZ2 A;  5CYM A;  4Z4H A;  3OS2 A;  4KB1 A;  4FJM A;  4CIF A;  4FLU A;  3V9U A;  2VG5 A;  1IO2 A;  2GUI A;  1KFD A;  1RCH A;  3C6U A;  2BGG A;  1YTA A;  2KQ2 A;  3O3F A;  3K2P A;  4FM2 A;  1TKD A;  2HVH A;  1WSE A;  1VSH A;  3V1R A;  5EU7 A;  1JXE A;  4CF8 A;  1RT6 A;  4YFU A;  3SQ0 A;  4CJP A;  1RDD A;  2VG6 A;  4CJR A;  4DTN A;  1NKC A;  4DQP A;  4ID5 A;  4F3O A;  3TAP A;  3VQ9 A;  1W0H A;  4NCA A;  5C25 A;  2CPM A;  4FCY A;  3SJJ A;  2Z1H A;  4FJJ A;  4N41 A;  1WAF A;  5FRN A;  3F9K A;  1EKE A;  4PA1 A;  1JLC A;  2ETJ A;  3VQQ A;  1RT4 A;  3AVJ A;  1C1B A;  3U3Y A;  3DRP A;  4I9L A;  3WNF A;  1TL1 A;  3NH0 A;  2XY5 A;  3ZT3 A;  4MQ3 A;  3ZSO A;  2JLE A;  2RN2 A;  3OY9 A;  1NK5 A;  2B4J A;  2D0A A;  4DQI A;  2YNG A;  3VQE A;  1GOB A;  1KVA A;  4KTZ A;  3WNE A;  3H08 A;  3NH1 A;  4BDZ A;  5J2Q A;  1HYZ A;  3SUO A;  4CJ3 A;  1XC9 A;  4JLH A;  3M8P A;  3HP6 A;  4PUO A;  1T8E A;  3TAG A;  4KO0 A;  3SCX A;  4PWD A;  3V9S A;  4KRF A;  2VWK A;  4CF0 A;  1TK0 A;  1CLQ A;  2E4L A;  1RT5 A;  4N5S A;  2D5R A;  4RW8 A;  4CJ5 A;  3V9W A;  3DI6 A;  4CE9 A;  2G8U A;  3C94 A;  3RR7 A;  3ZSW A;  4H4O A;  2Z1G A;  4E19 A;  2BDP A;  1C0M A;  3LAK A;  2DTU A;  3MEE A;  3WNH A;  3ISN C;  3SQ1 A;  4TSX A;  4R5P A;  3I8D A;  3T19 A;  1RBR A;  1VRU A;  4Y1D A;  3M8R A;  4RW4 A;  3OYI A;  4FM0 A;  1KCF A;  4CJW A;  4KI4 A;  1S6Q A;  1RT2 A;  3NF9 A;  4JRP A;  1B9F A;  2FBY A;  3KD5 E;  1Z25 A;  3IS9 A;  4E7I A;  4F2R A;  1WNS A;  3DLK A;  4XIU A;  4M3X A;  2I5J A;  1LV5 A;  1S1V A;  4N47 A;  3OYM A;  4DQQ A;  1L3S A;  2A1S A;  2OPR A;  3HPH A;  3ZCM A;  3HT3 A;  2P5O A;  3L3U A;  3AA2 A;  2VG7 A;  1S1W A;  4IKF A;  4DF4 A;  4F2S A;  5K14 A;  4CFC A;  3VQC A;  1SV5 A;  3I0S A;  2RKI A;  4CGH A;  3KK1 A;  5J2P A;  4ZHR A;  2OA8 A;  4B9N A;  4FJI A;  4KHW A;  1VSM A;  5KTQ A;  4CES A;  3KLG A;  2EX3 A;  4OKJ A;  5FRM A;  4DF8 A;  3ULD A;  3VQ8 A;  3RMA A;  1U4B A;  4N76 A;  4I2Q A;  5KRS A;  4DFP A;  2G8F A;  1R0A A;  1J54 A;  2X78 A;  2XY7 A;  3DRS A;  1BCO A;  1MU2 A;  4CGF A;  2IS3 A;  2YHB A;  1HMV A;  3DRR A;  4Z4C A;  2O4G A;  2A1R A;  1K6Y A;  3KD1 E;  1CXU A;  1BIS A;  2XO7 A;  2BE2 A;  3NCI A;  3SPY A;  3DOL A;  5D3G A;  4OGE A;  3PO5 A;  4CGJ A;  4ELV A;  3TAR A;  4OKK A;  1KTQ A;  4GVM A;  4M3R A;  1YT3 A;  1A5W A;  4CJQ A;  4CER A;  4AHU A;  4JS4 A;  4C8N A;  1NJW A;  2QKK A;  1QHT A;  3RR8 A;  2WOM A;  2OZS A;  3VQ4 A;  3HYF A;  2P5G A;  1RBU A;  1NK7 A;  1BGX T;  2G8H A;  4DTM A;  3OYG A;  4I9Q A;  4HTU A;  1JL1 A;  1A5X A;  1HQE A;  1XHX A;  3ALY A;  3AVB A;  4O4G A;  1UG8 A;  3RMB A;  3IAY A;  3K5N A;  1NJY A;  2QKB A;  1TV6 A;  2YKN A;  4N56 A;  4FZX C;  2IOC A;  3NF6 A;  3AVN A;  4O44 A;  4E7H A;  2Y1I A;  3VQB A;  5I42 A;  4E89 A;  1SKW A;  4B9L A;  4CJL A;  2OZM A;  2HW3 A;  3L3V A;  3QNN A;  1LAW A;  2E6L A;  3B6P A;  4AHS A;  3SUN A;  3AVF A;  4W5T A;  5HLF A;  2KZM A;  3LPT A;  4NCG A;  3ITH A;  4FLV A;  4CF2 A;  1FKP A;  4IFV A; 
#chains in the Genus database with same CATH topology
 3ATU A;  2E3U A;  3PX0 A;  5TKW A;  4KTW A;  1QSS A;  4O0I A;  3P31 A;  2O8D A;  1GOC A;  3D7E O;  1ITG A;  4H03 B;  4FZY A;  1K8A O;  3CFO A;  3OYB A;  2ATQ A;  3VEO A;  4F8R A;  1XI1 A;  2YJF A;  1D9D A;  1Y64 A;  3ASM A;  4W5R A;  4AHR A;  4O8U A;  3WNG A;  3PLA A;  3QER A;  3T1H H;  1XUP O;  4B08 A;  3R6M A;  1ODH A;  3C6H A;  4DV2 K;  2YV0 X;  1WN7 A;  4QS9 A;  4NLC A;  4JI0 H;  3CYM A;  4DSJ A;  1U6Z A;  1NK4 A;  4FJ8 A;  3WQT A;  1EC6 A;  2Y1J A;  1KLN A;  1VQ7 N;  4HUF A;  1BQN A;  3WQU A;  5TKY A;  3ZSR A;  1NOZ A;  4RW7 A;  4IBN A;  2A42 A;  2QWM A;  3K0S A;  3ZT0 A;  3JXU A;  4H5T A;  1U49 A;  4KV8 A;  3AGK A;  1HYV A;  4DSI A;  4U67 L;  4KKO A;  2PY5 A;  3QIC A;  3OYL A;  4DFM A;  4YY3 K;  3CQY A;  2FBT A;  3KWI A;  1NM1 A;  2QWQ A;  3LP2 A;  2IC3 A;  3VA0 A;  4HCC A;  3FFI A;  3PIP L;  2UXC H;  4BE0 A;  3QEV A;  1HKG A;  3A0I X;  3M6G A;  1PQX A;  1TUU A;  4M7Y A;  4YOX A;  2F4V K;  2PQU A;  4FW1 A;  4GKJ K;  1T6D A;  1XMQ K;  4FK4 A;  2Q0R A;  1OH8 A;  5BR9 A;  1Q86 O;  1MSZ A;  5LJV A;  3K9J A;  5C24 A;  4ILJ A;  3O9R A;  2I7P A;  2FSN A;  1WVN A;  3SJH A;  5KPR A;  3CCR N;  3UIQ A;  1GLJ O;  4KHP K;  3DAW A;  5AZJ B;  5H1S Q;  2ZJP L;  4AHT A;  2X6S A;  1XC3 A;  1L3U A;  4YDU C;  3ZEU A;  4H5R A;  4E1N A;  2G8I A;  3CJ7 A;  4BRN A;  3SQ4 A;  2EHG A;  3I33 A;  3CME N;  5C2D A;  1S1X A;  2O8C B;  3J80 O;  3P39 A;  3S9H A;  1IBL H;  1X0A A;  1HJR A;  3CC4 N;  5I9E B;  1X9W A;  1N32 K;  1WBD A;  3OYE A;  3WXL A;  2HHS A;  5DT9 A;  1N8R O;  2D0C A;  1KVC A;  4Q5V A;  1S9E A;  4H5N A;  4B3S K;  5AJ3 K;  5AQZ A;  3GAB A;  4A5B A;  4CGG A;  2ZF5 O;  2P9L B;  1ATS A;  3ZSY A;  4B9U A;  3LWL A;  1L3V A;  4JI7 H;  4DSK A;  4WCE L;  1KC8 O;  4Z0U A;  4X64 K;  4GW6 A;  1KLM A;  3RF2 A;  5CE3 A;  5B8H A;  4CCH A;  2XY6 A;  3U8X A;  4LFB H;  4PL7 A;  3AAR A;  3TR8 A;  4A61 A;  1YJ9 N;  2E88 A;  4NZT M;  4OPK A;  2Q97 A;  3SAF A;  2KFN A;  3VEX A;  1C0U A;  3GG4 A;  2BTF A;  3GDQ A;  3U3G A;  1BUP A;  3LP1 A;  4FJX A;  1KAX A;  4GVE A;  3KK2 A;  4DTX A;  3E01 A;  1GLA G;  1TKT A;  4FWS A;  5BRH A;  3KIO A;  4WFA L;  3CCE N;  4C8M A;  3AA3 A;  5LMU H;  4DR5 K;  3E9L A;  1ZBS A;  3V81 A;  3VKE A;  1TGO A;  1CZB A;  2M6Q A;  3MN5 A;  4M3Y A;  4AF1 A;  2PT7 G;  2PYJ A;  4LF6 H;  4B1X B;  2YQR A;  5GIP A;  1NNE A;  4B1Z A;  5JS2 A;  2HH3 A;  2CWF A;  4WQ4 A;  4EZ9 A;  3LAN A;  4EAH D;  1NGC A;  1FKO A;  4EHT A;  4DR4 H;  3L4Q A;  4EHU A;  1E3M A;  4ZTJ A;  1V9N A;  1YVU A;  4DV5 H;  4FOI A;  3SBT A;  3L0Q A;  5AQN A;  1NGF A;  2BA0 A;  4RG8 A;  4BC2 A;  4LF4 K;  2JWK A;  4CD1 A;  4A57 A;  2DY4 A;  4IFE A;  1EWR A;  2ZGZ A;  4CHQ A;  3V69 A;  4B8T A;  3S3O A;  1VSE A;  5GAE P;  3AEV B;  3HP9 A;  3OJU A;  4DLG A;  5E41 A;  3P1G A;  3CCM N;  5JLH A;  1VQ5 N;  4CBU A;  2NRW A;  3DM2 A;  4CJF A;  1I94 K;  2AXY A;  1IKW A;  4B3M K;  4DR6 K;  3L2Q A;  2P9P B;  4ELT A;  1SAZ A;  5LMN H;  3QD7 X;  3SB1 A;  4LF9 K;  5JVG L;  2A3Z A;  2ZGY A;  4B3T H;  4NXM H;  2NRZ A;  4DV1 K;  4CZJ A;  1T7P A;  4B1V A;  4DR2 H;  4YNQ A;  3VEN A;  2NRX A;  3VPZ A;  3CQ8 A;  2OCE A;  4X65 H;  2P2R A;  4BR9 A;  4IG0 A;  4BWJ A;  4IFY A;  4YOR A;  2CWH A;  4CZK A;  5SWM A;  4ISE A;  3AVK A;  5JVH L;  1JL2 A;  2UUB K;  2ITM A;  1HRH A;  2G8V A;  2CTE A;  3I8B A;  3EN9 A;  3MX5 A;  2UUC K;  1JLQ A;  2W41 A;  3M3Z A;  1Q8I A;  3JSM A;  3QIO A;  4DB3 A;  2QWN A;  4F3T A;  4OPJ A;  3A8Y A;  1XNQ K;  3TPQ A;  3C6T A;  4CEZ A;  3G10 A;  4NYF A;  4XH4 A;  1U2V A;  3PX4 A;  1YJN N;  4CJS A;  2F8T A;  4DTP A;  5J1E A;  3SNN A;  4JKC A;  4BC3 A;  1H1V A;  1VBI A;  4B9M A;  5F1X A;  4FJH A;  2P9I A;  4QOZ B;  1XWL A;  2V7Y A;  3U4L A;  3I56 N;  4WAL A;  4CD3 A;  5KI6 A;  3AO4 A;  3I55 N;  4B9V A;  1MWK A;  2Z1J A;  3AO1 A;  1ATR A;  1YVN A;  1NGE A;  2HHQ A;  2JEA I;  2DFE A;  5AFU H;  3UOE A;  4FWO A;  3P4I A;  2Q2R A;  1C1C A;  3OVN A;  4BAC A;  4CFA A;  1UAX A;  2NUB A;  2RPI A;  2D4W A;  2YHW A;  3KLH A;  3DXK A;  1NKE A;  4CHZ A;  2FMR A;  1HX1 A;  1X3N A;  1YAG A;  3C95 A;  1DGK N;  4CIG A;  3O3H A;  5CZ2 A;  2KLA A;  4KB1 A;  4FLU A;  3V9U A;  2HMP A;  1OH6 A;  1YTA A;  1WSE A;  1VSH A;  3FE1 A;  3V1R A;  4YFU A;  1NKC A;  2VG6 A;  4BRL A;  3VQ9 A;  1J6Z A;  5FRN A;  1WAF A;  4PA1 A;  3VQQ A;  2ETJ A;  4B3R H;  4JI4 K;  3VGM A;  4AQY K;  3VF2 A;  1LCU A;  2ASM A;  3O9Q A;  3ZSO A;  1NK5 A;  4JKG A;  1HPM A;  1KVA A;  1LOT B;  4B9Q A;  1VHX A;  4DV0 K;  1C0G A;  2FF6 A;  3HP6 A;  4PWD A;  3V9S A;  1YHQ N;  4LFA K;  2VWK A;  4CF0 A;  3ZLJ A;  1CLQ A;  4N5S A;  3JS6 A;  4YHH K;  2D5R A;  4CJ5 A;  3M5R A;  3V9W A;  3DI6 A;  2E2Q A;  5EOY A;  3JAM O;  3RR7 A;  3ZSW A;  2Z1G A;  4E19 A;  5DM6 L;  2DTU A;  2HH2 A;  2YHX A;  3SAG A;  4R5P A;  4Y1D A;  4RW4 A;  1WBB A;  3OYI A;  4DR3 K;  4XH5 A;  2UUA H;  4KI4 A;  1RT2 A;  3FGU A;  4JRP A;  1B9F A;  2FBY A;  2HBJ A;  3IS9 A;  1VQK N;  4M3X A;  4XIU A;  5EY4 A;  1YUW A;  5K36 G;  1QQN A;  1S1V A;  1QQM A;  3OHR A;  4GY2 B;  3HBT A;  4N47 A;  3TTC A;  3ZCM A;  2P5O A;  3L3U A;  1X4M A;  2VG7 A;  3MX2 A;  3OW2 M;  4F2S A;  2VQF H;  4KHQ A;  2RKI A;  3OTO H;  3LDL A;  4Z94 A;  4ZHR A;  1J5K A;  1U4B A;  3VQ8 A;  5AQR A;  2O8F B;  3KVG A;  2CGJ A;  4DUY K;  2X78 A;  1NMD A;  1HMV A;  2YHB A;  3DRR A;  4JD2 A;  1X9J A;  3KD1 E;  1BG3 A;  2DPN A;  3UKR A;  1BIS A;  5GAG P;  3NCI A;  2E8A A;  1N33 K;  4GKK K;  3DOL A;  2O8E A;  3AGR A;  3L4I A;  4ELV A;  3TAR A;  4I6M A;  1A5W A;  3AAQ A;  2O4C A;  1RBU A;  4BR7 A;  1BGX T;  2FFM A;  5M1Q A;  1JL1 A;  3AVB A;  2UU9 H;  2I7N A;  3IAY A;  3NF6 A;  1SKW A;  3AVN A;  3CCL N;  2QM1 A;  4E89 A;  2OZM A;  1LAW A;  3A5O C;  3B6P A;  4FPA A;  4AHS A;  3THW A;  5EX5 A;  4EC5 A;  2KZM A;  4NCG A;  3L7Z C;  4JVH A;  4LF8 K;  1FKP A;  1Q81 O;  4BRI A;  4J2A A;  3VF6 A;  3S3N A;  2VCP A;  4MO4 A;  1TKX A;  3OYK A;  2FXU A;  3B6O A;  2CTF A;  3EEQ A;  1IBK H;  1OVQ A;  2W40 A;  1S9G A;  5HRP A;  1NGJ A;  1VIG A;  2E6M A;  4DR1 H;  3ID6 A;  4JS5 A;  5HRR A;  3EKU A;  4CEA A;  5CHI A;  2ZD1 A;  4DTO A;  3J80 W;  3IG1 A;  4OO1 J;  3O1W A;  1U47 A;  2V51 B;  1JXB A;  5EXW A;  1GOA A;  1TYQ A;  4DSE A;  3RWU A;  2O8D B;  3OS1 A;  2YNI A;  3BEX A;  5ADX A;  3ZT1 A;  1TUY A;  3O1B A;  3HK2 A;  3GKU A;  1RGI A;  4BE1 A;  3T1Y K;  2OPU A;  3A5M C;  1SUQ A;  3FAU A;  1ZZI A;  4BRF A;  3U6F A;  3HZ6 A;  2IIR A;  3DLE A;  3MEC A;  4FZZ A;  5A2Q O;  4LF7 K;  1YJW N;  3RMD A;  4W5N A;  1KQS M;  1T05 A;  2O4I A;  2GTD A;  4BGB A;  2E5L H;  2XRI A;  4JKB A;  4KHN A;  4H0V B;  1ZTG A;  5FRO A;  1X9M A;  3L2V A;  1LW2 A;  4FJ9 A;  2KTQ A;  1TK8 A;  4E7J A;  1TK5 A;  1NOY A;  4PDB A;  3O4N A;  4FVM A;  4CHP A;  4LF5 K;  3NH2 A;  2ZM6 K;  4C8K A;  2QW9 A;  3PY8 A;  4GMJ B;  4LY7 A;  1S22 A;  1KRP A;  3GE1 A;  1HKB A;  1WLJ A;  2UXD K;  1IKX A;  3SV3 A;  4QCL A;  3VOV A;  2HOE A;  1VSF A;  3WEE A;  5KRT A;  1NK6 A;  5SZT A;  2E20 A;  5HRS A;  1ASU A;  2HB5 A;  3LDP A;  5BR8 H;  1EX4 A;  5C42 A;  3UKU A;  3QFP A;  3A5N C;  3D45 A;  5AQT A;  4YOW A;  1RT3 A;  1GLL O;  4J8F A;  2YCH A;  3E9P A;  2K1H A;  1HYS A;  2YI1 A;  4H0T B;  3OBW A;  4DV6 H;  2QI2 A;  2BH1 A;  3CPW M;  3ZX2 A;  1N36 H;  4UY8 O;  3S3M A;  2LTM A;  4H0P A;  3KK3 A;  4JK9 A;  1RTI A;  4OX9 H;  2UXB H;  1C6V A;  2NRH A;  4BQL A;  5FDL A;  5AQY A;  4DV2 H;  1RIL A;  4JKE A;  3P5J A;  5AQW A;  3TTF A;  2Z1I A;  1TUA A;  3CXC M;  3AO5 A;  4M3W A;  3R1X A;  3ZEU B;  2QWO A;  4CJ4 A;  3D6R A;  1JKH A;  4AHC A;  4LH4 A;  3HOS A;  1QVF M;  4FOE A;  4B8A B;  4DTS A;  4AIM A;  3ID8 A;  1RBV A;  3KWG A;  1GLE G;  2OPS A;  1UA0 A;  2KFZ A;  1WSH A;  1GLC G;  3TAF A;  1XNR H;  2VWJ A;  5J2N A;  2OPP A;  4J2D A;  5JEA G;  1M1K O;  3LWM A;  2F7T A;  3NBP A;  3D2F A;  4YY3 H;  1OKJ A;  4F9O A;  3KLF A;  4KHY A;  1MA9 B;  4BC4 A;  2AA4 A;  3RSE B;  4CW7 B;  2FBX A;  3EYZ A;  1K8K A;  2OAN A;  1BI4 B;  3J81 O;  2O8B A;  3KJV A;  4IO8 A;  2VQE K;  1HKC A;  2WON A;  4DLE A;  2HHU A;  3CI5 A;  1VQL N;  3H1V X;  4CFB A;  1BWF O;  4JI2 K;  3O9S A;  3HST B;  4H0Y B;  3EE8 A;  4K8Z A;  3ZT4 A;  4ISF A;  2F4V H;  3QEW A;  1NJX A;  4HHT A;  4MLE A;  3O4Q A;  3J8A A;  4DU4 A;  4CJT A;  1XMQ H;  3BF3 A;  3H3O B;  3ZSQ A;  1R59 O;  4DV4 K;  4JI1 K;  4OD6 A;  2HF4 A;  1NJZ A;  2QXF A;  5HRN A;  4JYA K;  3AVH A;  2IDO A;  2NRR A;  5HP1 A;  1ZZK A;  1LAV A;  3QEP A;  4X66 K;  2KW4 A;  3E9O A;  3MMV A;  3OYA A;  1KFS A;  1S1T A;  5AQM A;  2YNH A;  4O8K A;  4KHP H;  4K0K K;  3W3D A;  2X74 A;  2Q0U A;  2WFB A;  3C0B A;  2FPH X;  3QEI A;  2XHB A;  1CZ9 A;  4Y0W A;  2G8K A;  1REV A;  2VGN A;  5AQQ A;  1NK9 A;  4C8L A;  1QZ5 A;  3OJS A;  5C12 A;  5AQX A;  3LZJ A;  2CTL A;  3VF4 A;  2Y3M A;  4DS5 A;  4OPH A;  4GV6 A;  1ASV A;  4FXD A;  1W9H A;  4BRC A;  2H3G X;  3NFA A;  4E3S A;  2D9I A;  4B3S H;  4CHY A;  3L2W A;  4NLB A;  2FBV A;  5LY3 A;  1SL1 A;  1CZA N;  1YIT N;  3T1H K;  3W0L A;  2M8W A;  4JAX A;  4CHN A;  4J2B A;  4G08 A;  4B8C D;  1NG9 A;  2Q36 A;  4OPA A;  3CCS N;  4X64 H;  1KSP A;  4EP5 A;  3DLB A;  3MN7 A;  4BDY A;  4JI0 K;  1VQ4 N;  3R3L A;  4HCB A;  2MJH A;  3TAM A;  4NXN K;  3O3G A;  1BQM A;  2QKK A;  1WSJ A;  4FLW A;  1ILY A;  4CGD A;  1SZ2 A;  1FK9 A;  2D0P A;  4KI6 A;  3F73 A;  4Z4G A;  3MXM A;  3AY9 A;  3MDQ A;  1I39 A;  5AQO A;  1HNI A;  3VTI A;  3RVC A;  1LW0 A;  3NF7 A;  5C10 A;  4NCB A;  3HJF A;  4NB4 A;  1U45 A;  1C1A A;  4M3Z A;  4CZG A;  2F8S A;  3TSU A;  4BR0 A;  4WYB A;  2D0O A;  4CIE A;  3QO9 A;  5AQH A;  4QS7 A;  3JAM W;  4QAG A;  4Z4I A;  4CK1 A;  2GWJ A;  2HBK A;  1SKR A;  3OYN A;  2CTJ A;  2JE6 I;  2PFU A;  1WHR A;  4FLY A;  4WQ4 C;  2QXL A;  2P1J A;  3DXM A;  4H5V A;  2DFH A;  3VQ5 A;  4DV7 K;  3KDK A;  3OS0 A;  3VGL A;  1N6Q A;  1RDA A;  4A2B A;  1S1U A;  1QQO A;  3C7N B;  3DMJ A;  2UXC K;  5JLF A;  4DUZ H;  2P51 A;  4Z4F A;  5KGW A;  1XQS C;  1J5E K;  4F4K A;  4CF1 A;  4W5Q A;  2HHX A;  1SKS A;  3ZYY X;  2HHT A;  1KVB A;  3FZL A;  1SL2 A;  1YXQ A;  3P38 A;  2NLX A;  1G99 A;  4CZM A;  2F96 A;  3VQ7 A;  3KDG A;  4CHO A;  1U2V B;  2QWR A;  1UA1 A;  2ITG A;  3HVT A;  1KD1 O;  1JLG A;  4FWQ A;  4EZ6 A;  3HOT A;  4JK8 A;  1CXQ A;  1BIZ A;  4JKA A;  5KPT A;  4CZH A;  3AA4 A;  4MFB A;  1QQC A;  3QIP A;  1X9S A;  2CTK A;  2P9I B;  4BR5 A;  4B9S A;  1NXU A;  1VSL A;  2HHH K;  3VQP A;  3NF8 A;  3QBX A;  2BAN A;  4DQS A;  5CYM A;  1IBL K;  2OTL N;  1KFD A;  3HRG A;  5GIN A;  2HVH A;  2KQ2 A;  1MWM A;  1TKD A;  5EU7 A;  1JXE A;  4DTN A;  1WB9 A;  3CJB A;  4NCA A;  3BF1 A;  4XEI A;  4FJJ A;  2Z1H A;  3DXK B;  2ANN A;  4IEI A;  2FSJ A;  4BRD A;  1S3X A;  5EVZ A;  1S20 A;  2FLO A;  4DQ8 A;  3WNF A;  4I9L A;  3THX B;  1TL1 A;  4BRQ A;  4JI7 K;  3NMU A;  2RN2 A;  4A2A A;  2YNG A;  1GOB A;  3NH1 A;  5J2Q A;  3H08 A;  3SUO A;  1HYZ A;  1XC9 A;  4JLH A;  3LM2 A;  4KO0 A;  3QB0 A;  2F9T A;  3ZET A;  4H4O A;  1C0M A;  3MEE A;  2PAV A;  3ISN C;  5C2F A;  3SQ1 A;  5E26 A;  1VRU A;  3PIO L;  4JKG B;  4FM0 A;  1BA1 A;  1D4X A;  4F2R A;  4WFN L;  1GLB G;  1Z25 A;  4E7I A;  1LV5 A;  3LDQ A;  2ANR A;  2A1S A;  2OPR A;  3HPH A;  5LMU K;  2X06 A;  3AA2 A;  4R79 A;  1S1W A;  4KBO A;  1Z2I A;  5K14 A;  4B9T A;  3VQC A;  4JHD A;  4LF6 K;  3FZH A;  1T6C A;  5KTQ A;  4PHT X;  3J7A K;  2IVP A;  4AM6 A;  4OKJ A;  2E2O A;  4DF8 A;  5KRS A;  1W97 L;  4DFP A;  2G8F A;  1R0A A;  3IUC A;  1J54 A;  5KQD A;  1MU2 A;  4CGF A;  1K6Y A;  3PSF A;  2PY9 A;  2JVZ A;  4A62 A;  4LFC H;  4FWK A;  4WF9 L;  5D3G A;  3D2E A;  3C6A A;  4CGJ A;  1ZC6 A;  4M3R A;  2P9L A;  4AHU A;  1NJW A;  3WT0 A;  2OZS A;  1QHT A;  2WOM A;  1AN7 A;  1NGB A;  2P9N B;  3HYF A;  3ZX0 A;  1NK7 A;  2P5G A;  4LIJ A;  4DTM A;  2RE2 A;  3IMX A;  4HTU A;  4I9Q A;  3ALY A;  4JI8 K;  4JD2 B;  3UKR B;  2YKN A;  2LF0 A;  4O44 A;  2O8E B;  5AQV A;  3L3V A;  3QNN A;  3U1K A;  2E6L A;  1HNX K;  4I6M B;  4X62 H;  4JI4 H;  5HLF A;  4JKH A;  3ITH A;  4CF2 A;  4V19 S;  5C15 A;  1D8Y A;  4G9Z A;  1Z26 A;  5LMN K;  4ZTF A;  2B6A A;  3PSI A;  4B3T K;  1K73 O;  1EP4 A;  3J7Z O;  5AQP A;  2A41 A;  5F0X A;  1N5Y A;  4YHH H;  4KB0 A;  5M1F A;  4DR2 K;  3F5T A;  4AIL C;  4X65 K;  4CK3 A;  3THW B;  1SS6 A;  3BY5 A;  1F0X A;  5CY4 A;  3K5L A;  3CFP A;  5DMR A;  4BRO A;  3IRX A;  3PUF A;  3LL3 A;  2P9U B;  4AH9 A;  1ZBH A;  1SL0 A;  3R8E A;  1KHM A;  5IT9 O;  2QTD A;  5JMV A;  4DR3 H;  4HVJ A;  1RT7 A;  3MXI A;  3BGR A;  4BVP A;  4FLX A;  3SQ2 A;  1FXX A;  3L8B A;  4PY5 A;  1KAZ A;  2HMI A;  4FK2 A;  3OET A;  4FWM A;  1VQ8 N;  1Q18 A;  3U9D A;  1QS4 A;  4BRP A;  1VQN N;  4XH1 A;  2BUP A;  3WXK A;  4DV3 K;  1ZBF A;  3CC2 N;  1Q7Y O;  4JV5 K;  3PV8 A;  4BRA A;  4CJE A;  1HNV A;  3Q7B A;  3O80 A;  1YTU A;  4Q0B A;  4WAN A;  4LH5 A;  1NGG A;  3ULE B;  2HND A;  3TSP A;  1N33 H;  1QVG M;  3N4Q A;  4M41 A;  5AZI A;  3J81 W;  3THV A;  3SI6 A;  4UQG A;  4HUE A;  1D5A A;  4DR7 K;  3UE5 A;  3LP0 A;  5JIC A;  4DWI A;  2P9K A;  4YOY A;  4IDH A;  2CTM A;  4JVY A;  3AVL A;  2EWS A;  1RBT A;  1LWE A;  1O13 A;  4CJU A;  4CF9 A;  3KTQ A;  5IWA H;  3GOI A;  3V1Q A;  1WSG A;  4CK2 A;  4CJK A;  1RFQ A;  3HO1 A;  2IVN A;  2WUS A;  1HNZ H;  2X6N A;  3VES A;  1X1P A;  3HM8 A;  4WFB L;  4BE2 A;  3RRH A;  3V9Z A;  4E1M A;  4K43 A;  1IV0 A;  2V7Z A;  5LL6 Z;  4A59 A;  3CF5 L;  4EP4 A;  1NGI A;  2GEL A;  4CGI A;  3M1F A;  3V6D A;  4M3U A;  5BPM A;  4DFK A;  4BRE A;  3WEE B;  1QSL A;  3LPU A;  4BR4 A;  4PKG A;  5FLX O;  3T7Z A;  5M1K A;  4B3R K;  1J9A A;  3DOK A;  5LJW A;  3UKU B;  2IVO A;  1U48 A;  4O55 A;  4O5B A;  1QTM A;  4EIA A;  4FM1 A;  4FJK A;  4BWM A;  2LRR A;  2PBD A;  1BL3 A;  4BDP A;  1U04 A;  3TAB A;  3SPZ A;  3EO3 A;  1IKV A;  3O4W A;  4MDB A;  4CJ7 A;  4G1Q A;  4DMN A;  2QWL A;  3TWH A;  4JI5 K;  1N34 H;  2W6L A;  3VGK A;  1P8Z A;  5BPN A;  5AQL A;  3T1Y H;  4J2E A;  1UWB A;  3VET A;  4CFD A;  4IFD G;  1IKY A;  4CED A;  2UUA K;  4O0J A;  3CJA A;  3MED A;  4JI6 H;  4C8O A;  4WQ5 A;  2D1K A;  3MCA B;  1ESV A;  4JNE A;  4IOC L;  4LF7 H;  1A5V A;  4NYN A;  4IO9 L;  3U9Z A;  1JCF A;  3V1O A;  3MAQ A;  1FW6 A;  3LAM A;  2XY8 A;  3EL2 A;  4H8A A;  2CH5 A;  2ASO A;  3VN5 A;  3OTO K;  1K9M O;  4FJN A;  4O5F A;  1I6U A;  3MN9 A;  4CZI A;  1IBM K;  3AA5 X;  4BG9 A;  5ADX H;  3K58 A;  2CH6 A;  4NO7 A;  1F21 A;  1QSY A;  3ENH A;  4H4M A;  3JYT A;  4JI3 H;  4CEF A;  4DS4 A;  4IEE A;  3D2F B;  1XMO H;  2YKM A;  2YNF A;  3NGI A;  3HM9 A;  4CZF A;  4U7B A;  2W42 A;  3BZC A;  2G8W A;  3ZT2 A;  3F2K A;  3DYA A;  1IG8 A;  3OBY A;  3H46 O;  3KLE A;  3L2U A;  2ZQE A;  3T3F A;  1NLV A;  2O8B B;  1ZYQ A;  1BOT O;  1VQ6 N;  4MO5 A;  4DU3 A;  3R9P A;  4GV3 A;  2UU9 K;  3HPO A;  2WTU A;  4BRK A;  4ICL A;  1SQK A;  2FF3 B;  2HBM A;  4BRG A;  3CCV N;  3Q7C A;  5BRE A;  1JLB A;  2GV9 A;  3SUP A;  1WUA A;  3MK6 A;  3K5O A;  3VEV A;  3UB5 A;  4FLT A;  1LWF A;  1TL3 A;  5CZ1 A;  3HTV A;  4JK7 A;  2HF3 A;  3L2R A;  1K1G A;  1WOQ A;  4DCH A;  1RDC A;  3HI0 A;  3AV9 A;  1IBK K;  3MWP A;  3SZ2 A;  1DLO A;  3CPE A;  1IH7 A;  3K59 A;  1DKG D;  2QWP A;  4IOX A;  3BUZ B;  2Q3S A;  4OCH A;  3AO3 A;  2VWB A;  3SLC A;  4CBW A;  1RBS A;  2Q31 A;  2LTL A;  1RNH A;  3P83 D;  4DKW A;  4ID1 A;  1RTD A;  3SMP A;  1QHA A;  3E1Y A;  4FPB A;  4DTJ A;  1ZBU A;  3LDS A;  1Q9X A;  3EKS A;  5AQF A;  1HNW K;  4OO1 G;  3A5L C;  5HOO A;  5I3U A;  4Z4E A;  2A40 A;  1J53 A;  4H8K A;  4RW6 A;  2G8Y A;  1ASW A;  3LZI A;  3CM5 A;  4PL8 A;  4QS8 A;  2PZS A;  4I7F A;  3DLG A;  3QIN A;  3ZSZ A;  3QEX A;  4NZR M;  2VQE H;  3ATV A;  3CET A;  3HL8 A;  1OVY A;  1VQ9 N;  3QES A;  5JS1 A;  2E5L K;  3AVM A;  3LM9 A;  3O8M A;  3CCU N;  3RTV A;  1X4N A;  1HQU A;  4H0O A;  3I0P A;  4FWN A;  4JI1 H;  4GNI A;  5HBM A;  1OH5 A;  4JYA H;  3GR5 A;  3K57 A;  3AVA A;  4X66 H;  1NGD A;  1ZBI A;  1V4T A;  3LDN A;  4PQU A;  3KK7 A;  1HR0 K;  1FJG K;  4BC5 A;  4W5O A;  2FSK A;  4FWR A;  4IDK A;  3AVC A;  1JCG A;  1BU6 O;  3ZX3 A;  4GV9 A;  3CIP A;  3T1A A;  1WE8 A;  5BR8 K;  5KPZ A;  4OGC A;  1KXP A;  1J5O A;  3VEZ A;  4K8X A;  5AR0 A;  3IDH A;  5FPD A;  3NAE A;  2LSN A;  3THY A;  4FYD A;  5J2M A;  2QK9 A;  4DV6 K;  1NGH A;  1ZZJ A;  4BRM A;  1N36 K;  4CJV A;  1TAU A;  4GKJ H;  1C0T A;  4DSL A;  4DG1 A;  2B5J A;  4OX9 K;  2UXB K;  3FZK A;  4ISG A;  1BIU A;  2ZE2 A;  1Y97 A;  4E7L A;  5E84 A;  2GBZ A;  3MWT A;  4Z4H A;  3OS2 A;  3EZJ A;  1IO2 A;  2GUI A;  4JN4 A;  3O3F A;  1RT6 A;  4CJP A;  4CJR A;  4F3O A;  4ID5 A;  3TAP A;  1W0H A;  2CPM A;  5C25 A;  4NXN H;  3EE9 A;  4FCY A;  1DEJ A;  3F9K A;  1EKE A;  1RT4 A;  3S41 A;  1C1B A;  3U3Y A;  3DRP A;  4BRH A;  3NH0 A;  2CPQ A;  3ZT3 A;  1EO1 A;  5C0X G;  4DQI A;  2B4J A;  2D0A A;  3VQE A;  4KTZ A;  4CJ3 A;  3M8P A;  4PUO A;  3TAG A;  3SCX A;  1XNR K;  4KRF A;  1TK0 A;  1N32 H;  2E4L A;  1QZ6 A;  3TSQ A;  4CE9 A;  3CCJ N;  2VYP A;  4CZE A;  3CHW A;  3C94 A;  3LAK A;  3WNH A;  4E9J A;  5IT9 W;  1RBR A;  4DV7 H;  3M8R A;  1VIH A;  1KCF A;  2OTJ N;  5KQ8 A;  3ZET B;  3OYM A;  1L3S A;  1NGA A;  3HT3 A;  1J5E H;  4IKF A;  2GUP A;  3KK1 A;  5J2P A;  3I0S A;  2OA8 A;  4EFH A;  2CGL A;  1VSM A;  5BRF A;  4CES A;  3MCP A;  1P90 A;  2EX3 A;  2NZT A;  3ULD A;  4DHY A;  2XY7 A;  4FVU A;  4FWL A;  2IS3 A;  2A1R A;  1NJI O;  2O4G A;  2XO7 A;  4B1U B;  3VEW A;  4DR5 H;  1YI2 N;  3FLC O;  2P9S A;  1NMN A;  2HHH H;  4JHD B;  3WXJ A;  1KTQ A;  3DLL L;  5AQG A;  4CJQ A;  5AQU A;  3O9U A;  4CER A;  4C8N A;  5BRD A;  4JS4 A;  3RR8 A;  4KPY A;  2HBL A;  1NBW A;  3VQ4 A;  2BL5 A;  4IJN A;  1HQE A;  1XHX A;  3J7A P;  4O4G A;  1UG8 A;  3RMB A;  3K5N A;  1NJY A;  2QKB A;  3NCV A;  1X9Z A;  4CZL A;  4N56 A;  2IOC A;  4H5W A;  4E7H A;  1E4G T;  4MDA A;  1JCE A;  4B9L A;  3D2E B;  4CJL A;  3AVF A;  4W5T A;  1EQY A;  1RDW X;  3CD6 N;  2DGR A;  3I8D A;  2V52 B;  3QNO A;  2FC0 A;  4LF4 H;  3RSE A;  1BI4 A;  1WSI A;  1W2B M;  3WXM B;  3E66 A;  1VQO N;  4FK0 A;  1IG9 A;  4RTF D;  3SAH A;  4HUG A;  4JEP A;  5FLX W;  1M90 O;  5GAH P;  3TU5 A;  4PKH A;  1B92 A;  1RTH A;  2YX6 A;  3ZSV A;  4BY9 C;  2E1Z A;  3O9T A;  4IG3 A;  4FW2 A;  4OKE A;  1I94 H;  2ZQB A;  1KAY A;  4BVO A;  1Z05 A;  2HHW A;  2RF2 A;  4B3M H;  4DR6 H;  4YDU A;  1X3M A;  4LF9 H;  1ZXO A;  4QMF B;  2HVI A;  2QA4 N;  4FLZ A;  4DV1 H;  2KHO A;  3SK3 A;  2R7Y A;  4I2P A;  1S5J A;  3RRG A;  5C0Y A;  4KH5 A;  4M42 A;  2PYL A;  3QBW A;  4IWV A;  3EZW A;  3ENB A;  3FFK B;  3I0R A;  3WUH A;  3G0Z A;  1OH7 A;  3DLH A;  2CGK A;  1JLA A;  2UUB H;  4JKF A;  3MEG A;  2ZJQ L;  4DUZ K;  4CEO A;  4LFB K;  2UUC H;  4DU1 A;  1BA0 A;  2IAJ A;  2W6K A;  2NN6 G;  3RMC A;  4A5A A;  1ATN A;  4ELU A;  4LSL A;  1TKZ A;  4C23 A;  3OYF A;  2KZZ A;  3TAQ A;  1EXQ A;  1VQM N;  1XNQ H;  2F9W A;  1RDU A;  3NE6 A;  2E2P A;  4M45 A;  1I3A A;  3NGZ A;  1ZBL A;  3DWL A;  3SBG A;  4FJ7 A;  1HPZ A;  3IFR A;  1T44 A;  2HNZ A;  3H3N O;  2E1Y A;  3FZF A;  4JI8 H;  4YOT A;  2IGI A;  3G6E N;  4E7K A;  1XRH A;  2JEB I;  5AZJ A;  1G15 A;  1NK8 A;  3A2F A;  5AZI B;  1XHZ A;  1HNX H;  3IKM A;  4IZ9 A;  4BQZ A;  2WC9 A;  1VRT A;  5CYQ A;  4AHV A;  3H45 C;  5GIO A;  5A2Q W;  4FWP A;  2Z0S A;  2JZX A;  4KRE A;  2P9K B;  2O8C A;  2HHV A;  3OYH A;  5BN9 A;  5AQJ A;  1DT9 A;  3D0P A;  4KHU A;  4DR4 K;  4DV5 K;  3LP3 A;  3PO4 A;  3HVR A;  4CEQ A;  3OA9 A;  2GWK A;  3DLR A;  5KGX A;  1T3V A;  5FPM A;  2QND A;  3ZSX A;  3AVG A;  4PKI A;  3G25 A;  3QDK A;  4DSF A;  3NHG A;  2D0B A;  2J4R A;  3C7N A;  1BHL A;  3QLH A;  2HNY A;  4RW9 A;  1NKB A;  2AP1 A;  1NU0 A;  1VAZ A;  1VSK A;  4CEE A;  3HXM A;  1B9D A;  3GBT A;  4K42 A;  3VER A;  3NVM A;  3VQ6 A;  4OLB A;  4ILG B;  1YF5 L;  4OVL A;  1DTJ A;  3K5M A;  1VSI A;  4AQY H;  3OYC A;  4FJ5 A;  4KHS A;  1VSD A;  4DTR A;  4M3T A;  4B3O A;  3HPG A;  3SUQ A;  5AQI A;  4DV3 H;  4DV0 H;  1JLF A;  3O6W A;  4NXM K;  2JA9 A;  4JV5 H;  4DTU A;  5CR4 A;  3MN6 A;  4FJL A;  4LFA H;  5ELZ A;  1SEI A;  3TAN A;  4CBX A;  1NK0 A;  3M8Q A;  5AQK A;  1DTT A;  4FJU A;  3DJC A;  1TVR A;  5M1P A;  2KKZ A;  4CEB A;  4DR7 H;  4BR2 A;  4YOU A;  1L3T A;  1WSF A;  5DM7 L;  3G71 N;  4ILH A;  3CMA N;  2NRT A;  1JJ2 M;  4LFC K;  5AFU A;  3T69 A;  5MLC Q;  2UYT A;  5LL6 b;  1YIJ N;  3WXI A;  3CM6 A;  4B8C A;  3THX A;  3VA3 A;  4DFJ A;  3CC7 N;  3AVI A;  1TYQ B;  2OYQ A;  2ZWH A;  4JKD A;  4WE1 A;  4CEC A;  4IOA L;  1MDU B;  4DUY H;  3ENO A;  3KLI A;  3HSC A;  1DTQ A;  1S72 N;  4GKK H;  3OYD A;  4X62 K;  4NBQ A;  1Q82 O;  3CCQ N;  3MXJ A;  4LD0 A;  5M1O A;  2P9P A;  4KAZ A;  3FR0 A;  3NGY A;  3CJ9 A;  5M1N A;  3L6Q A;  3NDK A;  4JI5 H;  4WQ5 C;  5HRO A;  4BA2 I;  1UOC A;  2HST A;  4LF8 H;  3OYJ A;  2GEM A;  3TAE A;  2RHK A;  2YHA A;  4KTQ A;  3PX6 A;  1WAJ A;  3GL1 A;  1O1W A;  1TAQ A;  2OPQ A;  4FJS A;  5FPN A;  1JLE A;  4Y1C A;  4OJR A;  3O5B A;  5BPL A;  3SV4 A;  3V9X A;  4JRQ A;  1S6P A;  1BCM A;  3QET A;  4E0D A;  1LWC A;  3KKS A;  3F9M A;  5HL7 L;  1VSJ A;  4FJG A;  1Z6R A;  4H0X B;  4OLA A;  3CG7 A;  4B1W B;  2OPV A;  4LC9 B;  1IBM H;  1RTJ A;  2P9N A;  4L8R B;  3VQA A;  4HTL A;  3SMS A;  1S03 G;  1L5U A;  1QE1 A;  4BG8 A;  3KKR A;  2ASP A;  1HJO A;  4C1N I;  5T7B A;  4KFB A;  2Q1N A;  1HUX A;  3H1Q A;  1RDB A;  3VMF B;  4BGA A;  2NNW A;  2ZJR L;  3LAL A;  3EY1 A;  4L3Q A;  5DK5 A;  3SYZ A;  3BP8 A;  4E1J A;  1GLD G;  3VQD A;  3CFR A;  2AJQ A;  2JGU A;  2VKC A;  4LSN A;  5IWA K;  5F2R A;  5AQS A;  2VQF K;  3V4I A;  4RWT A;  1HNZ K;  1E4F T;  4RCH A;  2P9U A;  1EET A;  1T03 A;  1V4S A;  4LF5 H;  3TTD A;  2ZM6 H;  3EZ5 A;  3AAP A;  1RT1 A;  2UXD H;  1GLF O;  1D9F A;  3TI0 A;  4K41 A;  1NWK A;  4AM3 A;  4BA1 I;  3BDP A;  2DFF A;  3N4P A;  1FKA H;  3NVK A;  1VK0 A;  4DQR A;  1Q9Y A;  3M8S A;  3AO2 A;  1K8K B;  4HWI A;  1BDG A;  4M63 C;  4FJM A;  4CIF A;  2VG5 A;  3C6U A;  1RCH A;  4CVN E;  3THY B;  2BGG A;  3O08 A;  1HNW H;  4FM2 A;  3K2P A;  2YHY A;  1IJJ A;  4CF8 A;  3SQ0 A;  3KZB A;  4N76 A;  4IJA A;  4DQP A;  1RDD A;  1N34 K;  3ULE A;  3SJJ A;  4N41 A;  1JLC A;  1EWQ A;  2E2N A;  3AVJ A;  3BZK A;  4IXC A;  3CJC A;  4KH4 A;  1C0F A;  4YOV A;  2XY5 A;  4MQ3 A;  2JLE A;  3OY9 A;  3J7Y P;  3WNE A;  4JI6 K;  4BDZ A;  3KHY A;  1T8E A;  1RT5 A;  4RW8 A;  4FL9 A;  2G8U A;  1DT4 A;  2QEX N;  4DR1 K;  2JWL A;  2BDP A;  3OSS D;  4M7X A;  1J4W A;  4TSX A;  3T19 A;  2YJE A;  3FZM A;  4CJW A;  1S6Q A;  3NF9 A;  1W7A A;  3KD5 E;  1VQP N;  1WNS A;  3DLK A;  2I5J A;  3LDO A;  4JI3 K;  5GAD P;  2O8F A;  1HR0 H;  1FJG H;  4DQQ A;  1XMO K;  1BO5 O;  4DF4 A;  4CFC A;  4CGH A;  1SV5 A;  4FJI A;  4B9N A;  3C65 A;  4K25 A;  4KHW A;  3H6E A;  3KLG A;  3QFU A;  3VTH A;  5FRM A;  2NRV A;  2WBN A;  3RMA A;  2VGM A;  3G4S N;  4I2Q A;  4KH6 A;  3DRS A;  1BCO A;  4Z4C A;  3QML A;  3K9K A;  4FSV A;  4JI2 H;  1CXU A;  2BE2 A;  4CI6 A;  3SPY A;  3CQX A;  2A6A A;  2A5X A;  4AM7 A;  5FPE A;  4OGE A;  4FO0 A;  3PO5 A;  4OKK A;  4DV4 H;  4GVM A;  1YT3 A;  1V8C A;  3CJ1 A;  3B8A X;  4B1Y B;  2G8H A;  5BN8 A;  3OYG A;  1WTJ A;  1A5X A;  1TV6 A;  4FZX C;  4K0K H;  3CER A;  2P9S B;  2Y1I A;  5I42 A;  4MLH A;  3VQB A;  2HW3 A;  3DXM B;  3SUN A;  3VEY A;  3LPT A;  4C1N K;  1HLU A;  4FLV A;  2GX9 A;  4IFV A; 
#chains in the Genus database with same CATH homology
 3QNO A;  2FC0 A;  1Z26 A;  4J2A A;  1BI4 A;  1WSI A;  3PX0 A;  4ZTF A;  2B6A A;  3S3N A;  1EP4 A;  4KTW A;  4FK0 A;  1IG9 A;  1QSS A;  1TKX A;  3OYK A;  4HUG A;  3B6O A;  4O0I A;  1N5Y A;  1GOC A;  4KB0 A;  1ITG A;  4FZY A;  1S9G A;  5HRP A;  4AIL C;  3CFO A;  1B92 A;  1RTH A;  4CK3 A;  2E6M A;  3OYB A;  2ATQ A;  5CY4 A;  3ZSV A;  3K5L A;  5HRR A;  3CFP A;  4IG3 A;  5DMR A;  4CEA A;  4FW2 A;  3IRX A;  4JS5 A;  1XI1 A;  1D9D A;  3ASM A;  3PUF A;  4OKE A;  4AHR A;  3WNG A;  2ZD1 A;  4W5R A;  2ZQB A;  4DTO A;  4AH9 A;  3QER A;  3IG1 A;  1SL0 A;  1ZBH A;  2HHW A;  2RF2 A;  1U47 A;  4B08 A;  1JXB A;  4HVJ A;  4KPY A;  1RT7 A;  1GOA A;  2YV0 X;  4DSE A;  1WN7 A;  4KHQ A;  3RWU A;  3MXI A;  2HVI A;  3BGR A;  3OS1 A;  2YNI A;  4FLZ A;  4FLX A;  3SQ2 A;  3CYM A;  1FXX A;  4DSJ A;  3L8B A;  3ZT1 A;  1NK4 A;  4FJ8 A;  2HHU A;  2R7Y A;  3HK2 A;  4PY5 A;  4I2P A;  3GKU A;  1S5J A;  4BE1 A;  2Y1J A;  1KLN A;  3RRG A;  4HUF A;  2HMI A;  4FK2 A;  1BQN A;  4M42 A;  2PYL A;  3ZSR A;  1SUQ A;  1QS4 A;  1NOZ A;  4RW7 A;  4IBN A;  3I0R A;  3U6F A;  3G0Z A;  3ZT0 A;  1ZBF A;  3DLH A;  1JLA A;  3DLE A;  3MEC A;  1U49 A;  4KV8 A;  4FZZ A;  3MEG A;  3PV8 A;  4DSI A;  1HYV A;  4CJE A;  1HNV A;  4CEO A;  1YTU A;  3RMD A;  4Q0B A;  4DU1 A;  4LH5 A;  4KKO A;  2PY5 A;  4W5N A;  2IAJ A;  2HND A;  3OYL A;  4DFM A;  1T05 A;  3RMC A;  4ELU A;  2FBT A;  4LSL A;  2O4I A;  1TKZ A;  2XRI A;  3OYF A;  2KZZ A;  4KHN A;  5FRO A;  3TAQ A;  4M41 A;  1X9M A;  3LP2 A;  2IC3 A;  1EXQ A;  3L2V A;  3THV A;  1LW2 A;  3VA0 A;  3SI6 A;  4FJ9 A;  1TK8 A;  4E7J A;  4UQG A;  3NE6 A;  4HUE A;  1TK5 A;  1NOY A;  3O4N A;  4M45 A;  4FVM A;  1D5A A;  4CHP A;  4HCC A;  3NH2 A;  4C8K A;  1I3A A;  3FFI A;  3NGZ A;  1ZBL A;  3LP0 A;  3PY8 A;  4GMJ B;  4LY7 A;  4DWI A;  1KRP A;  1HPZ A;  4FJ7 A;  1WLJ A;  4BE0 A;  3QEV A;  2HNZ A;  1IKX A;  2IGI A;  3SV3 A;  3AVL A;  4E7K A;  4QCL A;  4FW1 A;  1RBT A;  1LWE A;  1VSF A;  4CJU A;  1G15 A;  4CF9 A;  5KRT A;  1NK6 A;  3V1Q A;  5SZT A;  3KTQ A;  1NK8 A;  5HRS A;  1ASU A;  3A2F A;  4FK4 A;  2HB5 A;  1XHZ A;  1WSG A;  4CK2 A;  4CJK A;  1MSZ A;  3HO1 A;  1EX4 A;  1VRT A;  5CYQ A;  4AHV A;  5C42 A;  2X6N A;  1X1P A;  4BE2 A;  3RRH A;  3D45 A;  3V9Z A;  1RT3 A;  4KRE A;  5C24 A;  4E1M A;  4B9T A;  4EP4 A;  2HHV A;  4CGI A;  3OYH A;  3V6D A;  4M3U A;  3UIQ A;  1HYS A;  3D0P A;  4KHU A;  4DFK A;  4AHT A;  1QSL A;  3LPU A;  2X6S A;  1L3U A;  3LP3 A;  3PO4 A;  3HVR A;  4CEQ A;  4E1N A;  5KGX A;  3DLR A;  1J9A A;  3S3M A;  3DOK A;  2G8I A;  3KK3 A;  1RTI A;  3SQ4 A;  2EHG A;  1C6V A;  3AVG A;  3ZSX A;  1U48 A;  4O55 A;  4O5B A;  1QTM A;  4DSF A;  4FM1 A;  1S1X A;  3NHG A;  4FJK A;  4BWM A;  3S9H A;  2D0B A;  1BL3 A;  5FDL A;  4BDP A;  1U04 A;  2LRR A;  1RIL A;  1HJR A;  3TAB A;  1BHL A;  3QLH A;  3SPZ A;  2HNY A;  1X9W A;  3P5J A;  1IKV A;  4RW9 A;  2Z1I A;  3OYE A;  1NKB A;  2HHS A;  3AO5 A;  4M3W A;  4G1Q A;  1VSK A;  4CEE A;  4DMN A;  3HXM A;  3TWH A;  1B9D A;  1KVC A;  2D0C A;  1S9E A;  4CJ4 A;  4Q5V A;  1JKH A;  3VQ6 A;  4AHC A;  4OLB A;  4OVL A;  4J2E A;  1UWB A;  4CGG A;  4LH4 A;  3K5M A;  1VSI A;  4B8A B;  4CFD A;  4DTS A;  3OYC A;  3ZSY A;  4FJ5 A;  4KHS A;  4B9U A;  3LWL A;  1VSD A;  4DTR A;  1L3V A;  4M3T A;  4B3O A;  1IKY A;  4CED A;  4DSK A;  3HPG A;  1RBV A;  3SUQ A;  4O0J A;  3MED A;  4Z0U A;  2OPS A;  1UA0 A;  1JLF A;  4C8O A;  4GW6 A;  2KFZ A;  1KLM A;  1WSH A;  3TAF A;  2VWJ A;  5J2N A;  1A5V A;  4DTU A;  4NYN A;  4CCH A;  4FJL A;  2XY6 A;  2OPP A;  3V1O A;  3MAQ A;  4J2D A;  3TAN A;  3LWM A;  3TR8 A;  3LAM A;  3NBP A;  1NK0 A;  2XY8 A;  3M8Q A;  1DTT A;  3KLF A;  4OPK A;  3VN5 A;  4KHY A;  4FJN A;  2KFN A;  1C0U A;  1TVR A;  2FBX A;  3EYZ A;  1BI4 B;  3U3G A;  3KJV A;  3AA5 X;  4CEB A;  3K58 A;  3LP1 A;  1F21 A;  4FJX A;  2WON A;  3KK2 A;  4DLE A;  4DTX A;  3E01 A;  1L3T A;  1TKT A;  1WSF A;  4H4M A;  3JYT A;  1QSY A;  4CEF A;  4DS4 A;  4CFB A;  3KIO A;  3HST B;  4C8M A;  3AA3 A;  4K8Z A;  3ZT4 A;  2YKM A;  3QEW A;  3V81 A;  1NJX A;  2YNF A;  3NGI A;  4HHT A;  3HM9 A;  1TGO A;  1CZB A;  3O4Q A;  4DU4 A;  2W42 A;  4CJT A;  2G8W A;  3ZT2 A;  4M3Y A;  3ZSQ A;  3L2U A;  3DYA A;  3KLE A;  3CM6 A;  2PYJ A;  1NJZ A;  4B8C A;  3T3F A;  2QXF A;  5HRN A;  3AVH A;  2IDO A;  1ZYQ A;  5JS2 A;  3VA3 A;  4DFJ A;  5HP1 A;  1LAV A;  3AVI A;  3QEP A;  2KW4 A;  2OYQ A;  4DU3 A;  3OYA A;  1KFS A;  4EZ9 A;  1S1T A;  4WE1 A;  4CEC A;  2YNH A;  3LAN A;  3HPO A;  1FKO A;  4ICL A;  2X74 A;  3KLI A;  1DTQ A;  1JLB A;  3QEI A;  4ZTJ A;  3OYD A;  1YVU A;  1CZ9 A;  2XHB A;  2G8K A;  1REV A;  2GV9 A;  3SUP A;  3K5O A;  1NK9 A;  4C8L A;  1D8Y A;  4RG8 A;  3OJS A;  4FLT A;  1LWF A;  1TL3 A;  3MXJ A;  2DY4 A;  5CZ1 A;  4LD0 A;  3LZJ A;  4CHQ A;  3L2R A;  2QK9 A;  4KAZ A;  3NGY A;  3S3O A;  1VSE A;  4DS5 A;  1RDC A;  3AV9 A;  3HP9 A;  1ASV A;  3OJU A;  3NDK A;  4DLG A;  5E41 A;  3SZ2 A;  4FXD A;  1DLO A;  3P1G A;  1IH7 A;  1W9H A;  3K59 A;  3NFA A;  4E3S A;  4CHY A;  3DM2 A;  2Q3S A;  3L2W A;  3AO3 A;  5HRO A;  4CJF A;  2FBV A;  1RBS A;  1SL1 A;  1RNH A;  3P83 D;  4ID1 A;  1RTD A;  1UOC A;  1IKW A;  4CHN A;  4DTJ A;  3OYJ A;  3TAE A;  4J2B A;  3L2Q A;  2YHA A;  1ZBU A;  3LDS A;  1Q9X A;  4ELT A;  4KTQ A;  3PX6 A;  1WAJ A;  1O1W A;  1TAQ A;  2OPQ A;  4EP5 A;  1KSP A;  3DLB A;  4BDY A;  5I3U A;  4HCB A;  1T7P A;  3TAM A;  4Z4E A;  1JLE A;  1J53 A;  4OJR A;  4Y1C A;  1BQM A;  3O3G A;  1WSJ A;  4FLW A;  3SV4 A;  4YNQ A;  3V9X A;  4CGD A;  4H8K A;  4RW6 A;  1FK9 A;  3CQ8 A;  1S6P A;  1BCM A;  3F73 A;  4JRQ A;  3QET A;  4KI6 A;  3MXM A;  4Z4G A;  4E0D A;  1LWC A;  1ASW A;  1I39 A;  3CM5 A;  3KKS A;  3LZI A;  2PZS A;  4I7F A;  4IG0 A;  3DLG A;  4IFY A;  4BWJ A;  1VSJ A;  1HNI A;  3QIN A;  4FJG A;  5SWM A;  3AVK A;  3ZSZ A;  3CG7 A;  1LW0 A;  4OLA A;  1JL2 A;  3NF7 A;  3HJF A;  3QEX A;  4NCB A;  1RTJ A;  1HRH A;  1C1A A;  1U45 A;  2G8V A;  4L8R B;  4M3Z A;  2F8S A;  3VQA A;  3HL8 A;  4CIE A;  3QO9 A;  1JLQ A;  4QAG A;  4Z4I A;  1L5U A;  4CK1 A;  3QES A;  1Q8I A;  1SKR A;  3OYN A;  1QE1 A;  5JS1 A;  3JSM A;  1WHR A;  4FLY A;  3AVM A;  3QIO A;  3KKR A;  2P1J A;  3RTV A;  1HQU A;  4F3T A;  5T7B A;  2DFH A;  4KFB A;  3VQ5 A;  4OPJ A;  1RDB A;  3C6T A;  5HBM A;  3OS0 A;  4CEZ A;  1N6Q A;  1RDA A;  3G10 A;  1S1U A;  4NYF A;  3AVA A;  3K57 A;  3LAL A;  3DMJ A;  1ZBI A;  3PX4 A;  4PQU A;  4CJS A;  2F8T A;  3EY1 A;  2P51 A;  4Z4F A;  5DK5 A;  5KGW A;  3SYZ A;  4DTP A;  4W5O A;  5J1E A;  3VQD A;  3CFR A;  3SNN A;  2JGU A;  2AJQ A;  4B9M A;  4F4K A;  4LSN A;  4CF1 A;  4W5Q A;  4FJH A;  2HHX A;  4IDK A;  3AVC A;  1SKS A;  2HHT A;  4QOZ B;  1KVB A;  1XWL A;  1SL2 A;  3V4I A;  3T1A A;  2F96 A;  4OGC A;  3VQ7 A;  2KTQ A;  5KI6 A;  1J5O A;  3AO4 A;  4CHO A;  1EET A;  4B9V A;  4K8X A;  1UA1 A;  1T03 A;  2ITG A;  3HVT A;  2Z1J A;  3AO1 A;  3EZ5 A;  1JLG A;  3NAE A;  2LSN A;  2HHQ A;  2DFE A;  4EZ6 A;  4F8R A;  1CXQ A;  1RT1 A;  1BIZ A;  4FYD A;  1C1C A;  3OVN A;  4BAC A;  5J2M A;  4CFA A;  1UAX A;  2NUB A;  3AA4 A;  2RPI A;  1QQC A;  4MFB A;  3QIP A;  3TI0 A;  1X9S A;  1D9F A;  4B9S A;  3KLH A;  1VSL A;  3BDP A;  1TAU A;  4CJV A;  2DFF A;  1C0T A;  4DSL A;  3VQP A;  4DG1 A;  4CHZ A;  1NKE A;  1VK0 A;  2B5J A;  4DQR A;  1Q9Y A;  3NF8 A;  3M8S A;  3AO2 A;  3C95 A;  1BIU A;  2ZE2 A;  1Y97 A;  2BAN A;  4E7L A;  4CIG A;  4DQS A;  3O3H A;  2GBZ A;  5CZ2 A;  5CYM A;  4Z4H A;  3OS2 A;  4KB1 A;  4FJM A;  4CIF A;  4FLU A;  3V9U A;  2VG5 A;  1IO2 A;  2GUI A;  1KFD A;  1RCH A;  3C6U A;  2BGG A;  1YTA A;  2KQ2 A;  3O3F A;  3K2P A;  4FM2 A;  1TKD A;  2HVH A;  1WSE A;  1VSH A;  3V1R A;  5EU7 A;  1JXE A;  4CF8 A;  1RT6 A;  4YFU A;  3SQ0 A;  4CJP A;  1RDD A;  2VG6 A;  4CJR A;  4DTN A;  1NKC A;  4DQP A;  4ID5 A;  4F3O A;  3TAP A;  3VQ9 A;  1W0H A;  4NCA A;  5C25 A;  2CPM A;  4FCY A;  3SJJ A;  2Z1H A;  4FJJ A;  4N41 A;  1WAF A;  5FRN A;  3F9K A;  1EKE A;  4PA1 A;  1JLC A;  2ETJ A;  3VQQ A;  1RT4 A;  3AVJ A;  1C1B A;  3U3Y A;  3DRP A;  4I9L A;  3WNF A;  1TL1 A;  3NH0 A;  2XY5 A;  3ZT3 A;  4MQ3 A;  3ZSO A;  2JLE A;  2RN2 A;  3OY9 A;  1NK5 A;  2B4J A;  2D0A A;  4DQI A;  2YNG A;  3VQE A;  1GOB A;  1KVA A;  4KTZ A;  3WNE A;  3H08 A;  3NH1 A;  4BDZ A;  5J2Q A;  1HYZ A;  3SUO A;  4CJ3 A;  1XC9 A;  4JLH A;  3M8P A;  3HP6 A;  4PUO A;  1T8E A;  3TAG A;  4KO0 A;  3SCX A;  4PWD A;  3V9S A;  4KRF A;  2VWK A;  4CF0 A;  1TK0 A;  1CLQ A;  2E4L A;  1RT5 A;  4N5S A;  2D5R A;  4RW8 A;  4CJ5 A;  3V9W A;  3DI6 A;  4CE9 A;  2G8U A;  3C94 A;  3RR7 A;  3ZSW A;  4H4O A;  2Z1G A;  4E19 A;  2BDP A;  1C0M A;  3LAK A;  2DTU A;  3MEE A;  3WNH A;  3ISN C;  3SQ1 A;  4TSX A;  4R5P A;  3I8D A;  3T19 A;  1RBR A;  1VRU A;  4Y1D A;  3M8R A;  4RW4 A;  3OYI A;  4FM0 A;  1KCF A;  4CJW A;  4KI4 A;  1S6Q A;  1RT2 A;  3NF9 A;  4JRP A;  1B9F A;  2FBY A;  3KD5 E;  1Z25 A;  3IS9 A;  4E7I A;  4F2R A;  1WNS A;  3DLK A;  4XIU A;  4M3X A;  2I5J A;  1LV5 A;  1S1V A;  4N47 A;  3OYM A;  4DQQ A;  1L3S A;  2A1S A;  2OPR A;  3HPH A;  3ZCM A;  3HT3 A;  2P5O A;  3L3U A;  3AA2 A;  2VG7 A;  1S1W A;  4IKF A;  4DF4 A;  4F2S A;  5K14 A;  4CFC A;  3VQC A;  1SV5 A;  3I0S A;  2RKI A;  4CGH A;  3KK1 A;  5J2P A;  4ZHR A;  2OA8 A;  4B9N A;  4FJI A;  4KHW A;  1VSM A;  5KTQ A;  4CES A;  3KLG A;  2EX3 A;  4OKJ A;  5FRM A;  4DF8 A;  3ULD A;  3VQ8 A;  3RMA A;  1U4B A;  4N76 A;  4I2Q A;  5KRS A;  4DFP A;  2G8F A;  1R0A A;  1J54 A;  2X78 A;  2XY7 A;  3DRS A;  1BCO A;  1MU2 A;  4CGF A;  2IS3 A;  2YHB A;  1HMV A;  3DRR A;  4Z4C A;  2O4G A;  2A1R A;  1K6Y A;  3KD1 E;  1CXU A;  1BIS A;  2XO7 A;  2BE2 A;  3NCI A;  3SPY A;  3DOL A;  5D3G A;  4OGE A;  3PO5 A;  4CGJ A;  4ELV A;  3TAR A;  4OKK A;  1KTQ A;  4GVM A;  4M3R A;  1YT3 A;  1A5W A;  4CJQ A;  4CER A;  4AHU A;  4JS4 A;  4C8N A;  1NJW A;  2QKK A;  1QHT A;  3RR8 A;  2WOM A;  2OZS A;  3VQ4 A;  3HYF A;  2P5G A;  1RBU A;  1NK7 A;  1BGX T;  2G8H A;  4DTM A;  3OYG A;  4I9Q A;  4HTU A;  1JL1 A;  1A5X A;  1HQE A;  1XHX A;  3ALY A;  3AVB A;  4O4G A;  1UG8 A;  3RMB A;  3IAY A;  3K5N A;  1NJY A;  2QKB A;  1TV6 A;  2YKN A;  4N56 A;  4FZX C;  2IOC A;  3NF6 A;  3AVN A;  4O44 A;  4E7H A;  2Y1I A;  3VQB A;  5I42 A;  4E89 A;  1SKW A;  4B9L A;  4CJL A;  2OZM A;  2HW3 A;  3L3V A;  3QNN A;  1LAW A;  2E6L A;  3B6P A;  4AHS A;  3SUN A;  3AVF A;  4W5T A;  5HLF A;  2KZM A;  3LPT A;  4NCG A;  3ITH A;  4FLV A;  4CF2 A;  1FKP A;  4IFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...