2A1SA

Crystal structure of native parn nuclease domain
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
430
structure length
391
Chain Sequence
MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Poly(A)-specific ribonuclease PARN
publication title Structural insight into poly(A) binding and catalytic mechanism of human PARN
pubmed doi rcsb
source organism Homo sapiens
total genus 112
structure length 391
sequence length 430
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2a1sA01
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 2a1sA02
3TANA 1BL3A 4CHQA 1U4BA 4CJEA 4E1MA 1EP4A 3ZSVA 3TAQA 5CYMA 4PUOA 4Z4EA 1GOCA 4KHYA 1RT5A 3VQ5A 1BQNA 4LH5A 4CF2A 2XY7A 2GV9A 1BGXT 3HO1A 3CM5A 1XWLA 3SI6A 4CF1A 1RBVA 1HYZA 5CZ1A 2ZQBA 4BWJA 1BIUA 1QTMA 4FZYA 1J5OA 3DLRA 1MU2A 5HRPA 1VSJA 4DS5A 1A5XA 2D0AA 4LSNA 1T7PA 1LWCA 1RBRA 1RDCA 1C0UA 3P83D 3EY1A 2OYQA 2YHAA 3OJUA 3QINA 2KTQA 4OKJA 1JLQA 1L3SA 3QIOA 4DTPA 4IG0A 3CG7A 3AVLA 1NKCA 4FLUA 3L2RA 4E3SA 1NJYA 4FYDA 2BANA 4CCHA 4K8ZA 4FM2A 3OYMA 3DM2A 1A5WA 4H4OA 5KRSA 3O3HA 1L5UA 2Y1IA 1QSYA 2Z1HA 3K58A 3ALYA 3NBPA 3HM9A 1KVAA 3KIOA 5JS2A 2XY5A 3ISNC 2VG5A 3OVNA 2HHUA 5HRNA 4CJPA 4UQGA 3QERA 3ZSOA 2KQ2A 2HHSA 2OPQA 3K59A 1HNVA 2GBZA 2OA8A 4PY5A 4CJKA 5HRRA 1D8YA 4DFPA 4CJVA 4B9UA 3B6PA 1W0HA 4M3XA 5HP1A 2HNYA 3IG1A 3MECA 3VQ8A 2F96A 4GMJB 4CJSA 5C24A 1HJRA 4CJ3A 5HROA 4F8RA 1NJWA 1VSIA 4KFBA 5SWMA 4M45A 2YNHA 3CFOA 4DQQA 1Q9YA 4DQPA 1BI4B 3LAKA 5J2QA 5FRMA 1A5VA 1XC9A 4O55A 1TAQA 1WNSA 4NCAA 4W5RA 1FKOA 3MXJA 3OYHA 3C6TA 4J2AA 4FJLA 1VSKA 2KZZA 3DLGA 3NF6A 2YNIA 4B9LA 1S5JA 4JRQA 4CEBA 4B9MA 1DLOA 2EHGA 4DQSA 3ASMA 4AHCA 3VQ6A 3OS0A 3HJFA 4KTWA 1LWEA 2DFFA 4CEOA 3VQCA 4W5OA 4DQIA 3AVIA 1UG8A 3I0SA 5FDLA 1RTIA 1SKWA 4CEAA 1S1TA 3U3YA 1KRPA 4MFBA 4EP5A 1CXQA 1J53A 5DK5A 2G8IA 4K8XA 4QCLA 3AVHA 3ZSRA 1T8EA 4DWIA 3OS1A 4BACA 1C6VA 3HP6A 4E19A 3AVKA 2FBVA 2G8WA 2PYLA 4DS4A 1HYVA 5T7BA 3TWHA 3RMCA 2PY5A 4C8NA 4DU3A 3RR8A 3WNEA 1VSLA 4DU1A 3RRGA 3E01A 2XRIA 4BE0A 3C6UA 4O0JA 4F2RA 4FJNA 4CGIA 2QXFA 3GKUA 3F73A 3SUQA 5HRSA 1YVUA 1ZBHA 2HVHA 5FROA 3QLHA 4J2DA 4CECA 3QEPA 4FJJA 3L3VA 2GUIA 1WAFA 2D0BA 2P1JA 4KRFA 1J54A 4IFVA 3OYGA 1NJZA 1TKDA 4ELTA 3BGRA 2FC0A 3VQ9A 3NH2A 3KJVA 4HUGA 1X9MA 4O4GA 4DSEA 4CIEA 3VQBA 4AHSA 4CEZA 4CGDA 3OS2A 3T1AA 2DY4A 1WSEA 2XHBA 2DTUA 1BIZA 4HCCA 4KTZA 4FLTA 2QKKA 3OYDA 3MXIA 1LW2A 4FM1A 4CFBA 3ZT4A 2Z1GA 4NCBA 4KHSA 1LAVA 3RMBA 1VSFA 4C8MA 3L3UA 1JLGA 3WNHA 3NE6A 3DLBA 1SL1A 4DTSA 1IH7A 3KKRA 3O4QA 1LAWA 3K5NA 1RTDA 1TK8A 2R7YA 2HMIA 4DMNA 1JL1A 3F9KA 3U6FA 2IGIA 3SJJA 4B9VA 1C0TA 1S9EA 4L8RB 3V6DA 1UAXA 3VQPA 4DSFA 3AO4A 3AVMA 3NH1A 4CJLA 3AV9A 3LALA 1RT4A 1NKEA 1Q9XA 1HYSA 1YTAA 4JS4A 2XO7A 1B92A 3OYFA 3K5OA 2Z1IA 3G10A 1UA1A 4Z0UA 1Q8IA 1D9DA 1TVRA 1RTJA 3DRSA 3NF8A 3ZT2A 4FJXA 1RDAA 3SZ2A 4DTOA 2B5JA 3DLEA 3PX4A 3LP0A 4IG3A 1N6QA 1KVBA 2X74A 2FBXA 3V1OA 4CHZA 1TK0A 1LW0A 3HT3A 3PY8A 4KREA 1WN7A 1VK0A 4I9QA 2E6MA 1S9GA 4CGHA 3HP9A 3S3MA 1RTHA 5J2MA 3M8QA 3NF7A 3M8RA 3LZIA 1NK0A 4CERA 2HHTA 1VSEA 1NK7A 3SUOA 1RILA 2X6NA 2YKMA 2IS3A 1B9FA 1BISA 1D9FA 3HYFA 1FXXA 1KFSA 4CEFA 4E0DA 4ICLA 1RDBA 2ZE2A 1JXBA 1C1AA 1L3UA 2XY8A 1JXEA 4LH4A 1TKTA 3CFPA 1TV6A 1WSIA 4Z4GA 3G0ZA 3HVTA 4FZZA 2O4IA 2HB5A 4KV8A 1NK6A 3HVRA 1X9SA 1IG9A 2VG7A 3ZSYA 3ZSWA 3HK2A 2G8KA 3H08A 4XIUA 2CPMA 2HVIA 3A2FA 4FCYA 1KLMA 4CJRA 5KRTA 1VRUA 3LANA 4LY7A 4FLYA 3SUPA 3THVA 4CEDA 3AVJA 3AVGA 2DFEA 4KKOA 4M3RA 3CQ8A 3LZJA 3V9WA 4M3YA 2KFNA 4I2QA 1ITGA 3NF9A 3C94A 3V81A 4N56A 4E7HA 1WAJA 4CJWA 3QNOA 3MEGA 5I42A 4FJMA 2E4LA 4N5SA 4M3WA 2KZMA 4B9SA 4O0IA 1BQMA 4CEEA 1SUQA 3LP1A 4RW8A 4BE2A 1U49A 3KLHA 4YFUA 4DQRA 4FVMA 1QSSA 4FK2A 2AJQA 4ELUA 4DTJA 2IDOA 4W5QA 3ZSQA 4NYNA 3EYZA 3LPTA 5KTQA 1QSLA 5D3GA 4AHTA 3LP2A 1FKPA 1U47A 3HXMA 3QESA 4CFCA 1WLJA 3O4NA 1X1PA 1RT1A 3MAQA 1XHZA 4E1NA 1UOCA 2JLEA 2ATQA 2YHBA 4O44A 4DU4A 4DF4A 4CHPA 4Z4CA 3SQ4A 3AVAA 3HPGA 3OYIA 3MEDA 4E7KA 4B8AB 4DSKA 4EZ9A 2HHXA 3OYAA 1JL2A 4CEQA 3NAEA 2PZSA 4C8KA 1JLCA 4ID5A 2BDPA 5J2PA 1JLBA 4QOZB 3NDKA 3KLGA 4FLXA 4B9TA 2FBYA 4BDYA 2VWKA 4CGJA 2G8VA 1SL2A 4KHNA 4ID1A 2FBTA 3AO2A 3LP3A 4CIGA 3RTVA 4N41A 1TKZA 4OVLA 4DLEA 1SV5A 4FW1A 3K2PA 1FK9A 2W42A 3HSTB 4TSXA 1TKXA 2ZD1A 3B6OA 4RW6A 3OYEA 1TL3A 4Y1DA 1KVCA 1TAUA 3L2UA 3CYMA 3AVFA 4EP4A 3DLHA 4BDPA 3KD5E 1WHRA 4B8CA 4CFDA 2DFHA 1HMVA 5K14A 1S6QA 3OYKA 5CYQA 3LWMA 3JYTA 3MXMA 2OZMA 4CF9A 1HNIA 4OGCA 3V9ZA 4DSJA 4KHWA 2OPRA 3IRXA 1ASVA 1VSMA 4OKKA 3QNNA 3KD1E 4KHQA 3NGYA 2KW4A 1KCFA 1JLAA 5J1EA 1WSHA 3NHGA 3IAYA 1ZBFA 3KLIA 4AILC 5I3UA 1CZBA 4HCBA 1C1BA 3QO9A 4E7JA 4KTQA 1C0MA 3D45A 1S6PA 3M8SA 3I8DA 2RPIA 1RBUA 4BWMA 1S1XA 1HRHA 1CLQA 1U45A 3RR7A 1W9HA 4Z4HA 1K6YA 2OZSA 2JGUA 1RNHA 3VQQA 4W5NA 4PWDA 4CK1A 2RKIA 1ZBUA 2PYJA 1I3AA 4OPJA 3P1GA 3S3OA 1NK5A 1S1WA 1TL1A 3BDPA 4OJRA 1Y97A 3HPHA 4PA1A 5HBMA 3PX6A 3KTQA 4CJ5A 2F8SA 3SUNA 1NK9A 3O3GA 3D0PA 1REVA 2I5JA 2NUBA 3DMJA 3TAGA 2P5OA 3UIQA 4FJIA 3KKSA 4IBNA 4FLWA 4PQUA 3WNGA 3ZCMA 3ITHA 4OGEA 4C8LA 4HUEA 3EZ5A 2G8FA 1EETA 3AO5A 3L2WA 4RG8A 4F2SA 1KFDA 4Z4IA 5KI6A 4M41A 1S1UA 2X6SA 3OY9A 3VQ4A 4CFAA 4ZTJA 1UA0A 3AVNA 1ASUA 4FJ8A 3QEXA 2Z1JA 2XY6A 1QHTA 3TAEA 3HL8A 4FJ9A 1O1WA 1RCHA 1NOZA 4G1QA 4FK4A 1D5AA 4NYFA 1RDDA 4ZHRA 4DSIA 1VRTA 4B9NA 4JS5A 1QS4A 3ZT0A 1IKYA 3RRHA 4HHTA 4H8KA 3P5JA 2OPSA 4AH9A 4BE1A 4FJ5A 4HVJA 3QEVA 3TAPA 4NCGA 3LWLA 3OYJA 1BHLA 1UWBA 2HW3A 4M3ZA 3DOLA 1TGOA 1DTQA 1GOBA 1VSHA 2ETJA 2YNGA 4CJTA 4DF8A 2RF2A 5C42A 1BCMA 3CFRA 3PUFA 3VQDA 5CZ2A 3KK2A 2E6LA 1B9DA 2D5RA 3VN5A 3L2VA 5FRNA 3AO1A 4MQ3A 3OYNA 3JSMA 4FLVA 4DTRA 4W5TA 1SKSA 1XHXA 1HQEA 3TARA 4CGFA 4CJFA 4N76A 3OYCA 3IS9A 3DYAA 4CIFA 4OLAA 1CZ9A 3T3FA 4LSLA 4DFMA 1RBSA 3T19A 4KB0A 2YNFA 1RT7A 1XI1A 3DI6A 2F8TA 2IOCA 1JKHA 4CJ4A 3AVBA 4FM0A 3AA4A 1YT3A 4FLZA 3U3GA 4J2BA 5SZTA 4DTMA 2BGGA 4CHYA 3V9UA 1YTUA 3VQ7A 2P51A 4CJUA 1RT6A 3AA5X 4CHNA 5HLFA 4AHVA 4FJHA 4KPYA 4OPKA 2LRRA 1BI4A 3LPUA 3SQ2A 4Z4FA 5E41A 3QIPA 4KB1A 4OLBA 1NJXA 4DTUA 3KLEA 4KAZA 4DTNA 4F3TA 3OYLA 2G8HA 3NGIA 4HUFA 3K5LA 1N5YA 4IDKA 3O3FA 4FJGA 3KK3A 4I2PA 4CF8A 2VG6A 4RW4A 4M3TA 4DG1A 4Q0BA 3SV4A 4JRPA 2KFZA 3DOKA 1KLNA 1G15A 3C95A 3RMAA 1I39A 2Q3SA 3VA3A 2D0CA 4EZ6A 3TR8A 4CJQA 3NH0A 3K57A 5J2NA 3HPOA 3AA3A 5C25A 3PO4A 4R5PA 2P5GA 1IKVA 3QEWA 2QKBA 2HHVA 3NGZA 1IKXA 1GOAA 1T03A 1KTQA 4E7LA 4E7IA 4FW2A 3S3NA 1T05A 2IAJA 4Y1CA 1NOYA 1X9WA 3AVCA 3M8PA 4FK0A 3PO5A 1RT2A 4CF0A 2Y1JA 4C8OA 1LWFA 1Z25A 4I9LA 3L2QA 4FZXC 1NK8A 3CM6A 1EXQA 3LDSA 3SQ0A 3VA0A 1WSGA 4ELVA 4RW7A 2O4GA 4GW6A 3ZSXA 2WONA 1S1VA 2RN2A 1NK4A 3AA2A 3PX0A 4FJKA 4CESA 1DTTA 3NCIA 3SYZA 3TAMA 4KI4A 4QAGA 1MSZA 1U48A 1RT3A 4HTUA 3V1QA 5EU7A 3DRRA 4IFYA 4O5BA 3SPYA 1L3VA 2HHWA 5DMRA 4YNQA 2B6AA 3TABA 2VWJA 3WNFA 1F21A 1U04A 3ZSZA 2LSNA 1SL0A 3ZT3A 4FJ7A 4CGGA 3QEIA 3RMDA 1QQCA 1IKWA 3DRPA 5CY4A 3L8BA 4F4KA 4I7FA 3SNNA 3AO3A 4FXDA 3OJSA 4DTXA 3LAMA 1J9AA 3KLFA 3V9SA 4E89A 1KSPA 1JLFA 3K5MA 5JS1A 3V9XA 3SPZA 4AHRA 4DLGA 1VSDA 2IC3A 1NKBA 2WOMA 1JLEA 2HNZA 3DLKA 4KHUA 1EX4A 4DFJA 3SCXA 1ASWA 1ZBLA 5KGWA 4M42A 2HNDA 1QE1A 1TK5A 1IO2A 2A1SA 3ZT1A 4JLHA 4B08A 3QETA 3I0RA 4CHOA 3SQ1A 2OPPA 1L3TA 3ULDA 3RWUA 1BCOA 4LD0A 2G8UA 3V4IA 3SV3A 1Z26A 1C1CA 2HHQA 4ZTFA 1ZBIA 2EX3A 3TI0A 4KO0A 4RW9A 2B4JA 4N47A 1CXUA 1HPZA 2A1RA 1EKEA 3FFIA 5KGXA 4Q5VA 3KK1A 1WSFA 2YV0X 3TAFA 4H4MA 2YKNA 3PV8A 4GVMA 4DFKA 1LV5A 4DSLA 4J2EA 3MEEA 1WSJA 1HQUA 2BE2A 4CK2A 4CK3A 4CE9A 4IKFA 1RBTA 3OYBA 4OKEA 2ITGA 4KI6A 3VQEA 2QK9A 3S9HA 4WE1A 4AHUA 1ZYQA 4M3UA 4F3OA 3VQAA 3NFAA 1R0AA 3V1RA 4B3OA 4BDZA 1SKRA 2X78A
chains in the Genus database with same CATH superfamily
4CJEA 1EP4A 1GOCA 3O8MA 3C0BA 3CCUN 4BRKA 4LH5A 3THYB 2HBKA 2XY7A 1HJOA 1HR0K 3HO1A 3CM5A 5CZ1A 4BWJA 4FZYA 3CF5L 1J5OA 2FPHX 5HRPA 1VSJA 4FO0A 1O13A 2D0AA 1T7PA 1RBRA 2QWQA 1RDCA 1JCEA 4BRMA 4OPHA 2AA4A 2VQFK 3CCLN 2Q97A 5LMNK 2A6AA 2LTMA 3EEQA 2H3GX 3THXA 1QQMA 1GLJO 4JI2H 4K8ZA 4H0TB 1ZTGA 4FM2A 1A5WA 4KBOA 4IOAL 2CTJA 3K58A 1KVAA 5AQIA 2VG5A 3OVNA 4CZGA 5HRNA 4UQGA 1HKBA 3K59A 5LJVA 4M3XA 3B6PA 2ZJQL 3VQ8A 1Z05A 4J8FA 4GMJB 1S03G 1HJRA 3E66A 2YNHA 4NZTM 1WBDA 4DQPA 3LAKA 5J2QA 4DV4K 1A5VA 1XC9A 1VQ7N 2UU9H 1GLFO 4W5RA 1X9ZA 4B9LA 4B9MA 4LFBK 2V7ZA 2EHGA 3CCVN 4DQSA 3HJFA 2O8FB 1RTIA 3OW2M 5DK5A 4QCLA 3AAQA 2PT7G 5EXWA 3ID8A 3OS1A 5KQDA 3GE1A 4E19A 2HHHH 2G8WA 3MMVA 1HYVA 3RR8A 4MDAA 3AY9A 3CJCA 3E01A 1ATSA 2XRIA 3DXKB 1TUAA 2QXFA 3VF2A 3EKSA 1ZBHA 1IBLK 1K1GA 4MO4A 3QLHA 1X3MA 4CECA 2GUIA 3VTIA 2CGJA 2D0PA 4PKGA 1KXPA 4KRFA 1J54A 1H1VA 1NJZA 2CTEA 1HKGA 1X9MA 1KC8O 1WSEA 3CXCM 1DEJA 4FLTA 3OYDA 3CCRN 1LW2A 4LF6K 1LAVA 3RMBA 1VSFA 4Y0WA 3CQXA 2CGLA 1SL1A 3TTFA 4H5VA 1IBMH 1W97L 1LAWA 1RTDA 2HMIA 4L8RB 1C0TA 3AVMA 3T1HH 4KHPH 2QA4N 1NKEA 1LOTB 4JS4A 2E2QA 1B92A 4JI4H 2V7YA 1D9DA 2G8YA 2QXLA 1RTJA 3DRSA 2UXDK 4DTOA 2B5JA 3DLEA 1N6QA 4NXMH 5AFUA 4KREA 1VK0A 4I9QA 2I7PA 1NK7A 3SUOA 1RILA 4LFCK 2YKMA 3I0PA 4GKKK 1D9FA 3HYFA 1HKCA 4K0KH 4DR6H 3EZWA 4K42A 2WC9A 3CFPA 4E1JA 1Q82O 4FZZA 2O4IA 4WFNL 1W2BM 3HVRA 3ZSWA 3ZSYA 4CJRA 1IV0A 5KPZA 4QS7A 5AJ3K 4CEDA 4FWNA 3MWTA 3W3DA 2UUAH 4A62A 1NGFA 4M3RA 4M3YA 2KFNA 5EX5A 3QD7X 3C94A 3EE9A 1WAJA 3QNOA 4FJMA 1XC3A 5BR8K 1EC6A 4O0IA 3LL3A 1X4MA 4JHDB 4L3QA 4DQRA 4YFUA 5GIPA 4ELUA 1WVNA 2YCHA 3ZSQA 4JVHA 3CCQN 5KTQA 2KKZA 3VEZA 3QESA 1WLJA 3O4NA 1X1PA 1XHZA 2E88A 2ATQA 1T6DA 2YHBA 3AVAA 3HPGA 3OYIA 4E7KA 1HX1A 4FJUA 5C0XG 3OYAA 4C8KA 2QEXN 3FFKB 2UUBK 1MDUB 3SBTA 4LF5H 2BDPA 1QHAA 4BDYA 5ADXA 4KHNA 3AO2A 3LP3A 3RTVA 3L7ZC 3ZETA 4OVLA 4DLEA 3NMUA 3K2PA 1FK9A 1K73O 5KPRA 5M1NA 2P9PB 2UU9K 2HBLA 3KD5E 3AVFA 4BDPA 4FWMA 4B8CA 2KLAA 2DFHA 1HMVA 3JYTA 1S6QA 2OZMA 3LWMA 4CZJA 2O8DB 1VSMA 1TYQA 2KW4A 1KCFA 1IBKH 2P9IB 5J1EA 2RE2A 3EKUA 4GNIA 2HF4A 3G71N 1VQPN 3M8SA 3I8DA 2HHHK 2CTKA 4BWMA 2D1KA 1C0GA 1HRHA 3JS6A 3MK6A 4JI1K 4C1NI 2OZSA 4KH4A 3VQQA 1J5EK 2PYJA 3TTDA 2IIRA 1DTJA 3VERA 3P1GA 4C1NK 1TL1A 2IVNA 3BDPA 3HM8A 3KTQA 4CJ5A 1N32K 3TSPA 3SUNA 3O3GA 3D0PA 2I5JA 3DMJA 3KKSA 4PQUA 3ZCMA 3ITHA 3RSEA 2G8FA 3J80W 3AO5A 4RG8A 1Y64A 1SQKA 1S1UA 3VEXA 1I94H 4IJNA 4JK7A 5C12A 3AGRA 3AVNA 3IFRA 2HMPA 3QEXA 2XY6A 1K9MO 3TAEA 3HL8A 4OX9K 4AF1A 3VMFB 4ZHRA 3I55N 1VRTA 1SS6A 3LM9A 4JAXA 1QS4A 2CTLA 2M8WA 1IKYA 2E8AA 2W41A 3P5JA 2OPSA 4AH9A 5C0YA 4HVJA 1P90A 4JI3H 1OVQA 2OANA 1TUYA 1VQ5N 3T1HK 4KHPK 1DTQA 4YDUA 4CJTA 3BY5A 5C42A 5F1XA 3CFRA 3VQDA 3CMEN 2QWLA 4FWLA 3ULEA 1QZ6A 1EWQA 3BF1A 4M7YA 4MQ3A 4B8TA 4NXMK 4FLVA 2NRZA 3LDNA 5I9EB 2QWPA 4N76A 4K25A 4CIFA 3CC2N 3WXLA 4OLAA 1CZ9A 3T19A 4KB0A 5E26A 2YNFA 4B1XB 1Z2IA 4CJ4A 3FLCO 2UXCH 3AA4A 3D2FA 1YT3A 1ATNA 3U3GA 3F2KA 5SZTA 4CHYA 3VQ7A 4BROA 4CHNA 4NBQA 4WQ5C 5HLFA 4KPYA 4BRLA 3SQ2A 4JI6H 2P9UA 4OLBA 3FE1A 4WFAL 5E84A 4KAZA 1VQNN 2G8HA 2M6QA 4HUFA 4BC4A 5DM7L 2QWRA 3KK3A 3ENOA 1J5KA 4M3TA 4DG1A 2FXUA 3EL2A 4EC5A 3SV4A 2UUAK 4JRPA 1ZBSA 3DOKA 1NGGA 3RMAA 4QS8A 1BU6O 3H1VX 3K57A 3AA3A 5AQPA 5C25A 4R5PA 3QEWA 4XEIA 4E7IA 1BWFO 2YHWA 2IAJA 1P8ZA 3AVCA 4WYBA 4CF0A 2CH6A 4JI5H 3L2QA 2F4VH 1NGIA 2QWMA 3SQ0A 2Q2RA 2PQUA 4A57A 2QWNA 3WXJA 1NK4A 2RN2A 4PDBA 5AFUH 1MSZA 1U48A 1RT3A 3V1QA 4X62H 3DRRA 4IFYA 4YNQA 2B6AA 4AIMA 4H0PA 4LF5K 3CJAA 3ZSZA 2VQEK 3ZEUA 5CHIA 2QWOA 4EIAA 3TU5A 2O8BA 4B1ZA 4JKGB 3QEIA 4JYAH 4JK9A 1IKWA 1WB9A 3AO3A 4EHUA 3OJSA 4K41A 1NGEA 4BGBA 4NXNK 2CPQA 1J9AA 4NO7A 1ZZJA 3V9XA 4GV3A 4AHRA 2IC3A 2WOMA 2GTDA 1RGIA 1QE1A 2CGKA 5TKYA 3SQ1A 3P31A 4EAHD 3MN9A 2UYTA 2HHQA 4ZTFA 1ZBIA 4X64H 1DT9A 4N47A 4GV9A 5EY4A 3TAFA 4F9OA 4H4MA 4NB4A 3PV8A 3GDQA 2WFBA 4GVMA 4OO1G 5AZJB 2E1ZA 1QQNA 1WSJA 3KK7A 1WBBA 5KPTA 4CE9A 4IKFA 2ITGA 4IEIA 3TTCA 3S9HA 4WE1A 4DV7H 2VQFH 4AHUA 3O9UA 3NFAA 4B3OA 3A5MC 1W7AA 1BL3A 4CHQA 3WT0A 3ZSVA 4FWPA 1YXQA 3FZMA 3MX2A 4CF2A 3H45C 2YJEA 3QBXA 3MCAB 3AARA 4FWSA 1MU2A 4MDBA 1C0UA 4BREA 3IKMA 4LIJA 4JI3K 5EOYA 3QINA 4CZHA 1YJNN 4OKJA 1JLQA 3QIOA 3CG7A 1NKCA 4FLUA 2FSKA 2E3UA 1XMQK 4DV4H 3FAUA 4H4OA 1WTJA 1L5UA 2JA9A 4LFBH 3NBPA 2FLOA 5JS2A 3KIOA 3PIOL 3QERA 2KQ2A 3O1BA 2HHSA 3DLLL 3CERA 4BGAA 5HRRA 4B9UA 1W0HA 2HNYA 4CJSA 4CJ3A 4M45A 3NVMA 4DQQA 1Q9YA 1BI4B 4JI6K 2O8CB 4IFDG 1TAQA 1WNSA 3EO3A 3L6QA 3G4SN 3MXJA 3NF6A 1VIGA 4CEBA 1DLOA 5C2FA 4DR3H 2DFFA 4CEOA 1UG8A 3CJ1A 3VTHA 1CXQA 4BR4A 1DKGD 1YF5L 4BACA 5EVZA 4DR4K 2PYLA 2FBVA 4DS4A 1BG3A 2D4WA 3TWHA 2PY5A 3BZCA 3JXUA 5HL7L 5IT9W 4MO5A 4FJNA 4LF6H 2ZGYA 1YVUA 1KQSM 4J2DA 3QEPA 4FJJA 1IJJA 3L3VA 1WAFA 2JWKA 4IFVA 4X62K 3OYGA 2QTDA 5GAHP 3TPQA 4YOYA 3BGRA 5MLCQ 3KJVA 4BRCA 3CCMN 2PFUA 4O4GA 3VQBA 4AHSA 2NRHA 3K9KA 3OS2A 2UXDH 2DY4A 1JJ2M 2DTUA 2QKKA 3KWIA 3MXIA 1E3MA 4NCBA 4KHSA 4JKEA 4JN4A 2FSJA 3L3UA 4BRAA 3O4QA 3K5NA 1TK8A 4DSKA 1JL1A 3KZBA 4I6MB 2IGIA 3U6FA 3SJJA 1S9EA 3HTVA 3VQPA 4DSFA 3AO4A 1RT4A 2P9SA 1C0FA 1EO1A 2XO7A 3OYFA 1UA1A 1Q8IA 3PLAA 1TVRA 4X64K 3ENBA 3PX4A 2V52B 2NRXA 3V1OA 3HT3A 3PY8A 3K0SA 2E6MA 1S9GA 3S3MA 3T7ZA 1RTHA 5J2MA 3M8QA 3J80O 1XQSC 3M8RA 4CERA 4B1VA 2X6NA 1B9FA 1BISA 1FXXA 1KFSA 3WEEA 4DV7K 2UUCK 2JEAI 3U9ZA 1C1AA 5BR8H 4WANA 3HVTA 4KV8A 1IG9A 2VG7A 3HZ6A 5AQFA 5IWAH 4BC3A 4JD2A 3A2FA 4FCYA 1QZ5A 3THVA 3AVGA 3M1FA 4AM6A 3UKUB 3V9WA 1ILYA 4I2QA 1BA1A 4LF4K 4N56A 2UUBH 2E4LA 4CBWA 2KZMA 3J81O 3J8AA 4CEEA 1SUQA 3LP1A 4RW8A 1KD1O 1QSSA 3KLHA 4FVMA 4DTJA 2IDOA 4W5QA 3EYZA 3LPTA 1NGDA 3FZKA 1NMNA 2HSTA 1S3XA 3HXMA 1VAZA 1ZZIA 1IG8A 3VF4A 4BC2A 5GINA 5LL6Z 3P39A 4BR0A 2PZSA 4CEQA 3O08A 4ID5A 3CC4N 3C7NA 3KLGA 3G25A 1ZZKA 2FBYA 2VWKA 4CGJA 4B3RK 4ID1A 4CIGA 4N41A 4DUYH 1TKZA 3UKRB 1XMOK 1YI2N 3M3ZA 4X65H 1SAZA 1SV5A 4A2BA 4JI1H 1J5EH 1TKXA 2ZD1A 3B6OA 4RW6A 1TL3A 3CQYA 4WCEL 5JVGL 1KVCA 1TAUA 1WHRA 1X4NA 3OYKA 5CYQA 1N32H 2BL5A 3THWA 4DR3K 4KHWA 2HOEA 2OPRA 3IRXA 4OKKA 4HTLA 5JICA 1N36K 1YHQN 3IAYA 1ZBFA 5M1FA 1RFQA 4HCBA 3QO9A 4E7JA 3MX5A 2NRRA 1HNWK 2P9LB 1CLQA 3U8XA 1U45A 3RR7A 1RNHA 4PWDA 2VYPA 5LY3A 1I3AA 4OPJA 3ID6A 4OX9H 1U2VB 4OJRA 3HPHA 5HBMA 1REVA 1FJGK 3UIQA 4BA2I 3OA9A 1TYQB 3SAFA 4C8LA 1GLAG 1QVGM 1EETA 2Q0RA 5FPMA 1XRHA 2PY9A 4F2SA 5KI6A 4B3MK 3OY9A 3VQ4A 5JLFA 4MLHA 3THYA 1NGBA 2WBNA 2Z1JA 1QHTA 4DR7K 1PQXA 1XNQK 1RCHA 4G1QA 3FZHA 4CJ7A 4BRFA 1RDDA 2YI1A 4BQZA 4A59A 2E5LK 4PKHA 3EZJA 4HHTA 4GY2B 3UB5A 4BE1A 2X06A 4BR7A 3C6AA 5LJWA 2UXBK 4M3ZA 1GLDG 5AQJA 1VSHA 2YNGA 4DF8A 1NNEA 1BCMA 4BRQA 2A42A 1OVYA 1VQKN 1ZXOA 4BR5A 4CD3A 3WQUA 4B9QA 5GIOA 3OYNA 3JSMA 4DTRA 1HQEA 3BEXA 3TARA 2QI2A 4CGFA 1HLUA 2NRVA 3OYCA 3DYAA 4ISGA 3O4WA 5GAEP 4JEPA 3T3FA 2OTLN 4LF8K 3VGKA 1RT7A 3DI6A 2IOCA 4FM0A 4RWTA 1YTUA 3V9UA 3SB1A 1RT6A 3ULEB 2LRRA 2J4RA 2F9WA 3LPUA 3B8AX 1K8AO 3QIPA 4DTUA 5IWAK 2W6LA 4GKJK 4YDUC 2MJHA 3O3FA 3MWPA 4I2PA 5CE3A 2O8FA 2VG6A 4RW4A 5CR4A 2JEBI 2KFZA 2E1YA 1YAGA 3C95A 2Q3SA 3VESA 3TR8A 3D2FB 3J7AK 5FLXO 2VQEH 2HHVA 1IKVA 2QKBA 3HBTA 1K8KB 4CD1A 1T03A 1KTQA 4E7LA 3S3NA 1T05A 4M7XA 3WUHA 2OPUA 3M8PA 1OH5A 3CC7N 4I9LA 4NXNH 1DT4A 5JEAG 3LDSA 1WSGA 4RW7A 3PX0A 4HWIA 3NCIA 3TAMA 4WF9L 3SPYA 4JKAA 4H5RA 3TABA 2VCPA 3H6EA 4FJ7A 4DUYK 5CY4A 3DRPA 4X65K 5AQLA 4F4KA 3SNNA 4K43A 4WFBL 4DTXA 4BA1I 4H8AA 2D9IA 2HNZA 4KHUA 1D4XA 4M42A 1TK5A 4XH1A 2A1SA 4PKIA 3ZT1A 4XH5A 3QETA 3I0RA 5LL6b 3GOIA 5IT9O 4BRGA 2OPPA 1BCOA 4LD0A 1C1CA 3WQTA 2B4JA 1CXUA 1HPZA 2A1RA 1ATRA 1WSFA 3CPWM 5AQTA 1LV5A 4DFKA 4A61A 3MEEA 4ILGB 1RBTA 2P9KA 4YY3K 3VQAA 1J6ZA 3TAQA 4PUOA 4Z4EA 5AZIB 1RT5A 3VQ5A 1BQNA 1XMQH 1SZ2A 3M6GA 1BGXT 1RBVA 1HYZA 3D2EB 3I8BA 1VHXA 5JMVA 1QTMA 3J81W 5JLHA 3CETA 5AQZA 2O4CA 4YOTA 5BR9A 4DS5A 1T44A 1A5XA 2V51B 4CVNE 4LSNA 2IVPA 2OYQA 2JE6I 4DV5H 3OTOK 3OJUA 1L3SA 4DTPA 3Q7CA 4E3SA 4RTFD 4FYDA 4IO8A 3DM2A 3VENA 3O3HA 4ILHA 2Y1IA 2Z1HA 4EFHA 3ALYA 4IOCL 4YOVA 4JKHA 3QBWA 2HHUA 3A5NC 2XY5A 3ISNC 3W0LA 3U4LA 4CZIA 3O80A 2OA8A 4PY5A 1D8YA 4DFPA 2W40A 5HP1A 2DGRA 3MECA 2F96A 4DR4H 1V9NA 2ANRA 1NJWA 4KFBA 2ZM6K 3J7AP 3KWGA 5FRMA 2P9PA 4O55A 1I6UA 1BO5O 2ANNA 4J2AA 2KZZA 3DLGA 2YNIA 4JRQA 3OS0A 4WQ4C 4YORA 3VQ6A 4KTWA 2NN6G 1LWEA 2O8DA 3VQCA 4DQIA 4BY9C 3AVIA 3I0SA 3MCPA 5M1QA 1SKWA 1HNZK 1S1TA 2P9IA 3DXMA 3U3YA 1S72N 1J53A 4IFEA 1KRPA 2G8IA 4K8XA 3AVHA 3R6MA 4DWIA 2GWJA 4H5TA 3HP6A 4JV5K 3AVKA 3I33A 4H0YB 5H1SQ 4LF7K 3RMCA 1OH8A 4C8NA 4DU3A 3WNEA 1VSLA 3KDKA 3C6UA 4O0JA 5C10A 4G08A 2GX9A 5GAGP 5BREA 3GKUA 2ZGZA 2YX6A 3F73A 3SUQA 5FROA 3IUCA 3O9TA 3CJ9A 1VQ6N 5DM6L 4ELTA 2FC0A 2QW9A 3DWLA 3VQ9A 2HBJA 1XNRK 4DV1K 4DSEA 4BRHA 4CGDA 1NXUA 3O9SA 1BIZA 4KTZA 3LDLA 2QM1A 4FM1A 4CFBA 3ZT4A 3KDGA 4YHHK 3WNHA 3DLBA 2NLXA 3NE6A 4DTSA 2ZQEA 4V19S 3F9KA 3CHWA 4B9VA 1V8CA 3V6DA 5AQYA 3T1YK 2BH1A 3NH1A 2OTJN 3AV9A 3HRGA 1X0AA 1HYSA 1YTAA 2UUCH 3K5OA 5BRHA 3EE8A 4Z0UA 3ZT2A 4FJXA 3SZ2A 3CCEN 3LP0A 1KVBA 2BTFA 2P9NB 3MDQA 5ADXH 3NF7A 1E4FT 5JVHL 3L4QA 2IS3A 4LF4H 4CEFA 4DV6K 2GUPA 3H46O 2JWLA 1RDBA 2ZE2A 1JXBA 4NZRM 3C6HA 1L3UA 3CCJN 4M63C 1JXEA 4LH4A 5BRFA 4BRPA 1WSIA 4WQ4A 1GLBG 3G0ZA 3KVGA 1NK6A 3AAPA 2G8KA 4JI8H 2HVIA 5KRTA 3FR0A 4LY7A 4FLYA 3SUPA 5FLXW 3C65A 1HNXK 4KKOA 3GL1A 2Z0SA 3LZJA 4CBUA 2D0OA 4DV5K 3V81A 4E7HA 3MEGA 1T3VA 4N5SA 2AP1A 3P38A 4B3RH 4JKDA 5ELZA 4JI0K 4FK2A 1GLEG 3THXB 1U49A 1XMOH 3N4QA 3D7EO 2E2PA 1NGHA 1QSLA 4JD2B 4AHTA 2EWSA 1FKPA 1BUPA 1GLCG 2IVOA 4FPAA 1U47A 4CFCA 1RT1A 2AXYA 4E1NA 4DU4A 4CHPA 3SQ4A 4DR1K 4OD6A 4B8AB 4EZ9A 4UY8O 2HH2A 3BP8A 1JL2A 3VGMA 1N36H 1JLCA 4CZEA 3E1YA 1JLBA 4Z94A 4B9TA 4DV2K 2NZTA 1NG9A 3ATVA 4X66K 2G8VA 1NLVA 3A8YA 1HNWH 2FBTA 3PSIA 4JKGA 2WUSA 4FW1A 4DUZK 3HSTB 4FWQA 3OYEA 4Y1DA 3ZX2A 3L2UA 4EP4A 3DLHA 3VEVA 1CZAN 4CFDA 3PSFA 5K14A 3MXMA 4LFAK 4H5WA 4CF9A 1FJGH 1ASVA 3T69A 3NGYA 1JLAA 1WSHA 3NHGA 3KLIA 3C7NB 1VQ4N 3ENHA 4KTQA 1C0MA 3D6RA 2RPIA 1RBUA 1DGKN 4B3MH 4Z4HA 1K6YA 2JGUA 3E9OA 4W5NA 4CK1A 5HOOA 4DR7H 1VQON 4AQYK 5AZJA 1AN7A 1XNQH 3S3OA 1NK5A 3UOEA 1NMDA 1Y97A 4MLEA 4PA1A 2E5LH 1NK9A 2NUBA 2HHTA 4FJIA 4H0XB 4JI7H 4FVUA 2UXBH 4BVPA 3ZYYX 4HUEA 1YITN 2JVZA 4M41A 1RDUA 3JAMW 4CFAA 1UA0A 1ASUA 4FJ8A 4B3SK 4FJ9A 2OCEA 4GV6A 1NOZA 1VBIA 1D5AA 4NYFA 4DSIA 4B9NA 4CZKA 3RRHA 4LF8H 4H8KA 3IDHA 3AEVB 4NCGA 2LF0A 1UWBA 5F2RA 3H1QA 3DOLA 2Q0UA 1U6ZA 3CD6N 2FSNA 2RF2A 3PIPL 3PUFA 1T6CA 5CZ2A 3KK2A 2VKCA 2E6LA 3VN5A 2D5RA 2PAVA 2YQRA 5FRNA 2W6KA 4IWVA 3AO1A 4FPBA 5K36G 1VQLN 4GKJH 1XHXA 5BN9A 4JKBA 4B1YB 4CJFA 3MN6A 1FW6A 4YOWA 2ZJRL 4DFMA 4LSLA 1NM1A 1V4SA 3O9RA 2F8TA 3HOSA 3O6WA 2E2OA 4H0VB 5A2QO 3ATUA 4FLZA 5BPMA 4G9ZA 3OBWA 4DR2K 2BGGA 4CJUA 2P51A 3O9QA 3AA5X 1S20A 5BN8A 4OPKA 1BI4A 2O8CA 4Z4FA 4KB1A 1NJXA 1BOTO 3KLEA 1J4WA 4JI8K 3QMLA 3NGIA 1NGAA 3K5LA 1N5YA 4IDKA 1TUUA 3L4IA 2WTUA 5AQXA 2E2NA 4CF8A 4Q0BA 1KAXA 4IOXA 3AGKA 4LC9B 1G15A 3VA3A 4FSVA 4EZ6A 4CJQA 3NH0A 5J2NA 3HPOA 2LTLA 3K9JA 3PO4A 5AQUA 3SBGA 1YJWN 3NGZA 1IKXA 1GOAA 2Q31A 4FW2A 1F0XA 3BZKA 1X9WA 4FK0A 1Q7YO 4C8OA 1LWFA 3H3OB 2O8EA 3QFPA 4ELVA 3ZSXA 4GW6A 4B8CD 1S1VA 2YJFA 4FJKA 4CESA 4XH4A 1NBWA 1DTTA 3WXIA 4KI4A 4OCHA 4QAGA 2A40A 4O5BA 4BR9A 3VKEA 5DMRA 2KHOA 3NVKA 4H5NA 1ESVA 2JZXA 2VWJA 1F21A 1U04A 2LSNA 4QMFB 4YOUA 1SL0A 3ZT3A 3ZETB 5DT9A 1ODHA 3L8BA 3HSCA 4FXDA 1S22A 5JS1A 5B8HA 3SPZA 1VIHA 4DLGA 1VSDA 2GWKA 1NKBA 4I6MA 1JLEA 4DV3K 1ZBLA 2E20A 4CZLA 1IO2A 4YY3H 4JLHA 4B08A 2BUPA 5BRDA 3SV3A 4EHTA 4R79A 4KO0A 3TI0A 5KGXA 4Q5VA 3CCSN 2YV0X 4DSLA 4J2EA 1EQYA 3VEOA 1HQUA 4CK3A 3VGLA 3J7ZO 2FMRA 4DR5K 2QK9A 4DV0K 4JI7K 4LF9H 3OTOH 1ZYQA 4AM3A 4F3OA 3RSEB 1R0AA 3HOTA 4BDZA 1SKRA 4RCHA 2X78A 1YIJN 3TANA 1U4BA 4E1MA 3N4PA 5CYMA 4IEEA 3FZFA 4KHYA 3QFUA 3R1XA 1JCGA 2GV9A 3CJBA 5AQKA 1XWLA 3SI6A 4CF1A 2DPNA 4B3TK 2ZQBA 1BIUA 3OSSD 3DLRA 1SEIA 3L0QA 3UKUA 3MN7A 1G99A 1LWCA 3VEYA 2P9KB 3P83D 3EY1A 2YHAA 1FKAH 1NJIO 2KTQA 1NWKA 3M5RA 3VEWA 4IG0A 4JKFA 2ZM6H 3AVLA 3L2RA 1NJYA 2BANA 4CCHA 3QDKA 3OYMA 5KRSA 2ZJPL 2FF6A 1QSYA 5GADP 3OBYA 1QVFM 3EN9A 4A2AA 3HM9A 4BVOA 3G6EN 4CJPA 3ZSOA 1HNZH 2OPQA 1HNVA 2GBZA 2ASMA 4CJKA 4CJVA 2Y3MA 4DQ8A 1RDWX 3IG1A 4JV5H 5C24A 5HROA 4F8RA 4C23A 1VSIA 5SWMA 1KAZA 4JI2K 3UKRA 4LF7H 3CFOA 2K1HA 3DXKA 2P9UB 1JCFA 3HI0A 3VF6A 4NCAA 1FKOA 4OO1J 4NLCA 3C6TA 3OYHA 2ASPA 1VSKA 4FJLA 4E9JA 1S5JA 3SAHA 5AQMA 3TSQA 4GVEA 3ASMA 4AHCA 1YVNA 4W5OA 4A5BA 5FDLA 3O1WA 4PHTX 4CEAA 1OKJA 4MFBA 4EP5A 4B1UB 5AQQA 4CZMA 3ZSRA 1T8EA 2ASOA 4ISEA 1C6VA 5AQVA 2P9LA 1XNRH 3SK3A 5T7BA 4DV1H 4DU1A 3RRGA 4BE0A 3CIPA 4F2RA 4CGIA 1U2VA 1XUPO 4YHHH 5HRSA 4CW7B 2HVHA 1X9JA 1N8RO 5FPDA 1ZC6A 2D0BA 3DXMB 3T1YH 2P1JA 4JVYA 1TKDA 3TSUA 1MWKA 1WOQA 4CZFA 3NH2A 4HUGA 1N33H 3ZEUB 4CIEA 3UE5A 4CEZA 2O8BB 3T1AA 1E4GT 3QB0A 2XHBA 1X3NA 4HCCA 4OPAA 2Z1GA 4C8MA 1JLGA 4DCHA 1IH7A 3KKRA 2R7YA 4DMNA 1R59O 4FJSA 4FOIA 5M1OA 1UAXA 4DV6H 4CJLA 3LALA 4U7BA 1Q9XA 3WXKA 3CMAN 2Z1IA 3G10A 4O5FA 3NF8A 3GR5A 3VOVA 1MA9B 1RDAA 2A3ZA 4IG3A 2X74A 1TK0A 2FBXA 4CHZA 1LW0A 3VPZA 1WN7A 4BG8A 5A2QW 3LDPA 4CGHA 2OPVA 3HP9A 1KHMA 3LZIA 1IBMK 1NK0A 3GBTA 1HNXH 1VSEA 1MWMA 4JKCA 2BA0A 3ZX3A 3JAMO 1BA0A 1M90O 4E0DA 4LF9K 4ICLA 5AQRA 4CBXA 4JI4K 1EWRA 2XY8A 4JI0H 3Q7BA 3VETA 1TKTA 4KH5A 1TV6A 4Z4GA 4JHDA 2I7NA 2HB5A 3O5BA 1X9SA 3HK2A 5AQWA 3H08A 4XIUA 2CPMA 1KLMA 1VRUA 3LANA 5M1KA 3AVJA 2DFEA 2FF3B 3S41A 4ISFA 3J7YP 3CQ8A 4DR1H 3R8EA 1ITGA 3NF9A 4K0KK 4CJWA 4DR6K 5I42A 4JK8A 4M3WA 4DV2H 4B9SA 3WXMB 4X66H 1BQMA 4AM7A 1K8KA 4BE2A 2VWBA 2PBDA 1OH6A 4BC5A 4BR2A 2AJQA 4YOXA 1N34H 4DUZH 3CPEA 4NYNA 3R3LA 5D3GA 4JNEA 3LP2A 2CWFA 1WE8A 1NGJA 3MAQA 4DF4A 1UOCA 2JLEA 3F9MA 4O44A 4LFAH 4Z4CA 4H03B 2YHYA 3MEDA 4IJAA 2HHXA 3NAEA 2CWHA 4QOZB 5J2PA 5M1PA 3NDKA 4FLXA 4PL8A 5LMUH 1SL2A 2QNDA 1YUWA 4O8KA 4A5AA 4BG9A 2W42A 4TSXA 4AQYH 3CYMA 1Z6RA 4FWRA 4H0OA 1HNIA 4OGCA 3V9ZA 4DSJA 3ZX0A 3KD1E 3QNNA 4KHQA 4KH6A 2VGNA 5I3UA 4AILC 1CZBA 1C1BA 3D45A 1S6PA 1S1XA 1W9HA 1Q81O 3E9LA 3IMXA 2RKIA 4B3SH 1ZBUA 2HBMA 1S1WA 1KAYA 3PX6A 2F8SA 2CH5A 2P5OA 3TAGA 1NU0A 4FLWA 4IBNA 5F0XA 3WNGA 1IBKK 4OGEA 4BRDA 4QS9A 3EZ5A 2P2RA 3L2WA 4IXCA 1KFDA 4Z4IA 2FFMA 4FL9A 1N33K 4IO9L 2X6SA 4ZTJA 5AZIA 3DJCA 3KHYA 1HR0H 1LCUA 3D2EA 1O1WA 2HF3A 2ZWHA 4FK4A 5BPLA 3RF2A 3NCVA 4JS5A 2HH3A 3F5TA 3ZT0A 4WQ5A 4FJ5A 4DKWA 3QEVA 3U9DA 3TAPA 3LWLA 3OYJA 1BHLA 2HW3A 4IDHA 1VQ8N 3LM2A 1TGOA 5LMNH 1GOBA 2ETJA 2P9SB 3U1KA 3MN5A 1YJ9N 4DR2H 1BDGA 3QICA 1M1KO 2A41A 1I94K 4BRIA 1B9DA 3L2VA 5AR0A 4FWOA 4W5TA 3SLCA 1SKSA 1VQMN 3CJ7A 3P4IA 3IS9A 3SMSA 1RBSA 2YHXA 5FPEA 1XI1A 1JKHA 3AVBA 3WEEB 4BQLA 3A5OC 3BUZB 4DHYA 4DTMA 4J2BA 3I56N 5AQNA 1VQ9N 5KQ8A 1OH7A 4AHVA 4FJHA 4NLBA 5AQOA 3R9PA 3A5LC 5E41A 4DTNA 2F7TA 4F3TA 3OYLA 3BF3A 5TKWA 2Q36A 2GEMA 4FJGA 3GABA 4B1WB 1NGCA 2NNWA 4CI6A 4U67L 3SAGA 1KLNA 1I39A 2D0CA 2UXCK 2ITMA 1Q18A 3CI5A 2P5GA 2A5XA 4FWKA 5BPNA 4IZ9A 1N34K 4Y1CA 1NOYA 3PO5A 1RT2A 2Y1JA 1Z25A 3E9PA 4FZXC 1NK8A 3CM6A 2CTMA 1EXQA 5AQSA 2NRWA 4BRNA 3VA0A 2O4GA 1IBLH 2WONA 3AA2A 2CTFA 3SYZA 4DV3H 5FPNA 4DB3A 4HTUA 3DAWA 4O8UA 5EU7A 3LDOA 1L3VA 2HHWA 4FOEA 3WNFA 2ZF5O 5LMUK 2Q1NA 4CGGA 3RMDA 1QQCA 4I7FA 4JI5K 3LDQA 2F4VK 3LAMA 1QQOA 4PL7A 3KLFA 3GG4A 4E89A 1JLFA 3K5MA 5AQHA 3V9SA 1KSPA 2O8EB 1Q86O 1HUXA 4WALA 3DLKA 1EX4A 2NRTA 3THWB 4DFJA 3SCXA 1ASWA 5KGWA 2HNDA 3ZLJA 4DR5H 4DV0H 5AQGA 4CHOA 3OETA 1L3TA 3ULDA 3RWUA 2VGMA 2G8UA 3V4IA 3V69A 1Z26A 5C15A 2EX3A 4RW9A 2GELA 3FGUA 1EKEA 3FFIA 2RHKA 4JYAK 3KK1A 2YKNA 2F9TA 2P9NA 3SJHA 3H3NO 4B3TH 3SMPA 3FZLA 2BE2A 4CK2A 3RVCA 4LFCH 3OYBA 4OKEA 1HPMA 3A0IX 4GKKH 4KI6A 1V4TA 3VQEA 4ILJA 4M3UA 1WUAA 5C2DA 3V1RA 3OHRA 1GLLO
chains in the Genus database with same CATH topology
3TANA 1BL3A 4CHQA 1U4BA 4CJEA 4E1MA 1EP4A 3ZSVA 3TAQA 5CYMA 4PUOA 4Z4EA 1GOCA 4KHYA 1RT5A 3VQ5A 1BQNA 4LH5A 4CF2A 2XY7A 2GV9A 1BGXT 3HO1A 3CM5A 1XWLA 3SI6A 4CF1A 1RBVA 1HYZA 5CZ1A 2ZQBA 4BWJA 1BIUA 1QTMA 4FZYA 1J5OA 3DLRA 1MU2A 5HRPA 1VSJA 4DS5A 1A5XA 2D0AA 4LSNA 1T7PA 1LWCA 1RBRA 1RDCA 1C0UA 3P83D 3EY1A 2OYQA 2YHAA 3OJUA 3QINA 2KTQA 4OKJA 1JLQA 1L3SA 3QIOA 4DTPA 4IG0A 3CG7A 3AVLA 1NKCA 4FLUA 3L2RA 4E3SA 1NJYA 4FYDA 2BANA 4CCHA 4K8ZA 4FM2A 3OYMA 3DM2A 1A5WA 4H4OA 5KRSA 3O3HA 1L5UA 2Y1IA 1QSYA 2Z1HA 3K58A 3ALYA 3NBPA 3HM9A 1KVAA 3KIOA 5JS2A 2XY5A 3ISNC 2VG5A 3OVNA 2HHUA 5HRNA 4CJPA 4UQGA 3QERA 3ZSOA 2KQ2A 2HHSA 2OPQA 3K59A 1HNVA 2GBZA 2OA8A 4PY5A 4CJKA 5HRRA 1D8YA 4DFPA 4CJVA 4B9UA 3B6PA 1W0HA 4M3XA 5HP1A 2HNYA 3IG1A 3MECA 3VQ8A 2F96A 4GMJB 4CJSA 5C24A 1HJRA 4CJ3A 5HROA 4F8RA 1NJWA 1VSIA 4KFBA 5SWMA 4M45A 2YNHA 3CFOA 4DQQA 1Q9YA 4DQPA 1BI4B 3LAKA 5J2QA 5FRMA 1A5VA 1XC9A 4O55A 1TAQA 1WNSA 4NCAA 4W5RA 1FKOA 3MXJA 3OYHA 3C6TA 4J2AA 4FJLA 1VSKA 2KZZA 3DLGA 3NF6A 2YNIA 4B9LA 1S5JA 4JRQA 4CEBA 4B9MA 1DLOA 2EHGA 4DQSA 3ASMA 4AHCA 3VQ6A 3OS0A 3HJFA 4KTWA 1LWEA 2DFFA 4CEOA 3VQCA 4W5OA 4DQIA 3AVIA 1UG8A 3I0SA 5FDLA 1RTIA 1SKWA 4CEAA 1S1TA 3U3YA 1KRPA 4MFBA 4EP5A 1CXQA 1J53A 5DK5A 2G8IA 4K8XA 4QCLA 3AVHA 3ZSRA 1T8EA 4DWIA 3OS1A 4BACA 1C6VA 3HP6A 4E19A 3AVKA 2FBVA 2G8WA 2PYLA 4DS4A 1HYVA 5T7BA 3TWHA 3RMCA 2PY5A 4C8NA 4DU3A 3RR8A 3WNEA 1VSLA 4DU1A 3RRGA 3E01A 2XRIA 4BE0A 3C6UA 4O0JA 4F2RA 4FJNA 4CGIA 2QXFA 3GKUA 3F73A 3SUQA 5HRSA 1YVUA 1ZBHA 2HVHA 5FROA 3QLHA 4J2DA 4CECA 3QEPA 4FJJA 3L3VA 2GUIA 1WAFA 2D0BA 2P1JA 4KRFA 1J54A 4IFVA 3OYGA 1NJZA 1TKDA 4ELTA 3BGRA 2FC0A 3VQ9A 3NH2A 3KJVA 4HUGA 1X9MA 4O4GA 4DSEA 4CIEA 3VQBA 4AHSA 4CEZA 4CGDA 3OS2A 3T1AA 2DY4A 1WSEA 2XHBA 2DTUA 1BIZA 4HCCA 4KTZA 4FLTA 2QKKA 3OYDA 3MXIA 1LW2A 4FM1A 4CFBA 3ZT4A 2Z1GA 4NCBA 4KHSA 1LAVA 3RMBA 1VSFA 4C8MA 3L3UA 1JLGA 3WNHA 3NE6A 3DLBA 1SL1A 4DTSA 1IH7A 3KKRA 3O4QA 1LAWA 3K5NA 1RTDA 1TK8A 2R7YA 2HMIA 4DMNA 1JL1A 3F9KA 3U6FA 2IGIA 3SJJA 4B9VA 1C0TA 1S9EA 4L8RB 3V6DA 1UAXA 3VQPA 4DSFA 3AO4A 3AVMA 3NH1A 4CJLA 3AV9A 3LALA 1RT4A 1NKEA 1Q9XA 1HYSA 1YTAA 4JS4A 2XO7A 1B92A 3OYFA 3K5OA 2Z1IA 3G10A 1UA1A 4Z0UA 1Q8IA 1D9DA 1TVRA 1RTJA 3DRSA 3NF8A 3ZT2A 4FJXA 1RDAA 3SZ2A 4DTOA 2B5JA 3DLEA 3PX4A 3LP0A 4IG3A 1N6QA 1KVBA 2X74A 2FBXA 3V1OA 4CHZA 1TK0A 1LW0A 3HT3A 3PY8A 4KREA 1WN7A 1VK0A 4I9QA 2E6MA 1S9GA 4CGHA 3HP9A 3S3MA 1RTHA 5J2MA 3M8QA 3NF7A 3M8RA 3LZIA 1NK0A 4CERA 2HHTA 1VSEA 1NK7A 3SUOA 1RILA 2X6NA 2YKMA 2IS3A 1B9FA 1BISA 1D9FA 3HYFA 1FXXA 1KFSA 4CEFA 4E0DA 4ICLA 1RDBA 2ZE2A 1JXBA 1C1AA 1L3UA 2XY8A 1JXEA 4LH4A 1TKTA 3CFPA 1TV6A 1WSIA 4Z4GA 3G0ZA 3HVTA 4FZZA 2O4IA 2HB5A 4KV8A 1NK6A 3HVRA 1X9SA 1IG9A 2VG7A 3ZSYA 3ZSWA 3HK2A 2G8KA 3H08A 4XIUA 2CPMA 2HVIA 3A2FA 4FCYA 1KLMA 4CJRA 5KRTA 1VRUA 3LANA 4LY7A 4FLYA 3SUPA 3THVA 4CEDA 3AVJA 3AVGA 2DFEA 4KKOA 4M3RA 3CQ8A 3LZJA 3V9WA 4M3YA 2KFNA 4I2QA 1ITGA 3NF9A 3C94A 3V81A 4N56A 4E7HA 1WAJA 4CJWA 3QNOA 3MEGA 5I42A 4FJMA 2E4LA 4N5SA 4M3WA 2KZMA 4B9SA 4O0IA 1BQMA 4CEEA 1SUQA 3LP1A 4RW8A 4BE2A 1U49A 3KLHA 4YFUA 4DQRA 4FVMA 1QSSA 4FK2A 2AJQA 4ELUA 4DTJA 2IDOA 4W5QA 3ZSQA 4NYNA 3EYZA 3LPTA 5KTQA 1QSLA 5D3GA 4AHTA 3LP2A 1FKPA 1U47A 3HXMA 3QESA 4CFCA 1WLJA 3O4NA 1X1PA 1RT1A 3MAQA 1XHZA 4E1NA 1UOCA 2JLEA 2ATQA 2YHBA 4O44A 4DU4A 4DF4A 4CHPA 4Z4CA 3SQ4A 3AVAA 3HPGA 3OYIA 3MEDA 4E7KA 4B8AB 4DSKA 4EZ9A 2HHXA 3OYAA 1JL2A 4CEQA 3NAEA 2PZSA 4C8KA 1JLCA 4ID5A 2BDPA 5J2PA 1JLBA 4QOZB 3NDKA 3KLGA 4FLXA 4B9TA 2FBYA 4BDYA 2VWKA 4CGJA 2G8VA 1SL2A 4KHNA 4ID1A 2FBTA 3AO2A 3LP3A 4CIGA 3RTVA 4N41A 1TKZA 4OVLA 4DLEA 1SV5A 4FW1A 3K2PA 1FK9A 2W42A 3HSTB 4TSXA 1TKXA 2ZD1A 3B6OA 4RW6A 3OYEA 1TL3A 4Y1DA 1KVCA 1TAUA 3L2UA 3CYMA 3AVFA 4EP4A 3DLHA 4BDPA 3KD5E 1WHRA 4B8CA 4CFDA 2DFHA 1HMVA 5K14A 1S6QA 3OYKA 5CYQA 3LWMA 3JYTA 3MXMA 2OZMA 4CF9A 1HNIA 4OGCA 3V9ZA 4DSJA 4KHWA 2OPRA 3IRXA 1ASVA 1VSMA 4OKKA 3QNNA 3KD1E 4KHQA 3NGYA 2KW4A 1KCFA 1JLAA 5J1EA 1WSHA 3NHGA 3IAYA 1ZBFA 3KLIA 4AILC 5I3UA 1CZBA 4HCBA 1C1BA 3QO9A 4E7JA 4KTQA 1C0MA 3D45A 1S6PA 3M8SA 3I8DA 2RPIA 1RBUA 4BWMA 1S1XA 1HRHA 1CLQA 1U45A 3RR7A 1W9HA 4Z4HA 1K6YA 2OZSA 2JGUA 1RNHA 3VQQA 4W5NA 4PWDA 4CK1A 2RKIA 1ZBUA 2PYJA 1I3AA 4OPJA 3P1GA 3S3OA 1NK5A 1S1WA 1TL1A 3BDPA 4OJRA 1Y97A 3HPHA 4PA1A 5HBMA 3PX6A 3KTQA 4CJ5A 2F8SA 3SUNA 1NK9A 3O3GA 3D0PA 1REVA 2I5JA 2NUBA 3DMJA 3TAGA 2P5OA 3UIQA 4FJIA 3KKSA 4IBNA 4FLWA 4PQUA 3WNGA 3ZCMA 3ITHA 4OGEA 4C8LA 4HUEA 3EZ5A 2G8FA 1EETA 3AO5A 3L2WA 4RG8A 4F2SA 1KFDA 4Z4IA 5KI6A 4M41A 1S1UA 2X6SA 3OY9A 3VQ4A 4CFAA 4ZTJA 1UA0A 3AVNA 1ASUA 4FJ8A 3QEXA 2Z1JA 2XY6A 1QHTA 3TAEA 3HL8A 4FJ9A 1O1WA 1RCHA 1NOZA 4G1QA 4FK4A 1D5AA 4NYFA 1RDDA 4ZHRA 4DSIA 1VRTA 4B9NA 4JS5A 1QS4A 3ZT0A 1IKYA 3RRHA 4HHTA 4H8KA 3P5JA 2OPSA 4AH9A 4BE1A 4FJ5A 4HVJA 3QEVA 3TAPA 4NCGA 3LWLA 3OYJA 1BHLA 1UWBA 2HW3A 4M3ZA 3DOLA 1TGOA 1DTQA 1GOBA 1VSHA 2ETJA 2YNGA 4CJTA 4DF8A 2RF2A 5C42A 1BCMA 3CFRA 3PUFA 3VQDA 5CZ2A 3KK2A 2E6LA 1B9DA 2D5RA 3VN5A 3L2VA 5FRNA 3AO1A 4MQ3A 3OYNA 3JSMA 4FLVA 4DTRA 4W5TA 1SKSA 1XHXA 1HQEA 3TARA 4CGFA 4CJFA 4N76A 3OYCA 3IS9A 3DYAA 4CIFA 4OLAA 1CZ9A 3T3FA 4LSLA 4DFMA 1RBSA 3T19A 4KB0A 2YNFA 1RT7A 1XI1A 3DI6A 2F8TA 2IOCA 1JKHA 4CJ4A 3AVBA 4FM0A 3AA4A 1YT3A 4FLZA 3U3GA 4J2BA 5SZTA 4DTMA 2BGGA 4CHYA 3V9UA 1YTUA 3VQ7A 2P51A 4CJUA 1RT6A 3AA5X 4CHNA 5HLFA 4AHVA 4FJHA 4KPYA 4OPKA 2LRRA 1BI4A 3LPUA 3SQ2A 4Z4FA 5E41A 3QIPA 4KB1A 4OLBA 1NJXA 4DTUA 3KLEA 4KAZA 4DTNA 4F3TA 3OYLA 2G8HA 3NGIA 4HUFA 3K5LA 1N5YA 4IDKA 3O3FA 4FJGA 3KK3A 4I2PA 4CF8A 2VG6A 4RW4A 4M3TA 4DG1A 4Q0BA 3SV4A 4JRPA 2KFZA 3DOKA 1KLNA 1G15A 3C95A 3RMAA 1I39A 2Q3SA 3VA3A 2D0CA 4EZ6A 3TR8A 4CJQA 3NH0A 3K57A 5J2NA 3HPOA 3AA3A 5C25A 3PO4A 4R5PA 2P5GA 1IKVA 3QEWA 2QKBA 2HHVA 3NGZA 1IKXA 1GOAA 1T03A 1KTQA 4E7LA 4E7IA 4FW2A 3S3NA 1T05A 2IAJA 4Y1CA 1NOYA 1X9WA 3AVCA 3M8PA 4FK0A 3PO5A 1RT2A 4CF0A 2Y1JA 4C8OA 1LWFA 1Z25A 4I9LA 3L2QA 4FZXC 1NK8A 3CM6A 1EXQA 3LDSA 3SQ0A 3VA0A 1WSGA 4ELVA 4RW7A 2O4GA 4GW6A 3ZSXA 2WONA 1S1VA 2RN2A 1NK4A 3AA2A 3PX0A 4FJKA 4CESA 1DTTA 3NCIA 3SYZA 3TAMA 4KI4A 4QAGA 1MSZA 1U48A 1RT3A 4HTUA 3V1QA 5EU7A 3DRRA 4IFYA 4O5BA 3SPYA 1L3VA 2HHWA 5DMRA 4YNQA 2B6AA 3TABA 2VWJA 3WNFA 1F21A 1U04A 3ZSZA 2LSNA 1SL0A 3ZT3A 4FJ7A 4CGGA 3QEIA 3RMDA 1QQCA 1IKWA 3DRPA 5CY4A 3L8BA 4F4KA 4I7FA 3SNNA 3AO3A 4FXDA 3OJSA 4DTXA 3LAMA 1J9AA 3KLFA 3V9SA 4E89A 1KSPA 1JLFA 3K5MA 5JS1A 3V9XA 3SPZA 4AHRA 4DLGA 1VSDA 2IC3A 1NKBA 2WOMA 1JLEA 2HNZA 3DLKA 4KHUA 1EX4A 4DFJA 3SCXA 1ASWA 1ZBLA 5KGWA 4M42A 2HNDA 1QE1A 1TK5A 1IO2A 2A1SA 3ZT1A 4JLHA 4B08A 3QETA 3I0RA 4CHOA 3SQ1A 2OPPA 1L3TA 3ULDA 3RWUA 1BCOA 4LD0A 2G8UA 3V4IA 3SV3A 1Z26A 1C1CA 2HHQA 4ZTFA 1ZBIA 2EX3A 3TI0A 4KO0A 4RW9A 2B4JA 4N47A 1CXUA 1HPZA 2A1RA 1EKEA 3FFIA 5KGXA 4Q5VA 3KK1A 1WSFA 2YV0X 3TAFA 4H4MA 2YKNA 3PV8A 4GVMA 4DFKA 1LV5A 4DSLA 4J2EA 3MEEA 1WSJA 1HQUA 2BE2A 4CK2A 4CK3A 4CE9A 4IKFA 1RBTA 3OYBA 4OKEA 2ITGA 4KI6A 3VQEA 2QK9A 3S9HA 4WE1A 4AHUA 1ZYQA 4M3UA 4F3OA 3VQAA 3NFAA 1R0AA 3V1RA 4B3OA 4BDZA 1SKRA 2X78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAN A;  1BL3 A;  4CHQ A;  1U4B A;  4CJE A;  4E1M A;  1EP4 A;  3ZSV A;  3TAQ A;  5CYM A;  4PUO A;  4Z4E A;  1GOC A;  4KHY A;  1RT5 A;  3VQ5 A;  1BQN A;  4LH5 A;  4CF2 A;  2XY7 A;  2GV9 A;  1BGX T;  3HO1 A;  3CM5 A;  1XWL A;  3SI6 A;  4CF1 A;  1RBV A;  1HYZ A;  5CZ1 A;  2ZQB A;  4BWJ A;  1BIU A;  1QTM A;  4FZY A;  1J5O A;  3DLR A;  1MU2 A;  5HRP A;  1VSJ A;  4DS5 A;  1A5X A;  2D0A A;  4LSN A;  1T7P A;  1LWC A;  1RBR A;  1RDC A;  1C0U A;  3P83 D;  3EY1 A;  2OYQ A;  2YHA A;  3OJU A;  3QIN A;  2KTQ A;  4OKJ A;  1JLQ A;  1L3S A;  3QIO A;  4DTP A;  4IG0 A;  3CG7 A;  3AVL A;  1NKC A;  4FLU A;  3L2R A;  4E3S A;  1NJY A;  4FYD A;  2BAN A;  4CCH A;  4K8Z A;  4FM2 A;  3OYM A;  3DM2 A;  1A5W A;  4H4O A;  5KRS A;  3O3H A;  1L5U A;  2Y1I A;  1QSY A;  2Z1H A;  3K58 A;  3ALY A;  3NBP A;  3HM9 A;  1KVA A;  3KIO A;  5JS2 A;  2XY5 A;  3ISN C;  2VG5 A;  3OVN A;  2HHU A;  5HRN A;  4CJP A;  4UQG A;  3QER A;  3ZSO A;  2KQ2 A;  2HHS A;  2OPQ A;  3K59 A;  1HNV A;  2GBZ A;  2OA8 A;  4PY5 A;  4CJK A;  5HRR A;  1D8Y A;  4DFP A;  4CJV A;  4B9U A;  3B6P A;  1W0H A;  4M3X A;  5HP1 A;  2HNY A;  3IG1 A;  3MEC A;  3VQ8 A;  2F96 A;  4GMJ B;  4CJS A;  5C24 A;  1HJR A;  4CJ3 A;  5HRO A;  4F8R A;  1NJW A;  1VSI A;  4KFB A;  5SWM A;  4M45 A;  2YNH A;  3CFO A;  4DQQ A;  1Q9Y A;  4DQP A;  1BI4 B;  3LAK A;  5J2Q A;  5FRM A;  1A5V A;  1XC9 A;  4O55 A;  1TAQ A;  1WNS A;  4NCA A;  4W5R A;  1FKO A;  3MXJ A;  3OYH A;  3C6T A;  4J2A A;  4FJL A;  1VSK A;  2KZZ A;  3DLG A;  3NF6 A;  2YNI A;  4B9L A;  1S5J A;  4JRQ A;  4CEB A;  4B9M A;  1DLO A;  2EHG A;  4DQS A;  3ASM A;  4AHC A;  3VQ6 A;  3OS0 A;  3HJF A;  4KTW A;  1LWE A;  2DFF A;  4CEO A;  3VQC A;  4W5O A;  4DQI A;  3AVI A;  1UG8 A;  3I0S A;  5FDL A;  1RTI A;  1SKW A;  4CEA A;  1S1T A;  3U3Y A;  1KRP A;  4MFB A;  4EP5 A;  1CXQ A;  1J53 A;  5DK5 A;  2G8I A;  4K8X A;  4QCL A;  3AVH A;  3ZSR A;  1T8E A;  4DWI A;  3OS1 A;  4BAC A;  1C6V A;  3HP6 A;  4E19 A;  3AVK A;  2FBV A;  2G8W A;  2PYL A;  4DS4 A;  1HYV A;  5T7B A;  3TWH A;  3RMC A;  2PY5 A;  4C8N A;  4DU3 A;  3RR8 A;  3WNE A;  1VSL A;  4DU1 A;  3RRG A;  3E01 A;  2XRI A;  4BE0 A;  3C6U A;  4O0J A;  4F2R A;  4FJN A;  4CGI A;  2QXF A;  3GKU A;  3F73 A;  3SUQ A;  5HRS A;  1YVU A;  1ZBH A;  2HVH A;  5FRO A;  3QLH A;  4J2D A;  4CEC A;  3QEP A;  4FJJ A;  3L3V A;  2GUI A;  1WAF A;  2D0B A;  2P1J A;  4KRF A;  1J54 A;  4IFV A;  3OYG A;  1NJZ A;  1TKD A;  4ELT A;  3BGR A;  2FC0 A;  3VQ9 A;  3NH2 A;  3KJV A;  4HUG A;  1X9M A;  4O4G A;  4DSE A;  4CIE A;  3VQB A;  4AHS A;  4CEZ A;  4CGD A;  3OS2 A;  3T1A A;  2DY4 A;  1WSE A;  2XHB A;  2DTU A;  1BIZ A;  4HCC A;  4KTZ A;  4FLT A;  2QKK A;  3OYD A;  3MXI A;  1LW2 A;  4FM1 A;  4CFB A;  3ZT4 A;  2Z1G A;  4NCB A;  4KHS A;  1LAV A;  3RMB A;  1VSF A;  4C8M A;  3L3U A;  1JLG A;  3WNH A;  3NE6 A;  3DLB A;  1SL1 A;  4DTS A;  1IH7 A;  3KKR A;  3O4Q A;  1LAW A;  3K5N A;  1RTD A;  1TK8 A;  2R7Y A;  2HMI A;  4DMN A;  1JL1 A;  3F9K A;  3U6F A;  2IGI A;  3SJJ A;  4B9V A;  1C0T A;  1S9E A;  4L8R B;  3V6D A;  1UAX A;  3VQP A;  4DSF A;  3AO4 A;  3AVM A;  3NH1 A;  4CJL A;  3AV9 A;  3LAL A;  1RT4 A;  1NKE A;  1Q9X A;  1HYS A;  1YTA A;  4JS4 A;  2XO7 A;  1B92 A;  3OYF A;  3K5O A;  2Z1I A;  3G10 A;  1UA1 A;  4Z0U A;  1Q8I A;  1D9D A;  1TVR A;  1RTJ A;  3DRS A;  3NF8 A;  3ZT2 A;  4FJX A;  1RDA A;  3SZ2 A;  4DTO A;  2B5J A;  3DLE A;  3PX4 A;  3LP0 A;  4IG3 A;  1N6Q A;  1KVB A;  2X74 A;  2FBX A;  3V1O A;  4CHZ A;  1TK0 A;  1LW0 A;  3HT3 A;  3PY8 A;  4KRE A;  1WN7 A;  1VK0 A;  4I9Q A;  2E6M A;  1S9G A;  4CGH A;  3HP9 A;  3S3M A;  1RTH A;  5J2M A;  3M8Q A;  3NF7 A;  3M8R A;  3LZI A;  1NK0 A;  4CER A;  2HHT A;  1VSE A;  1NK7 A;  3SUO A;  1RIL A;  2X6N A;  2YKM A;  2IS3 A;  1B9F A;  1BIS A;  1D9F A;  3HYF A;  1FXX A;  1KFS A;  4CEF A;  4E0D A;  4ICL A;  1RDB A;  2ZE2 A;  1JXB A;  1C1A A;  1L3U A;  2XY8 A;  1JXE A;  4LH4 A;  1TKT A;  3CFP A;  1TV6 A;  1WSI A;  4Z4G A;  3G0Z A;  3HVT A;  4FZZ A;  2O4I A;  2HB5 A;  4KV8 A;  1NK6 A;  3HVR A;  1X9S A;  1IG9 A;  2VG7 A;  3ZSY A;  3ZSW A;  3HK2 A;  2G8K A;  3H08 A;  4XIU A;  2CPM A;  2HVI A;  3A2F A;  4FCY A;  1KLM A;  4CJR A;  5KRT A;  1VRU A;  3LAN A;  4LY7 A;  4FLY A;  3SUP A;  3THV A;  4CED A;  3AVJ A;  3AVG A;  2DFE A;  4KKO A;  4M3R A;  3CQ8 A;  3LZJ A;  3V9W A;  4M3Y A;  2KFN A;  4I2Q A;  1ITG A;  3NF9 A;  3C94 A;  3V81 A;  4N56 A;  4E7H A;  1WAJ A;  4CJW A;  3QNO A;  3MEG A;  5I42 A;  4FJM A;  2E4L A;  4N5S A;  4M3W A;  2KZM A;  4B9S A;  4O0I A;  1BQM A;  4CEE A;  1SUQ A;  3LP1 A;  4RW8 A;  4BE2 A;  1U49 A;  3KLH A;  4YFU A;  4DQR A;  4FVM A;  1QSS A;  4FK2 A;  2AJQ A;  4ELU A;  4DTJ A;  2IDO A;  4W5Q A;  3ZSQ A;  4NYN A;  3EYZ A;  3LPT A;  5KTQ A;  1QSL A;  5D3G A;  4AHT A;  3LP2 A;  1FKP A;  1U47 A;  3HXM A;  3QES A;  4CFC A;  1WLJ A;  3O4N A;  1X1P A;  1RT1 A;  3MAQ A;  1XHZ A;  4E1N A;  1UOC A;  2JLE A;  2ATQ A;  2YHB A;  4O44 A;  4DU4 A;  4DF4 A;  4CHP A;  4Z4C A;  3SQ4 A;  3AVA A;  3HPG A;  3OYI A;  3MED A;  4E7K A;  4B8A B;  4DSK A;  4EZ9 A;  2HHX A;  3OYA A;  1JL2 A;  4CEQ A;  3NAE A;  2PZS A;  4C8K A;  1JLC A;  4ID5 A;  2BDP A;  5J2P A;  1JLB A;  4QOZ B;  3NDK A;  3KLG A;  4FLX A;  4B9T A;  2FBY A;  4BDY A;  2VWK A;  4CGJ A;  2G8V A;  1SL2 A;  4KHN A;  4ID1 A;  2FBT A;  3AO2 A;  3LP3 A;  4CIG A;  3RTV A;  4N41 A;  1TKZ A;  4OVL A;  4DLE A;  1SV5 A;  4FW1 A;  3K2P A;  1FK9 A;  2W42 A;  3HST B;  4TSX A;  1TKX A;  2ZD1 A;  3B6O A;  4RW6 A;  3OYE A;  1TL3 A;  4Y1D A;  1KVC A;  1TAU A;  3L2U A;  3CYM A;  3AVF A;  4EP4 A;  3DLH A;  4BDP A;  3KD5 E;  1WHR A;  4B8C A;  4CFD A;  2DFH A;  1HMV A;  5K14 A;  1S6Q A;  3OYK A;  5CYQ A;  3LWM A;  3JYT A;  3MXM A;  2OZM A;  4CF9 A;  1HNI A;  4OGC A;  3V9Z A;  4DSJ A;  4KHW A;  2OPR A;  3IRX A;  1ASV A;  1VSM A;  4OKK A;  3QNN A;  3KD1 E;  4KHQ A;  3NGY A;  2KW4 A;  1KCF A;  1JLA A;  5J1E A;  1WSH A;  3NHG A;  3IAY A;  1ZBF A;  3KLI A;  4AIL C;  5I3U A;  1CZB A;  4HCB A;  1C1B A;  3QO9 A;  4E7J A;  4KTQ A;  1C0M A;  3D45 A;  1S6P A;  3M8S A;  3I8D A;  2RPI A;  1RBU A;  4BWM A;  1S1X A;  1HRH A;  1CLQ A;  1U45 A;  3RR7 A;  1W9H A;  4Z4H A;  1K6Y A;  2OZS A;  2JGU A;  1RNH A;  3VQQ A;  4W5N A;  4PWD A;  4CK1 A;  2RKI A;  1ZBU A;  2PYJ A;  1I3A A;  4OPJ A;  3P1G A;  3S3O A;  1NK5 A;  1S1W A;  1TL1 A;  3BDP A;  4OJR A;  1Y97 A;  3HPH A;  4PA1 A;  5HBM A;  3PX6 A;  3KTQ A;  4CJ5 A;  2F8S A;  3SUN A;  1NK9 A;  3O3G A;  3D0P A;  1REV A;  2I5J A;  2NUB A;  3DMJ A;  3TAG A;  2P5O A;  3UIQ A;  4FJI A;  3KKS A;  4IBN A;  4FLW A;  4PQU A;  3WNG A;  3ZCM A;  3ITH A;  4OGE A;  4C8L A;  4HUE A;  3EZ5 A;  2G8F A;  1EET A;  3AO5 A;  3L2W A;  4RG8 A;  4F2S A;  1KFD A;  4Z4I A;  5KI6 A;  4M41 A;  1S1U A;  2X6S A;  3OY9 A;  3VQ4 A;  4CFA A;  4ZTJ A;  1UA0 A;  3AVN A;  1ASU A;  4FJ8 A;  3QEX A;  2Z1J A;  2XY6 A;  1QHT A;  3TAE A;  3HL8 A;  4FJ9 A;  1O1W A;  1RCH A;  1NOZ A;  4G1Q A;  4FK4 A;  1D5A A;  4NYF A;  1RDD A;  4ZHR A;  4DSI A;  1VRT A;  4B9N A;  4JS5 A;  1QS4 A;  3ZT0 A;  1IKY A;  3RRH A;  4HHT A;  4H8K A;  3P5J A;  2OPS A;  4AH9 A;  4BE1 A;  4FJ5 A;  4HVJ A;  3QEV A;  3TAP A;  4NCG A;  3LWL A;  3OYJ A;  1BHL A;  1UWB A;  2HW3 A;  4M3Z A;  3DOL A;  1TGO A;  1DTQ A;  1GOB A;  1VSH A;  2ETJ A;  2YNG A;  4CJT A;  4DF8 A;  2RF2 A;  5C42 A;  1BCM A;  3CFR A;  3PUF A;  3VQD A;  5CZ2 A;  3KK2 A;  2E6L A;  1B9D A;  2D5R A;  3VN5 A;  3L2V A;  5FRN A;  3AO1 A;  4MQ3 A;  3OYN A;  3JSM A;  4FLV A;  4DTR A;  4W5T A;  1SKS A;  1XHX A;  1HQE A;  3TAR A;  4CGF A;  4CJF A;  4N76 A;  3OYC A;  3IS9 A;  3DYA A;  4CIF A;  4OLA A;  1CZ9 A;  3T3F A;  4LSL A;  4DFM A;  1RBS A;  3T19 A;  4KB0 A;  2YNF A;  1RT7 A;  1XI1 A;  3DI6 A;  2F8T A;  2IOC A;  1JKH A;  4CJ4 A;  3AVB A;  4FM0 A;  3AA4 A;  1YT3 A;  4FLZ A;  3U3G A;  4J2B A;  5SZT A;  4DTM A;  2BGG A;  4CHY A;  3V9U A;  1YTU A;  3VQ7 A;  2P51 A;  4CJU A;  1RT6 A;  3AA5 X;  4CHN A;  5HLF A;  4AHV A;  4FJH A;  4KPY A;  4OPK A;  2LRR A;  1BI4 A;  3LPU A;  3SQ2 A;  4Z4F A;  5E41 A;  3QIP A;  4KB1 A;  4OLB A;  1NJX A;  4DTU A;  3KLE A;  4KAZ A;  4DTN A;  4F3T A;  3OYL A;  2G8H A;  3NGI A;  4HUF A;  3K5L A;  1N5Y A;  4IDK A;  3O3F A;  4FJG A;  3KK3 A;  4I2P A;  4CF8 A;  2VG6 A;  4RW4 A;  4M3T A;  4DG1 A;  4Q0B A;  3SV4 A;  4JRP A;  2KFZ A;  3DOK A;  1KLN A;  1G15 A;  3C95 A;  3RMA A;  1I39 A;  2Q3S A;  3VA3 A;  2D0C A;  4EZ6 A;  3TR8 A;  4CJQ A;  3NH0 A;  3K57 A;  5J2N A;  3HPO A;  3AA3 A;  5C25 A;  3PO4 A;  4R5P A;  2P5G A;  1IKV A;  3QEW A;  2QKB A;  2HHV A;  3NGZ A;  1IKX A;  1GOA A;  1T03 A;  1KTQ A;  4E7L A;  4E7I A;  4FW2 A;  3S3N A;  1T05 A;  2IAJ A;  4Y1C A;  1NOY A;  1X9W A;  3AVC A;  3M8P A;  4FK0 A;  3PO5 A;  1RT2 A;  4CF0 A;  2Y1J A;  4C8O A;  1LWF A;  1Z25 A;  4I9L A;  3L2Q A;  4FZX C;  1NK8 A;  3CM6 A;  1EXQ A;  3LDS A;  3SQ0 A;  3VA0 A;  1WSG A;  4ELV A;  4RW7 A;  2O4G A;  4GW6 A;  3ZSX A;  2WON A;  1S1V A;  2RN2 A;  1NK4 A;  3AA2 A;  3PX0 A;  4FJK A;  4CES A;  1DTT A;  3NCI A;  3SYZ A;  3TAM A;  4KI4 A;  4QAG A;  1MSZ A;  1U48 A;  1RT3 A;  4HTU A;  3V1Q A;  5EU7 A;  3DRR A;  4IFY A;  4O5B A;  3SPY A;  1L3V A;  2HHW A;  5DMR A;  4YNQ A;  2B6A A;  3TAB A;  2VWJ A;  3WNF A;  1F21 A;  1U04 A;  3ZSZ A;  2LSN A;  1SL0 A;  3ZT3 A;  4FJ7 A;  4CGG A;  3QEI A;  3RMD A;  1QQC A;  1IKW A;  3DRP A;  5CY4 A;  3L8B A;  4F4K A;  4I7F A;  3SNN A;  3AO3 A;  4FXD A;  3OJS A;  4DTX A;  3LAM A;  1J9A A;  3KLF A;  3V9S A;  4E89 A;  1KSP A;  1JLF A;  3K5M A;  5JS1 A;  3V9X A;  3SPZ A;  4AHR A;  4DLG A;  1VSD A;  2IC3 A;  1NKB A;  2WOM A;  1JLE A;  2HNZ A;  3DLK A;  4KHU A;  1EX4 A;  4DFJ A;  3SCX A;  1ASW A;  1ZBL A;  5KGW A;  4M42 A;  2HND A;  1QE1 A;  1TK5 A;  1IO2 A;  2A1S A;  3ZT1 A;  4JLH A;  4B08 A;  3QET A;  3I0R A;  4CHO A;  3SQ1 A;  2OPP A;  1L3T A;  3ULD A;  3RWU A;  1BCO A;  4LD0 A;  2G8U A;  3V4I A;  3SV3 A;  1Z26 A;  1C1C A;  2HHQ A;  4ZTF A;  1ZBI A;  2EX3 A;  3TI0 A;  4KO0 A;  4RW9 A;  2B4J A;  4N47 A;  1CXU A;  1HPZ A;  2A1R A;  1EKE A;  3FFI A;  5KGX A;  4Q5V A;  3KK1 A;  1WSF A;  2YV0 X;  3TAF A;  4H4M A;  2YKN A;  3PV8 A;  4GVM A;  4DFK A;  1LV5 A;  4DSL A;  4J2E A;  3MEE A;  1WSJ A;  1HQU A;  2BE2 A;  4CK2 A;  4CK3 A;  4CE9 A;  4IKF A;  1RBT A;  3OYB A;  4OKE A;  2ITG A;  4KI6 A;  3VQE A;  2QK9 A;  3S9H A;  4WE1 A;  4AHU A;  1ZYQ A;  4M3U A;  4F3O A;  3VQA A;  3NFA A;  1R0A A;  3V1R A;  4B3O A;  4BDZ A;  1SKR A;  2X78 A; 
#chains in the Genus database with same CATH topology
 4CJE A;  1EP4 A;  1GOC A;  3O8M A;  3C0B A;  3CCU N;  4BRK A;  4LH5 A;  3THY B;  2HBK A;  2XY7 A;  1HJO A;  1HR0 K;  3HO1 A;  3CM5 A;  5CZ1 A;  4BWJ A;  4FZY A;  3CF5 L;  1J5O A;  2FPH X;  5HRP A;  1VSJ A;  4FO0 A;  1O13 A;  2D0A A;  1T7P A;  1RBR A;  2QWQ A;  1RDC A;  1JCE A;  4BRM A;  4OPH A;  2AA4 A;  2VQF K;  3CCL N;  2Q97 A;  5LMN K;  2A6A A;  2LTM A;  3EEQ A;  2H3G X;  3THX A;  1QQM A;  1GLJ O;  4JI2 H;  4K8Z A;  4H0T B;  1ZTG A;  4FM2 A;  1A5W A;  4KBO A;  4IOA L;  2CTJ A;  3K58 A;  1KVA A;  5AQI A;  2VG5 A;  3OVN A;  4CZG A;  5HRN A;  4UQG A;  1HKB A;  3K59 A;  5LJV A;  4M3X A;  3B6P A;  2ZJQ L;  3VQ8 A;  1Z05 A;  4J8F A;  4GMJ B;  1S03 G;  1HJR A;  3E66 A;  2YNH A;  4NZT M;  1WBD A;  4DQP A;  3LAK A;  5J2Q A;  4DV4 K;  1A5V A;  1XC9 A;  1VQ7 N;  2UU9 H;  1GLF O;  4W5R A;  1X9Z A;  4B9L A;  4B9M A;  4LFB K;  2V7Z A;  2EHG A;  3CCV N;  4DQS A;  3HJF A;  2O8F B;  1RTI A;  3OW2 M;  5DK5 A;  4QCL A;  3AAQ A;  2PT7 G;  5EXW A;  3ID8 A;  3OS1 A;  5KQD A;  3GE1 A;  4E19 A;  2HHH H;  2G8W A;  3MMV A;  1HYV A;  3RR8 A;  4MDA A;  3AY9 A;  3CJC A;  3E01 A;  1ATS A;  2XRI A;  3DXK B;  1TUA A;  2QXF A;  3VF2 A;  3EKS A;  1ZBH A;  1IBL K;  1K1G A;  4MO4 A;  3QLH A;  1X3M A;  4CEC A;  2GUI A;  3VTI A;  2CGJ A;  2D0P A;  4PKG A;  1KXP A;  4KRF A;  1J54 A;  1H1V A;  1NJZ A;  2CTE A;  1HKG A;  1X9M A;  1KC8 O;  1WSE A;  3CXC M;  1DEJ A;  4FLT A;  3OYD A;  3CCR N;  1LW2 A;  4LF6 K;  1LAV A;  3RMB A;  1VSF A;  4Y0W A;  3CQX A;  2CGL A;  1SL1 A;  3TTF A;  4H5V A;  1IBM H;  1W97 L;  1LAW A;  1RTD A;  2HMI A;  4L8R B;  1C0T A;  3AVM A;  3T1H H;  4KHP H;  2QA4 N;  1NKE A;  1LOT B;  4JS4 A;  2E2Q A;  1B92 A;  4JI4 H;  2V7Y A;  1D9D A;  2G8Y A;  2QXL A;  1RTJ A;  3DRS A;  2UXD K;  4DTO A;  2B5J A;  3DLE A;  1N6Q A;  4NXM H;  5AFU A;  4KRE A;  1VK0 A;  4I9Q A;  2I7P A;  1NK7 A;  3SUO A;  1RIL A;  4LFC K;  2YKM A;  3I0P A;  4GKK K;  1D9F A;  3HYF A;  1HKC A;  4K0K H;  4DR6 H;  3EZW A;  4K42 A;  2WC9 A;  3CFP A;  4E1J A;  1Q82 O;  4FZZ A;  2O4I A;  4WFN L;  1W2B M;  3HVR A;  3ZSW A;  3ZSY A;  4CJR A;  1IV0 A;  5KPZ A;  4QS7 A;  5AJ3 K;  4CED A;  4FWN A;  3MWT A;  3W3D A;  2UUA H;  4A62 A;  1NGF A;  4M3R A;  4M3Y A;  2KFN A;  5EX5 A;  3QD7 X;  3C94 A;  3EE9 A;  1WAJ A;  3QNO A;  4FJM A;  1XC3 A;  5BR8 K;  1EC6 A;  4O0I A;  3LL3 A;  1X4M A;  4JHD B;  4L3Q A;  4DQR A;  4YFU A;  5GIP A;  4ELU A;  1WVN A;  2YCH A;  3ZSQ A;  4JVH A;  3CCQ N;  5KTQ A;  2KKZ A;  3VEZ A;  3QES A;  1WLJ A;  3O4N A;  1X1P A;  1XHZ A;  2E88 A;  2ATQ A;  1T6D A;  2YHB A;  3AVA A;  3HPG A;  3OYI A;  4E7K A;  1HX1 A;  4FJU A;  5C0X G;  3OYA A;  4C8K A;  2QEX N;  3FFK B;  2UUB K;  1MDU B;  3SBT A;  4LF5 H;  2BDP A;  1QHA A;  4BDY A;  5ADX A;  4KHN A;  3AO2 A;  3LP3 A;  3RTV A;  3L7Z C;  3ZET A;  4OVL A;  4DLE A;  3NMU A;  3K2P A;  1FK9 A;  1K73 O;  5KPR A;  5M1N A;  2P9P B;  2UU9 K;  2HBL A;  3KD5 E;  3AVF A;  4BDP A;  4FWM A;  4B8C A;  2KLA A;  2DFH A;  1HMV A;  3JYT A;  1S6Q A;  2OZM A;  3LWM A;  4CZJ A;  2O8D B;  1VSM A;  1TYQ A;  2KW4 A;  1KCF A;  1IBK H;  2P9I B;  5J1E A;  2RE2 A;  3EKU A;  4GNI A;  2HF4 A;  3G71 N;  1VQP N;  3M8S A;  3I8D A;  2HHH K;  2CTK A;  4BWM A;  2D1K A;  1C0G A;  1HRH A;  3JS6 A;  3MK6 A;  4JI1 K;  4C1N I;  2OZS A;  4KH4 A;  3VQQ A;  1J5E K;  2PYJ A;  3TTD A;  2IIR A;  1DTJ A;  3VER A;  3P1G A;  4C1N K;  1TL1 A;  2IVN A;  3BDP A;  3HM8 A;  3KTQ A;  4CJ5 A;  1N32 K;  3TSP A;  3SUN A;  3O3G A;  3D0P A;  2I5J A;  3DMJ A;  3KKS A;  4PQU A;  3ZCM A;  3ITH A;  3RSE A;  2G8F A;  3J80 W;  3AO5 A;  4RG8 A;  1Y64 A;  1SQK A;  1S1U A;  3VEX A;  1I94 H;  4IJN A;  4JK7 A;  5C12 A;  3AGR A;  3AVN A;  3IFR A;  2HMP A;  3QEX A;  2XY6 A;  1K9M O;  3TAE A;  3HL8 A;  4OX9 K;  4AF1 A;  3VMF B;  4ZHR A;  3I55 N;  1VRT A;  1SS6 A;  3LM9 A;  4JAX A;  1QS4 A;  2CTL A;  2M8W A;  1IKY A;  2E8A A;  2W41 A;  3P5J A;  2OPS A;  4AH9 A;  5C0Y A;  4HVJ A;  1P90 A;  4JI3 H;  1OVQ A;  2OAN A;  1TUY A;  1VQ5 N;  3T1H K;  4KHP K;  1DTQ A;  4YDU A;  4CJT A;  3BY5 A;  5C42 A;  5F1X A;  3CFR A;  3VQD A;  3CME N;  2QWL A;  4FWL A;  3ULE A;  1QZ6 A;  1EWQ A;  3BF1 A;  4M7Y A;  4MQ3 A;  4B8T A;  4NXM K;  4FLV A;  2NRZ A;  3LDN A;  5I9E B;  2QWP A;  4N76 A;  4K25 A;  4CIF A;  3CC2 N;  3WXL A;  4OLA A;  1CZ9 A;  3T19 A;  4KB0 A;  5E26 A;  2YNF A;  4B1X B;  1Z2I A;  4CJ4 A;  3FLC O;  2UXC H;  3AA4 A;  3D2F A;  1YT3 A;  1ATN A;  3U3G A;  3F2K A;  5SZT A;  4CHY A;  3VQ7 A;  4BRO A;  4CHN A;  4NBQ A;  4WQ5 C;  5HLF A;  4KPY A;  4BRL A;  3SQ2 A;  4JI6 H;  2P9U A;  4OLB A;  3FE1 A;  4WFA L;  5E84 A;  4KAZ A;  1VQN N;  2G8H A;  2M6Q A;  4HUF A;  4BC4 A;  5DM7 L;  2QWR A;  3KK3 A;  3ENO A;  1J5K A;  4M3T A;  4DG1 A;  2FXU A;  3EL2 A;  4EC5 A;  3SV4 A;  2UUA K;  4JRP A;  1ZBS A;  3DOK A;  1NGG A;  3RMA A;  4QS8 A;  1BU6 O;  3H1V X;  3K57 A;  3AA3 A;  5AQP A;  5C25 A;  4R5P A;  3QEW A;  4XEI A;  4E7I A;  1BWF O;  2YHW A;  2IAJ A;  1P8Z A;  3AVC A;  4WYB A;  4CF0 A;  2CH6 A;  4JI5 H;  3L2Q A;  2F4V H;  1NGI A;  2QWM A;  3SQ0 A;  2Q2R A;  2PQU A;  4A57 A;  2QWN A;  3WXJ A;  1NK4 A;  2RN2 A;  4PDB A;  5AFU H;  1MSZ A;  1U48 A;  1RT3 A;  3V1Q A;  4X62 H;  3DRR A;  4IFY A;  4YNQ A;  2B6A A;  4AIM A;  4H0P A;  4LF5 K;  3CJA A;  3ZSZ A;  2VQE K;  3ZEU A;  5CHI A;  2QWO A;  4EIA A;  3TU5 A;  2O8B A;  4B1Z A;  4JKG B;  3QEI A;  4JYA H;  4JK9 A;  1IKW A;  1WB9 A;  3AO3 A;  4EHU A;  3OJS A;  4K41 A;  1NGE A;  4BGB A;  4NXN K;  2CPQ A;  1J9A A;  4NO7 A;  1ZZJ A;  3V9X A;  4GV3 A;  4AHR A;  2IC3 A;  2WOM A;  2GTD A;  1RGI A;  1QE1 A;  2CGK A;  5TKY A;  3SQ1 A;  3P31 A;  4EAH D;  3MN9 A;  2UYT A;  2HHQ A;  4ZTF A;  1ZBI A;  4X64 H;  1DT9 A;  4N47 A;  4GV9 A;  5EY4 A;  3TAF A;  4F9O A;  4H4M A;  4NB4 A;  3PV8 A;  3GDQ A;  2WFB A;  4GVM A;  4OO1 G;  5AZJ B;  2E1Z A;  1QQN A;  1WSJ A;  3KK7 A;  1WBB A;  5KPT A;  4CE9 A;  4IKF A;  2ITG A;  4IEI A;  3TTC A;  3S9H A;  4WE1 A;  4DV7 H;  2VQF H;  4AHU A;  3O9U A;  3NFA A;  4B3O A;  3A5M C;  1W7A A;  1BL3 A;  4CHQ A;  3WT0 A;  3ZSV A;  4FWP A;  1YXQ A;  3FZM A;  3MX2 A;  4CF2 A;  3H45 C;  2YJE A;  3QBX A;  3MCA B;  3AAR A;  4FWS A;  1MU2 A;  4MDB A;  1C0U A;  4BRE A;  3IKM A;  4LIJ A;  4JI3 K;  5EOY A;  3QIN A;  4CZH A;  1YJN N;  4OKJ A;  1JLQ A;  3QIO A;  3CG7 A;  1NKC A;  4FLU A;  2FSK A;  2E3U A;  1XMQ K;  4DV4 H;  3FAU A;  4H4O A;  1WTJ A;  1L5U A;  2JA9 A;  4LFB H;  3NBP A;  2FLO A;  5JS2 A;  3KIO A;  3PIO L;  3QER A;  2KQ2 A;  3O1B A;  2HHS A;  3DLL L;  3CER A;  4BGA A;  5HRR A;  4B9U A;  1W0H A;  2HNY A;  4CJS A;  4CJ3 A;  4M45 A;  3NVM A;  4DQQ A;  1Q9Y A;  1BI4 B;  4JI6 K;  2O8C B;  4IFD G;  1TAQ A;  1WNS A;  3EO3 A;  3L6Q A;  3G4S N;  3MXJ A;  3NF6 A;  1VIG A;  4CEB A;  1DLO A;  5C2F A;  4DR3 H;  2DFF A;  4CEO A;  1UG8 A;  3CJ1 A;  3VTH A;  1CXQ A;  4BR4 A;  1DKG D;  1YF5 L;  4BAC A;  5EVZ A;  4DR4 K;  2PYL A;  2FBV A;  4DS4 A;  1BG3 A;  2D4W A;  3TWH A;  2PY5 A;  3BZC A;  3JXU A;  5HL7 L;  5IT9 W;  4MO5 A;  4FJN A;  4LF6 H;  2ZGY A;  1YVU A;  1KQS M;  4J2D A;  3QEP A;  4FJJ A;  1IJJ A;  3L3V A;  1WAF A;  2JWK A;  4IFV A;  4X62 K;  3OYG A;  2QTD A;  5GAH P;  3TPQ A;  4YOY A;  3BGR A;  5MLC Q;  3KJV A;  4BRC A;  3CCM N;  2PFU A;  4O4G A;  3VQB A;  4AHS A;  2NRH A;  3K9K A;  3OS2 A;  2UXD H;  2DY4 A;  1JJ2 M;  2DTU A;  2QKK A;  3KWI A;  3MXI A;  1E3M A;  4NCB A;  4KHS A;  4JKE A;  4JN4 A;  2FSJ A;  3L3U A;  4BRA A;  3O4Q A;  3K5N A;  1TK8 A;  4DSK A;  1JL1 A;  3KZB A;  4I6M B;  2IGI A;  3U6F A;  3SJJ A;  1S9E A;  3HTV A;  3VQP A;  4DSF A;  3AO4 A;  1RT4 A;  2P9S A;  1C0F A;  1EO1 A;  2XO7 A;  3OYF A;  1UA1 A;  1Q8I A;  3PLA A;  1TVR A;  4X64 K;  3ENB A;  3PX4 A;  2V52 B;  2NRX A;  3V1O A;  3HT3 A;  3PY8 A;  3K0S A;  2E6M A;  1S9G A;  3S3M A;  3T7Z A;  1RTH A;  5J2M A;  3M8Q A;  3J80 O;  1XQS C;  3M8R A;  4CER A;  4B1V A;  2X6N A;  1B9F A;  1BIS A;  1FXX A;  1KFS A;  3WEE A;  4DV7 K;  2UUC K;  2JEA I;  3U9Z A;  1C1A A;  5BR8 H;  4WAN A;  3HVT A;  4KV8 A;  1IG9 A;  2VG7 A;  3HZ6 A;  5AQF A;  5IWA H;  4BC3 A;  4JD2 A;  3A2F A;  4FCY A;  1QZ5 A;  3THV A;  3AVG A;  3M1F A;  4AM6 A;  3UKU B;  3V9W A;  1ILY A;  4I2Q A;  1BA1 A;  4LF4 K;  4N56 A;  2UUB H;  2E4L A;  4CBW A;  2KZM A;  3J81 O;  3J8A A;  4CEE A;  1SUQ A;  3LP1 A;  4RW8 A;  1KD1 O;  1QSS A;  3KLH A;  4FVM A;  4DTJ A;  2IDO A;  4W5Q A;  3EYZ A;  3LPT A;  1NGD A;  3FZK A;  1NMN A;  2HST A;  1S3X A;  3HXM A;  1VAZ A;  1ZZI A;  1IG8 A;  3VF4 A;  4BC2 A;  5GIN A;  5LL6 Z;  3P39 A;  4BR0 A;  2PZS A;  4CEQ A;  3O08 A;  4ID5 A;  3CC4 N;  3C7N A;  3KLG A;  3G25 A;  1ZZK A;  2FBY A;  2VWK A;  4CGJ A;  4B3R K;  4ID1 A;  4CIG A;  4N41 A;  4DUY H;  1TKZ A;  3UKR B;  1XMO K;  1YI2 N;  3M3Z A;  4X65 H;  1SAZ A;  1SV5 A;  4A2B A;  4JI1 H;  1J5E H;  1TKX A;  2ZD1 A;  3B6O A;  4RW6 A;  1TL3 A;  3CQY A;  4WCE L;  5JVG L;  1KVC A;  1TAU A;  1WHR A;  1X4N A;  3OYK A;  5CYQ A;  1N32 H;  2BL5 A;  3THW A;  4DR3 K;  4KHW A;  2HOE A;  2OPR A;  3IRX A;  4OKK A;  4HTL A;  5JIC A;  1N36 K;  1YHQ N;  3IAY A;  1ZBF A;  5M1F A;  1RFQ A;  4HCB A;  3QO9 A;  4E7J A;  3MX5 A;  2NRR A;  1HNW K;  2P9L B;  1CLQ A;  3U8X A;  1U45 A;  3RR7 A;  1RNH A;  4PWD A;  2VYP A;  5LY3 A;  1I3A A;  4OPJ A;  3ID6 A;  4OX9 H;  1U2V B;  4OJR A;  3HPH A;  5HBM A;  1REV A;  1FJG K;  3UIQ A;  4BA2 I;  3OA9 A;  1TYQ B;  3SAF A;  4C8L A;  1GLA G;  1QVG M;  1EET A;  2Q0R A;  5FPM A;  1XRH A;  2PY9 A;  4F2S A;  5KI6 A;  4B3M K;  3OY9 A;  3VQ4 A;  5JLF A;  4MLH A;  3THY A;  1NGB A;  2WBN A;  2Z1J A;  1QHT A;  4DR7 K;  1PQX A;  1XNQ K;  1RCH A;  4G1Q A;  3FZH A;  4CJ7 A;  4BRF A;  1RDD A;  2YI1 A;  4BQZ A;  4A59 A;  2E5L K;  4PKH A;  3EZJ A;  4HHT A;  4GY2 B;  3UB5 A;  4BE1 A;  2X06 A;  4BR7 A;  3C6A A;  5LJW A;  2UXB K;  4M3Z A;  1GLD G;  5AQJ A;  1VSH A;  2YNG A;  4DF8 A;  1NNE A;  1BCM A;  4BRQ A;  2A42 A;  1OVY A;  1VQK N;  1ZXO A;  4BR5 A;  4CD3 A;  3WQU A;  4B9Q A;  5GIO A;  3OYN A;  3JSM A;  4DTR A;  1HQE A;  3BEX A;  3TAR A;  2QI2 A;  4CGF A;  1HLU A;  2NRV A;  3OYC A;  3DYA A;  4ISG A;  3O4W A;  5GAE P;  4JEP A;  3T3F A;  2OTL N;  4LF8 K;  3VGK A;  1RT7 A;  3DI6 A;  2IOC A;  4FM0 A;  4RWT A;  1YTU A;  3V9U A;  3SB1 A;  1RT6 A;  3ULE B;  2LRR A;  2J4R A;  2F9W A;  3LPU A;  3B8A X;  1K8A O;  3QIP A;  4DTU A;  5IWA K;  2W6L A;  4GKJ K;  4YDU C;  2MJH A;  3O3F A;  3MWP A;  4I2P A;  5CE3 A;  2O8F A;  2VG6 A;  4RW4 A;  5CR4 A;  2JEB I;  2KFZ A;  2E1Y A;  1YAG A;  3C95 A;  2Q3S A;  3VES A;  3TR8 A;  3D2F B;  3J7A K;  5FLX O;  2VQE H;  2HHV A;  1IKV A;  2QKB A;  3HBT A;  1K8K B;  4CD1 A;  1T03 A;  1KTQ A;  4E7L A;  3S3N A;  1T05 A;  4M7X A;  3WUH A;  2OPU A;  3M8P A;  1OH5 A;  3CC7 N;  4I9L A;  4NXN H;  1DT4 A;  5JEA G;  3LDS A;  1WSG A;  4RW7 A;  3PX0 A;  4HWI A;  3NCI A;  3TAM A;  4WF9 L;  3SPY A;  4JKA A;  4H5R A;  3TAB A;  2VCP A;  3H6E A;  4FJ7 A;  4DUY K;  5CY4 A;  3DRP A;  4X65 K;  5AQL A;  4F4K A;  3SNN A;  4K43 A;  4WFB L;  4DTX A;  4BA1 I;  4H8A A;  2D9I A;  2HNZ A;  4KHU A;  1D4X A;  4M42 A;  1TK5 A;  4XH1 A;  2A1S A;  4PKI A;  3ZT1 A;  4XH5 A;  3QET A;  3I0R A;  5LL6 b;  3GOI A;  5IT9 O;  4BRG A;  2OPP A;  1BCO A;  4LD0 A;  1C1C A;  3WQT A;  2B4J A;  1CXU A;  1HPZ A;  2A1R A;  1ATR A;  1WSF A;  3CPW M;  5AQT A;  1LV5 A;  4DFK A;  4A61 A;  3MEE A;  4ILG B;  1RBT A;  2P9K A;  4YY3 K;  3VQA A;  1J6Z A;  3TAQ A;  4PUO A;  4Z4E A;  5AZI B;  1RT5 A;  3VQ5 A;  1BQN A;  1XMQ H;  1SZ2 A;  3M6G A;  1BGX T;  1RBV A;  1HYZ A;  3D2E B;  3I8B A;  1VHX A;  5JMV A;  1QTM A;  3J81 W;  5JLH A;  3CET A;  5AQZ A;  2O4C A;  4YOT A;  5BR9 A;  4DS5 A;  1T44 A;  1A5X A;  2V51 B;  4CVN E;  4LSN A;  2IVP A;  2OYQ A;  2JE6 I;  4DV5 H;  3OTO K;  3OJU A;  1L3S A;  4DTP A;  3Q7C A;  4E3S A;  4RTF D;  4FYD A;  4IO8 A;  3DM2 A;  3VEN A;  3O3H A;  4ILH A;  2Y1I A;  2Z1H A;  4EFH A;  3ALY A;  4IOC L;  4YOV A;  4JKH A;  3QBW A;  2HHU A;  3A5N C;  2XY5 A;  3ISN C;  3W0L A;  3U4L A;  4CZI A;  3O80 A;  2OA8 A;  4PY5 A;  1D8Y A;  4DFP A;  2W40 A;  5HP1 A;  2DGR A;  3MEC A;  2F96 A;  4DR4 H;  1V9N A;  2ANR A;  1NJW A;  4KFB A;  2ZM6 K;  3J7A P;  3KWG A;  5FRM A;  2P9P A;  4O55 A;  1I6U A;  1BO5 O;  2ANN A;  4J2A A;  2KZZ A;  3DLG A;  2YNI A;  4JRQ A;  3OS0 A;  4WQ4 C;  4YOR A;  3VQ6 A;  4KTW A;  2NN6 G;  1LWE A;  2O8D A;  3VQC A;  4DQI A;  4BY9 C;  3AVI A;  3I0S A;  3MCP A;  5M1Q A;  1SKW A;  1HNZ K;  1S1T A;  2P9I A;  3DXM A;  3U3Y A;  1S72 N;  1J53 A;  4IFE A;  1KRP A;  2G8I A;  4K8X A;  3AVH A;  3R6M A;  4DWI A;  2GWJ A;  4H5T A;  3HP6 A;  4JV5 K;  3AVK A;  3I33 A;  4H0Y B;  5H1S Q;  4LF7 K;  3RMC A;  1OH8 A;  4C8N A;  4DU3 A;  3WNE A;  1VSL A;  3KDK A;  3C6U A;  4O0J A;  5C10 A;  4G08 A;  2GX9 A;  5GAG P;  5BRE A;  3GKU A;  2ZGZ A;  2YX6 A;  3F73 A;  3SUQ A;  5FRO A;  3IUC A;  3O9T A;  3CJ9 A;  1VQ6 N;  5DM6 L;  4ELT A;  2FC0 A;  2QW9 A;  3DWL A;  3VQ9 A;  2HBJ A;  1XNR K;  4DV1 K;  4DSE A;  4BRH A;  4CGD A;  1NXU A;  3O9S A;  1BIZ A;  4KTZ A;  3LDL A;  2QM1 A;  4FM1 A;  4CFB A;  3ZT4 A;  3KDG A;  4YHH K;  3WNH A;  3DLB A;  2NLX A;  3NE6 A;  4DTS A;  2ZQE A;  4V19 S;  3F9K A;  3CHW A;  4B9V A;  1V8C A;  3V6D A;  5AQY A;  3T1Y K;  2BH1 A;  3NH1 A;  2OTJ N;  3AV9 A;  3HRG A;  1X0A A;  1HYS A;  1YTA A;  2UUC H;  3K5O A;  5BRH A;  3EE8 A;  4Z0U A;  3ZT2 A;  4FJX A;  3SZ2 A;  3CCE N;  3LP0 A;  1KVB A;  2BTF A;  2P9N B;  3MDQ A;  5ADX H;  3NF7 A;  1E4F T;  5JVH L;  3L4Q A;  2IS3 A;  4LF4 H;  4CEF A;  4DV6 K;  2GUP A;  3H46 O;  2JWL A;  1RDB A;  2ZE2 A;  1JXB A;  4NZR M;  3C6H A;  1L3U A;  3CCJ N;  4M63 C;  1JXE A;  4LH4 A;  5BRF A;  4BRP A;  1WSI A;  4WQ4 A;  1GLB G;  3G0Z A;  3KVG A;  1NK6 A;  3AAP A;  2G8K A;  4JI8 H;  2HVI A;  5KRT A;  3FR0 A;  4LY7 A;  4FLY A;  3SUP A;  5FLX W;  3C65 A;  1HNX K;  4KKO A;  3GL1 A;  2Z0S A;  3LZJ A;  4CBU A;  2D0O A;  4DV5 K;  3V81 A;  4E7H A;  3MEG A;  1T3V A;  4N5S A;  2AP1 A;  3P38 A;  4B3R H;  4JKD A;  5ELZ A;  4JI0 K;  4FK2 A;  1GLE G;  3THX B;  1U49 A;  1XMO H;  3N4Q A;  3D7E O;  2E2P A;  1NGH A;  1QSL A;  4JD2 B;  4AHT A;  2EWS A;  1FKP A;  1BUP A;  1GLC G;  2IVO A;  4FPA A;  1U47 A;  4CFC A;  1RT1 A;  2AXY A;  4E1N A;  4DU4 A;  4CHP A;  3SQ4 A;  4DR1 K;  4OD6 A;  4B8A B;  4EZ9 A;  4UY8 O;  2HH2 A;  3BP8 A;  1JL2 A;  3VGM A;  1N36 H;  1JLC A;  4CZE A;  3E1Y A;  1JLB A;  4Z94 A;  4B9T A;  4DV2 K;  2NZT A;  1NG9 A;  3ATV A;  4X66 K;  2G8V A;  1NLV A;  3A8Y A;  1HNW H;  2FBT A;  3PSI A;  4JKG A;  2WUS A;  4FW1 A;  4DUZ K;  3HST B;  4FWQ A;  3OYE A;  4Y1D A;  3ZX2 A;  3L2U A;  4EP4 A;  3DLH A;  3VEV A;  1CZA N;  4CFD A;  3PSF A;  5K14 A;  3MXM A;  4LFA K;  4H5W A;  4CF9 A;  1FJG H;  1ASV A;  3T69 A;  3NGY A;  1JLA A;  1WSH A;  3NHG A;  3KLI A;  3C7N B;  1VQ4 N;  3ENH A;  4KTQ A;  1C0M A;  3D6R A;  2RPI A;  1RBU A;  1DGK N;  4B3M H;  4Z4H A;  1K6Y A;  2JGU A;  3E9O A;  4W5N A;  4CK1 A;  5HOO A;  4DR7 H;  1VQO N;  4AQY K;  5AZJ A;  1AN7 A;  1XNQ H;  3S3O A;  1NK5 A;  3UOE A;  1NMD A;  1Y97 A;  4MLE A;  4PA1 A;  2E5L H;  1NK9 A;  2NUB A;  2HHT A;  4FJI A;  4H0X B;  4JI7 H;  4FVU A;  2UXB H;  4BVP A;  3ZYY X;  4HUE A;  1YIT N;  2JVZ A;  4M41 A;  1RDU A;  3JAM W;  4CFA A;  1UA0 A;  1ASU A;  4FJ8 A;  4B3S K;  4FJ9 A;  2OCE A;  4GV6 A;  1NOZ A;  1VBI A;  1D5A A;  4NYF A;  4DSI A;  4B9N A;  4CZK A;  3RRH A;  4LF8 H;  4H8K A;  3IDH A;  3AEV B;  4NCG A;  2LF0 A;  1UWB A;  5F2R A;  3H1Q A;  3DOL A;  2Q0U A;  1U6Z A;  3CD6 N;  2FSN A;  2RF2 A;  3PIP L;  3PUF A;  1T6C A;  5CZ2 A;  3KK2 A;  2VKC A;  2E6L A;  3VN5 A;  2D5R A;  2PAV A;  2YQR A;  5FRN A;  2W6K A;  4IWV A;  3AO1 A;  4FPB A;  5K36 G;  1VQL N;  4GKJ H;  1XHX A;  5BN9 A;  4JKB A;  4B1Y B;  4CJF A;  3MN6 A;  1FW6 A;  4YOW A;  2ZJR L;  4DFM A;  4LSL A;  1NM1 A;  1V4S A;  3O9R A;  2F8T A;  3HOS A;  3O6W A;  2E2O A;  4H0V B;  5A2Q O;  3ATU A;  4FLZ A;  5BPM A;  4G9Z A;  3OBW A;  4DR2 K;  2BGG A;  4CJU A;  2P51 A;  3O9Q A;  3AA5 X;  1S20 A;  5BN8 A;  4OPK A;  1BI4 A;  2O8C A;  4Z4F A;  4KB1 A;  1NJX A;  1BOT O;  3KLE A;  1J4W A;  4JI8 K;  3QML A;  3NGI A;  1NGA A;  3K5L A;  1N5Y A;  4IDK A;  1TUU A;  3L4I A;  2WTU A;  5AQX A;  2E2N A;  4CF8 A;  4Q0B A;  1KAX A;  4IOX A;  3AGK A;  4LC9 B;  1G15 A;  3VA3 A;  4FSV A;  4EZ6 A;  4CJQ A;  3NH0 A;  5J2N A;  3HPO A;  2LTL A;  3K9J A;  3PO4 A;  5AQU A;  3SBG A;  1YJW N;  3NGZ A;  1IKX A;  1GOA A;  2Q31 A;  4FW2 A;  1F0X A;  3BZK A;  1X9W A;  4FK0 A;  1Q7Y O;  4C8O A;  1LWF A;  3H3O B;  2O8E A;  3QFP A;  4ELV A;  3ZSX A;  4GW6 A;  4B8C D;  1S1V A;  2YJF A;  4FJK A;  4CES A;  4XH4 A;  1NBW A;  1DTT A;  3WXI A;  4KI4 A;  4OCH A;  4QAG A;  2A40 A;  4O5B A;  4BR9 A;  3VKE A;  5DMR A;  2KHO A;  3NVK A;  4H5N A;  1ESV A;  2JZX A;  2VWJ A;  1F21 A;  1U04 A;  2LSN A;  4QMF B;  4YOU A;  1SL0 A;  3ZT3 A;  3ZET B;  5DT9 A;  1ODH A;  3L8B A;  3HSC A;  4FXD A;  1S22 A;  5JS1 A;  5B8H A;  3SPZ A;  1VIH A;  4DLG A;  1VSD A;  2GWK A;  1NKB A;  4I6M A;  1JLE A;  4DV3 K;  1ZBL A;  2E20 A;  4CZL A;  1IO2 A;  4YY3 H;  4JLH A;  4B08 A;  2BUP A;  5BRD A;  3SV3 A;  4EHT A;  4R79 A;  4KO0 A;  3TI0 A;  5KGX A;  4Q5V A;  3CCS N;  2YV0 X;  4DSL A;  4J2E A;  1EQY A;  3VEO A;  1HQU A;  4CK3 A;  3VGL A;  3J7Z O;  2FMR A;  4DR5 K;  2QK9 A;  4DV0 K;  4JI7 K;  4LF9 H;  3OTO H;  1ZYQ A;  4AM3 A;  4F3O A;  3RSE B;  1R0A A;  3HOT A;  4BDZ A;  1SKR A;  4RCH A;  2X78 A;  1YIJ N;  3TAN A;  1U4B A;  4E1M A;  3N4P A;  5CYM A;  4IEE A;  3FZF A;  4KHY A;  3QFU A;  3R1X A;  1JCG A;  2GV9 A;  3CJB A;  5AQK A;  1XWL A;  3SI6 A;  4CF1 A;  2DPN A;  4B3T K;  2ZQB A;  1BIU A;  3OSS D;  3DLR A;  1SEI A;  3L0Q A;  3UKU A;  3MN7 A;  1G99 A;  1LWC A;  3VEY A;  2P9K B;  3P83 D;  3EY1 A;  2YHA A;  1FKA H;  1NJI O;  2KTQ A;  1NWK A;  3M5R A;  3VEW A;  4IG0 A;  4JKF A;  2ZM6 H;  3AVL A;  3L2R A;  1NJY A;  2BAN A;  4CCH A;  3QDK A;  3OYM A;  5KRS A;  2ZJP L;  2FF6 A;  1QSY A;  5GAD P;  3OBY A;  1QVF M;  3EN9 A;  4A2A A;  3HM9 A;  4BVO A;  3G6E N;  4CJP A;  3ZSO A;  1HNZ H;  2OPQ A;  1HNV A;  2GBZ A;  2ASM A;  4CJK A;  4CJV A;  2Y3M A;  4DQ8 A;  1RDW X;  3IG1 A;  4JV5 H;  5C24 A;  5HRO A;  4F8R A;  4C23 A;  1VSI A;  5SWM A;  1KAZ A;  4JI2 K;  3UKR A;  4LF7 H;  3CFO A;  2K1H A;  3DXK A;  2P9U B;  1JCF A;  3HI0 A;  3VF6 A;  4NCA A;  1FKO A;  4OO1 J;  4NLC A;  3C6T A;  3OYH A;  2ASP A;  1VSK A;  4FJL A;  4E9J A;  1S5J A;  3SAH A;  5AQM A;  3TSQ A;  4GVE A;  3ASM A;  4AHC A;  1YVN A;  4W5O A;  4A5B A;  5FDL A;  3O1W A;  4PHT X;  4CEA A;  1OKJ A;  4MFB A;  4EP5 A;  4B1U B;  5AQQ A;  4CZM A;  3ZSR A;  1T8E A;  2ASO A;  4ISE A;  1C6V A;  5AQV A;  2P9L A;  1XNR H;  3SK3 A;  5T7B A;  4DV1 H;  4DU1 A;  3RRG A;  4BE0 A;  3CIP A;  4F2R A;  4CGI A;  1U2V A;  1XUP O;  4YHH H;  5HRS A;  4CW7 B;  2HVH A;  1X9J A;  1N8R O;  5FPD A;  1ZC6 A;  2D0B A;  3DXM B;  3T1Y H;  2P1J A;  4JVY A;  1TKD A;  3TSU A;  1MWK A;  1WOQ A;  4CZF A;  3NH2 A;  4HUG A;  1N33 H;  3ZEU B;  4CIE A;  3UE5 A;  4CEZ A;  2O8B B;  3T1A A;  1E4G T;  3QB0 A;  2XHB A;  1X3N A;  4HCC A;  4OPA A;  2Z1G A;  4C8M A;  1JLG A;  4DCH A;  1IH7 A;  3KKR A;  2R7Y A;  4DMN A;  1R59 O;  4FJS A;  4FOI A;  5M1O A;  1UAX A;  4DV6 H;  4CJL A;  3LAL A;  4U7B A;  1Q9X A;  3WXK A;  3CMA N;  2Z1I A;  3G10 A;  4O5F A;  3NF8 A;  3GR5 A;  3VOV A;  1MA9 B;  1RDA A;  2A3Z A;  4IG3 A;  2X74 A;  1TK0 A;  2FBX A;  4CHZ A;  1LW0 A;  3VPZ A;  1WN7 A;  4BG8 A;  5A2Q W;  3LDP A;  4CGH A;  2OPV A;  3HP9 A;  1KHM A;  3LZI A;  1IBM K;  1NK0 A;  3GBT A;  1HNX H;  1VSE A;  1MWM A;  4JKC A;  2BA0 A;  3ZX3 A;  3JAM O;  1BA0 A;  1M90 O;  4E0D A;  4LF9 K;  4ICL A;  5AQR A;  4CBX A;  4JI4 K;  1EWR A;  2XY8 A;  4JI0 H;  3Q7B A;  3VET A;  1TKT A;  4KH5 A;  1TV6 A;  4Z4G A;  4JHD A;  2I7N A;  2HB5 A;  3O5B A;  1X9S A;  3HK2 A;  5AQW A;  3H08 A;  4XIU A;  2CPM A;  1KLM A;  1VRU A;  3LAN A;  5M1K A;  3AVJ A;  2DFE A;  2FF3 B;  3S41 A;  4ISF A;  3J7Y P;  3CQ8 A;  4DR1 H;  3R8E A;  1ITG A;  3NF9 A;  4K0K K;  4CJW A;  4DR6 K;  5I42 A;  4JK8 A;  4M3W A;  4DV2 H;  4B9S A;  3WXM B;  4X66 H;  1BQM A;  4AM7 A;  1K8K A;  4BE2 A;  2VWB A;  2PBD A;  1OH6 A;  4BC5 A;  4BR2 A;  2AJQ A;  4YOX A;  1N34 H;  4DUZ H;  3CPE A;  4NYN A;  3R3L A;  5D3G A;  4JNE A;  3LP2 A;  2CWF A;  1WE8 A;  1NGJ A;  3MAQ A;  4DF4 A;  1UOC A;  2JLE A;  3F9M A;  4O44 A;  4LFA H;  4Z4C A;  4H03 B;  2YHY A;  3MED A;  4IJA A;  2HHX A;  3NAE A;  2CWH A;  4QOZ B;  5J2P A;  5M1P A;  3NDK A;  4FLX A;  4PL8 A;  5LMU H;  1SL2 A;  2QND A;  1YUW A;  4O8K A;  4A5A A;  4BG9 A;  2W42 A;  4TSX A;  4AQY H;  3CYM A;  1Z6R A;  4FWR A;  4H0O A;  1HNI A;  4OGC A;  3V9Z A;  4DSJ A;  3ZX0 A;  3KD1 E;  3QNN A;  4KHQ A;  4KH6 A;  2VGN A;  5I3U A;  4AIL C;  1CZB A;  1C1B A;  3D45 A;  1S6P A;  1S1X A;  1W9H A;  1Q81 O;  3E9L A;  3IMX A;  2RKI A;  4B3S H;  1ZBU A;  2HBM A;  1S1W A;  1KAY A;  3PX6 A;  2F8S A;  2CH5 A;  2P5O A;  3TAG A;  1NU0 A;  4FLW A;  4IBN A;  5F0X A;  3WNG A;  1IBK K;  4OGE A;  4BRD A;  4QS9 A;  3EZ5 A;  2P2R A;  3L2W A;  4IXC A;  1KFD A;  4Z4I A;  2FFM A;  4FL9 A;  1N33 K;  4IO9 L;  2X6S A;  4ZTJ A;  5AZI A;  3DJC A;  3KHY A;  1HR0 H;  1LCU A;  3D2E A;  1O1W A;  2HF3 A;  2ZWH A;  4FK4 A;  5BPL A;  3RF2 A;  3NCV A;  4JS5 A;  2HH3 A;  3F5T A;  3ZT0 A;  4WQ5 A;  4FJ5 A;  4DKW A;  3QEV A;  3U9D A;  3TAP A;  3LWL A;  3OYJ A;  1BHL A;  2HW3 A;  4IDH A;  1VQ8 N;  3LM2 A;  1TGO A;  5LMN H;  1GOB A;  2ETJ A;  2P9S B;  3U1K A;  3MN5 A;  1YJ9 N;  4DR2 H;  1BDG A;  3QIC A;  1M1K O;  2A41 A;  1I94 K;  4BRI A;  1B9D A;  3L2V A;  5AR0 A;  4FWO A;  4W5T A;  3SLC A;  1SKS A;  1VQM N;  3CJ7 A;  3P4I A;  3IS9 A;  3SMS A;  1RBS A;  2YHX A;  5FPE A;  1XI1 A;  1JKH A;  3AVB A;  3WEE B;  4BQL A;  3A5O C;  3BUZ B;  4DHY A;  4DTM A;  4J2B A;  3I56 N;  5AQN A;  1VQ9 N;  5KQ8 A;  1OH7 A;  4AHV A;  4FJH A;  4NLB A;  5AQO A;  3R9P A;  3A5L C;  5E41 A;  4DTN A;  2F7T A;  4F3T A;  3OYL A;  3BF3 A;  5TKW A;  2Q36 A;  2GEM A;  4FJG A;  3GAB A;  4B1W B;  1NGC A;  2NNW A;  4CI6 A;  4U67 L;  3SAG A;  1KLN A;  1I39 A;  2D0C A;  2UXC K;  2ITM A;  1Q18 A;  3CI5 A;  2P5G A;  2A5X A;  4FWK A;  5BPN A;  4IZ9 A;  1N34 K;  4Y1C A;  1NOY A;  3PO5 A;  1RT2 A;  2Y1J A;  1Z25 A;  3E9P A;  4FZX C;  1NK8 A;  3CM6 A;  2CTM A;  1EXQ A;  5AQS A;  2NRW A;  4BRN A;  3VA0 A;  2O4G A;  1IBL H;  2WON A;  3AA2 A;  2CTF A;  3SYZ A;  4DV3 H;  5FPN A;  4DB3 A;  4HTU A;  3DAW A;  4O8U A;  5EU7 A;  3LDO A;  1L3V A;  2HHW A;  4FOE A;  3WNF A;  2ZF5 O;  5LMU K;  2Q1N A;  4CGG A;  3RMD A;  1QQC A;  4I7F A;  4JI5 K;  3LDQ A;  2F4V K;  3LAM A;  1QQO A;  4PL7 A;  3KLF A;  3GG4 A;  4E89 A;  1JLF A;  3K5M A;  5AQH A;  3V9S A;  1KSP A;  2O8E B;  1Q86 O;  1HUX A;  4WAL A;  3DLK A;  1EX4 A;  2NRT A;  3THW B;  4DFJ A;  3SCX A;  1ASW A;  5KGW A;  2HND A;  3ZLJ A;  4DR5 H;  4DV0 H;  5AQG A;  4CHO A;  3OET A;  1L3T A;  3ULD A;  3RWU A;  2VGM A;  2G8U A;  3V4I A;  3V69 A;  1Z26 A;  5C15 A;  2EX3 A;  4RW9 A;  2GEL A;  3FGU A;  1EKE A;  3FFI A;  2RHK A;  4JYA K;  3KK1 A;  2YKN A;  2F9T A;  2P9N A;  3SJH A;  3H3N O;  4B3T H;  3SMP A;  3FZL A;  2BE2 A;  4CK2 A;  3RVC A;  4LFC H;  3OYB A;  4OKE A;  1HPM A;  3A0I X;  4GKK H;  4KI6 A;  1V4T A;  3VQE A;  4ILJ A;  4M3U A;  1WUA A;  5C2D A;  3V1R A;  3OHR A;  1GLL O; 
#chains in the Genus database with same CATH homology
 3TAN A;  1BL3 A;  4CHQ A;  1U4B A;  4CJE A;  4E1M A;  1EP4 A;  3ZSV A;  3TAQ A;  5CYM A;  4PUO A;  4Z4E A;  1GOC A;  4KHY A;  1RT5 A;  3VQ5 A;  1BQN A;  4LH5 A;  4CF2 A;  2XY7 A;  2GV9 A;  1BGX T;  3HO1 A;  3CM5 A;  1XWL A;  3SI6 A;  4CF1 A;  1RBV A;  1HYZ A;  5CZ1 A;  2ZQB A;  4BWJ A;  1BIU A;  1QTM A;  4FZY A;  1J5O A;  3DLR A;  1MU2 A;  5HRP A;  1VSJ A;  4DS5 A;  1A5X A;  2D0A A;  4LSN A;  1T7P A;  1LWC A;  1RBR A;  1RDC A;  1C0U A;  3P83 D;  3EY1 A;  2OYQ A;  2YHA A;  3OJU A;  3QIN A;  2KTQ A;  4OKJ A;  1JLQ A;  1L3S A;  3QIO A;  4DTP A;  4IG0 A;  3CG7 A;  3AVL A;  1NKC A;  4FLU A;  3L2R A;  4E3S A;  1NJY A;  4FYD A;  2BAN A;  4CCH A;  4K8Z A;  4FM2 A;  3OYM A;  3DM2 A;  1A5W A;  4H4O A;  5KRS A;  3O3H A;  1L5U A;  2Y1I A;  1QSY A;  2Z1H A;  3K58 A;  3ALY A;  3NBP A;  3HM9 A;  1KVA A;  3KIO A;  5JS2 A;  2XY5 A;  3ISN C;  2VG5 A;  3OVN A;  2HHU A;  5HRN A;  4CJP A;  4UQG A;  3QER A;  3ZSO A;  2KQ2 A;  2HHS A;  2OPQ A;  3K59 A;  1HNV A;  2GBZ A;  2OA8 A;  4PY5 A;  4CJK A;  5HRR A;  1D8Y A;  4DFP A;  4CJV A;  4B9U A;  3B6P A;  1W0H A;  4M3X A;  5HP1 A;  2HNY A;  3IG1 A;  3MEC A;  3VQ8 A;  2F96 A;  4GMJ B;  4CJS A;  5C24 A;  1HJR A;  4CJ3 A;  5HRO A;  4F8R A;  1NJW A;  1VSI A;  4KFB A;  5SWM A;  4M45 A;  2YNH A;  3CFO A;  4DQQ A;  1Q9Y A;  4DQP A;  1BI4 B;  3LAK A;  5J2Q A;  5FRM A;  1A5V A;  1XC9 A;  4O55 A;  1TAQ A;  1WNS A;  4NCA A;  4W5R A;  1FKO A;  3MXJ A;  3OYH A;  3C6T A;  4J2A A;  4FJL A;  1VSK A;  2KZZ A;  3DLG A;  3NF6 A;  2YNI A;  4B9L A;  1S5J A;  4JRQ A;  4CEB A;  4B9M A;  1DLO A;  2EHG A;  4DQS A;  3ASM A;  4AHC A;  3VQ6 A;  3OS0 A;  3HJF A;  4KTW A;  1LWE A;  2DFF A;  4CEO A;  3VQC A;  4W5O A;  4DQI A;  3AVI A;  1UG8 A;  3I0S A;  5FDL A;  1RTI A;  1SKW A;  4CEA A;  1S1T A;  3U3Y A;  1KRP A;  4MFB A;  4EP5 A;  1CXQ A;  1J53 A;  5DK5 A;  2G8I A;  4K8X A;  4QCL A;  3AVH A;  3ZSR A;  1T8E A;  4DWI A;  3OS1 A;  4BAC A;  1C6V A;  3HP6 A;  4E19 A;  3AVK A;  2FBV A;  2G8W A;  2PYL A;  4DS4 A;  1HYV A;  5T7B A;  3TWH A;  3RMC A;  2PY5 A;  4C8N A;  4DU3 A;  3RR8 A;  3WNE A;  1VSL A;  4DU1 A;  3RRG A;  3E01 A;  2XRI A;  4BE0 A;  3C6U A;  4O0J A;  4F2R A;  4FJN A;  4CGI A;  2QXF A;  3GKU A;  3F73 A;  3SUQ A;  5HRS A;  1YVU A;  1ZBH A;  2HVH A;  5FRO A;  3QLH A;  4J2D A;  4CEC A;  3QEP A;  4FJJ A;  3L3V A;  2GUI A;  1WAF A;  2D0B A;  2P1J A;  4KRF A;  1J54 A;  4IFV A;  3OYG A;  1NJZ A;  1TKD A;  4ELT A;  3BGR A;  2FC0 A;  3VQ9 A;  3NH2 A;  3KJV A;  4HUG A;  1X9M A;  4O4G A;  4DSE A;  4CIE A;  3VQB A;  4AHS A;  4CEZ A;  4CGD A;  3OS2 A;  3T1A A;  2DY4 A;  1WSE A;  2XHB A;  2DTU A;  1BIZ A;  4HCC A;  4KTZ A;  4FLT A;  2QKK A;  3OYD A;  3MXI A;  1LW2 A;  4FM1 A;  4CFB A;  3ZT4 A;  2Z1G A;  4NCB A;  4KHS A;  1LAV A;  3RMB A;  1VSF A;  4C8M A;  3L3U A;  1JLG A;  3WNH A;  3NE6 A;  3DLB A;  1SL1 A;  4DTS A;  1IH7 A;  3KKR A;  3O4Q A;  1LAW A;  3K5N A;  1RTD A;  1TK8 A;  2R7Y A;  2HMI A;  4DMN A;  1JL1 A;  3F9K A;  3U6F A;  2IGI A;  3SJJ A;  4B9V A;  1C0T A;  1S9E A;  4L8R B;  3V6D A;  1UAX A;  3VQP A;  4DSF A;  3AO4 A;  3AVM A;  3NH1 A;  4CJL A;  3AV9 A;  3LAL A;  1RT4 A;  1NKE A;  1Q9X A;  1HYS A;  1YTA A;  4JS4 A;  2XO7 A;  1B92 A;  3OYF A;  3K5O A;  2Z1I A;  3G10 A;  1UA1 A;  4Z0U A;  1Q8I A;  1D9D A;  1TVR A;  1RTJ A;  3DRS A;  3NF8 A;  3ZT2 A;  4FJX A;  1RDA A;  3SZ2 A;  4DTO A;  2B5J A;  3DLE A;  3PX4 A;  3LP0 A;  4IG3 A;  1N6Q A;  1KVB A;  2X74 A;  2FBX A;  3V1O A;  4CHZ A;  1TK0 A;  1LW0 A;  3HT3 A;  3PY8 A;  4KRE A;  1WN7 A;  1VK0 A;  4I9Q A;  2E6M A;  1S9G A;  4CGH A;  3HP9 A;  3S3M A;  1RTH A;  5J2M A;  3M8Q A;  3NF7 A;  3M8R A;  3LZI A;  1NK0 A;  4CER A;  2HHT A;  1VSE A;  1NK7 A;  3SUO A;  1RIL A;  2X6N A;  2YKM A;  2IS3 A;  1B9F A;  1BIS A;  1D9F A;  3HYF A;  1FXX A;  1KFS A;  4CEF A;  4E0D A;  4ICL A;  1RDB A;  2ZE2 A;  1JXB A;  1C1A A;  1L3U A;  2XY8 A;  1JXE A;  4LH4 A;  1TKT A;  3CFP A;  1TV6 A;  1WSI A;  4Z4G A;  3G0Z A;  3HVT A;  4FZZ A;  2O4I A;  2HB5 A;  4KV8 A;  1NK6 A;  3HVR A;  1X9S A;  1IG9 A;  2VG7 A;  3ZSY A;  3ZSW A;  3HK2 A;  2G8K A;  3H08 A;  4XIU A;  2CPM A;  2HVI A;  3A2F A;  4FCY A;  1KLM A;  4CJR A;  5KRT A;  1VRU A;  3LAN A;  4LY7 A;  4FLY A;  3SUP A;  3THV A;  4CED A;  3AVJ A;  3AVG A;  2DFE A;  4KKO A;  4M3R A;  3CQ8 A;  3LZJ A;  3V9W A;  4M3Y A;  2KFN A;  4I2Q A;  1ITG A;  3NF9 A;  3C94 A;  3V81 A;  4N56 A;  4E7H A;  1WAJ A;  4CJW A;  3QNO A;  3MEG A;  5I42 A;  4FJM A;  2E4L A;  4N5S A;  4M3W A;  2KZM A;  4B9S A;  4O0I A;  1BQM A;  4CEE A;  1SUQ A;  3LP1 A;  4RW8 A;  4BE2 A;  1U49 A;  3KLH A;  4YFU A;  4DQR A;  4FVM A;  1QSS A;  4FK2 A;  2AJQ A;  4ELU A;  4DTJ A;  2IDO A;  4W5Q A;  3ZSQ A;  4NYN A;  3EYZ A;  3LPT A;  5KTQ A;  1QSL A;  5D3G A;  4AHT A;  3LP2 A;  1FKP A;  1U47 A;  3HXM A;  3QES A;  4CFC A;  1WLJ A;  3O4N A;  1X1P A;  1RT1 A;  3MAQ A;  1XHZ A;  4E1N A;  1UOC A;  2JLE A;  2ATQ A;  2YHB A;  4O44 A;  4DU4 A;  4DF4 A;  4CHP A;  4Z4C A;  3SQ4 A;  3AVA A;  3HPG A;  3OYI A;  3MED A;  4E7K A;  4B8A B;  4DSK A;  4EZ9 A;  2HHX A;  3OYA A;  1JL2 A;  4CEQ A;  3NAE A;  2PZS A;  4C8K A;  1JLC A;  4ID5 A;  2BDP A;  5J2P A;  1JLB A;  4QOZ B;  3NDK A;  3KLG A;  4FLX A;  4B9T A;  2FBY A;  4BDY A;  2VWK A;  4CGJ A;  2G8V A;  1SL2 A;  4KHN A;  4ID1 A;  2FBT A;  3AO2 A;  3LP3 A;  4CIG A;  3RTV A;  4N41 A;  1TKZ A;  4OVL A;  4DLE A;  1SV5 A;  4FW1 A;  3K2P A;  1FK9 A;  2W42 A;  3HST B;  4TSX A;  1TKX A;  2ZD1 A;  3B6O A;  4RW6 A;  3OYE A;  1TL3 A;  4Y1D A;  1KVC A;  1TAU A;  3L2U A;  3CYM A;  3AVF A;  4EP4 A;  3DLH A;  4BDP A;  3KD5 E;  1WHR A;  4B8C A;  4CFD A;  2DFH A;  1HMV A;  5K14 A;  1S6Q A;  3OYK A;  5CYQ A;  3LWM A;  3JYT A;  3MXM A;  2OZM A;  4CF9 A;  1HNI A;  4OGC A;  3V9Z A;  4DSJ A;  4KHW A;  2OPR A;  3IRX A;  1ASV A;  1VSM A;  4OKK A;  3QNN A;  3KD1 E;  4KHQ A;  3NGY A;  2KW4 A;  1KCF A;  1JLA A;  5J1E A;  1WSH A;  3NHG A;  3IAY A;  1ZBF A;  3KLI A;  4AIL C;  5I3U A;  1CZB A;  4HCB A;  1C1B A;  3QO9 A;  4E7J A;  4KTQ A;  1C0M A;  3D45 A;  1S6P A;  3M8S A;  3I8D A;  2RPI A;  1RBU A;  4BWM A;  1S1X A;  1HRH A;  1CLQ A;  1U45 A;  3RR7 A;  1W9H A;  4Z4H A;  1K6Y A;  2OZS A;  2JGU A;  1RNH A;  3VQQ A;  4W5N A;  4PWD A;  4CK1 A;  2RKI A;  1ZBU A;  2PYJ A;  1I3A A;  4OPJ A;  3P1G A;  3S3O A;  1NK5 A;  1S1W A;  1TL1 A;  3BDP A;  4OJR A;  1Y97 A;  3HPH A;  4PA1 A;  5HBM A;  3PX6 A;  3KTQ A;  4CJ5 A;  2F8S A;  3SUN A;  1NK9 A;  3O3G A;  3D0P A;  1REV A;  2I5J A;  2NUB A;  3DMJ A;  3TAG A;  2P5O A;  3UIQ A;  4FJI A;  3KKS A;  4IBN A;  4FLW A;  4PQU A;  3WNG A;  3ZCM A;  3ITH A;  4OGE A;  4C8L A;  4HUE A;  3EZ5 A;  2G8F A;  1EET A;  3AO5 A;  3L2W A;  4RG8 A;  4F2S A;  1KFD A;  4Z4I A;  5KI6 A;  4M41 A;  1S1U A;  2X6S A;  3OY9 A;  3VQ4 A;  4CFA A;  4ZTJ A;  1UA0 A;  3AVN A;  1ASU A;  4FJ8 A;  3QEX A;  2Z1J A;  2XY6 A;  1QHT A;  3TAE A;  3HL8 A;  4FJ9 A;  1O1W A;  1RCH A;  1NOZ A;  4G1Q A;  4FK4 A;  1D5A A;  4NYF A;  1RDD A;  4ZHR A;  4DSI A;  1VRT A;  4B9N A;  4JS5 A;  1QS4 A;  3ZT0 A;  1IKY A;  3RRH A;  4HHT A;  4H8K A;  3P5J A;  2OPS A;  4AH9 A;  4BE1 A;  4FJ5 A;  4HVJ A;  3QEV A;  3TAP A;  4NCG A;  3LWL A;  3OYJ A;  1BHL A;  1UWB A;  2HW3 A;  4M3Z A;  3DOL A;  1TGO A;  1DTQ A;  1GOB A;  1VSH A;  2ETJ A;  2YNG A;  4CJT A;  4DF8 A;  2RF2 A;  5C42 A;  1BCM A;  3CFR A;  3PUF A;  3VQD A;  5CZ2 A;  3KK2 A;  2E6L A;  1B9D A;  2D5R A;  3VN5 A;  3L2V A;  5FRN A;  3AO1 A;  4MQ3 A;  3OYN A;  3JSM A;  4FLV A;  4DTR A;  4W5T A;  1SKS A;  1XHX A;  1HQE A;  3TAR A;  4CGF A;  4CJF A;  4N76 A;  3OYC A;  3IS9 A;  3DYA A;  4CIF A;  4OLA A;  1CZ9 A;  3T3F A;  4LSL A;  4DFM A;  1RBS A;  3T19 A;  4KB0 A;  2YNF A;  1RT7 A;  1XI1 A;  3DI6 A;  2F8T A;  2IOC A;  1JKH A;  4CJ4 A;  3AVB A;  4FM0 A;  3AA4 A;  1YT3 A;  4FLZ A;  3U3G A;  4J2B A;  5SZT A;  4DTM A;  2BGG A;  4CHY A;  3V9U A;  1YTU A;  3VQ7 A;  2P51 A;  4CJU A;  1RT6 A;  3AA5 X;  4CHN A;  5HLF A;  4AHV A;  4FJH A;  4KPY A;  4OPK A;  2LRR A;  1BI4 A;  3LPU A;  3SQ2 A;  4Z4F A;  5E41 A;  3QIP A;  4KB1 A;  4OLB A;  1NJX A;  4DTU A;  3KLE A;  4KAZ A;  4DTN A;  4F3T A;  3OYL A;  2G8H A;  3NGI A;  4HUF A;  3K5L A;  1N5Y A;  4IDK A;  3O3F A;  4FJG A;  3KK3 A;  4I2P A;  4CF8 A;  2VG6 A;  4RW4 A;  4M3T A;  4DG1 A;  4Q0B A;  3SV4 A;  4JRP A;  2KFZ A;  3DOK A;  1KLN A;  1G15 A;  3C95 A;  3RMA A;  1I39 A;  2Q3S A;  3VA3 A;  2D0C A;  4EZ6 A;  3TR8 A;  4CJQ A;  3NH0 A;  3K57 A;  5J2N A;  3HPO A;  3AA3 A;  5C25 A;  3PO4 A;  4R5P A;  2P5G A;  1IKV A;  3QEW A;  2QKB A;  2HHV A;  3NGZ A;  1IKX A;  1GOA A;  1T03 A;  1KTQ A;  4E7L A;  4E7I A;  4FW2 A;  3S3N A;  1T05 A;  2IAJ A;  4Y1C A;  1NOY A;  1X9W A;  3AVC A;  3M8P A;  4FK0 A;  3PO5 A;  1RT2 A;  4CF0 A;  2Y1J A;  4C8O A;  1LWF A;  1Z25 A;  4I9L A;  3L2Q A;  4FZX C;  1NK8 A;  3CM6 A;  1EXQ A;  3LDS A;  3SQ0 A;  3VA0 A;  1WSG A;  4ELV A;  4RW7 A;  2O4G A;  4GW6 A;  3ZSX A;  2WON A;  1S1V A;  2RN2 A;  1NK4 A;  3AA2 A;  3PX0 A;  4FJK A;  4CES A;  1DTT A;  3NCI A;  3SYZ A;  3TAM A;  4KI4 A;  4QAG A;  1MSZ A;  1U48 A;  1RT3 A;  4HTU A;  3V1Q A;  5EU7 A;  3DRR A;  4IFY A;  4O5B A;  3SPY A;  1L3V A;  2HHW A;  5DMR A;  4YNQ A;  2B6A A;  3TAB A;  2VWJ A;  3WNF A;  1F21 A;  1U04 A;  3ZSZ A;  2LSN A;  1SL0 A;  3ZT3 A;  4FJ7 A;  4CGG A;  3QEI A;  3RMD A;  1QQC A;  1IKW A;  3DRP A;  5CY4 A;  3L8B A;  4F4K A;  4I7F A;  3SNN A;  3AO3 A;  4FXD A;  3OJS A;  4DTX A;  3LAM A;  1J9A A;  3KLF A;  3V9S A;  4E89 A;  1KSP A;  1JLF A;  3K5M A;  5JS1 A;  3V9X A;  3SPZ A;  4AHR A;  4DLG A;  1VSD A;  2IC3 A;  1NKB A;  2WOM A;  1JLE A;  2HNZ A;  3DLK A;  4KHU A;  1EX4 A;  4DFJ A;  3SCX A;  1ASW A;  1ZBL A;  5KGW A;  4M42 A;  2HND A;  1QE1 A;  1TK5 A;  1IO2 A;  2A1S A;  3ZT1 A;  4JLH A;  4B08 A;  3QET A;  3I0R A;  4CHO A;  3SQ1 A;  2OPP A;  1L3T A;  3ULD A;  3RWU A;  1BCO A;  4LD0 A;  2G8U A;  3V4I A;  3SV3 A;  1Z26 A;  1C1C A;  2HHQ A;  4ZTF A;  1ZBI A;  2EX3 A;  3TI0 A;  4KO0 A;  4RW9 A;  2B4J A;  4N47 A;  1CXU A;  1HPZ A;  2A1R A;  1EKE A;  3FFI A;  5KGX A;  4Q5V A;  3KK1 A;  1WSF A;  2YV0 X;  3TAF A;  4H4M A;  2YKN A;  3PV8 A;  4GVM A;  4DFK A;  1LV5 A;  4DSL A;  4J2E A;  3MEE A;  1WSJ A;  1HQU A;  2BE2 A;  4CK2 A;  4CK3 A;  4CE9 A;  4IKF A;  1RBT A;  3OYB A;  4OKE A;  2ITG A;  4KI6 A;  3VQE A;  2QK9 A;  3S9H A;  4WE1 A;  4AHU A;  1ZYQ A;  4M3U A;  4F3O A;  3VQA A;  3NFA A;  1R0A A;  3V1R A;  4B3O A;  4BDZ A;  1SKR A;  2X78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...