2A1SA

Crystal structure of native parn nuclease domain
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
430
structure length
391
Chain Sequence
MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A)-specific ribonuclease PARN
publication title Structural insight into poly(A) binding and catalytic mechanism of human PARN
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 112
structure length 391
sequence length 430
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2a1sA01
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 2a1sA02
1S1UA 1TKZA 4C8LA 4FJLA 1Q9YA 1KFSA 1ZBHA 3ISNC 5C24A 4CIFA 1HYVA 4N5SA 2GV9A 4YNQA 1FK9A 4KAZA 1IKVA 3OYNA 3MEEA 3OYEA 4IG3A 3TAEA 2HHSA 2X74A 3CFOA 2HHWA 1IO2A 3QEXA 4KB1A 1RBUA 1SUQA 1HNVA 3AO2A 4OGEA 3O3FA 2BE2A 4DTSA 3TABA 4FJGA 2D0CA 4N41A 1RT2A 4PUOA 3KIOA 1RBSA 1NK5A 1B9FA 5C25A 4PY5A 4FJXA 3L2VA 4CFAA 1FKOA 1JXEA 3SQ4A 4DQIA 1BHLA 1EX4A 4FZYA 1A5XA 3V9XA 3S3NA 3RR8A 3S3MA 4ELUA 4L8RB 2KZZA 2YNHA 5K14A 4GW6A 1L3TA 4KHUA 5KRSA 1ZBLA 3QEWA 2P1JA 3V9SA 2ETJA 3QIOA 1CXQA 2PZSA 4M3YA 3SZ2A 3LPTA 1N6QA 1R0AA 2P5GA 4M3RA 4OPKA 4BE0A 3VQAA 3SQ1A 3UIQA 3LALA 4FJNA 3QETA 3KD5E 3I0RA 3QNOA 1BI4B 1Y97A 4JLHA 3PY8A 4CHQA 4M3UA 1WLJA 4B9UA 1WSFA 4CFDA 1DTTA 3AA3A 3KLIA 3CQ8A 4FJ7A 2HB5A 4Q5VA 4LH4A 1NK4A 4FJMA 1RNHA 3V1RA 1W0HA 3KLGA 3TAFA 3KD1E 4HUEA 4JRQA 4KV8A 3SV4A 1SL0A 1TL3A 2RKIA 3L2UA 4DU1A 3ULDA 3QEPA 1RTDA 4CEEA 2O4GA 4FJIA 1VSMA 1XHZA 4IG0A 2Z1GA 1VSLA 1K6YA 4KRFA 1NK6A 4NCAA 4FM2A 3SPYA 4O55A 3L8BA 3SUPA 4PQUA 4DSFA 1XHXA 4J2DA 1BI4A 3QIPA 4LD0A 2B4JA 4CERA 4CEQA 3RRHA 4CHOA 3MXIA 2GUIA 2X6NA 3AVJA 1KRPA 4HTUA 1YTAA 3T19A 3DI6A 5J1EA 4FJ8A 3AO1A 2KZMA 4DLGA 4DG1A 3EZ5A 1VSDA 1QSSA 1WSEA 4HVJA 1ZBFA 3OS0A 2YHAA 3K59A 1RDCA 4F2SA 2HHQA 2RF2A 3U6FA 1W9HA 3B6OA 2DTUA 3A2FA 2RPIA 1D9FA 2RN2A 3NBPA 3SUQA 2KQ2A 4N76A 5FRMA 2BGGA 3NF9A 4OKJA 4OPJA 1NKCA 4UQGA 3HL8A 2OA8A 5KGXA 4M3TA 1WN7A 4IFVA 4FLYA 3VQDA 1TAUA 1FXXA 3DLGA 3PUFA 4MQ3A 4I2PA 4FLVA 3HYFA 4DTRA 1RTIA 3EY1A 4I9LA 4CGIA 1L3SA 5J2PA 4LH5A 4FXDA 2HMIA 3L2RA 4OGCA 4FLWA 3OYMA 2QKBA 2E6MA 5J2MA 1BQMA 2DFHA 3CFPA 3TAPA 3ZSXA 4WE1A 4E89A 3V9UA 2ITGA 2Z1JA 3RMDA 4FW1A 3BGRA 4BWMA 2QKKA 4RW7A 4KO0A 3P1GA 3DLRA 4KHWA 3NF8A 1RCHA 2F96A 3K2PA 3ZSRA 4CJPA 3DOKA 4FW2A 3U3GA 4N56A 4B8CA 3I8DA 4BDZA 3TANA 2FBVA 4CJVA 4CHNA 3P83D 4RW6A 3TARA 3BDPA 3SJJA 3CM5A 3SQ0A 4E1MA 4B08A 4B9MA 3ZSYA 4Y1CA 3OYBA 1UOCA 2X6SA 4CK2A 1TKXA 1A5VA 1RT4A 1HMVA 3VQQA 4AILC 5KI6A 4LSNA 4CFBA 4M41A 4JRPA 4DF8A 1RDDA 3G0ZA 3VN5A 3L2QA 4FLZA 4DU3A 4DTXA 4DWIA 2YKNA 1VSKA 1S1WA 1I3AA 1RBRA 1S1TA 4FVMA 4E7KA 4FJHA 4FM1A 4H4MA 3QO9A 3OYLA 2XY5A 1JLFA 2YNFA 2YNIA 1D5AA 2IOCA 4CECA 1D9DA 2YV0X 2KFZA 3OYGA 5EU7A 4DSKA 3OYJA 2P5OA 3EYZA 3SUOA 4IDKA 4KI6A 4CJ3A 2PYJA 4E3SA 4BDPA 4FLXA 2F8SA 4CGJA 3AO3A 5JS2A 2IGIA 3ZSVA 3NFAA 4DMNA 2FBYA 1CZBA 4AHVA 1BGXT 3QLHA 4N47A 4M45A 3WNGA 1WAJA 5T7BA 2PYLA 2I5JA 4XIUA 4GVMA 3AVCA 1NKBA 1MSZA 1WNSA 1I39A 1RT3A 1UWBA 1KTQA 2XY7A 2ZQBA 3QINA 1LAWA 1VSFA 1WSGA 2ZE2A 3B6PA 4RW4A 1ASUA 3V1QA 3LWMA 3AVMA 3DOLA 1Q9XA 1IKWA 1HNIA 1C0TA 3THVA 1WHRA 2KTQA 4KKOA 3PO4A 2HNZA 3ALYA 3CM6A 3VQPA 1NJXA 1JLAA 3ZT1A 4QCLA 4ICLA 4CJTA 2XO7A 1IKXA 1C6VA 1LWEA 1TV6A 4F3TA 4EP4A 4CK3A 1S9EA 4B9TA 3OVNA 3AVKA 4KTWA 2HHXA 1RBVA 3OYHA 3TWHA 1TKTA 5HBMA 1T05A 4W5TA 4KHNA 4LSLA 1S5JA 2P51A 4DFKA 1BCOA 2E4LA 4Z4CA 4FYDA 4E7LA 3S3OA 1GOAA 3CG7A 4AHSA 3PO5A 3SI6A 4AHCA 2OPPA 3LP0A 2OPRA 3ZSWA 4F3OA 2KFNA 2NUBA 3OS1A 3HK2A 3V6DA 1BISA 4CJRA 4FCYA 4DTJA 3KJVA 4C8MA 2FC0A 1JLCA 1GOCA 3F9KA 1SL1A 4M3XA 4FK0A 3OS2A 3TAGA 3M8SA 1YVUA 3LWLA 4DTMA 1KLMA 1RDAA 2JGUA 3MECA 3SYZA 1TVRA 4HHTA 1YTUA 1SV5A 3RMAA 1N5YA 4TSXA 2G8VA 1J9AA 1QSYA 5KTQA 4E0DA 4BE1A 4ZTJA 4K8ZA 4KFBA 3AA4A 4CJKA 4J2EA 4HCCA 4W5NA 4IKFA 1GOBA 2DY4A 5J2NA 3LANA 4ID5A 3FFIA 1WAFA 4ZTFA 1B9DA 4DFJA 3K5MA 5SZTA 1JL1A 3AVLA 4DLEA 3IAYA 1J53A 1CXUA 1X1PA 4FM0A 1HYSA 4BDYA 2Y1IA 4ID1A 4DSJA 3AVNA 4CHZA 1RT7A 1REVA 2LSNA 4CHYA 3NGZA 2IC3A 3VA3A 4KHSA 3NDKA 1DLOA 3NF6A 1BCMA 3HJFA 3T1AA 4DSLA 4FZXC 1UA0A 1QQCA 1KVBA 3NGYA 4CGHA 1CLQA 3NH1A 4HUFA 2DFEA 3M8RA 3PX6A 1RTHA 2HVIA 2VG7A 3CYMA 4CIEA 4DSIA 3C94A 4KREA 2R7YA 1TK0A 3VQ7A 1Z25A 1C1BA 3VQEA 3NGIA 3ZT2A 2VG5A 4O44A 3RMCA 4FZZA 3WNFA 3LDSA 3NE6A 1KLNA 4QOZB 4KTQA 4CEBA 3NCIA 3KKRA 1NOYA 3TAMA 1U45A 1RT1A 3OYKA 1QSLA 3IG1A 2YKMA 2XRIA 2WONA 3DMJA 3O4QA 4KPYA 4M3ZA 2G8WA 4RG8A 3KK3A 3VQ9A 4FJ9A 4IFYA 3DRRA 1YT3A 5CZ1A 4NCGA 3O3GA 4B9VA 1KSPA 4B9SA 4DQPA 4B9LA 4OLBA 5I42A 3SNNA 2HHUA 3DRSA 3HPGA 1QS4A 1TGOA 1L3VA 4KHQA 4Z4IA 3OYDA 5E41A 3QERA 3DYAA 5FROA 4E7IA 3C95A 4BWJA 3RTVA 5D3GA 1QHTA 4CHPA 4W5OA 3TI0A 3VQ5A 4CJUA 2XY6A 4DU4A 4CGDA 2W42A 3HM9A 4FJKA 3NF7A 4O0IA 4RW8A 5KGWA 2BDPA 4CESA 3ITHA 4W5RA 1KFDA 1XWLA 3LAKA 4KI4A 4JS5A 4M3WA 1KCFA 3VQBA 4E7HA 2PY5A 1JLQA 5HLFA 3PX0A 3NH2A 2OYQA 4ELTA 4DSEA 1EETA 1RDBA 4CEOA 3ZSZA 2YNGA 4F8RA 2VWKA 2D0BA 1L5UA 3HP9A 4DS4A 1U48A 2FBXA 5DMRA 5CY4A 2ZD1A 4CJEA 2YHBA 3PX4A 1C1AA 2E6LA 2HHTA 4J2BA 4PWDA 4Z4EA 4CF2A 1TAQA 3AVAA 1CZ9A 5HRRA 3ZSQA 3VQ4A 2ATQA 4AHUA 5HP1A 3OYCA 3NAEA 4CJ5A 3DRPA 1JLGA 4CEDA 3K58A 2XHBA 4F4KA 5JS1A 2IS3A 3MXMA 2HNDA 1XC9A 3AVBA 3MAQA 3MXJA 2G8FA 1JXBA 4ZHRA 3ZCMA 1VSJA 3JYTA 3RMBA 3S9HA 4C8OA 3M8QA 4KTZA 5CYMA 2CPMA 4KB0A 2EHGA 3ZT4A 3L2WA 3RRGA 1U04A 3AVGA 1SKRA 5I3UA 4EZ6A 2B5JA 3V81A 1DTQA 3HPOA 2KW4A 1NJWA 4K8XA 3RWUA 3GKUA 3SPZA 3V1OA 4CJSA 2OZSA 1T7PA 2LRRA 2HW3A 4B3OA 1NK8A 2HVHA 1O1WA 3QESA 3KTQA 3LP3A 4RW9A 1RTJA 3MEGA 5FRNA 5FDLA 5KRTA 2GBZA 1S6QA 4CIGA 4FLUA 3L3UA 4DTUA 4CJQA 4FK2A 4Z4GA 4QAGA 1SKWA 3KK1A 4OLAA 1FKPA 4AHRA 3PV8A 3K5LA 5HROA 4J2AA 4HCBA 1UG8A 1RBTA 3V9ZA 3T3FA 1TK8A 1U47A 1HPZA 3OJUA 1NK0A 4CK1A 4FLTA 1RT5A 1S1XA 2HNYA 2VWJA 4B9NA 3JSMA 4CJWA 2F8TA 2A1RA 3HXMA 1XI1A 1ASVA 1BL3A 1HQUA 1LW2A 2D5RA 3IRXA 3OYAA 3DLHA 1S9GA 4E7JA 1HRHA 3G10A 3ASMA 3AO5A 3D0PA 1BQNA 1IH7A 2VG6A 4I7FA 4C8NA 5HRNA 2OPQA 2OZMA 3AVHA 3SUNA 1BIUA 1T03A 4DQSA 3CFRA 1G15A 4CJLA 3LPUA 3KLFA 4GMJB 3LZJA 3L3VA 1NK7A 2AJQA 3AO4A 3HT3A 1B92A 1JKHA 4CGFA 1LWFA 1J54A 2DFFA 5SWMA 4ELVA 4HUGA 3SV3A 1F21A 1ZYQA 1T8EA 1C1CA 2QK9A 1JL2A 3TAQA 2O4IA 4G1QA 3WNHA 3E01A 3I0SA 4DTOA 1LAVA 1SL2A 4JS4A 1HQEA 4Z0UA 3WNEA 1WSJA 1ZBIA 3HO1A 4O0JA 3O3HA 3AA2A 3P5JA 4I9QA 3KK2A 2XY8A 1EXQA 3OY9A 4DFPA 1KVAA 3LZIA 4OJRA 4OKEA 4DQRA 2G8HA 4Y1DA 3RR7A 3C6UA 1S6PA 1JLBA 2Q3SA 4E1NA 5HRSA 3AA5X 3NH0A 1Q8IA 4CJ4A 4DS5A 2IAJA 1HJRA 1QE1A 3SCXA 3VA0A 4IBNA 4OKKA 1J5OA 5CYQA 3KLEA 3QEVA 1NK9A 1UAXA 2G8IA 1L3UA 1U49A 3AVIA 1IG9A 4CJFA 1NJYA 2EX3A 4DF4A 4CGGA 2Y1JA 1ASWA 3QNNA 1UA1A 1NOZA 4Q0BA 3K5OA 2B6AA 3V9WA 5HRPA 4DQQA 1VSIA 2G8KA 3D45A 3MEDA 4W5QA 4DFMA 3QEIA 1X9SA 4BACA 1A5WA 3AVFA 4NYFA 2Z1IA 3DM2A 5CZ2A 1X9WA 4Z4FA 4H8KA 1U4BA 5C42A 3U3YA 1ZBUA 2QXFA 4DTNA 4C8KA 4F2RA 4CF9A 3KKSA 4FK4A 1LV5A 1C0MA 3K5NA 2G8UA 1HYZA 1Z26A 2X78A 4BE2A 1KVCA 2WOMA 1EKEA 4CF1A 1LWCA 1TKDA 1BIZA 4AHTA 3LAMA 1NKEA 4DTPA 3SQ2A 1SKSA 2IDOA 1RT6A 3AV9A 4B8AB 1TK5A 4CCHA 3KLHA 4LY7A 4CEZA 2OPSA 3VQ8A 3OJSA 3HP6A 4I2QA 3K57A 4O5BA 1VRUA 1S1VA 3ZT0A 3DLBA 4O4GA 3ZT3A 4R5PA 1EP4A 3DLEA 4CE9A 2JLEA 1IKYA 3ZSOA 3NHGA 3H08A 1QTMA 4KHYA 2Z1HA 1VSHA 2FBTA 5J2QA 4CF8A 3M8PA 3DLKA 3HSTB 3F73A 1RILA 3VQCA 1X9MA 5DK5A 3OYIA 4Z4HA 2BANA 1VK0A 1LW0A 3IS9A 4H4OA 4MFBA 4CF0A 4AH9A 2A1SA 1C0UA 3HPHA 1TL1A 3HVRA 1NJZA 4EZ9A 3C6TA 4M42A 2D0AA 1WSIA 3VQ6A 4FJ5A 4CEFA 4EP5A 4NYNA 4NCBA 3HVTA 1D8YA 4YFUA 3TR8A 3O4NA 3LP2A 4CEAA 4FJJA 2HHVA 3LP1A 1MU2A 1VSEA 1WSHA 4OVLA 1VRTA 4CFCA 4E19A 1ITGA 1JLEA 3OYFA 3V4IA 4PA1A
chains in the Genus database with same CATH superfamily
1TKZA 4A5BA 2ZJRL 4NXMH 2UUBK 3ISNC 1HYVA 2GV9A 3OYNA 5JLHA 4B9QA 3MEEA 1K73O 3TAEA 2HHSA 3CFOA 2HHWA 3EZJA 1RBUA 5AQXA 1NGFA 1HNVA 3AO2A 3IUCA 4I6MB 4OGEA 3CCSN 2YX6A 2W41A 3KIOA 1NK5A 2A3ZA 5C25A 2HHHH 1FKOA 4H5TA 4DQIA 3LDQA 1HNZH 4L8RB 4YHHH 5K14A 1ATNA 4GW6A 1NWKA 4LFAH 3QEWA 3V9SA 4DV4H 5A2QW 1N6QA 2P5GA 2VQEH 4OPKA 4BE0A 3WXLA 3U4LA 3QETA 4JI0K 3KD5E 3TTCA 1Q86O 1Y97A 5M1FA 1WLJA 3AA3A 3KLIA 2HB5A 1RNHA 3TAFA 4HUEA 1SZ2A 3DWLA 1M90O 4FWLA 3LDLA 1KXPA 2WTUA 1VSLA 1EQYA 4FM2A 4JKBA 3SUPA 4WCEL 1XHXA 4DV3H 4CERA 4CEQA 4HTUA 1YTAA 1V4SA 3WXJA 4BG8A 4DLGA 3IMXA 1MDUB 1ZBFA 2HMPA 4F2SA 2RF2A 1W9HA 3B6OA 3CIPA 2DTUA 4KRFA 4LFBK 4BROA 4UQGA 5KGXA 4FLYA 2HBLA 3VQDA 2QWPA 3DLGA 2JWLA 3G71N 4I2PA 3EY1A 4I9LA 2HMIA 3EKSA 4NB4A 2V51B 2QKBA 2E6MA 5AQZA 3TAPA 3IFRA 3DXMA 3ZSXA 3FZKA 3RMDA 3B8AX 2PY9A 4FPBA 4N56A 4LF5K 4CHNA 2F4VH 4MO5A 4XH4A 2VGMA 5AQUA 3QBXA 4E1MA 4B9MA 3AY9A 4CK2A 1EWQA 1A5VA 1RT4A 1RDWX 4E1JA 4AILC 4DF8A 4CFBA 2UYTA 5I42A 2HHQA 2Y3MA 3A5LC 4DV6K 2YKNA 1VSKA 1S1TA 4FM1A 3OYLA 4CECA 2IOCA 2YV0X 3WEEB 5LMNK 4JAXA 3OYJA 3E9OA 1WE8A 1QVFM 4BR5A 4BDPA 4X66K 2OTLN 4YY3K 4DMNA 2LTMA 5C0YA 4JI8H 1NGGA 3M3ZA 1U6ZA 3QLHA 3TPQA 1W97L 1WAJA 2A5XA 2I5JA 4XIUA 4GVMA 4OX9H 1NKBA 1I39A 1UWBA 4QS7A 3QINA 1LAWA 1WSGA 3B6PA 4B3RK 2V7YA 4BVOA 3THVA 3KHYA 1WHRA 3PO4A 1FJGK 3ALYA 1NJXA 1JLAA 4JN4A 1U2VB 4F3TA 4X65H 3OVNA 2GWKA 1YXQA 4KTWA 2HHXA 5HBMA 1X3NA 2EWSA 4LSLA 4B1VA 1S5JA 1BCOA 4Z4CA 4GKKH 1VQPN 1M1KO 4E7LA 1YJ9N 2V7ZA 4KH5A 4F3OA 2NUBA 3OW2M 5AQHA 4CJRA 4BRCA 4C8MA 1BU6O 4BREA 2UXBH 1YVUA 4DTMA 1OVYA 2ASMA 3RMAA 2YQRA 1J9AA 5KTQA 4H0XB 4E0DA 4CJKA 5J2NA 4DR5K 3MN5A 3K5MA 1JL1A 3AVLA 4WQ5C 1X3MA 3PLAA 1SAZA 3CJBA 4DSJA 3CERA 1RT7A 4H0VB 4ILHA 2P9LA 1HKGA 3KVGA 5JICA 3NGZA 3VA3A 2O8CB 3QD7X 2NRZA 2VGNA 2NRHA 4BR2A 5DT9A 4FZXC 4JI5K 1CLQA 1N32K 5AQNA 2FMRA 3VTIA 1E4GT 3FE1A 2DFEA 3M8RA 1RTHA 4JKFA 4DSIA 5M1PA 2O8BA 3KDKA 5M1OA 2VG5A 3WNFA 3LDSA 4QOZB 3NCIA 4H5RA 1K9MO 1QSLA 3EE8A 1EO1A 1T6CA 4FVUA 2G8WA 4OPHA 2WC9A 1IBMK 4FJ9A 4IFYA 1YT3A 4CW7B 1VQ7N 3J7ZO 4B9LA 4OLBA 3SNNA 2HHUA 3HPGA 1QS4A 4FOIA 5E41A 5FROA 3A5MC 4IFDG 1QHTA 2BTFA 3F2KA 4GNIA 4QMFB 2A40A 3T1HK 1J5KA 4PKGA 3H6EA 4WF9L 2BDPA 2Q31A 3VEZA 3LAKA 3UOEA 4E7HA 2O8FA 1JLQA 3NH2A 4BRGA 4DSEA 3VOVA 4F8RA 2D0BA 3FR0A 5CY4A 2ZD1A 4DR1K 2YHBA 3PX4A 3CMEN 2P9IB 4J2BA 2ZQEA 4CF2A 2NRVA 1TAQA 1CZ9A 3ZSQA 3VQ4A 4B3SH 4BG9A 2E20A 3OYCA 1XNQH 3NAEA 3VF4A 3DRPA 3DAWA 4CEDA 3I0PA 2NRTA 2IS3A 3MXMA 1VQ9N 1P90A 1YUWA 3MAQA 4NZTM 3CD6N 2ZGZA 3ZCMA 2CPMA 3ZT4A 1VQ6N 3RRGA 1BOTO 3TTDA 4H8AA 4NXNK 5BPNA 4IFEA 3U9DA 3TU5A 1QQMA 1NBWA 1ZC6A 3SMSA 2LF0A 2LRRA 4KHPK 4B3OA 2HVHA 2YJFA 3VTHA 3O9QA 4DKWA 3O80A 5FRNA 1N34H 1S6QA 1DTJA 3BF1A 3MWTA 2QM1A 4CJQA 2BL5A 4Z4GA 4QAGA 1SKWA 4EHTA 1UG8A 4HCBA 3T3FA 3THYA 3CJCA 5FPNA 2ZM6K 4FLTA 2HNYA 3JSMA 4BRAA 4CJWA 2F8TA 2A1RA 3HXMA 1XI1A 3WQTA 1LW2A 3IRXA 3J7AK 1S9GA 1HRHA 1BQNA 4YOYA 2OPQA 2OZMA 4OCHA 4B1ZA 2OANA 4A62A 2G8YA 1T03A 3CFRA 3LZJA 3KLFA 4FWKA 2AJQA 2O8EB 3HT3A 2M6QA 2QA4N 4CGFA 3J81W 1IBLK 5GAHP 1ZYQA 4JV5H 3OTOH 1T8EA 2QK9A 1JL2A 2QNDA 4G1QA 3E01A 3UKUB 3THXB 1SL2A 4DR4K 2JA9A 1VQLN 5AQOA 2I7PA 1EC6A 3WNEA 2E1YA 4I9QA 2XY8A 4OKEA 3RR7A 4JI2H 4JNEA 3C6UA 4H5NA 4B8CD 5HRSA 3NH0A 1XMQH 1NGEA 3LDOA 1QE1A 3BEXA 5FPEA 4OKKA 1IBKK 1L3UA 3AVIA 5M1QA 1HNXK 4CGGA 1ASWA 5M1KA 3QNNA 1NOZA 1UA1A 3K5OA 2B6AA 3UKRB 3CC2N 2NN6G 1VSIA 4M7YA 3SJHA 2G8KA 3MEDA 3HTVA 5CZ2A 4B1YB 3GDQA 1P8ZA 1U4BA 3U3YA 1ZBUA 1I94H 3KKSA 4CZJA 1C0MA 1HYZA 1Z26A 2X78A 2UXCH 4G08A 4CF1A 1RGIA 3MCAB 3RF2A 4MLHA 4BRDA 1NKEA 4JI7K 3Q7CA 4JK7A 3AV9A 4B8AB 3KLHA 3VQ8A 3L4IA 3J8AA 4O4GA 2OCEA 3ZT3A 3AGRA 5BPLA 3H08A 1VSHA 5AZJB 5CHIA 3F73A 3EE9A 2DPNA 5DK5A 4Z4HA 3DXKB 3IS9A 3MCPA 4EZ9A 2WUSA 4CBWA 1WSIA 3G25A 4FJ5A 4NYNA 4NCBA 5AQGA 2P9PA 3LP2A 4C23A 3C7NB 1MU2A 1VSEA 1VRTA 4CFCA 4E19A 3V69A 3OYFA 1X9WA 3R3LA 5KQDA 5EX5A 3NVKA 1XQSC 2VQFH 2YHYA 4KAZA 1FK9A 1HLUA 1IKVA 3O8MA 4IG3A 2X74A 3WEEA 2D0PA 3QEXA 5IT9W 3L7ZC 4X62K 1Q7YO 3FZMA 4DV5H 3O3FA 4N41A 1ZTGA 4LC9B 4PDBA 2GWJA 1B9FA 4FL9A 4QS8A 1N8RO 4BRKA 2W6LA 5I9EB 1HR0K 4UY8O 1EX4A 4FZYA 1DKGD 5BN9A 4ELUA 2YNHA 2P1JA 3U1KA 3QICA 3SZ2A 2CH5A 3LPTA 4JKCA 3CPWM 1R0AA 5BR9A 4M3RA 3ZEUB 4FO0A 5JVHL 3KDGA 3H1QA 3P39A 3FZFA 1YJNN 4X64H 4JI1K 1BI4B 3O9UA 5H1SQ 4CFDA 4LH4A 2CTKA 1WBDA 3KLGA 3KD1E 1TL3A 2RKIA 3C6HA 3VENA 2E5LH 4DV2H 3ZYYX 3QEPA 1XUPO 4CEEA 4CZKA 4FJIA 1NJIO 4IG0A 4PHTX 1NK6A 3SPYA 4O55A 4PQUA 4J2DA 3MDQA 3BF3A 2OTJN 3QIPA 2B4JA 1KRPA 4FJ8A 2FPHX 2KZMA 4ISFA 5J1EA 3EN9A 3AO1A 4DG1A 3C0BA 3EZ5A 3GOIA 1QSSA 4DR3H 3K9JA 4DV0H 4NO7A 3U6FA 2PBDA 1D9FA 2RN2A 2BGGA 4A61A 2KQ2A 3SUQA 5FRMA 4DUYK 3HL8A 4IFVA 4IEEA 1TAUA 4MQ3A 4FLVA 4DTRA 3HM8A 4CGIA 1L3SA 4DR2H 5LJVA 2VCPA 4DV1K 3OYMA 2NNWA 1BQMA 4LFCH 2J4RA 2Z1JA 3EZWA 3BGRA 4IOAL 4JKHA 4KHWA 3NF8A 3DLLL 4CJPA 2FBVA 3LDPA 1KAZA 4LF8K 4B08A 3OYBA 1UOCA 3OSSD 1HMVA 2QWNA 5KI6A 4JRPA 4M41A 3T1YH 3G0ZA 3R1XA 3VN5A 1ATRA 3L2QA 4DTXA 1VIHA 1S1WA 1VQMN 1I3AA 1RBRA 2YNFA 3O6WA 4DSKA 2ZJQL 2QEXN 3EYZA 2E2QA 3MK6A 2F9WA 2PYJA 5JEAG 2F8SA 2HHHK 3NCVA 3ENOA 3AO3A 1NXUA 4MDBA 2IGIA 3ZSVA 3MMVA 1HNZK 4AHVA 4N47A 1KQSM 3WNGA 4YHHK 2PYLA 2YHXA 1NGCA 1WNSA 1YITN 5EXWA 3VF2A 1KTQA 4DV4K 4IOXA 1HJOA 1VSFA 4BACA 2VQEK 4FWSA 3C6AA 1T3VA 1GLJO 3SB1A 3RSEB 2KHOA 5E26A 3CM6A 4HTLA 2XO7A 3SAGA 2UUCH 4DHYA 1IKXA 4WFBL 4EP4A 4CK3A 1S9EA 4KBOA 4B9TA 2UU9H 4EFHA 1T05A 3VF6A 4KHNA 5BR8K 4JI4H 2P51A 2P9IA 1KHMA 4AIMA 4B3MK 1NGHA 2OPPA 2KFNA 1K1GA 4DV3K 1BISA 4FCYA 1GLCG 4JI6K 1N36H 2P9NA 4LF6K 2FC0A 1GOCA 1SL1A 4M3XA 4FK0A 3TAGA 3ID6A 5F0XA 3MECA 5AZIA 4HHTA 1SV5A 1K8KA 4TSXA 2G8VA 1NGBA 5C10A 4BE1A 4O8KA 1GLEG 3AA4A 5C12A 4J2EA 4HCCA 1QZ6A 4BRHA 3LANA 3S41A 5DM6L 3FFIA 1WAFA 3D2FA 3KWIA 4WQ4C 4DFJA 3BZCA 4YOVA 3IAYA 4FM0A 3L0QA 1HYSA 4JK9A 2Y1IA 4ID1A 4DQ8A 1F0XA 1REVA 2LSNA 4A59A 4KHSA 3NF6A 3HJFA 2CTMA 3W0LA 4L3QA 2CTLA 3T1AA 1J6ZA 1QQCA 1KVBA 5JVGL 4Z94A 2CGKA 2QWLA 3PSFA 2HVIA 2VG7A 4JI3K 4CIEA 4KREA 3VQ7A 5HL7L 3RMCA 4FZZA 4O8UA 3KZBA 4KTQA 4CEBA 4FJUA 3KKRA 3M5RA 3TAMA 1VQ5N 1RT1A 3Q7BA 3IG1A 3DMJA 3O4QA 5F2RA 3KK3A 1VBIA 5CZ1A 3O3GA 2PAVA 3UKUA 3DRSA 3THXA 4Z4IA 3QERA 3DYAA 4BVPA 1OH7A 3CHWA 4AQYK 3TI0A 2Q36A 3IDHA 3SK3A 4IDHA 2W42A 3HM9A 4FJKA 5HOOA 4RW8A 5KGWA 4BGBA 2M8WA 4JS5A 4DR7K 3M6GA 2CWFA 2PY5A 2UXDK 4JD2B 3OBWA 3PX0A 2OYQA 1S3XA 4DR6H 2YNGA 2VWKA 1L5UA 1U48A 5DMRA 3CJ9A 1HKBA 4NLCA 5AQTA 4IZ9A 5AQKA 2E6LA 2HHTA 5K36G 1J5EK 4Z4EA 4JVYA 3AVAA 2ATQA 4M63C 4CJ5A 4F4KA 3VEXA 2HNDA 3MXJA 3I56N 2G8FA 3RMBA 3VEWA 1VSJA 2CH6A 4YDUC 3CQYA 5CYMA 4LF5H 1OH6A 2E1ZA 1TYQB 2B5JA 3THWB 4IEIA 1NJWA 3HPOA 4B1XB 3ZETA 4K8XA 3RWUA 5IWAH 2HW3A 1ZZJA 4CD1A 1O1WA 4JKGA 1GLLO 3LP3A 2GELA 4YDUA 4BR4A 4CIGA 4FLUA 4FK2A 2P9SB 1OH8A 4X66H 3N4QA 3KK1A 4OLAA 5HROA 1RBTA 1TK8A 1VAZA 2PQUA 4NBQA 4CBUA 2P9KB 4C1NI 5ADXA 3OBYA 4B3RH 3G10A 1K8AO 3AO5A 3D0PA 1IH7A 4C8NA 3I8BA 3WUHA 3AVHA 3FZHA 1FJGH 1GLDG 4CJLA 3L3VA 3CF5L 1WB9A 1J54A 4B3TK 3G6EN 5BREA 3E1YA 3LL3A 3WXIA 4KH6A 4DTOA 1XMOH 2AA4A 4WQ5A 2GEMA 5KPTA 2FFMA 4O0JA 3O3HA 3P5JA 4YOXA 1EXQA 4DFPA 1KVAA 4OJRA 3ENHA 4Y1DA 3SBTA 2NZTA 3R8EA 4E1NA 2Q3SA 1IG8A 4CJ4A 1HJRA 3SCXA 5BRHA 4IBNA 5CYQA 3HSCA 2HOEA 3KLEA 3QEVA 4MLEA 1IG9A 4CJFA 1NJYA 4MO4A 4DF4A 3O08A 2BA0A 3D2EB 4DR5H 5HRPA 4DQQA 2PFUA 3D45A 1HNWK 2D0OA 1X9SA 4B3SK 3AVFA 4Z4FA 2CPQA 4RTFD 3HZ6A 4C8KA 4E9JA 4F2RA 3QFPA 4FK4A 1LV5A 4B1WB 1LWCA 4AHTA 2I7NA 3LAMA 3BP8A 1SKSA 4JI5H 1N32H 2IDOA 1N33K 1Q81O 1TK5A 3MWPA 3HP6A 4U67L 2GX9A 4DV7K 4CE9A 1IKYA 1QTMA 3E9PA 3E66A 1Q82O 3DLKA 3HSTB 3VQCA 1LW0A 5ELZA 4AH9A 2A1SA 1TL1A 1NJZA 3C6TA 1IBMH 4OPAA 3CCJN 3AAQA 3GL1A 3VEVA 4YFUA 2HHVA 4FJJA 3LP1A 1LCUA 1TUAA 2JVZA 4BRFA 3H1VX 4O5FA 3V4IA 1O13A 1WOQA 2VYPA 3T1HH 4C8LA 3ZX2A 4FJLA 2RHKA 5C24A 4N5SA 2D4WA 4YNQA 4CZHA 2JWKA 4U7BA 1IO2A 5JMVA 5C0XG 2BE2A 3D6RA 4XH5A 3LM2A 2QWQA 1RT2A 4PUOA 1RBSA 3I55N 2AP1A 3E9LA 4PY5A 3L2VA 4CFAA 2Q97A 1JXEA 3SQ4A 1BHLA 4LF9H 3V9XA 3S3NA 3KWGA 3S3MA 2KZZA 4DR1H 1L3TA 1JCFA 4KHUA 3GG4A 4BC4A 2ZWHA 1LOTB 2PZSA 4GV3A 3CJAA 4M3YA 1HKCA 4B8TA 3SQ1A 4FJNA 3CJ7A 4I6MA 3ZX0A 3I0RA 1BDGA 3QNOA 3PY8A 5GADP 3DJCA 4M3UA 1WSFA 5AQIA 1JCEA 1VHXA 3M1FA 3CQ8A 4Q5VA 4FJ7A 4FJMA 1WBBA 5AQRA 4JRQA 4KV8A 3SV4A 1KC8O 4JHDB 4XEIA 3JS6A 3ULDA 4NXNH 3OETA 1OH5A 2O4GA 1SS6A 2Z1GA 3CETA 3VEYA 3U9ZA 3OA9A 3L8BA 1YF5L 4DSFA 4BRNA 2FSKA 4LD0A 3MXIA 3RRHA 4CHOA 2GUIA 2X6NA 1SEIA 2AXYA 2A42A 2UXCK 3DXMB 4RWTA 1VSDA 1WSEA 4HVJA 2E2NA 3K59A 1RDCA 2ZM6H 3JAMO 1S22A 4OKJA 4OPJA 1NKCA 3CCVN 1WN7A 3PUFA 5J2PA 2QWMA 3L2RA 4OGCA 1FW6A 4WE1A 4OO1G 2JZXA 4BWMA 2QKKA 4KO0A 4OD6A 1RCHA 2F96A 2Q2RA 3ZSRA 3I8DA 4BDZA 3TANA 4CJVA 3P83D 4RW6A 3TARA 3BDPA 3SJJA 3CM5A 3J7YP 4CD3A 3ZSYA 3D7EO 5GAEP 2X6SA 3RVCA 1TKXA 1GLBG 2VQFK 3VPZA 4LSNA 1RDDA 4FLZA 2GTDA 4DWIA 5GIPA 4FVMA 4E7KA 4FJHA 3GBTA 4H4MA 3QO9A 1MWMA 4DV5K 2XY5A 1JLFA 2YNIA 4WALA 4Y0WA 3C65A 2KFZA 3CCQN 5EU7A 5GAGP 5AFUH 4IDKA 4H5VA 4E3SA 4BC2A 3O9RA 4CGJA 5JS2A 1VQON 3NFAA 1HNXH 2FBYA 1CZBA 5ADXH 3FLCO 2RE2A 1MSZA 3T7ZA 3WT0A 1QQOA 4RW4A 4FJXA 3AVMA 3DOLA 1Q9XA 1IKWA 3HRGA 4FWRA 4F9OA 3ZT1A 4ICLA 4CJTA 1G99A 1LWEA 1TV6A 4DB3A 3AVKA 5FLXO 3OYHA 1EWRA 3TWHA 1BUPA 3WXKA 4W5TA 2JEAI 2UUAK 4DFKA 3SMPA 2E4LA 3P31A 1BG3A 3LDNA 4FYDA 1ZXOA 3SBGA 3S3OA 1D4XA 4BR7A 2NRXA 4QS9A 3CJ1A 4AHCA 3ZSWA 2OPRA 2FXUA 4CBXA 5MLCQ 3CQXA 3OS1A 3V6DA 3KJVA 1WTJA 4K0KK 1JLCA 3F9KA 1U2VA 3M8SA 3LWLA 3WQUA 2P9LB 2ANNA 4FJSA 1RDAA 2JGUA 4DR3K 1YTUA 2NRRA 1TYQA 4DV0K 4K8ZA 3VGLA 4KFBA 5AQVA 4W5NA 4IKFA 1NG9A 1GOBA 3BY5A 1XNRH 1ODHA 1QHAA 4ZTFA 1DEJA 3R9PA 4KH4A 5SZTA 4LF7K 4DR2K 2O8BB 1NGIA 3AVNA 2YHWA 4CHZA 4X62H 4AM6A 2P9SA 2F9TA 4FWPA 3O1WA 3NDKA 1MA9B 1DLOA 4JEPA 4JYAK 3O9TA 2D9IA 1HR0H 4CGHA 3P38A 2H3GX 3H45C 5BRDA 3C94A 3T1YK 3A8YA 2R7YA 3VQEA 4O44A 3NE6A 1PQXA 4JI1H 1Y64A 2P9UB 1NOYA 2O8CA 5LMUH 2XRIA 2WONA 4M3ZA 1NGDA 5KPRA 1V8CA 4DUZH 4NCGA 1KSPA 3TSPA 4B9SA 4DQPA 2E3UA 4KHQA 1E3MA 3OYDA 3QBWA 4JKDA 3OHRA 5D3GA 4CHPA 5TKYA 2YCHA 3VQ5A 1DT4A 4RCHA 4NXMK 5AQSA 3O1BA 4CGDA 3NF7A 3T69A 2LTLA 4O0IA 1S72N 1W2BM 4LF4H 2V52B 2IVNA 4KI4A 4M3WA 3R6MA 3VQBA 4GKJH 5AQYA 2FSJA 5HLFA 4ELTA 3A0IX 4PKHA 1ILYA 2ASOA 3HP9A 2FBXA 4DUYH 1FKAH 2QXLA 1X9ZA 4CJEA 4LFAK 4PWDA 4AHUA 1TUYA 3SAHA 4G9ZA 3ENBA 4DV1H 4LIJA 4EHUA 3O4WA 3HBTA 3ZLJA 3GABA 4ZHRA 3JYTA 1VQKN 2PT7G 2CTJA 4H0PA 4K41A 2KLAA 4CI6A 3N4PA 4KB0A 2EHGA 1KAXA 3ID8A 1SKRA 5I3UA 3L4QA 5FPDA 4LF8H 5EY4A 3PIOL 4CZIA 4K43A 2OZSA 1T7PA 4C1NK 4GY2B 2W40A 5LJWA 4FWMA 2QTDA 3QESA 4RW9A 3MEGA 5FDLA 5KRTA 2GBZA 4BGAA 2ZJPL 3L3UA 4DTUA 3CCMN 1FKPA 4AHRA 3K5LA 4J2AA 3V9ZA 2ASPA 2HF3A 1U47A 1NK0A 4CK1A 3NMUA 1RT5A 5C2DA 2VWJA 4A2BA 4YORA 4WFAL 2HSTA 1BL3A 2D5RA 3OYAA 2UUBH 4E7JA 3EL2A 3ASMA 2NRWA 3F9MA 1TUUA 2OPVA 3VERA 3LPUA 2DGRA 4YOWA 3AGKA 4EC5A 1B92A 2DFFA 2NLXA 5BRFA 4HUGA 2HBKA 1F21A 4BRPA 4CJ7A 3TSUA 3HOTA 1C1CA 5BR8H 3TAQA 3WNHA 2F4VK 4WQ4A 1YHQN 4B3MH 5DM7L 4JS4A 4A5AA 3F5TA 1HQEA 3HO1A 2IVPA 2O8DB 3KK2A 4DQRA 4JI6H 3J80W 4JI0H 4LF6H 1BO5O 2O8EA 1JLBA 3H3NO 4DS5A 1HPMA 1UAXA 2G8IA 4DR6K 4JHDA 2JE6I 4DCHA 5BN8A 4JI8K 4Q0BA 1X4NA 4IWVA 4OX9K 1YI2N 4ILJA 4W5QA 4DFMA 3QEIA 3VESA 4GVEA 3DM2A 4FWNA 5C42A 5JLFA 5AQLA 1C0GA 4CF9A 2IVOA 3K5NA 2G8UA 4BE2A 2FF3B 4EAHD 2WOMA 3ULEB 4X65K 1BIZA 3G4SN 3SQ2A 5AQPA 3NVMA 2P9PB 1RT6A 3UKRA 5FPMA 4LFBH 4CEZA 2OPSA 4I2QA 4JI3H 1VRUA 1S1VA 5IWAK 3ZT0A 3DLBA 4GKKK 2ZF5O 1EP4A 2JLEA 3NHGA 3O9SA 3P4IA 4KHYA 2Z1HA 2FBTA 4CF8A 3M8PA 5AR0A 5CE3A 4BC5A 3OYIA 2UXBK 2BANA 4B9VA 1VQNN 4CF0A 5LL6b 1BA0A 2FF6A 3ATVA 2D0AA 4AM7A 4EP5A 3HVTA 3J7AP 3SLCA 3TR8A 3O4NA 4B1UB 4OVLA 1WSHA 4FOEA 1JLEA 4BY9C 4AQYH 1S1UA 4BQLA 1Q9YA 1KFSA 1ZBHA 5A2QO 4CIFA 5AZJA 4DV6H 2X06A 1NMDA 3OYEA 4KB1A 3DXKA 3QMLA 1SUQA 2ANRA 4DTSA 3TABA 4FJGA 5LMNH 2D0CA 4DR7H 2UXDH 3SAFA 1OVQA 5C2FA 1DGKN 4BR9A 4YY3H 3C7NA 2HH2A 5AFUA 1A5XA 4CZMA 1XMOK 3RR8A 5KQ8A 2VKCA 1HUXA 5KRSA 1ZBLA 1WVNA 2YI1A 1J5EH 2ETJA 2HBMA 3QIOA 1CXQA 2QW9A 3VQAA 3UIQA 3LALA 2WBNA 3J80O 1JCGA 3JXUA 5B8HA 4JLHA 4CHQA 4B9UA 3CC4N 1DTTA 4CZFA 2A6AA 1NK4A 2E8AA 2Q0RA 1OKJA 2BH1A 5AQWA 3TTFA 1W0HA 3V1RA 1SL0A 3L2UA 4DU1A 1C0FA 1RTDA 3HI0A 4EIAA 1V9NA 1VSMA 1XHZA 3ZEUA 1K6YA 4NCAA 1BI4A 4A57A 4M42A 2OPUA 3AVJA 4GV6A 1Z6RA 3T19A 3DI6A 3ZX3A 4BQZA 4BC3A 3UB5A 4NZRM 3A5NC 3OS0A 2YHAA 2IIRA 3A2FA 2RPIA 4IOCL 3NBPA 3QFUA 4N76A 1V4TA 1JJ2M 3NF9A 3CXCM 2OA8A 4M3TA 1FXXA 3MN6A 3HYFA 1RTIA 1XNQK 1NM1A 4MDAA 4LH5A 4K42A 4BRQA 4FLWA 4NLBA 5J2MA 2DFHA 3CFPA 3V9UA 4E89A 1S20A 4B3TH 2ITGA 3W3DA 4FW1A 4RW7A 4BR0A 3P1GA 3DLRA 3K2PA 3DOKA 4FW2A 3U3GA 4B8CA 3JAMW 3FGUA 3ATUA 3SQ0A 1X9JA 2VWBA 4JKEA 1RDUA 4Y1CA 3AARA 2A41A 2P2RA 3VQQA 2QWRA 4IO8A 3PSIA 4DU3A 1IV0A 2P9UA 1D5AA 4HWIA 1N34K 1D9DA 4WFNL 3OYGA 2P5OA 4FSVA 3SUOA 5LY3A 4KI6A 4CJ3A 3K9KA 4FLXA 3BZKA 1YVNA 4LF9K 1BGXT 4M45A 5T7BA 4WYBA 3AVCA 4H5WA 1NGAA 1HNWH 1NLVA 1RT3A 3H3OB 3KK7A 2XY7A 2ZQBA 3V1QA 2ZE2A 3CCRN 1ASUA 3LWMA 1YAGA 1HNIA 1C0TA 3FZLA 2KTQA 4KKOA 2HNZA 1Z2IA 3VQPA 4QCLA 2P9NB 1C6VA 5F1XA 1Z05A 5AZIB 1YIJN 4JV5K 1RBVA 1TKTA 3MN7A 3OTOK 1N33H 1K8KB 2D1KA 2E2OA 3CI5A 2MJHA 4DV7H 1GOAA 3CG7A 3D2FB 3VMFB 4AHSA 3RSEA 4PL7A 3SI6A 4PKIA 3PO5A 3LP0A 5GIOA 3HK2A 4JI2K 4DTJA 2Q1NA 3OS2A 2HBJA 1XMQK 3IKMA 1KLMA 3SYZA 1SQKA 3AAPA 1TVRA 3MX2A 5FLXW 5AQFA 1N5YA 3PIPL 1QSYA 4ZTJA 4FWOA 3VETA 3U8XA 2DY4A 4ID5A 1B9DA 1YJWN 5AJ3K 4DLEA 4KHPH 1J53A 5CR4A 1CXUA 1X1PA 1T6DA 4BDYA 1Q18A 4CHYA 4H0YB 1I94K 2IC3A 3CCEN 1BCMA 1T44A 2CTEA 4BRMA 3UE5A 4DSLA 1I6UA 1UA0A 2F7TA 4BRIA 3NGYA 4J8FA 2CWHA 3EKUA 3NH1A 4HUFA 1GLAG 4JVHA 4R79A 3PX6A 3CYMA 3VEOA 1KAYA 1TK0A 1Z25A 1C1BA 3NGIA 3ZT2A 1KLNA 3GE1A 4V19S 2BUPA 1ZBSA 1U45A 3OYKA 2YKMA 4KPYA 4ISGA 4RG8A 3VQ9A 4CZLA 1IBLH 3DRRA 1L3VA 3HOSA 1TGOA 1R59O 3MX5A 4E7IA 3C95A 4ISEA 4BWJA 4IJAA 3RTVA 5BPMA 4W5OA 4DR4H 2O8DA 4AF1A 4CJUA 2XY6A 4DU4A 2K1HA 4FPAA 3I33A 1X4MA 4BA2I 1X0AA 4CESA 3ITHA 4W5RA 4OO1J 1KFDA 1XWLA 3EEQA 4H0OA 2QI2A 1KCFA 1QVGM 5AQMA 1IBKH 4CZEA 1EETA 1RDBA 4CEOA 3ZSZA 4DS4A 4IJNA 1S03G 2QWOA 2CTFA 1C1AA 3ZETB 5HRRA 2E88A 5HP1A 1JLGA 4JKGB 1XC3A 4PL8A 2XHBA 3K58A 5JS1A 1XC9A 3AVBA 3L6QA 4X64K 3ULEA 2JEBI 1JXBA 4JD2A 3H46O 3S9HA 1QQNA 4C8OA 3M8QA 4KTZA 3L2WA 3TSQA 4JI7H 1U04A 3AVGA 4EZ6A 2E5LK 4DV2K 3V81A 2FLOA 4IXCA 1DTQA 1XNRK 2KW4A 1NMNA 5C15A 3GKUA 3SPZA 3V1OA 4CJSA 4BRLA 4CVNE 1NK8A 1IJJA 4XH1A 3VKEA 3KTQA 4YOTA 2HH3A 1RTJA 3FAUA 5TKWA 2CGLA 1RFQA 3J81O 3GR5A 3PV8A 2ZGYA 1BWFO 1HPZA 3OJUA 3THWA 1AN7A 1S1XA 2YJEA 5E84A 4B9NA 5EOYA 1W7AA 5KPZA 3LM9A 1ASVA 2W6KA 1HQUA 3DLHA 3CMAN 3QDKA 4K25A 4A2AA 2VG6A 4I7FA 5HRNA 1XRHA 4WANA 3SUNA 1BIUA 4DQSA 1G15A 3A5OC 4GMJB 1HX1A 5LMUK 1NK7A 3AO4A 4JK8A 4LFCK 1JKHA 1LWFA 5SWMA 4ELVA 4DUZK 3SV3A 4BA1I 1WUAA 1H1VA 2UUAH 2KKZA 4ILGB 2O4IA 1QZ5A 3I0SA 2P9KA 1LAVA 4M7XA 1E4FT 2GUPA 1MWKA 3FFKB 4Z0UA 1WSJA 1ZBIA 3AA2A 3OY9A 2G8HA 3LZIA 3CPEA 3AEVB 2E2PA 4K0KH 4LF4K 1S6PA 3K0SA 3AA5X 1BA1A 1DT9A 4H03B 5M1NA 1Q8IA 2IAJA 3VA0A 1J5OA 4GKJK 2FSNA 5AQQA 1NK9A 1U49A 2O8FB 3CCUN 5AQJA 2EX3A 2Y1JA 3V9WA 1ESVA 3MN9A 4LF7H 1VQ8N 1A5WA 1VQ4N 4NYFA 2Z1IA 4GV9A 1ZZKA 4H8KA 1KD1O 3BUZB 4H0TB 4AM3A 2QXFA 4DTNA 4YOUA 1NU0A 5GINA 2WFBA 2UUCK 1GLFO 3WXMB 1KVCA 3VGKA 2UU9K 1EKEA 1TKDA 4JYAH 5EVZA 4CZGA 4DTPA 4JKAA 3VGMA 3D2EA 4CCHA 4LY7A 4JI4K 1CZAN 3OJSA 3K57A 3O5BA 4O5BA 3CCLN 2Q0UA 2HF4A 4R5PA 3DLEA 1ZZIA 3ZSOA 5J2QA 4IO9L 2CGJA 5IT9O 1RILA 1X9MA 1N36K 1VK0A 4MFBA 4H4OA 4FXDA 3HVRA 1C0UA 3HPHA 1NNEA 1VIGA 3VQ6A 4CEFA 1NGJA 2ITMA 1D8YA 3EO3A 1J4WA 2Z0SA 3QB0A 4CEAA 3CC7N 3THYB 2O4CA 1ITGA 4FWQA 1ATSA 4PA1A 5LL6Z
chains in the Genus database with same CATH topology
1S1UA 1TKZA 4C8LA 4FJLA 1Q9YA 1KFSA 1ZBHA 3ISNC 5C24A 4CIFA 1HYVA 4N5SA 2GV9A 4YNQA 1FK9A 4KAZA 1IKVA 3OYNA 3MEEA 3OYEA 4IG3A 3TAEA 2HHSA 2X74A 3CFOA 2HHWA 1IO2A 3QEXA 4KB1A 1RBUA 1SUQA 1HNVA 3AO2A 4OGEA 3O3FA 2BE2A 4DTSA 3TABA 4FJGA 2D0CA 4N41A 1RT2A 4PUOA 3KIOA 1RBSA 1NK5A 1B9FA 5C25A 4PY5A 4FJXA 3L2VA 4CFAA 1FKOA 1JXEA 3SQ4A 4DQIA 1BHLA 1EX4A 4FZYA 1A5XA 3V9XA 3S3NA 3RR8A 3S3MA 4ELUA 4L8RB 2KZZA 2YNHA 5K14A 4GW6A 1L3TA 4KHUA 5KRSA 1ZBLA 3QEWA 2P1JA 3V9SA 2ETJA 3QIOA 1CXQA 2PZSA 4M3YA 3SZ2A 3LPTA 1N6QA 1R0AA 2P5GA 4M3RA 4OPKA 4BE0A 3VQAA 3SQ1A 3UIQA 3LALA 4FJNA 3QETA 3KD5E 3I0RA 3QNOA 1BI4B 1Y97A 4JLHA 3PY8A 4CHQA 4M3UA 1WLJA 4B9UA 1WSFA 4CFDA 1DTTA 3AA3A 3KLIA 3CQ8A 4FJ7A 2HB5A 4Q5VA 4LH4A 1NK4A 4FJMA 1RNHA 3V1RA 1W0HA 3KLGA 3TAFA 3KD1E 4HUEA 4JRQA 4KV8A 3SV4A 1SL0A 1TL3A 2RKIA 3L2UA 4DU1A 3ULDA 3QEPA 1RTDA 4CEEA 2O4GA 4FJIA 1VSMA 1XHZA 4IG0A 2Z1GA 1VSLA 1K6YA 4KRFA 1NK6A 4NCAA 4FM2A 3SPYA 4O55A 3L8BA 3SUPA 4PQUA 4DSFA 1XHXA 4J2DA 1BI4A 3QIPA 4LD0A 2B4JA 4CERA 4CEQA 3RRHA 4CHOA 3MXIA 2GUIA 2X6NA 3AVJA 1KRPA 4HTUA 1YTAA 3T19A 3DI6A 5J1EA 4FJ8A 3AO1A 2KZMA 4DLGA 4DG1A 3EZ5A 1VSDA 1QSSA 1WSEA 4HVJA 1ZBFA 3OS0A 2YHAA 3K59A 1RDCA 4F2SA 2HHQA 2RF2A 3U6FA 1W9HA 3B6OA 2DTUA 3A2FA 2RPIA 1D9FA 2RN2A 3NBPA 3SUQA 2KQ2A 4N76A 5FRMA 2BGGA 3NF9A 4OKJA 4OPJA 1NKCA 4UQGA 3HL8A 2OA8A 5KGXA 4M3TA 1WN7A 4IFVA 4FLYA 3VQDA 1TAUA 1FXXA 3DLGA 3PUFA 4MQ3A 4I2PA 4FLVA 3HYFA 4DTRA 1RTIA 3EY1A 4I9LA 4CGIA 1L3SA 5J2PA 4LH5A 4FXDA 2HMIA 3L2RA 4OGCA 4FLWA 3OYMA 2QKBA 2E6MA 5J2MA 1BQMA 2DFHA 3CFPA 3TAPA 3ZSXA 4WE1A 4E89A 3V9UA 2ITGA 2Z1JA 3RMDA 4FW1A 3BGRA 4BWMA 2QKKA 4RW7A 4KO0A 3P1GA 3DLRA 4KHWA 3NF8A 1RCHA 2F96A 3K2PA 3ZSRA 4CJPA 3DOKA 4FW2A 3U3GA 4N56A 4B8CA 3I8DA 4BDZA 3TANA 2FBVA 4CJVA 4CHNA 3P83D 4RW6A 3TARA 3BDPA 3SJJA 3CM5A 3SQ0A 4E1MA 4B08A 4B9MA 3ZSYA 4Y1CA 3OYBA 1UOCA 2X6SA 4CK2A 1TKXA 1A5VA 1RT4A 1HMVA 3VQQA 4AILC 5KI6A 4LSNA 4CFBA 4M41A 4JRPA 4DF8A 1RDDA 3G0ZA 3VN5A 3L2QA 4FLZA 4DU3A 4DTXA 4DWIA 2YKNA 1VSKA 1S1WA 1I3AA 1RBRA 1S1TA 4FVMA 4E7KA 4FJHA 4FM1A 4H4MA 3QO9A 3OYLA 2XY5A 1JLFA 2YNFA 2YNIA 1D5AA 2IOCA 4CECA 1D9DA 2YV0X 2KFZA 3OYGA 5EU7A 4DSKA 3OYJA 2P5OA 3EYZA 3SUOA 4IDKA 4KI6A 4CJ3A 2PYJA 4E3SA 4BDPA 4FLXA 2F8SA 4CGJA 3AO3A 5JS2A 2IGIA 3ZSVA 3NFAA 4DMNA 2FBYA 1CZBA 4AHVA 1BGXT 3QLHA 4N47A 4M45A 3WNGA 1WAJA 5T7BA 2PYLA 2I5JA 4XIUA 4GVMA 3AVCA 1NKBA 1MSZA 1WNSA 1I39A 1RT3A 1UWBA 1KTQA 2XY7A 2ZQBA 3QINA 1LAWA 1VSFA 1WSGA 2ZE2A 3B6PA 4RW4A 1ASUA 3V1QA 3LWMA 3AVMA 3DOLA 1Q9XA 1IKWA 1HNIA 1C0TA 3THVA 1WHRA 2KTQA 4KKOA 3PO4A 2HNZA 3ALYA 3CM6A 3VQPA 1NJXA 1JLAA 3ZT1A 4QCLA 4ICLA 4CJTA 2XO7A 1IKXA 1C6VA 1LWEA 1TV6A 4F3TA 4EP4A 4CK3A 1S9EA 4B9TA 3OVNA 3AVKA 4KTWA 2HHXA 1RBVA 3OYHA 3TWHA 1TKTA 5HBMA 1T05A 4W5TA 4KHNA 4LSLA 1S5JA 2P51A 4DFKA 1BCOA 2E4LA 4Z4CA 4FYDA 4E7LA 3S3OA 1GOAA 3CG7A 4AHSA 3PO5A 3SI6A 4AHCA 2OPPA 3LP0A 2OPRA 3ZSWA 4F3OA 2KFNA 2NUBA 3OS1A 3HK2A 3V6DA 1BISA 4CJRA 4FCYA 4DTJA 3KJVA 4C8MA 2FC0A 1JLCA 1GOCA 3F9KA 1SL1A 4M3XA 4FK0A 3OS2A 3TAGA 3M8SA 1YVUA 3LWLA 4DTMA 1KLMA 1RDAA 2JGUA 3MECA 3SYZA 1TVRA 4HHTA 1YTUA 1SV5A 3RMAA 1N5YA 4TSXA 2G8VA 1J9AA 1QSYA 5KTQA 4E0DA 4BE1A 4ZTJA 4K8ZA 4KFBA 3AA4A 4CJKA 4J2EA 4HCCA 4W5NA 4IKFA 1GOBA 2DY4A 5J2NA 3LANA 4ID5A 3FFIA 1WAFA 4ZTFA 1B9DA 4DFJA 3K5MA 5SZTA 1JL1A 3AVLA 4DLEA 3IAYA 1J53A 1CXUA 1X1PA 4FM0A 1HYSA 4BDYA 2Y1IA 4ID1A 4DSJA 3AVNA 4CHZA 1RT7A 1REVA 2LSNA 4CHYA 3NGZA 2IC3A 3VA3A 4KHSA 3NDKA 1DLOA 3NF6A 1BCMA 3HJFA 3T1AA 4DSLA 4FZXC 1UA0A 1QQCA 1KVBA 3NGYA 4CGHA 1CLQA 3NH1A 4HUFA 2DFEA 3M8RA 3PX6A 1RTHA 2HVIA 2VG7A 3CYMA 4CIEA 4DSIA 3C94A 4KREA 2R7YA 1TK0A 3VQ7A 1Z25A 1C1BA 3VQEA 3NGIA 3ZT2A 2VG5A 4O44A 3RMCA 4FZZA 3WNFA 3LDSA 3NE6A 1KLNA 4QOZB 4KTQA 4CEBA 3NCIA 3KKRA 1NOYA 3TAMA 1U45A 1RT1A 3OYKA 1QSLA 3IG1A 2YKMA 2XRIA 2WONA 3DMJA 3O4QA 4KPYA 4M3ZA 2G8WA 4RG8A 3KK3A 3VQ9A 4FJ9A 4IFYA 3DRRA 1YT3A 5CZ1A 4NCGA 3O3GA 4B9VA 1KSPA 4B9SA 4DQPA 4B9LA 4OLBA 5I42A 3SNNA 2HHUA 3DRSA 3HPGA 1QS4A 1TGOA 1L3VA 4KHQA 4Z4IA 3OYDA 5E41A 3QERA 3DYAA 5FROA 4E7IA 3C95A 4BWJA 3RTVA 5D3GA 1QHTA 4CHPA 4W5OA 3TI0A 3VQ5A 4CJUA 2XY6A 4DU4A 4CGDA 2W42A 3HM9A 4FJKA 3NF7A 4O0IA 4RW8A 5KGWA 2BDPA 4CESA 3ITHA 4W5RA 1KFDA 1XWLA 3LAKA 4KI4A 4JS5A 4M3WA 1KCFA 3VQBA 4E7HA 2PY5A 1JLQA 5HLFA 3PX0A 3NH2A 2OYQA 4ELTA 4DSEA 1EETA 1RDBA 4CEOA 3ZSZA 2YNGA 4F8RA 2VWKA 2D0BA 1L5UA 3HP9A 4DS4A 1U48A 2FBXA 5DMRA 5CY4A 2ZD1A 4CJEA 2YHBA 3PX4A 1C1AA 2E6LA 2HHTA 4J2BA 4PWDA 4Z4EA 4CF2A 1TAQA 3AVAA 1CZ9A 5HRRA 3ZSQA 3VQ4A 2ATQA 4AHUA 5HP1A 3OYCA 3NAEA 4CJ5A 3DRPA 1JLGA 4CEDA 3K58A 2XHBA 4F4KA 5JS1A 2IS3A 3MXMA 2HNDA 1XC9A 3AVBA 3MAQA 3MXJA 2G8FA 1JXBA 4ZHRA 3ZCMA 1VSJA 3JYTA 3RMBA 3S9HA 4C8OA 3M8QA 4KTZA 5CYMA 2CPMA 4KB0A 2EHGA 3ZT4A 3L2WA 3RRGA 1U04A 3AVGA 1SKRA 5I3UA 4EZ6A 2B5JA 3V81A 1DTQA 3HPOA 2KW4A 1NJWA 4K8XA 3RWUA 3GKUA 3SPZA 3V1OA 4CJSA 2OZSA 1T7PA 2LRRA 2HW3A 4B3OA 1NK8A 2HVHA 1O1WA 3QESA 3KTQA 3LP3A 4RW9A 1RTJA 3MEGA 5FRNA 5FDLA 5KRTA 2GBZA 1S6QA 4CIGA 4FLUA 3L3UA 4DTUA 4CJQA 4FK2A 4Z4GA 4QAGA 1SKWA 3KK1A 4OLAA 1FKPA 4AHRA 3PV8A 3K5LA 5HROA 4J2AA 4HCBA 1UG8A 1RBTA 3V9ZA 3T3FA 1TK8A 1U47A 1HPZA 3OJUA 1NK0A 4CK1A 4FLTA 1RT5A 1S1XA 2HNYA 2VWJA 4B9NA 3JSMA 4CJWA 2F8TA 2A1RA 3HXMA 1XI1A 1ASVA 1BL3A 1HQUA 1LW2A 2D5RA 3IRXA 3OYAA 3DLHA 1S9GA 4E7JA 1HRHA 3G10A 3ASMA 3AO5A 3D0PA 1BQNA 1IH7A 2VG6A 4I7FA 4C8NA 5HRNA 2OPQA 2OZMA 3AVHA 3SUNA 1BIUA 1T03A 4DQSA 3CFRA 1G15A 4CJLA 3LPUA 3KLFA 4GMJB 3LZJA 3L3VA 1NK7A 2AJQA 3AO4A 3HT3A 1B92A 1JKHA 4CGFA 1LWFA 1J54A 2DFFA 5SWMA 4ELVA 4HUGA 3SV3A 1F21A 1ZYQA 1T8EA 1C1CA 2QK9A 1JL2A 3TAQA 2O4IA 4G1QA 3WNHA 3E01A 3I0SA 4DTOA 1LAVA 1SL2A 4JS4A 1HQEA 4Z0UA 3WNEA 1WSJA 1ZBIA 3HO1A 4O0JA 3O3HA 3AA2A 3P5JA 4I9QA 3KK2A 2XY8A 1EXQA 3OY9A 4DFPA 1KVAA 3LZIA 4OJRA 4OKEA 4DQRA 2G8HA 4Y1DA 3RR7A 3C6UA 1S6PA 1JLBA 2Q3SA 4E1NA 5HRSA 3AA5X 3NH0A 1Q8IA 4CJ4A 4DS5A 2IAJA 1HJRA 1QE1A 3SCXA 3VA0A 4IBNA 4OKKA 1J5OA 5CYQA 3KLEA 3QEVA 1NK9A 1UAXA 2G8IA 1L3UA 1U49A 3AVIA 1IG9A 4CJFA 1NJYA 2EX3A 4DF4A 4CGGA 2Y1JA 1ASWA 3QNNA 1UA1A 1NOZA 4Q0BA 3K5OA 2B6AA 3V9WA 5HRPA 4DQQA 1VSIA 2G8KA 3D45A 3MEDA 4W5QA 4DFMA 3QEIA 1X9SA 4BACA 1A5WA 3AVFA 4NYFA 2Z1IA 3DM2A 5CZ2A 1X9WA 4Z4FA 4H8KA 1U4BA 5C42A 3U3YA 1ZBUA 2QXFA 4DTNA 4C8KA 4F2RA 4CF9A 3KKSA 4FK4A 1LV5A 1C0MA 3K5NA 2G8UA 1HYZA 1Z26A 2X78A 4BE2A 1KVCA 2WOMA 1EKEA 4CF1A 1LWCA 1TKDA 1BIZA 4AHTA 3LAMA 1NKEA 4DTPA 3SQ2A 1SKSA 2IDOA 1RT6A 3AV9A 4B8AB 1TK5A 4CCHA 3KLHA 4LY7A 4CEZA 2OPSA 3VQ8A 3OJSA 3HP6A 4I2QA 3K57A 4O5BA 1VRUA 1S1VA 3ZT0A 3DLBA 4O4GA 3ZT3A 4R5PA 1EP4A 3DLEA 4CE9A 2JLEA 1IKYA 3ZSOA 3NHGA 3H08A 1QTMA 4KHYA 2Z1HA 1VSHA 2FBTA 5J2QA 4CF8A 3M8PA 3DLKA 3HSTB 3F73A 1RILA 3VQCA 1X9MA 5DK5A 3OYIA 4Z4HA 2BANA 1VK0A 1LW0A 3IS9A 4H4OA 4MFBA 4CF0A 4AH9A 2A1SA 1C0UA 3HPHA 1TL1A 3HVRA 1NJZA 4EZ9A 3C6TA 4M42A 2D0AA 1WSIA 3VQ6A 4FJ5A 4CEFA 4EP5A 4NYNA 4NCBA 3HVTA 1D8YA 4YFUA 3TR8A 3O4NA 3LP2A 4CEAA 4FJJA 2HHVA 3LP1A 1MU2A 1VSEA 1WSHA 4OVLA 1VRTA 4CFCA 4E19A 1ITGA 1JLEA 3OYFA 3V4IA 4PA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1U A;  1TKZ A;  4C8L A;  4FJL A;  1Q9Y A;  1KFS A;  1ZBH A;  3ISN C;  5C24 A;  4CIF A;  1HYV A;  4N5S A;  2GV9 A;  4YNQ A;  1FK9 A;  4KAZ A;  1IKV A;  3OYN A;  3MEE A;  3OYE A;  4IG3 A;  3TAE A;  2HHS A;  2X74 A;  3CFO A;  2HHW A;  1IO2 A;  3QEX A;  4KB1 A;  1RBU A;  1SUQ A;  1HNV A;  3AO2 A;  4OGE A;  3O3F A;  2BE2 A;  4DTS A;  3TAB A;  4FJG A;  2D0C A;  4N41 A;  1RT2 A;  4PUO A;  3KIO A;  1RBS A;  1NK5 A;  1B9F A;  5C25 A;  4PY5 A;  4FJX A;  3L2V A;  4CFA A;  1FKO A;  1JXE A;  3SQ4 A;  4DQI A;  1BHL A;  1EX4 A;  4FZY A;  1A5X A;  3V9X A;  3S3N A;  3RR8 A;  3S3M A;  4ELU A;  4L8R B;  2KZZ A;  2YNH A;  5K14 A;  4GW6 A;  1L3T A;  4KHU A;  5KRS A;  1ZBL A;  3QEW A;  2P1J A;  3V9S A;  2ETJ A;  3QIO A;  1CXQ A;  2PZS A;  4M3Y A;  3SZ2 A;  3LPT A;  1N6Q A;  1R0A A;  2P5G A;  4M3R A;  4OPK A;  4BE0 A;  3VQA A;  3SQ1 A;  3UIQ A;  3LAL A;  4FJN A;  3QET A;  3KD5 E;  3I0R A;  3QNO A;  1BI4 B;  1Y97 A;  4JLH A;  3PY8 A;  4CHQ A;  4M3U A;  1WLJ A;  4B9U A;  1WSF A;  4CFD A;  1DTT A;  3AA3 A;  3KLI A;  3CQ8 A;  4FJ7 A;  2HB5 A;  4Q5V A;  4LH4 A;  1NK4 A;  4FJM A;  1RNH A;  3V1R A;  1W0H A;  3KLG A;  3TAF A;  3KD1 E;  4HUE A;  4JRQ A;  4KV8 A;  3SV4 A;  1SL0 A;  1TL3 A;  2RKI A;  3L2U A;  4DU1 A;  3ULD A;  3QEP A;  1RTD A;  4CEE A;  2O4G A;  4FJI A;  1VSM A;  1XHZ A;  4IG0 A;  2Z1G A;  1VSL A;  1K6Y A;  4KRF A;  1NK6 A;  4NCA A;  4FM2 A;  3SPY A;  4O55 A;  3L8B A;  3SUP A;  4PQU A;  4DSF A;  1XHX A;  4J2D A;  1BI4 A;  3QIP A;  4LD0 A;  2B4J A;  4CER A;  4CEQ A;  3RRH A;  4CHO A;  3MXI A;  2GUI A;  2X6N A;  3AVJ A;  1KRP A;  4HTU A;  1YTA A;  3T19 A;  3DI6 A;  5J1E A;  4FJ8 A;  3AO1 A;  2KZM A;  4DLG A;  4DG1 A;  3EZ5 A;  1VSD A;  1QSS A;  1WSE A;  4HVJ A;  1ZBF A;  3OS0 A;  2YHA A;  3K59 A;  1RDC A;  4F2S A;  2HHQ A;  2RF2 A;  3U6F A;  1W9H A;  3B6O A;  2DTU A;  3A2F A;  2RPI A;  1D9F A;  2RN2 A;  3NBP A;  3SUQ A;  2KQ2 A;  4N76 A;  5FRM A;  2BGG A;  3NF9 A;  4OKJ A;  4OPJ A;  1NKC A;  4UQG A;  3HL8 A;  2OA8 A;  5KGX A;  4M3T A;  1WN7 A;  4IFV A;  4FLY A;  3VQD A;  1TAU A;  1FXX A;  3DLG A;  3PUF A;  4MQ3 A;  4I2P A;  4FLV A;  3HYF A;  4DTR A;  1RTI A;  3EY1 A;  4I9L A;  4CGI A;  1L3S A;  5J2P A;  4LH5 A;  4FXD A;  2HMI A;  3L2R A;  4OGC A;  4FLW A;  3OYM A;  2QKB A;  2E6M A;  5J2M A;  1BQM A;  2DFH A;  3CFP A;  3TAP A;  3ZSX A;  4WE1 A;  4E89 A;  3V9U A;  2ITG A;  2Z1J A;  3RMD A;  4FW1 A;  3BGR A;  4BWM A;  2QKK A;  4RW7 A;  4KO0 A;  3P1G A;  3DLR A;  4KHW A;  3NF8 A;  1RCH A;  2F96 A;  3K2P A;  3ZSR A;  4CJP A;  3DOK A;  4FW2 A;  3U3G A;  4N56 A;  4B8C A;  3I8D A;  4BDZ A;  3TAN A;  2FBV A;  4CJV A;  4CHN A;  3P83 D;  4RW6 A;  3TAR A;  3BDP A;  3SJJ A;  3CM5 A;  3SQ0 A;  4E1M A;  4B08 A;  4B9M A;  3ZSY A;  4Y1C A;  3OYB A;  1UOC A;  2X6S A;  4CK2 A;  1TKX A;  1A5V A;  1RT4 A;  1HMV A;  3VQQ A;  4AIL C;  5KI6 A;  4LSN A;  4CFB A;  4M41 A;  4JRP A;  4DF8 A;  1RDD A;  3G0Z A;  3VN5 A;  3L2Q A;  4FLZ A;  4DU3 A;  4DTX A;  4DWI A;  2YKN A;  1VSK A;  1S1W A;  1I3A A;  1RBR A;  1S1T A;  4FVM A;  4E7K A;  4FJH A;  4FM1 A;  4H4M A;  3QO9 A;  3OYL A;  2XY5 A;  1JLF A;  2YNF A;  2YNI A;  1D5A A;  2IOC A;  4CEC A;  1D9D A;  2YV0 X;  2KFZ A;  3OYG A;  5EU7 A;  4DSK A;  3OYJ A;  2P5O A;  3EYZ A;  3SUO A;  4IDK A;  4KI6 A;  4CJ3 A;  2PYJ A;  4E3S A;  4BDP A;  4FLX A;  2F8S A;  4CGJ A;  3AO3 A;  5JS2 A;  2IGI A;  3ZSV A;  3NFA A;  4DMN A;  2FBY A;  1CZB A;  4AHV A;  1BGX T;  3QLH A;  4N47 A;  4M45 A;  3WNG A;  1WAJ A;  5T7B A;  2PYL A;  2I5J A;  4XIU A;  4GVM A;  3AVC A;  1NKB A;  1MSZ A;  1WNS A;  1I39 A;  1RT3 A;  1UWB A;  1KTQ A;  2XY7 A;  2ZQB A;  3QIN A;  1LAW A;  1VSF A;  1WSG A;  2ZE2 A;  3B6P A;  4RW4 A;  1ASU A;  3V1Q A;  3LWM A;  3AVM A;  3DOL A;  1Q9X A;  1IKW A;  1HNI A;  1C0T A;  3THV A;  1WHR A;  2KTQ A;  4KKO A;  3PO4 A;  2HNZ A;  3ALY A;  3CM6 A;  3VQP A;  1NJX A;  1JLA A;  3ZT1 A;  4QCL A;  4ICL A;  4CJT A;  2XO7 A;  1IKX A;  1C6V A;  1LWE A;  1TV6 A;  4F3T A;  4EP4 A;  4CK3 A;  1S9E A;  4B9T A;  3OVN A;  3AVK A;  4KTW A;  2HHX A;  1RBV A;  3OYH A;  3TWH A;  1TKT A;  5HBM A;  1T05 A;  4W5T A;  4KHN A;  4LSL A;  1S5J A;  2P51 A;  4DFK A;  1BCO A;  2E4L A;  4Z4C A;  4FYD A;  4E7L A;  3S3O A;  1GOA A;  3CG7 A;  4AHS A;  3PO5 A;  3SI6 A;  4AHC A;  2OPP A;  3LP0 A;  2OPR A;  3ZSW A;  4F3O A;  2KFN A;  2NUB A;  3OS1 A;  3HK2 A;  3V6D A;  1BIS A;  4CJR A;  4FCY A;  4DTJ A;  3KJV A;  4C8M A;  2FC0 A;  1JLC A;  1GOC A;  3F9K A;  1SL1 A;  4M3X A;  4FK0 A;  3OS2 A;  3TAG A;  3M8S A;  1YVU A;  3LWL A;  4DTM A;  1KLM A;  1RDA A;  2JGU A;  3MEC A;  3SYZ A;  1TVR A;  4HHT A;  1YTU A;  1SV5 A;  3RMA A;  1N5Y A;  4TSX A;  2G8V A;  1J9A A;  1QSY A;  5KTQ A;  4E0D A;  4BE1 A;  4ZTJ A;  4K8Z A;  4KFB A;  3AA4 A;  4CJK A;  4J2E A;  4HCC A;  4W5N A;  4IKF A;  1GOB A;  2DY4 A;  5J2N A;  3LAN A;  4ID5 A;  3FFI A;  1WAF A;  4ZTF A;  1B9D A;  4DFJ A;  3K5M A;  5SZT A;  1JL1 A;  3AVL A;  4DLE A;  3IAY A;  1J53 A;  1CXU A;  1X1P A;  4FM0 A;  1HYS A;  4BDY A;  2Y1I A;  4ID1 A;  4DSJ A;  3AVN A;  4CHZ A;  1RT7 A;  1REV A;  2LSN A;  4CHY A;  3NGZ A;  2IC3 A;  3VA3 A;  4KHS A;  3NDK A;  1DLO A;  3NF6 A;  1BCM A;  3HJF A;  3T1A A;  4DSL A;  4FZX C;  1UA0 A;  1QQC A;  1KVB A;  3NGY A;  4CGH A;  1CLQ A;  3NH1 A;  4HUF A;  2DFE A;  3M8R A;  3PX6 A;  1RTH A;  2HVI A;  2VG7 A;  3CYM A;  4CIE A;  4DSI A;  3C94 A;  4KRE A;  2R7Y A;  1TK0 A;  3VQ7 A;  1Z25 A;  1C1B A;  3VQE A;  3NGI A;  3ZT2 A;  2VG5 A;  4O44 A;  3RMC A;  4FZZ A;  3WNF A;  3LDS A;  3NE6 A;  1KLN A;  4QOZ B;  4KTQ A;  4CEB A;  3NCI A;  3KKR A;  1NOY A;  3TAM A;  1U45 A;  1RT1 A;  3OYK A;  1QSL A;  3IG1 A;  2YKM A;  2XRI A;  2WON A;  3DMJ A;  3O4Q A;  4KPY A;  4M3Z A;  2G8W A;  4RG8 A;  3KK3 A;  3VQ9 A;  4FJ9 A;  4IFY A;  3DRR A;  1YT3 A;  5CZ1 A;  4NCG A;  3O3G A;  4B9V A;  1KSP A;  4B9S A;  4DQP A;  4B9L A;  4OLB A;  5I42 A;  3SNN A;  2HHU A;  3DRS A;  3HPG A;  1QS4 A;  1TGO A;  1L3V A;  4KHQ A;  4Z4I A;  3OYD A;  5E41 A;  3QER A;  3DYA A;  5FRO A;  4E7I A;  3C95 A;  4BWJ A;  3RTV A;  5D3G A;  1QHT A;  4CHP A;  4W5O A;  3TI0 A;  3VQ5 A;  4CJU A;  2XY6 A;  4DU4 A;  4CGD A;  2W42 A;  3HM9 A;  4FJK A;  3NF7 A;  4O0I A;  4RW8 A;  5KGW A;  2BDP A;  4CES A;  3ITH A;  4W5R A;  1KFD A;  1XWL A;  3LAK A;  4KI4 A;  4JS5 A;  4M3W A;  1KCF A;  3VQB A;  4E7H A;  2PY5 A;  1JLQ A;  5HLF A;  3PX0 A;  3NH2 A;  2OYQ A;  4ELT A;  4DSE A;  1EET A;  1RDB A;  4CEO A;  3ZSZ A;  2YNG A;  4F8R A;  2VWK A;  2D0B A;  1L5U A;  3HP9 A;  4DS4 A;  1U48 A;  2FBX A;  5DMR A;  5CY4 A;  2ZD1 A;  4CJE A;  2YHB A;  3PX4 A;  1C1A A;  2E6L A;  2HHT A;  4J2B A;  4PWD A;  4Z4E A;  4CF2 A;  1TAQ A;  3AVA A;  1CZ9 A;  5HRR A;  3ZSQ A;  3VQ4 A;  2ATQ A;  4AHU A;  5HP1 A;  3OYC A;  3NAE A;  4CJ5 A;  3DRP A;  1JLG A;  4CED A;  3K58 A;  2XHB A;  4F4K A;  5JS1 A;  2IS3 A;  3MXM A;  2HND A;  1XC9 A;  3AVB A;  3MAQ A;  3MXJ A;  2G8F A;  1JXB A;  4ZHR A;  3ZCM A;  1VSJ A;  3JYT A;  3RMB A;  3S9H A;  4C8O A;  3M8Q A;  4KTZ A;  5CYM A;  2CPM A;  4KB0 A;  2EHG A;  3ZT4 A;  3L2W A;  3RRG A;  1U04 A;  3AVG A;  1SKR A;  5I3U A;  4EZ6 A;  2B5J A;  3V81 A;  1DTQ A;  3HPO A;  2KW4 A;  1NJW A;  4K8X A;  3RWU A;  3GKU A;  3SPZ A;  3V1O A;  4CJS A;  2OZS A;  1T7P A;  2LRR A;  2HW3 A;  4B3O A;  1NK8 A;  2HVH A;  1O1W A;  3QES A;  3KTQ A;  3LP3 A;  4RW9 A;  1RTJ A;  3MEG A;  5FRN A;  5FDL A;  5KRT A;  2GBZ A;  1S6Q A;  4CIG A;  4FLU A;  3L3U A;  4DTU A;  4CJQ A;  4FK2 A;  4Z4G A;  4QAG A;  1SKW A;  3KK1 A;  4OLA A;  1FKP A;  4AHR A;  3PV8 A;  3K5L A;  5HRO A;  4J2A A;  4HCB A;  1UG8 A;  1RBT A;  3V9Z A;  3T3F A;  1TK8 A;  1U47 A;  1HPZ A;  3OJU A;  1NK0 A;  4CK1 A;  4FLT A;  1RT5 A;  1S1X A;  2HNY A;  2VWJ A;  4B9N A;  3JSM A;  4CJW A;  2F8T A;  2A1R A;  3HXM A;  1XI1 A;  1ASV A;  1BL3 A;  1HQU A;  1LW2 A;  2D5R A;  3IRX A;  3OYA A;  3DLH A;  1S9G A;  4E7J A;  1HRH A;  3G10 A;  3ASM A;  3AO5 A;  3D0P A;  1BQN A;  1IH7 A;  2VG6 A;  4I7F A;  4C8N A;  5HRN A;  2OPQ A;  2OZM A;  3AVH A;  3SUN A;  1BIU A;  1T03 A;  4DQS A;  3CFR A;  1G15 A;  4CJL A;  3LPU A;  3KLF A;  4GMJ B;  3LZJ A;  3L3V A;  1NK7 A;  2AJQ A;  3AO4 A;  3HT3 A;  1B92 A;  1JKH A;  4CGF A;  1LWF A;  1J54 A;  2DFF A;  5SWM A;  4ELV A;  4HUG A;  3SV3 A;  1F21 A;  1ZYQ A;  1T8E A;  1C1C A;  2QK9 A;  1JL2 A;  3TAQ A;  2O4I A;  4G1Q A;  3WNH A;  3E01 A;  3I0S A;  4DTO A;  1LAV A;  1SL2 A;  4JS4 A;  1HQE A;  4Z0U A;  3WNE A;  1WSJ A;  1ZBI A;  3HO1 A;  4O0J A;  3O3H A;  3AA2 A;  3P5J A;  4I9Q A;  3KK2 A;  2XY8 A;  1EXQ A;  3OY9 A;  4DFP A;  1KVA A;  3LZI A;  4OJR A;  4OKE A;  4DQR A;  2G8H A;  4Y1D A;  3RR7 A;  3C6U A;  1S6P A;  1JLB A;  2Q3S A;  4E1N A;  5HRS A;  3AA5 X;  3NH0 A;  1Q8I A;  4CJ4 A;  4DS5 A;  2IAJ A;  1HJR A;  1QE1 A;  3SCX A;  3VA0 A;  4IBN A;  4OKK A;  1J5O A;  5CYQ A;  3KLE A;  3QEV A;  1NK9 A;  1UAX A;  2G8I A;  1L3U A;  1U49 A;  3AVI A;  1IG9 A;  4CJF A;  1NJY A;  2EX3 A;  4DF4 A;  4CGG A;  2Y1J A;  1ASW A;  3QNN A;  1UA1 A;  1NOZ A;  4Q0B A;  3K5O A;  2B6A A;  3V9W A;  5HRP A;  4DQQ A;  1VSI A;  2G8K A;  3D45 A;  3MED A;  4W5Q A;  4DFM A;  3QEI A;  1X9S A;  4BAC A;  1A5W A;  3AVF A;  4NYF A;  2Z1I A;  3DM2 A;  5CZ2 A;  1X9W A;  4Z4F A;  4H8K A;  1U4B A;  5C42 A;  3U3Y A;  1ZBU A;  2QXF A;  4DTN A;  4C8K A;  4F2R A;  4CF9 A;  3KKS A;  4FK4 A;  1LV5 A;  1C0M A;  3K5N A;  2G8U A;  1HYZ A;  1Z26 A;  2X78 A;  4BE2 A;  1KVC A;  2WOM A;  1EKE A;  4CF1 A;  1LWC A;  1TKD A;  1BIZ A;  4AHT A;  3LAM A;  1NKE A;  4DTP A;  3SQ2 A;  1SKS A;  2IDO A;  1RT6 A;  3AV9 A;  4B8A B;  1TK5 A;  4CCH A;  3KLH A;  4LY7 A;  4CEZ A;  2OPS A;  3VQ8 A;  3OJS A;  3HP6 A;  4I2Q A;  3K57 A;  4O5B A;  1VRU A;  1S1V A;  3ZT0 A;  3DLB A;  4O4G A;  3ZT3 A;  4R5P A;  1EP4 A;  3DLE A;  4CE9 A;  2JLE A;  1IKY A;  3ZSO A;  3NHG A;  3H08 A;  1QTM A;  4KHY A;  2Z1H A;  1VSH A;  2FBT A;  5J2Q A;  4CF8 A;  3M8P A;  3DLK A;  3HST B;  3F73 A;  1RIL A;  3VQC A;  1X9M A;  5DK5 A;  3OYI A;  4Z4H A;  2BAN A;  1VK0 A;  1LW0 A;  3IS9 A;  4H4O A;  4MFB A;  4CF0 A;  4AH9 A;  2A1S A;  1C0U A;  3HPH A;  1TL1 A;  3HVR A;  1NJZ A;  4EZ9 A;  3C6T A;  4M42 A;  2D0A A;  1WSI A;  3VQ6 A;  4FJ5 A;  4CEF A;  4EP5 A;  4NYN A;  4NCB A;  3HVT A;  1D8Y A;  4YFU A;  3TR8 A;  3O4N A;  3LP2 A;  4CEA A;  4FJJ A;  2HHV A;  3LP1 A;  1MU2 A;  1VSE A;  1WSH A;  4OVL A;  1VRT A;  4CFC A;  4E19 A;  1ITG A;  1JLE A;  3OYF A;  3V4I A;  4PA1 A; 
#chains in the Genus database with same CATH topology
 1TKZ A;  4A5B A;  2ZJR L;  4NXM H;  2UUB K;  3ISN C;  1HYV A;  2GV9 A;  3OYN A;  5JLH A;  4B9Q A;  3MEE A;  1K73 O;  3TAE A;  2HHS A;  3CFO A;  2HHW A;  3EZJ A;  1RBU A;  5AQX A;  1NGF A;  1HNV A;  3AO2 A;  3IUC A;  4I6M B;  4OGE A;  3CCS N;  2YX6 A;  2W41 A;  3KIO A;  1NK5 A;  2A3Z A;  5C25 A;  2HHH H;  1FKO A;  4H5T A;  4DQI A;  3LDQ A;  1HNZ H;  4L8R B;  4YHH H;  5K14 A;  1ATN A;  4GW6 A;  1NWK A;  4LFA H;  3QEW A;  3V9S A;  4DV4 H;  5A2Q W;  1N6Q A;  2P5G A;  2VQE H;  4OPK A;  4BE0 A;  3WXL A;  3U4L A;  3QET A;  4JI0 K;  3KD5 E;  3TTC A;  1Q86 O;  1Y97 A;  5M1F A;  1WLJ A;  3AA3 A;  3KLI A;  2HB5 A;  1RNH A;  3TAF A;  4HUE A;  1SZ2 A;  3DWL A;  1M90 O;  4FWL A;  3LDL A;  1KXP A;  2WTU A;  1VSL A;  1EQY A;  4FM2 A;  4JKB A;  3SUP A;  4WCE L;  1XHX A;  4DV3 H;  4CER A;  4CEQ A;  4HTU A;  1YTA A;  1V4S A;  3WXJ A;  4BG8 A;  4DLG A;  3IMX A;  1MDU B;  1ZBF A;  2HMP A;  4F2S A;  2RF2 A;  1W9H A;  3B6O A;  3CIP A;  2DTU A;  4KRF A;  4LFB K;  4BRO A;  4UQG A;  5KGX A;  4FLY A;  2HBL A;  3VQD A;  2QWP A;  3DLG A;  2JWL A;  3G71 N;  4I2P A;  3EY1 A;  4I9L A;  2HMI A;  3EKS A;  4NB4 A;  2V51 B;  2QKB A;  2E6M A;  5AQZ A;  3TAP A;  3IFR A;  3DXM A;  3ZSX A;  3FZK A;  3RMD A;  3B8A X;  2PY9 A;  4FPB A;  4N56 A;  4LF5 K;  4CHN A;  2F4V H;  4MO5 A;  4XH4 A;  2VGM A;  5AQU A;  3QBX A;  4E1M A;  4B9M A;  3AY9 A;  4CK2 A;  1EWQ A;  1A5V A;  1RT4 A;  1RDW X;  4E1J A;  4AIL C;  4DF8 A;  4CFB A;  2UYT A;  5I42 A;  2HHQ A;  2Y3M A;  3A5L C;  4DV6 K;  2YKN A;  1VSK A;  1S1T A;  4FM1 A;  3OYL A;  4CEC A;  2IOC A;  2YV0 X;  3WEE B;  5LMN K;  4JAX A;  3OYJ A;  3E9O A;  1WE8 A;  1QVF M;  4BR5 A;  4BDP A;  4X66 K;  2OTL N;  4YY3 K;  4DMN A;  2LTM A;  5C0Y A;  4JI8 H;  1NGG A;  3M3Z A;  1U6Z A;  3QLH A;  3TPQ A;  1W97 L;  1WAJ A;  2A5X A;  2I5J A;  4XIU A;  4GVM A;  4OX9 H;  1NKB A;  1I39 A;  1UWB A;  4QS7 A;  3QIN A;  1LAW A;  1WSG A;  3B6P A;  4B3R K;  2V7Y A;  4BVO A;  3THV A;  3KHY A;  1WHR A;  3PO4 A;  1FJG K;  3ALY A;  1NJX A;  1JLA A;  4JN4 A;  1U2V B;  4F3T A;  4X65 H;  3OVN A;  2GWK A;  1YXQ A;  4KTW A;  2HHX A;  5HBM A;  1X3N A;  2EWS A;  4LSL A;  4B1V A;  1S5J A;  1BCO A;  4Z4C A;  4GKK H;  1VQP N;  1M1K O;  4E7L A;  1YJ9 N;  2V7Z A;  4KH5 A;  4F3O A;  2NUB A;  3OW2 M;  5AQH A;  4CJR A;  4BRC A;  4C8M A;  1BU6 O;  4BRE A;  2UXB H;  1YVU A;  4DTM A;  1OVY A;  2ASM A;  3RMA A;  2YQR A;  1J9A A;  5KTQ A;  4H0X B;  4E0D A;  4CJK A;  5J2N A;  4DR5 K;  3MN5 A;  3K5M A;  1JL1 A;  3AVL A;  4WQ5 C;  1X3M A;  3PLA A;  1SAZ A;  3CJB A;  4DSJ A;  3CER A;  1RT7 A;  4H0V B;  4ILH A;  2P9L A;  1HKG A;  3KVG A;  5JIC A;  3NGZ A;  3VA3 A;  2O8C B;  3QD7 X;  2NRZ A;  2VGN A;  2NRH A;  4BR2 A;  5DT9 A;  4FZX C;  4JI5 K;  1CLQ A;  1N32 K;  5AQN A;  2FMR A;  3VTI A;  1E4G T;  3FE1 A;  2DFE A;  3M8R A;  1RTH A;  4JKF A;  4DSI A;  5M1P A;  2O8B A;  3KDK A;  5M1O A;  2VG5 A;  3WNF A;  3LDS A;  4QOZ B;  3NCI A;  4H5R A;  1K9M O;  1QSL A;  3EE8 A;  1EO1 A;  1T6C A;  4FVU A;  2G8W A;  4OPH A;  2WC9 A;  1IBM K;  4FJ9 A;  4IFY A;  1YT3 A;  4CW7 B;  1VQ7 N;  3J7Z O;  4B9L A;  4OLB A;  3SNN A;  2HHU A;  3HPG A;  1QS4 A;  4FOI A;  5E41 A;  5FRO A;  3A5M C;  4IFD G;  1QHT A;  2BTF A;  3F2K A;  4GNI A;  4QMF B;  2A40 A;  3T1H K;  1J5K A;  4PKG A;  3H6E A;  4WF9 L;  2BDP A;  2Q31 A;  3VEZ A;  3LAK A;  3UOE A;  4E7H A;  2O8F A;  1JLQ A;  3NH2 A;  4BRG A;  4DSE A;  3VOV A;  4F8R A;  2D0B A;  3FR0 A;  5CY4 A;  2ZD1 A;  4DR1 K;  2YHB A;  3PX4 A;  3CME N;  2P9I B;  4J2B A;  2ZQE A;  4CF2 A;  2NRV A;  1TAQ A;  1CZ9 A;  3ZSQ A;  3VQ4 A;  4B3S H;  4BG9 A;  2E20 A;  3OYC A;  1XNQ H;  3NAE A;  3VF4 A;  3DRP A;  3DAW A;  4CED A;  3I0P A;  2NRT A;  2IS3 A;  3MXM A;  1VQ9 N;  1P90 A;  1YUW A;  3MAQ A;  4NZT M;  3CD6 N;  2ZGZ A;  3ZCM A;  2CPM A;  3ZT4 A;  1VQ6 N;  3RRG A;  1BOT O;  3TTD A;  4H8A A;  4NXN K;  5BPN A;  4IFE A;  3U9D A;  3TU5 A;  1QQM A;  1NBW A;  1ZC6 A;  3SMS A;  2LF0 A;  2LRR A;  4KHP K;  4B3O A;  2HVH A;  2YJF A;  3VTH A;  3O9Q A;  4DKW A;  3O80 A;  5FRN A;  1N34 H;  1S6Q A;  1DTJ A;  3BF1 A;  3MWT A;  2QM1 A;  4CJQ A;  2BL5 A;  4Z4G A;  4QAG A;  1SKW A;  4EHT A;  1UG8 A;  4HCB A;  3T3F A;  3THY A;  3CJC A;  5FPN A;  2ZM6 K;  4FLT A;  2HNY A;  3JSM A;  4BRA A;  4CJW A;  2F8T A;  2A1R A;  3HXM A;  1XI1 A;  3WQT A;  1LW2 A;  3IRX A;  3J7A K;  1S9G A;  1HRH A;  1BQN A;  4YOY A;  2OPQ A;  2OZM A;  4OCH A;  4B1Z A;  2OAN A;  4A62 A;  2G8Y A;  1T03 A;  3CFR A;  3LZJ A;  3KLF A;  4FWK A;  2AJQ A;  2O8E B;  3HT3 A;  2M6Q A;  2QA4 N;  4CGF A;  3J81 W;  1IBL K;  5GAH P;  1ZYQ A;  4JV5 H;  3OTO H;  1T8E A;  2QK9 A;  1JL2 A;  2QND A;  4G1Q A;  3E01 A;  3UKU B;  3THX B;  1SL2 A;  4DR4 K;  2JA9 A;  1VQL N;  5AQO A;  2I7P A;  1EC6 A;  3WNE A;  2E1Y A;  4I9Q A;  2XY8 A;  4OKE A;  3RR7 A;  4JI2 H;  4JNE A;  3C6U A;  4H5N A;  4B8C D;  5HRS A;  3NH0 A;  1XMQ H;  1NGE A;  3LDO A;  1QE1 A;  3BEX A;  5FPE A;  4OKK A;  1IBK K;  1L3U A;  3AVI A;  5M1Q A;  1HNX K;  4CGG A;  1ASW A;  5M1K A;  3QNN A;  1NOZ A;  1UA1 A;  3K5O A;  2B6A A;  3UKR B;  3CC2 N;  2NN6 G;  1VSI A;  4M7Y A;  3SJH A;  2G8K A;  3MED A;  3HTV A;  5CZ2 A;  4B1Y B;  3GDQ A;  1P8Z A;  1U4B A;  3U3Y A;  1ZBU A;  1I94 H;  3KKS A;  4CZJ A;  1C0M A;  1HYZ A;  1Z26 A;  2X78 A;  2UXC H;  4G08 A;  4CF1 A;  1RGI A;  3MCA B;  3RF2 A;  4MLH A;  4BRD A;  1NKE A;  4JI7 K;  3Q7C A;  4JK7 A;  3AV9 A;  4B8A B;  3KLH A;  3VQ8 A;  3L4I A;  3J8A A;  4O4G A;  2OCE A;  3ZT3 A;  3AGR A;  5BPL A;  3H08 A;  1VSH A;  5AZJ B;  5CHI A;  3F73 A;  3EE9 A;  2DPN A;  5DK5 A;  4Z4H A;  3DXK B;  3IS9 A;  3MCP A;  4EZ9 A;  2WUS A;  4CBW A;  1WSI A;  3G25 A;  4FJ5 A;  4NYN A;  4NCB A;  5AQG A;  2P9P A;  3LP2 A;  4C23 A;  3C7N B;  1MU2 A;  1VSE A;  1VRT A;  4CFC A;  4E19 A;  3V69 A;  3OYF A;  1X9W A;  3R3L A;  5KQD A;  5EX5 A;  3NVK A;  1XQS C;  2VQF H;  2YHY A;  4KAZ A;  1FK9 A;  1HLU A;  1IKV A;  3O8M A;  4IG3 A;  2X74 A;  3WEE A;  2D0P A;  3QEX A;  5IT9 W;  3L7Z C;  4X62 K;  1Q7Y O;  3FZM A;  4DV5 H;  3O3F A;  4N41 A;  1ZTG A;  4LC9 B;  4PDB A;  2GWJ A;  1B9F A;  4FL9 A;  4QS8 A;  1N8R O;  4BRK A;  2W6L A;  5I9E B;  1HR0 K;  4UY8 O;  1EX4 A;  4FZY A;  1DKG D;  5BN9 A;  4ELU A;  2YNH A;  2P1J A;  3U1K A;  3QIC A;  3SZ2 A;  2CH5 A;  3LPT A;  4JKC A;  3CPW M;  1R0A A;  5BR9 A;  4M3R A;  3ZEU B;  4FO0 A;  5JVH L;  3KDG A;  3H1Q A;  3P39 A;  3FZF A;  1YJN N;  4X64 H;  4JI1 K;  1BI4 B;  3O9U A;  5H1S Q;  4CFD A;  4LH4 A;  2CTK A;  1WBD A;  3KLG A;  3KD1 E;  1TL3 A;  2RKI A;  3C6H A;  3VEN A;  2E5L H;  4DV2 H;  3ZYY X;  3QEP A;  1XUP O;  4CEE A;  4CZK A;  4FJI A;  1NJI O;  4IG0 A;  4PHT X;  1NK6 A;  3SPY A;  4O55 A;  4PQU A;  4J2D A;  3MDQ A;  3BF3 A;  2OTJ N;  3QIP A;  2B4J A;  1KRP A;  4FJ8 A;  2FPH X;  2KZM A;  4ISF A;  5J1E A;  3EN9 A;  3AO1 A;  4DG1 A;  3C0B A;  3EZ5 A;  3GOI A;  1QSS A;  4DR3 H;  3K9J A;  4DV0 H;  4NO7 A;  3U6F A;  2PBD A;  1D9F A;  2RN2 A;  2BGG A;  4A61 A;  2KQ2 A;  3SUQ A;  5FRM A;  4DUY K;  3HL8 A;  4IFV A;  4IEE A;  1TAU A;  4MQ3 A;  4FLV A;  4DTR A;  3HM8 A;  4CGI A;  1L3S A;  4DR2 H;  5LJV A;  2VCP A;  4DV1 K;  3OYM A;  2NNW A;  1BQM A;  4LFC H;  2J4R A;  2Z1J A;  3EZW A;  3BGR A;  4IOA L;  4JKH A;  4KHW A;  3NF8 A;  3DLL L;  4CJP A;  2FBV A;  3LDP A;  1KAZ A;  4LF8 K;  4B08 A;  3OYB A;  1UOC A;  3OSS D;  1HMV A;  2QWN A;  5KI6 A;  4JRP A;  4M41 A;  3T1Y H;  3G0Z A;  3R1X A;  3VN5 A;  1ATR A;  3L2Q A;  4DTX A;  1VIH A;  1S1W A;  1VQM N;  1I3A A;  1RBR A;  2YNF A;  3O6W A;  4DSK A;  2ZJQ L;  2QEX N;  3EYZ A;  2E2Q A;  3MK6 A;  2F9W A;  2PYJ A;  5JEA G;  2F8S A;  2HHH K;  3NCV A;  3ENO A;  3AO3 A;  1NXU A;  4MDB A;  2IGI A;  3ZSV A;  3MMV A;  1HNZ K;  4AHV A;  4N47 A;  1KQS M;  3WNG A;  4YHH K;  2PYL A;  2YHX A;  1NGC A;  1WNS A;  1YIT N;  5EXW A;  3VF2 A;  1KTQ A;  4DV4 K;  4IOX A;  1HJO A;  1VSF A;  4BAC A;  2VQE K;  4FWS A;  3C6A A;  1T3V A;  1GLJ O;  3SB1 A;  3RSE B;  2KHO A;  5E26 A;  3CM6 A;  4HTL A;  2XO7 A;  3SAG A;  2UUC H;  4DHY A;  1IKX A;  4WFB L;  4EP4 A;  4CK3 A;  1S9E A;  4KBO A;  4B9T A;  2UU9 H;  4EFH A;  1T05 A;  3VF6 A;  4KHN A;  5BR8 K;  4JI4 H;  2P51 A;  2P9I A;  1KHM A;  4AIM A;  4B3M K;  1NGH A;  2OPP A;  2KFN A;  1K1G A;  4DV3 K;  1BIS A;  4FCY A;  1GLC G;  4JI6 K;  1N36 H;  2P9N A;  4LF6 K;  2FC0 A;  1GOC A;  1SL1 A;  4M3X A;  4FK0 A;  3TAG A;  3ID6 A;  5F0X A;  3MEC A;  5AZI A;  4HHT A;  1SV5 A;  1K8K A;  4TSX A;  2G8V A;  1NGB A;  5C10 A;  4BE1 A;  4O8K A;  1GLE G;  3AA4 A;  5C12 A;  4J2E A;  4HCC A;  1QZ6 A;  4BRH A;  3LAN A;  3S41 A;  5DM6 L;  3FFI A;  1WAF A;  3D2F A;  3KWI A;  4WQ4 C;  4DFJ A;  3BZC A;  4YOV A;  3IAY A;  4FM0 A;  3L0Q A;  1HYS A;  4JK9 A;  2Y1I A;  4ID1 A;  4DQ8 A;  1F0X A;  1REV A;  2LSN A;  4A59 A;  4KHS A;  3NF6 A;  3HJF A;  2CTM A;  3W0L A;  4L3Q A;  2CTL A;  3T1A A;  1J6Z A;  1QQC A;  1KVB A;  5JVG L;  4Z94 A;  2CGK A;  2QWL A;  3PSF A;  2HVI A;  2VG7 A;  4JI3 K;  4CIE A;  4KRE A;  3VQ7 A;  5HL7 L;  3RMC A;  4FZZ A;  4O8U A;  3KZB A;  4KTQ A;  4CEB A;  4FJU A;  3KKR A;  3M5R A;  3TAM A;  1VQ5 N;  1RT1 A;  3Q7B A;  3IG1 A;  3DMJ A;  3O4Q A;  5F2R A;  3KK3 A;  1VBI A;  5CZ1 A;  3O3G A;  2PAV A;  3UKU A;  3DRS A;  3THX A;  4Z4I A;  3QER A;  3DYA A;  4BVP A;  1OH7 A;  3CHW A;  4AQY K;  3TI0 A;  2Q36 A;  3IDH A;  3SK3 A;  4IDH A;  2W42 A;  3HM9 A;  4FJK A;  5HOO A;  4RW8 A;  5KGW A;  4BGB A;  2M8W A;  4JS5 A;  4DR7 K;  3M6G A;  2CWF A;  2PY5 A;  2UXD K;  4JD2 B;  3OBW A;  3PX0 A;  2OYQ A;  1S3X A;  4DR6 H;  2YNG A;  2VWK A;  1L5U A;  1U48 A;  5DMR A;  3CJ9 A;  1HKB A;  4NLC A;  5AQT A;  4IZ9 A;  5AQK A;  2E6L A;  2HHT A;  5K36 G;  1J5E K;  4Z4E A;  4JVY A;  3AVA A;  2ATQ A;  4M63 C;  4CJ5 A;  4F4K A;  3VEX A;  2HND A;  3MXJ A;  3I56 N;  2G8F A;  3RMB A;  3VEW A;  1VSJ A;  2CH6 A;  4YDU C;  3CQY A;  5CYM A;  4LF5 H;  1OH6 A;  2E1Z A;  1TYQ B;  2B5J A;  3THW B;  4IEI A;  1NJW A;  3HPO A;  4B1X B;  3ZET A;  4K8X A;  3RWU A;  5IWA H;  2HW3 A;  1ZZJ A;  4CD1 A;  1O1W A;  4JKG A;  1GLL O;  3LP3 A;  2GEL A;  4YDU A;  4BR4 A;  4CIG A;  4FLU A;  4FK2 A;  2P9S B;  1OH8 A;  4X66 H;  3N4Q A;  3KK1 A;  4OLA A;  5HRO A;  1RBT A;  1TK8 A;  1VAZ A;  2PQU A;  4NBQ A;  4CBU A;  2P9K B;  4C1N I;  5ADX A;  3OBY A;  4B3R H;  3G10 A;  1K8A O;  3AO5 A;  3D0P A;  1IH7 A;  4C8N A;  3I8B A;  3WUH A;  3AVH A;  3FZH A;  1FJG H;  1GLD G;  4CJL A;  3L3V A;  3CF5 L;  1WB9 A;  1J54 A;  4B3T K;  3G6E N;  5BRE A;  3E1Y A;  3LL3 A;  3WXI A;  4KH6 A;  4DTO A;  1XMO H;  2AA4 A;  4WQ5 A;  2GEM A;  5KPT A;  2FFM A;  4O0J A;  3O3H A;  3P5J A;  4YOX A;  1EXQ A;  4DFP A;  1KVA A;  4OJR A;  3ENH A;  4Y1D A;  3SBT A;  2NZT A;  3R8E A;  4E1N A;  2Q3S A;  1IG8 A;  4CJ4 A;  1HJR A;  3SCX A;  5BRH A;  4IBN A;  5CYQ A;  3HSC A;  2HOE A;  3KLE A;  3QEV A;  4MLE A;  1IG9 A;  4CJF A;  1NJY A;  4MO4 A;  4DF4 A;  3O08 A;  2BA0 A;  3D2E B;  4DR5 H;  5HRP A;  4DQQ A;  2PFU A;  3D45 A;  1HNW K;  2D0O A;  1X9S A;  4B3S K;  3AVF A;  4Z4F A;  2CPQ A;  4RTF D;  3HZ6 A;  4C8K A;  4E9J A;  4F2R A;  3QFP A;  4FK4 A;  1LV5 A;  4B1W B;  1LWC A;  4AHT A;  2I7N A;  3LAM A;  3BP8 A;  1SKS A;  4JI5 H;  1N32 H;  2IDO A;  1N33 K;  1Q81 O;  1TK5 A;  3MWP A;  3HP6 A;  4U67 L;  2GX9 A;  4DV7 K;  4CE9 A;  1IKY A;  1QTM A;  3E9P A;  3E66 A;  1Q82 O;  3DLK A;  3HST B;  3VQC A;  1LW0 A;  5ELZ A;  4AH9 A;  2A1S A;  1TL1 A;  1NJZ A;  3C6T A;  1IBM H;  4OPA A;  3CCJ N;  3AAQ A;  3GL1 A;  3VEV A;  4YFU A;  2HHV A;  4FJJ A;  3LP1 A;  1LCU A;  1TUA A;  2JVZ A;  4BRF A;  3H1V X;  4O5F A;  3V4I A;  1O13 A;  1WOQ A;  2VYP A;  3T1H H;  4C8L A;  3ZX2 A;  4FJL A;  2RHK A;  5C24 A;  4N5S A;  2D4W A;  4YNQ A;  4CZH A;  2JWK A;  4U7B A;  1IO2 A;  5JMV A;  5C0X G;  2BE2 A;  3D6R A;  4XH5 A;  3LM2 A;  2QWQ A;  1RT2 A;  4PUO A;  1RBS A;  3I55 N;  2AP1 A;  3E9L A;  4PY5 A;  3L2V A;  4CFA A;  2Q97 A;  1JXE A;  3SQ4 A;  1BHL A;  4LF9 H;  3V9X A;  3S3N A;  3KWG A;  3S3M A;  2KZZ A;  4DR1 H;  1L3T A;  1JCF A;  4KHU A;  3GG4 A;  4BC4 A;  2ZWH A;  1LOT B;  2PZS A;  4GV3 A;  3CJA A;  4M3Y A;  1HKC A;  4B8T A;  3SQ1 A;  4FJN A;  3CJ7 A;  4I6M A;  3ZX0 A;  3I0R A;  1BDG A;  3QNO A;  3PY8 A;  5GAD P;  3DJC A;  4M3U A;  1WSF A;  5AQI A;  1JCE A;  1VHX A;  3M1F A;  3CQ8 A;  4Q5V A;  4FJ7 A;  4FJM A;  1WBB A;  5AQR A;  4JRQ A;  4KV8 A;  3SV4 A;  1KC8 O;  4JHD B;  4XEI A;  3JS6 A;  3ULD A;  4NXN H;  3OET A;  1OH5 A;  2O4G A;  1SS6 A;  2Z1G A;  3CET A;  3VEY A;  3U9Z A;  3OA9 A;  3L8B A;  1YF5 L;  4DSF A;  4BRN A;  2FSK A;  4LD0 A;  3MXI A;  3RRH A;  4CHO A;  2GUI A;  2X6N A;  1SEI A;  2AXY A;  2A42 A;  2UXC K;  3DXM B;  4RWT A;  1VSD A;  1WSE A;  4HVJ A;  2E2N A;  3K59 A;  1RDC A;  2ZM6 H;  3JAM O;  1S22 A;  4OKJ A;  4OPJ A;  1NKC A;  3CCV N;  1WN7 A;  3PUF A;  5J2P A;  2QWM A;  3L2R A;  4OGC A;  1FW6 A;  4WE1 A;  4OO1 G;  2JZX A;  4BWM A;  2QKK A;  4KO0 A;  4OD6 A;  1RCH A;  2F96 A;  2Q2R A;  3ZSR A;  3I8D A;  4BDZ A;  3TAN A;  4CJV A;  3P83 D;  4RW6 A;  3TAR A;  3BDP A;  3SJJ A;  3CM5 A;  3J7Y P;  4CD3 A;  3ZSY A;  3D7E O;  5GAE P;  2X6S A;  3RVC A;  1TKX A;  1GLB G;  2VQF K;  3VPZ A;  4LSN A;  1RDD A;  4FLZ A;  2GTD A;  4DWI A;  5GIP A;  4FVM A;  4E7K A;  4FJH A;  3GBT A;  4H4M A;  3QO9 A;  1MWM A;  4DV5 K;  2XY5 A;  1JLF A;  2YNI A;  4WAL A;  4Y0W A;  3C65 A;  2KFZ A;  3CCQ N;  5EU7 A;  5GAG P;  5AFU H;  4IDK A;  4H5V A;  4E3S A;  4BC2 A;  3O9R A;  4CGJ A;  5JS2 A;  1VQO N;  3NFA A;  1HNX H;  2FBY A;  1CZB A;  5ADX H;  3FLC O;  2RE2 A;  1MSZ A;  3T7Z A;  3WT0 A;  1QQO A;  4RW4 A;  4FJX A;  3AVM A;  3DOL A;  1Q9X A;  1IKW A;  3HRG A;  4FWR A;  4F9O A;  3ZT1 A;  4ICL A;  4CJT A;  1G99 A;  1LWE A;  1TV6 A;  4DB3 A;  3AVK A;  5FLX O;  3OYH A;  1EWR A;  3TWH A;  1BUP A;  3WXK A;  4W5T A;  2JEA I;  2UUA K;  4DFK A;  3SMP A;  2E4L A;  3P31 A;  1BG3 A;  3LDN A;  4FYD A;  1ZXO A;  3SBG A;  3S3O A;  1D4X A;  4BR7 A;  2NRX A;  4QS9 A;  3CJ1 A;  4AHC A;  3ZSW A;  2OPR A;  2FXU A;  4CBX A;  5MLC Q;  3CQX A;  3OS1 A;  3V6D A;  3KJV A;  1WTJ A;  4K0K K;  1JLC A;  3F9K A;  1U2V A;  3M8S A;  3LWL A;  3WQU A;  2P9L B;  2ANN A;  4FJS A;  1RDA A;  2JGU A;  4DR3 K;  1YTU A;  2NRR A;  1TYQ A;  4DV0 K;  4K8Z A;  3VGL A;  4KFB A;  5AQV A;  4W5N A;  4IKF A;  1NG9 A;  1GOB A;  3BY5 A;  1XNR H;  1ODH A;  1QHA A;  4ZTF A;  1DEJ A;  3R9P A;  4KH4 A;  5SZT A;  4LF7 K;  4DR2 K;  2O8B B;  1NGI A;  3AVN A;  2YHW A;  4CHZ A;  4X62 H;  4AM6 A;  2P9S A;  2F9T A;  4FWP A;  3O1W A;  3NDK A;  1MA9 B;  1DLO A;  4JEP A;  4JYA K;  3O9T A;  2D9I A;  1HR0 H;  4CGH A;  3P38 A;  2H3G X;  3H45 C;  5BRD A;  3C94 A;  3T1Y K;  3A8Y A;  2R7Y A;  3VQE A;  4O44 A;  3NE6 A;  1PQX A;  4JI1 H;  1Y64 A;  2P9U B;  1NOY A;  2O8C A;  5LMU H;  2XRI A;  2WON A;  4M3Z A;  1NGD A;  5KPR A;  1V8C A;  4DUZ H;  4NCG A;  1KSP A;  3TSP A;  4B9S A;  4DQP A;  2E3U A;  4KHQ A;  1E3M A;  3OYD A;  3QBW A;  4JKD A;  3OHR A;  5D3G A;  4CHP A;  5TKY A;  2YCH A;  3VQ5 A;  1DT4 A;  4RCH A;  4NXM K;  5AQS A;  3O1B A;  4CGD A;  3NF7 A;  3T69 A;  2LTL A;  4O0I A;  1S72 N;  1W2B M;  4LF4 H;  2V52 B;  2IVN A;  4KI4 A;  4M3W A;  3R6M A;  3VQB A;  4GKJ H;  5AQY A;  2FSJ A;  5HLF A;  4ELT A;  3A0I X;  4PKH A;  1ILY A;  2ASO A;  3HP9 A;  2FBX A;  4DUY H;  1FKA H;  2QXL A;  1X9Z A;  4CJE A;  4LFA K;  4PWD A;  4AHU A;  1TUY A;  3SAH A;  4G9Z A;  3ENB A;  4DV1 H;  4LIJ A;  4EHU A;  3O4W A;  3HBT A;  3ZLJ A;  3GAB A;  4ZHR A;  3JYT A;  1VQK N;  2PT7 G;  2CTJ A;  4H0P A;  4K41 A;  2KLA A;  4CI6 A;  3N4P A;  4KB0 A;  2EHG A;  1KAX A;  3ID8 A;  1SKR A;  5I3U A;  3L4Q A;  5FPD A;  4LF8 H;  5EY4 A;  3PIO L;  4CZI A;  4K43 A;  2OZS A;  1T7P A;  4C1N K;  4GY2 B;  2W40 A;  5LJW A;  4FWM A;  2QTD A;  3QES A;  4RW9 A;  3MEG A;  5FDL A;  5KRT A;  2GBZ A;  4BGA A;  2ZJP L;  3L3U A;  4DTU A;  3CCM N;  1FKP A;  4AHR A;  3K5L A;  4J2A A;  3V9Z A;  2ASP A;  2HF3 A;  1U47 A;  1NK0 A;  4CK1 A;  3NMU A;  1RT5 A;  5C2D A;  2VWJ A;  4A2B A;  4YOR A;  4WFA L;  2HST A;  1BL3 A;  2D5R A;  3OYA A;  2UUB H;  4E7J A;  3EL2 A;  3ASM A;  2NRW A;  3F9M A;  1TUU A;  2OPV A;  3VER A;  3LPU A;  2DGR A;  4YOW A;  3AGK A;  4EC5 A;  1B92 A;  2DFF A;  2NLX A;  5BRF A;  4HUG A;  2HBK A;  1F21 A;  4BRP A;  4CJ7 A;  3TSU A;  3HOT A;  1C1C A;  5BR8 H;  3TAQ A;  3WNH A;  2F4V K;  4WQ4 A;  1YHQ N;  4B3M H;  5DM7 L;  4JS4 A;  4A5A A;  3F5T A;  1HQE A;  3HO1 A;  2IVP A;  2O8D B;  3KK2 A;  4DQR A;  4JI6 H;  3J80 W;  4JI0 H;  4LF6 H;  1BO5 O;  2O8E A;  1JLB A;  3H3N O;  4DS5 A;  1HPM A;  1UAX A;  2G8I A;  4DR6 K;  4JHD A;  2JE6 I;  4DCH A;  5BN8 A;  4JI8 K;  4Q0B A;  1X4N A;  4IWV A;  4OX9 K;  1YI2 N;  4ILJ A;  4W5Q A;  4DFM A;  3QEI A;  3VES A;  4GVE A;  3DM2 A;  4FWN A;  5C42 A;  5JLF A;  5AQL A;  1C0G A;  4CF9 A;  2IVO A;  3K5N A;  2G8U A;  4BE2 A;  2FF3 B;  4EAH D;  2WOM A;  3ULE B;  4X65 K;  1BIZ A;  3G4S N;  3SQ2 A;  5AQP A;  3NVM A;  2P9P B;  1RT6 A;  3UKR A;  5FPM A;  4LFB H;  4CEZ A;  2OPS A;  4I2Q A;  4JI3 H;  1VRU A;  1S1V A;  5IWA K;  3ZT0 A;  3DLB A;  4GKK K;  2ZF5 O;  1EP4 A;  2JLE A;  3NHG A;  3O9S A;  3P4I A;  4KHY A;  2Z1H A;  2FBT A;  4CF8 A;  3M8P A;  5AR0 A;  5CE3 A;  4BC5 A;  3OYI A;  2UXB K;  2BAN A;  4B9V A;  1VQN N;  4CF0 A;  5LL6 b;  1BA0 A;  2FF6 A;  3ATV A;  2D0A A;  4AM7 A;  4EP5 A;  3HVT A;  3J7A P;  3SLC A;  3TR8 A;  3O4N A;  4B1U B;  4OVL A;  1WSH A;  4FOE A;  1JLE A;  4BY9 C;  4AQY H;  1S1U A;  4BQL A;  1Q9Y A;  1KFS A;  1ZBH A;  5A2Q O;  4CIF A;  5AZJ A;  4DV6 H;  2X06 A;  1NMD A;  3OYE A;  4KB1 A;  3DXK A;  3QML A;  1SUQ A;  2ANR A;  4DTS A;  3TAB A;  4FJG A;  5LMN H;  2D0C A;  4DR7 H;  2UXD H;  3SAF A;  1OVQ A;  5C2F A;  1DGK N;  4BR9 A;  4YY3 H;  3C7N A;  2HH2 A;  5AFU A;  1A5X A;  4CZM A;  1XMO K;  3RR8 A;  5KQ8 A;  2VKC A;  1HUX A;  5KRS A;  1ZBL A;  1WVN A;  2YI1 A;  1J5E H;  2ETJ A;  2HBM A;  3QIO A;  1CXQ A;  2QW9 A;  3VQA A;  3UIQ A;  3LAL A;  2WBN A;  3J80 O;  1JCG A;  3JXU A;  5B8H A;  4JLH A;  4CHQ A;  4B9U A;  3CC4 N;  1DTT A;  4CZF A;  2A6A A;  1NK4 A;  2E8A A;  2Q0R A;  1OKJ A;  2BH1 A;  5AQW A;  3TTF A;  1W0H A;  3V1R A;  1SL0 A;  3L2U A;  4DU1 A;  1C0F A;  1RTD A;  3HI0 A;  4EIA A;  1V9N A;  1VSM A;  1XHZ A;  3ZEU A;  1K6Y A;  4NCA A;  1BI4 A;  4A57 A;  4M42 A;  2OPU A;  3AVJ A;  4GV6 A;  1Z6R A;  3T19 A;  3DI6 A;  3ZX3 A;  4BQZ A;  4BC3 A;  3UB5 A;  4NZR M;  3A5N C;  3OS0 A;  2YHA A;  2IIR A;  3A2F A;  2RPI A;  4IOC L;  3NBP A;  3QFU A;  4N76 A;  1V4T A;  1JJ2 M;  3NF9 A;  3CXC M;  2OA8 A;  4M3T A;  1FXX A;  3MN6 A;  3HYF A;  1RTI A;  1XNQ K;  1NM1 A;  4MDA A;  4LH5 A;  4K42 A;  4BRQ A;  4FLW A;  4NLB A;  5J2M A;  2DFH A;  3CFP A;  3V9U A;  4E89 A;  1S20 A;  4B3T H;  2ITG A;  3W3D A;  4FW1 A;  4RW7 A;  4BR0 A;  3P1G A;  3DLR A;  3K2P A;  3DOK A;  4FW2 A;  3U3G A;  4B8C A;  3JAM W;  3FGU A;  3ATU A;  3SQ0 A;  1X9J A;  2VWB A;  4JKE A;  1RDU A;  4Y1C A;  3AAR A;  2A41 A;  2P2R A;  3VQQ A;  2QWR A;  4IO8 A;  3PSI A;  4DU3 A;  1IV0 A;  2P9U A;  1D5A A;  4HWI A;  1N34 K;  1D9D A;  4WFN L;  3OYG A;  2P5O A;  4FSV A;  3SUO A;  5LY3 A;  4KI6 A;  4CJ3 A;  3K9K A;  4FLX A;  3BZK A;  1YVN A;  4LF9 K;  1BGX T;  4M45 A;  5T7B A;  4WYB A;  3AVC A;  4H5W A;  1NGA A;  1HNW H;  1NLV A;  1RT3 A;  3H3O B;  3KK7 A;  2XY7 A;  2ZQB A;  3V1Q A;  2ZE2 A;  3CCR N;  1ASU A;  3LWM A;  1YAG A;  1HNI A;  1C0T A;  3FZL A;  2KTQ A;  4KKO A;  2HNZ A;  1Z2I A;  3VQP A;  4QCL A;  2P9N B;  1C6V A;  5F1X A;  1Z05 A;  5AZI B;  1YIJ N;  4JV5 K;  1RBV A;  1TKT A;  3MN7 A;  3OTO K;  1N33 H;  1K8K B;  2D1K A;  2E2O A;  3CI5 A;  2MJH A;  4DV7 H;  1GOA A;  3CG7 A;  3D2F B;  3VMF B;  4AHS A;  3RSE A;  4PL7 A;  3SI6 A;  4PKI A;  3PO5 A;  3LP0 A;  5GIO A;  3HK2 A;  4JI2 K;  4DTJ A;  2Q1N A;  3OS2 A;  2HBJ A;  1XMQ K;  3IKM A;  1KLM A;  3SYZ A;  1SQK A;  3AAP A;  1TVR A;  3MX2 A;  5FLX W;  5AQF A;  1N5Y A;  3PIP L;  1QSY A;  4ZTJ A;  4FWO A;  3VET A;  3U8X A;  2DY4 A;  4ID5 A;  1B9D A;  1YJW N;  5AJ3 K;  4DLE A;  4KHP H;  1J53 A;  5CR4 A;  1CXU A;  1X1P A;  1T6D A;  4BDY A;  1Q18 A;  4CHY A;  4H0Y B;  1I94 K;  2IC3 A;  3CCE N;  1BCM A;  1T44 A;  2CTE A;  4BRM A;  3UE5 A;  4DSL A;  1I6U A;  1UA0 A;  2F7T A;  4BRI A;  3NGY A;  4J8F A;  2CWH A;  3EKU A;  3NH1 A;  4HUF A;  1GLA G;  4JVH A;  4R79 A;  3PX6 A;  3CYM A;  3VEO A;  1KAY A;  1TK0 A;  1Z25 A;  1C1B A;  3NGI A;  3ZT2 A;  1KLN A;  3GE1 A;  4V19 S;  2BUP A;  1ZBS A;  1U45 A;  3OYK A;  2YKM A;  4KPY A;  4ISG A;  4RG8 A;  3VQ9 A;  4CZL A;  1IBL H;  3DRR A;  1L3V A;  3HOS A;  1TGO A;  1R59 O;  3MX5 A;  4E7I A;  3C95 A;  4ISE A;  4BWJ A;  4IJA A;  3RTV A;  5BPM A;  4W5O A;  4DR4 H;  2O8D A;  4AF1 A;  4CJU A;  2XY6 A;  4DU4 A;  2K1H A;  4FPA A;  3I33 A;  1X4M A;  4BA2 I;  1X0A A;  4CES A;  3ITH A;  4W5R A;  4OO1 J;  1KFD A;  1XWL A;  3EEQ A;  4H0O A;  2QI2 A;  1KCF A;  1QVG M;  5AQM A;  1IBK H;  4CZE A;  1EET A;  1RDB A;  4CEO A;  3ZSZ A;  4DS4 A;  4IJN A;  1S03 G;  2QWO A;  2CTF A;  1C1A A;  3ZET B;  5HRR A;  2E88 A;  5HP1 A;  1JLG A;  4JKG B;  1XC3 A;  4PL8 A;  2XHB A;  3K58 A;  5JS1 A;  1XC9 A;  3AVB A;  3L6Q A;  4X64 K;  3ULE A;  2JEB I;  1JXB A;  4JD2 A;  3H46 O;  3S9H A;  1QQN A;  4C8O A;  3M8Q A;  4KTZ A;  3L2W A;  3TSQ A;  4JI7 H;  1U04 A;  3AVG A;  4EZ6 A;  2E5L K;  4DV2 K;  3V81 A;  2FLO A;  4IXC A;  1DTQ A;  1XNR K;  2KW4 A;  1NMN A;  5C15 A;  3GKU A;  3SPZ A;  3V1O A;  4CJS A;  4BRL A;  4CVN E;  1NK8 A;  1IJJ A;  4XH1 A;  3VKE A;  3KTQ A;  4YOT A;  2HH3 A;  1RTJ A;  3FAU A;  5TKW A;  2CGL A;  1RFQ A;  3J81 O;  3GR5 A;  3PV8 A;  2ZGY A;  1BWF O;  1HPZ A;  3OJU A;  3THW A;  1AN7 A;  1S1X A;  2YJE A;  5E84 A;  4B9N A;  5EOY A;  1W7A A;  5KPZ A;  3LM9 A;  1ASV A;  2W6K A;  1HQU A;  3DLH A;  3CMA N;  3QDK A;  4K25 A;  4A2A A;  2VG6 A;  4I7F A;  5HRN A;  1XRH A;  4WAN A;  3SUN A;  1BIU A;  4DQS A;  1G15 A;  3A5O C;  4GMJ B;  1HX1 A;  5LMU K;  1NK7 A;  3AO4 A;  4JK8 A;  4LFC K;  1JKH A;  1LWF A;  5SWM A;  4ELV A;  4DUZ K;  3SV3 A;  4BA1 I;  1WUA A;  1H1V A;  2UUA H;  2KKZ A;  4ILG B;  2O4I A;  1QZ5 A;  3I0S A;  2P9K A;  1LAV A;  4M7X A;  1E4F T;  2GUP A;  1MWK A;  3FFK B;  4Z0U A;  1WSJ A;  1ZBI A;  3AA2 A;  3OY9 A;  2G8H A;  3LZI A;  3CPE A;  3AEV B;  2E2P A;  4K0K H;  4LF4 K;  1S6P A;  3K0S A;  3AA5 X;  1BA1 A;  1DT9 A;  4H03 B;  5M1N A;  1Q8I A;  2IAJ A;  3VA0 A;  1J5O A;  4GKJ K;  2FSN A;  5AQQ A;  1NK9 A;  1U49 A;  2O8F B;  3CCU N;  5AQJ A;  2EX3 A;  2Y1J A;  3V9W A;  1ESV A;  3MN9 A;  4LF7 H;  1VQ8 N;  1A5W A;  1VQ4 N;  4NYF A;  2Z1I A;  4GV9 A;  1ZZK A;  4H8K A;  1KD1 O;  3BUZ B;  4H0T B;  4AM3 A;  2QXF A;  4DTN A;  4YOU A;  1NU0 A;  5GIN A;  2WFB A;  2UUC K;  1GLF O;  3WXM B;  1KVC A;  3VGK A;  2UU9 K;  1EKE A;  1TKD A;  4JYA H;  5EVZ A;  4CZG A;  4DTP A;  4JKA A;  3VGM A;  3D2E A;  4CCH A;  4LY7 A;  4JI4 K;  1CZA N;  3OJS A;  3K57 A;  3O5B A;  4O5B A;  3CCL N;  2Q0U A;  2HF4 A;  4R5P A;  3DLE A;  1ZZI A;  3ZSO A;  5J2Q A;  4IO9 L;  2CGJ A;  5IT9 O;  1RIL A;  1X9M A;  1N36 K;  1VK0 A;  4MFB A;  4H4O A;  4FXD A;  3HVR A;  1C0U A;  3HPH A;  1NNE A;  1VIG A;  3VQ6 A;  4CEF A;  1NGJ A;  2ITM A;  1D8Y A;  3EO3 A;  1J4W A;  2Z0S A;  3QB0 A;  4CEA A;  3CC7 N;  3THY B;  2O4C A;  1ITG A;  4FWQ A;  1ATS A;  4PA1 A;  5LL6 Z; 
#chains in the Genus database with same CATH homology
 1S1U A;  1TKZ A;  4C8L A;  4FJL A;  1Q9Y A;  1KFS A;  1ZBH A;  3ISN C;  5C24 A;  4CIF A;  1HYV A;  4N5S A;  2GV9 A;  4YNQ A;  1FK9 A;  4KAZ A;  1IKV A;  3OYN A;  3MEE A;  3OYE A;  4IG3 A;  3TAE A;  2HHS A;  2X74 A;  3CFO A;  2HHW A;  1IO2 A;  3QEX A;  4KB1 A;  1RBU A;  1SUQ A;  1HNV A;  3AO2 A;  4OGE A;  3O3F A;  2BE2 A;  4DTS A;  3TAB A;  4FJG A;  2D0C A;  4N41 A;  1RT2 A;  4PUO A;  3KIO A;  1RBS A;  1NK5 A;  1B9F A;  5C25 A;  4PY5 A;  4FJX A;  3L2V A;  4CFA A;  1FKO A;  1JXE A;  3SQ4 A;  4DQI A;  1BHL A;  1EX4 A;  4FZY A;  1A5X A;  3V9X A;  3S3N A;  3RR8 A;  3S3M A;  4ELU A;  4L8R B;  2KZZ A;  2YNH A;  5K14 A;  4GW6 A;  1L3T A;  4KHU A;  5KRS A;  1ZBL A;  3QEW A;  2P1J A;  3V9S A;  2ETJ A;  3QIO A;  1CXQ A;  2PZS A;  4M3Y A;  3SZ2 A;  3LPT A;  1N6Q A;  1R0A A;  2P5G A;  4M3R A;  4OPK A;  4BE0 A;  3VQA A;  3SQ1 A;  3UIQ A;  3LAL A;  4FJN A;  3QET A;  3KD5 E;  3I0R A;  3QNO A;  1BI4 B;  1Y97 A;  4JLH A;  3PY8 A;  4CHQ A;  4M3U A;  1WLJ A;  4B9U A;  1WSF A;  4CFD A;  1DTT A;  3AA3 A;  3KLI A;  3CQ8 A;  4FJ7 A;  2HB5 A;  4Q5V A;  4LH4 A;  1NK4 A;  4FJM A;  1RNH A;  3V1R A;  1W0H A;  3KLG A;  3TAF A;  3KD1 E;  4HUE A;  4JRQ A;  4KV8 A;  3SV4 A;  1SL0 A;  1TL3 A;  2RKI A;  3L2U A;  4DU1 A;  3ULD A;  3QEP A;  1RTD A;  4CEE A;  2O4G A;  4FJI A;  1VSM A;  1XHZ A;  4IG0 A;  2Z1G A;  1VSL A;  1K6Y A;  4KRF A;  1NK6 A;  4NCA A;  4FM2 A;  3SPY A;  4O55 A;  3L8B A;  3SUP A;  4PQU A;  4DSF A;  1XHX A;  4J2D A;  1BI4 A;  3QIP A;  4LD0 A;  2B4J A;  4CER A;  4CEQ A;  3RRH A;  4CHO A;  3MXI A;  2GUI A;  2X6N A;  3AVJ A;  1KRP A;  4HTU A;  1YTA A;  3T19 A;  3DI6 A;  5J1E A;  4FJ8 A;  3AO1 A;  2KZM A;  4DLG A;  4DG1 A;  3EZ5 A;  1VSD A;  1QSS A;  1WSE A;  4HVJ A;  1ZBF A;  3OS0 A;  2YHA A;  3K59 A;  1RDC A;  4F2S A;  2HHQ A;  2RF2 A;  3U6F A;  1W9H A;  3B6O A;  2DTU A;  3A2F A;  2RPI A;  1D9F A;  2RN2 A;  3NBP A;  3SUQ A;  2KQ2 A;  4N76 A;  5FRM A;  2BGG A;  3NF9 A;  4OKJ A;  4OPJ A;  1NKC A;  4UQG A;  3HL8 A;  2OA8 A;  5KGX A;  4M3T A;  1WN7 A;  4IFV A;  4FLY A;  3VQD A;  1TAU A;  1FXX A;  3DLG A;  3PUF A;  4MQ3 A;  4I2P A;  4FLV A;  3HYF A;  4DTR A;  1RTI A;  3EY1 A;  4I9L A;  4CGI A;  1L3S A;  5J2P A;  4LH5 A;  4FXD A;  2HMI A;  3L2R A;  4OGC A;  4FLW A;  3OYM A;  2QKB A;  2E6M A;  5J2M A;  1BQM A;  2DFH A;  3CFP A;  3TAP A;  3ZSX A;  4WE1 A;  4E89 A;  3V9U A;  2ITG A;  2Z1J A;  3RMD A;  4FW1 A;  3BGR A;  4BWM A;  2QKK A;  4RW7 A;  4KO0 A;  3P1G A;  3DLR A;  4KHW A;  3NF8 A;  1RCH A;  2F96 A;  3K2P A;  3ZSR A;  4CJP A;  3DOK A;  4FW2 A;  3U3G A;  4N56 A;  4B8C A;  3I8D A;  4BDZ A;  3TAN A;  2FBV A;  4CJV A;  4CHN A;  3P83 D;  4RW6 A;  3TAR A;  3BDP A;  3SJJ A;  3CM5 A;  3SQ0 A;  4E1M A;  4B08 A;  4B9M A;  3ZSY A;  4Y1C A;  3OYB A;  1UOC A;  2X6S A;  4CK2 A;  1TKX A;  1A5V A;  1RT4 A;  1HMV A;  3VQQ A;  4AIL C;  5KI6 A;  4LSN A;  4CFB A;  4M41 A;  4JRP A;  4DF8 A;  1RDD A;  3G0Z A;  3VN5 A;  3L2Q A;  4FLZ A;  4DU3 A;  4DTX A;  4DWI A;  2YKN A;  1VSK A;  1S1W A;  1I3A A;  1RBR A;  1S1T A;  4FVM A;  4E7K A;  4FJH A;  4FM1 A;  4H4M A;  3QO9 A;  3OYL A;  2XY5 A;  1JLF A;  2YNF A;  2YNI A;  1D5A A;  2IOC A;  4CEC A;  1D9D A;  2YV0 X;  2KFZ A;  3OYG A;  5EU7 A;  4DSK A;  3OYJ A;  2P5O A;  3EYZ A;  3SUO A;  4IDK A;  4KI6 A;  4CJ3 A;  2PYJ A;  4E3S A;  4BDP A;  4FLX A;  2F8S A;  4CGJ A;  3AO3 A;  5JS2 A;  2IGI A;  3ZSV A;  3NFA A;  4DMN A;  2FBY A;  1CZB A;  4AHV A;  1BGX T;  3QLH A;  4N47 A;  4M45 A;  3WNG A;  1WAJ A;  5T7B A;  2PYL A;  2I5J A;  4XIU A;  4GVM A;  3AVC A;  1NKB A;  1MSZ A;  1WNS A;  1I39 A;  1RT3 A;  1UWB A;  1KTQ A;  2XY7 A;  2ZQB A;  3QIN A;  1LAW A;  1VSF A;  1WSG A;  2ZE2 A;  3B6P A;  4RW4 A;  1ASU A;  3V1Q A;  3LWM A;  3AVM A;  3DOL A;  1Q9X A;  1IKW A;  1HNI A;  1C0T A;  3THV A;  1WHR A;  2KTQ A;  4KKO A;  3PO4 A;  2HNZ A;  3ALY A;  3CM6 A;  3VQP A;  1NJX A;  1JLA A;  3ZT1 A;  4QCL A;  4ICL A;  4CJT A;  2XO7 A;  1IKX A;  1C6V A;  1LWE A;  1TV6 A;  4F3T A;  4EP4 A;  4CK3 A;  1S9E A;  4B9T A;  3OVN A;  3AVK A;  4KTW A;  2HHX A;  1RBV A;  3OYH A;  3TWH A;  1TKT A;  5HBM A;  1T05 A;  4W5T A;  4KHN A;  4LSL A;  1S5J A;  2P51 A;  4DFK A;  1BCO A;  2E4L A;  4Z4C A;  4FYD A;  4E7L A;  3S3O A;  1GOA A;  3CG7 A;  4AHS A;  3PO5 A;  3SI6 A;  4AHC A;  2OPP A;  3LP0 A;  2OPR A;  3ZSW A;  4F3O A;  2KFN A;  2NUB A;  3OS1 A;  3HK2 A;  3V6D A;  1BIS A;  4CJR A;  4FCY A;  4DTJ A;  3KJV A;  4C8M A;  2FC0 A;  1JLC A;  1GOC A;  3F9K A;  1SL1 A;  4M3X A;  4FK0 A;  3OS2 A;  3TAG A;  3M8S A;  1YVU A;  3LWL A;  4DTM A;  1KLM A;  1RDA A;  2JGU A;  3MEC A;  3SYZ A;  1TVR A;  4HHT A;  1YTU A;  1SV5 A;  3RMA A;  1N5Y A;  4TSX A;  2G8V A;  1J9A A;  1QSY A;  5KTQ A;  4E0D A;  4BE1 A;  4ZTJ A;  4K8Z A;  4KFB A;  3AA4 A;  4CJK A;  4J2E A;  4HCC A;  4W5N A;  4IKF A;  1GOB A;  2DY4 A;  5J2N A;  3LAN A;  4ID5 A;  3FFI A;  1WAF A;  4ZTF A;  1B9D A;  4DFJ A;  3K5M A;  5SZT A;  1JL1 A;  3AVL A;  4DLE A;  3IAY A;  1J53 A;  1CXU A;  1X1P A;  4FM0 A;  1HYS A;  4BDY A;  2Y1I A;  4ID1 A;  4DSJ A;  3AVN A;  4CHZ A;  1RT7 A;  1REV A;  2LSN A;  4CHY A;  3NGZ A;  2IC3 A;  3VA3 A;  4KHS A;  3NDK A;  1DLO A;  3NF6 A;  1BCM A;  3HJF A;  3T1A A;  4DSL A;  4FZX C;  1UA0 A;  1QQC A;  1KVB A;  3NGY A;  4CGH A;  1CLQ A;  3NH1 A;  4HUF A;  2DFE A;  3M8R A;  3PX6 A;  1RTH A;  2HVI A;  2VG7 A;  3CYM A;  4CIE A;  4DSI A;  3C94 A;  4KRE A;  2R7Y A;  1TK0 A;  3VQ7 A;  1Z25 A;  1C1B A;  3VQE A;  3NGI A;  3ZT2 A;  2VG5 A;  4O44 A;  3RMC A;  4FZZ A;  3WNF A;  3LDS A;  3NE6 A;  1KLN A;  4QOZ B;  4KTQ A;  4CEB A;  3NCI A;  3KKR A;  1NOY A;  3TAM A;  1U45 A;  1RT1 A;  3OYK A;  1QSL A;  3IG1 A;  2YKM A;  2XRI A;  2WON A;  3DMJ A;  3O4Q A;  4KPY A;  4M3Z A;  2G8W A;  4RG8 A;  3KK3 A;  3VQ9 A;  4FJ9 A;  4IFY A;  3DRR A;  1YT3 A;  5CZ1 A;  4NCG A;  3O3G A;  4B9V A;  1KSP A;  4B9S A;  4DQP A;  4B9L A;  4OLB A;  5I42 A;  3SNN A;  2HHU A;  3DRS A;  3HPG A;  1QS4 A;  1TGO A;  1L3V A;  4KHQ A;  4Z4I A;  3OYD A;  5E41 A;  3QER A;  3DYA A;  5FRO A;  4E7I A;  3C95 A;  4BWJ A;  3RTV A;  5D3G A;  1QHT A;  4CHP A;  4W5O A;  3TI0 A;  3VQ5 A;  4CJU A;  2XY6 A;  4DU4 A;  4CGD A;  2W42 A;  3HM9 A;  4FJK A;  3NF7 A;  4O0I A;  4RW8 A;  5KGW A;  2BDP A;  4CES A;  3ITH A;  4W5R A;  1KFD A;  1XWL A;  3LAK A;  4KI4 A;  4JS5 A;  4M3W A;  1KCF A;  3VQB A;  4E7H A;  2PY5 A;  1JLQ A;  5HLF A;  3PX0 A;  3NH2 A;  2OYQ A;  4ELT A;  4DSE A;  1EET A;  1RDB A;  4CEO A;  3ZSZ A;  2YNG A;  4F8R A;  2VWK A;  2D0B A;  1L5U A;  3HP9 A;  4DS4 A;  1U48 A;  2FBX A;  5DMR A;  5CY4 A;  2ZD1 A;  4CJE A;  2YHB A;  3PX4 A;  1C1A A;  2E6L A;  2HHT A;  4J2B A;  4PWD A;  4Z4E A;  4CF2 A;  1TAQ A;  3AVA A;  1CZ9 A;  5HRR A;  3ZSQ A;  3VQ4 A;  2ATQ A;  4AHU A;  5HP1 A;  3OYC A;  3NAE A;  4CJ5 A;  3DRP A;  1JLG A;  4CED A;  3K58 A;  2XHB A;  4F4K A;  5JS1 A;  2IS3 A;  3MXM A;  2HND A;  1XC9 A;  3AVB A;  3MAQ A;  3MXJ A;  2G8F A;  1JXB A;  4ZHR A;  3ZCM A;  1VSJ A;  3JYT A;  3RMB A;  3S9H A;  4C8O A;  3M8Q A;  4KTZ A;  5CYM A;  2CPM A;  4KB0 A;  2EHG A;  3ZT4 A;  3L2W A;  3RRG A;  1U04 A;  3AVG A;  1SKR A;  5I3U A;  4EZ6 A;  2B5J A;  3V81 A;  1DTQ A;  3HPO A;  2KW4 A;  1NJW A;  4K8X A;  3RWU A;  3GKU A;  3SPZ A;  3V1O A;  4CJS A;  2OZS A;  1T7P A;  2LRR A;  2HW3 A;  4B3O A;  1NK8 A;  2HVH A;  1O1W A;  3QES A;  3KTQ A;  3LP3 A;  4RW9 A;  1RTJ A;  3MEG A;  5FRN A;  5FDL A;  5KRT A;  2GBZ A;  1S6Q A;  4CIG A;  4FLU A;  3L3U A;  4DTU A;  4CJQ A;  4FK2 A;  4Z4G A;  4QAG A;  1SKW A;  3KK1 A;  4OLA A;  1FKP A;  4AHR A;  3PV8 A;  3K5L A;  5HRO A;  4J2A A;  4HCB A;  1UG8 A;  1RBT A;  3V9Z A;  3T3F A;  1TK8 A;  1U47 A;  1HPZ A;  3OJU A;  1NK0 A;  4CK1 A;  4FLT A;  1RT5 A;  1S1X A;  2HNY A;  2VWJ A;  4B9N A;  3JSM A;  4CJW A;  2F8T A;  2A1R A;  3HXM A;  1XI1 A;  1ASV A;  1BL3 A;  1HQU A;  1LW2 A;  2D5R A;  3IRX A;  3OYA A;  3DLH A;  1S9G A;  4E7J A;  1HRH A;  3G10 A;  3ASM A;  3AO5 A;  3D0P A;  1BQN A;  1IH7 A;  2VG6 A;  4I7F A;  4C8N A;  5HRN A;  2OPQ A;  2OZM A;  3AVH A;  3SUN A;  1BIU A;  1T03 A;  4DQS A;  3CFR A;  1G15 A;  4CJL A;  3LPU A;  3KLF A;  4GMJ B;  3LZJ A;  3L3V A;  1NK7 A;  2AJQ A;  3AO4 A;  3HT3 A;  1B92 A;  1JKH A;  4CGF A;  1LWF A;  1J54 A;  2DFF A;  5SWM A;  4ELV A;  4HUG A;  3SV3 A;  1F21 A;  1ZYQ A;  1T8E A;  1C1C A;  2QK9 A;  1JL2 A;  3TAQ A;  2O4I A;  4G1Q A;  3WNH A;  3E01 A;  3I0S A;  4DTO A;  1LAV A;  1SL2 A;  4JS4 A;  1HQE A;  4Z0U A;  3WNE A;  1WSJ A;  1ZBI A;  3HO1 A;  4O0J A;  3O3H A;  3AA2 A;  3P5J A;  4I9Q A;  3KK2 A;  2XY8 A;  1EXQ A;  3OY9 A;  4DFP A;  1KVA A;  3LZI A;  4OJR A;  4OKE A;  4DQR A;  2G8H A;  4Y1D A;  3RR7 A;  3C6U A;  1S6P A;  1JLB A;  2Q3S A;  4E1N A;  5HRS A;  3AA5 X;  3NH0 A;  1Q8I A;  4CJ4 A;  4DS5 A;  2IAJ A;  1HJR A;  1QE1 A;  3SCX A;  3VA0 A;  4IBN A;  4OKK A;  1J5O A;  5CYQ A;  3KLE A;  3QEV A;  1NK9 A;  1UAX A;  2G8I A;  1L3U A;  1U49 A;  3AVI A;  1IG9 A;  4CJF A;  1NJY A;  2EX3 A;  4DF4 A;  4CGG A;  2Y1J A;  1ASW A;  3QNN A;  1UA1 A;  1NOZ A;  4Q0B A;  3K5O A;  2B6A A;  3V9W A;  5HRP A;  4DQQ A;  1VSI A;  2G8K A;  3D45 A;  3MED A;  4W5Q A;  4DFM A;  3QEI A;  1X9S A;  4BAC A;  1A5W A;  3AVF A;  4NYF A;  2Z1I A;  3DM2 A;  5CZ2 A;  1X9W A;  4Z4F A;  4H8K A;  1U4B A;  5C42 A;  3U3Y A;  1ZBU A;  2QXF A;  4DTN A;  4C8K A;  4F2R A;  4CF9 A;  3KKS A;  4FK4 A;  1LV5 A;  1C0M A;  3K5N A;  2G8U A;  1HYZ A;  1Z26 A;  2X78 A;  4BE2 A;  1KVC A;  2WOM A;  1EKE A;  4CF1 A;  1LWC A;  1TKD A;  1BIZ A;  4AHT A;  3LAM A;  1NKE A;  4DTP A;  3SQ2 A;  1SKS A;  2IDO A;  1RT6 A;  3AV9 A;  4B8A B;  1TK5 A;  4CCH A;  3KLH A;  4LY7 A;  4CEZ A;  2OPS A;  3VQ8 A;  3OJS A;  3HP6 A;  4I2Q A;  3K57 A;  4O5B A;  1VRU A;  1S1V A;  3ZT0 A;  3DLB A;  4O4G A;  3ZT3 A;  4R5P A;  1EP4 A;  3DLE A;  4CE9 A;  2JLE A;  1IKY A;  3ZSO A;  3NHG A;  3H08 A;  1QTM A;  4KHY A;  2Z1H A;  1VSH A;  2FBT A;  5J2Q A;  4CF8 A;  3M8P A;  3DLK A;  3HST B;  3F73 A;  1RIL A;  3VQC A;  1X9M A;  5DK5 A;  3OYI A;  4Z4H A;  2BAN A;  1VK0 A;  1LW0 A;  3IS9 A;  4H4O A;  4MFB A;  4CF0 A;  4AH9 A;  2A1S A;  1C0U A;  3HPH A;  1TL1 A;  3HVR A;  1NJZ A;  4EZ9 A;  3C6T A;  4M42 A;  2D0A A;  1WSI A;  3VQ6 A;  4FJ5 A;  4CEF A;  4EP5 A;  4NYN A;  4NCB A;  3HVT A;  1D8Y A;  4YFU A;  3TR8 A;  3O4N A;  3LP2 A;  4CEA A;  4FJJ A;  2HHV A;  3LP1 A;  1MU2 A;  1VSE A;  1WSH A;  4OVL A;  1VRT A;  4CFC A;  4E19 A;  1ITG A;  1JLE A;  3OYF A;  3V4I A;  4PA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...