2CTEA

Solution structure of the 1st kh type i domain from human vigilin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
94
structure length
94
Chain Sequence
b'GSSGSSGDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vigilin
publication title Solution structure of the 1st KH type I domain from human Vigilin
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 17
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2cteA01
1WE8A 4BA1I 2CTLA 2MJHA 1DT4A 2ANRA 1KHMA 2JEBI 1VIGA 4AM3A 2HH2A 2AXYA 1X4MA 1X4NA 2NN6G 3V69A 2QNDA 1J4WA 1K1GA 1EC6A 1ZTGA 2CTKA 2DGRA 1ZZKA 4NBQA 2E3UA 3U1KA 4JVYA 4B8TA 3AEVB 3L7ZC 1DTJA 3VKEA 2ANNA 4QMFB 2JEAI 2CTEA 5C0XG 4WANA 2BA0A 1WVNA 2JVZA 2JE6I 2PY9A 2BL5A 2CTFA 2OPUA 1J5KA 2CPQA 2YQRA 1ZZIA 2CTJA 5JEAG 2CTMA 5K36G 2JZXA 1ZZJA 4AIMA 2HH3A 2FMRA 1TUAA 2P2RA 4IFDG 4LIJA 2Z0SA 2JA9A 2PQUA 2OPVA 4JVHA 4WALA 4BA2I 1VIHA 4OO1G
chains in the Genus database with same CATH superfamily
2E5LH 2CTLA 2MJHA 4LFBH 1SEIA 4JI0H 2M8WA 1X4NA 2QNDA 3JAMW 4X64H 1IBLH 1EC6A 2HHHH 5A2QW 2O4CA 2X06A 2CTKA 2DGRA 4H8AA 3GABA 4NBQA 4DR1H 4LF4H 3GR5A 1I94H 4NZTM 4JI5H 4DR6H 2K1HA 1AN7A 1PQXA 2UUCH 2BL5A 2CTFA 2FPHX 2OPUA 2G8YA 4DR3H 4DUZH 4LF7H 5K36G 3J7AK 5DT9A 4AIMA 4OD6A 2UXCH 2UUAH 4G08A 3KDGA 3KDKA 1VBIA 4FJUA 4DV4H 2VQEH 4DR7H 1VIHA 1ZTGA 2UXDH 4BA1I 3OSSD 4LF9H 2LTLA 4DV1H 4B8CD 1HNZH 4OCHA 4B3RH 4DR2H 4AM3A 3FAUA 4B3MH 2NN6G 3GKUA 5FLXW 3QD7X 3SB1A 4GKKH 1XNQH 4YY3H 2LF0A 4LF6H 1XNRH 1XRHA 1IBMH 4JI6H 4JV5H 4B8TA 4B3SH 3L7ZC 1N33H 4PDBA 4FJSA 2JVZA 3RF2A 1NXUA 2CPQA 1ZZIA 1FKAH 2CTJA 5JEAG 2JZXA 2FMRA 1TUAA 4JI4H 2Z0SA 2JA9A 2PQUA 1FJGH 1Z2IA 4LF5H 2Y3MA 3NCVA 4DV3H 1WE8A 1IBKH 4JI3H 1ODHA 1DT4A 2ANRA 4JI1H 2M6QA 1VIGA 3OTOH 1HR0H 2F4VH 2UXBH 1X4MA 1MSZA 3V69A 1J4WA 5IT9W 2ZQEA 4NXNH 2A1SA 3OETA 1S20A 1K1GA 2UU9H 4X62H 1XMOH 1V8CA 2E3UA 4JVYA 2ZM6H 4DV2H 4DR4H 3AEVB 3VKEA 4DV6H 4QMFB 2JEAI 2CTEA 2BA0A 2PY9A 4E9JA 3EZJA 3J80W 3T1YH 4JI8H 4NXMH 1I6UA 2LRRA 4LFAH 4X65H 1X9ZA 4DV5H 4KHPH 2CTMA 1HNWH 4LF8H 1N34H 4LFCH 3I0PA 2UUBH 2P2RA 4IFDG 4LIJA 1V9NA 4WALA 1S03G 4BA2I 1UG8A 4DUYH 1WHRA 4GKJH 2VQFH 2CPMA 5LMNH 1X0AA 2VKCA 4X66H 1KHMA 2JEBI 2CWHA 2D9IA 4JI7H 2HH2A 2AXYA 4AQYH 2PT7G 4B3TH 5BR8H 3U1KA 1ZZKA 1F0XA 2FFMA 1XMQH 4K0KH 2ANNA 1DTJA 3J81W 4EC5A 5C0XG 4WANA 1WVNA 2JE6I 3T1HH 1J5KA 4DV7H 2CWFA 2YQRA 1N36H 1J5EH 1WTJA 1ZZJA 4OX9H 4JYAH 5LL6b 2HH3A 5IWAH 4DV0H 4NZRM 3UOEA 1HNXH 2LTMA 4JVHA 2OPVA 4JI2H 1N32H 4YHHH 5LMUH 4DR5H 4OO1G
chains in the Genus database with same CATH topology
1WE8A 4BA1I 2CTLA 2MJHA 1DT4A 2ANRA 1KHMA 2JEBI 1VIGA 4AM3A 2HH2A 2AXYA 1X4MA 1X4NA 2NN6G 3V69A 2QNDA 1J4WA 1K1GA 1EC6A 1ZTGA 2CTKA 2DGRA 1ZZKA 4NBQA 2E3UA 3U1KA 4JVYA 4B8TA 3AEVB 3L7ZC 1DTJA 3VKEA 2ANNA 4QMFB 2JEAI 2CTEA 5C0XG 4WANA 2BA0A 1WVNA 2JVZA 2JE6I 2PY9A 2BL5A 2CTFA 2OPUA 1J5KA 2CPQA 2YQRA 1ZZIA 2CTJA 5JEAG 2CTMA 5K36G 2JZXA 1ZZJA 4AIMA 2HH3A 2FMRA 1TUAA 2P2RA 4IFDG 4LIJA 2Z0SA 2JA9A 2PQUA 2OPVA 4JVHA 4WALA 4BA2I 1VIHA 4OO1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WE8 A;  4BA1 I;  2CTL A;  2MJH A;  1DT4 A;  2ANR A;  1KHM A;  2JEB I;  1VIG A;  4AM3 A;  2HH2 A;  2AXY A;  1X4M A;  1X4N A;  2NN6 G;  3V69 A;  2QND A;  1J4W A;  1K1G A;  1EC6 A;  1ZTG A;  2CTK A;  2DGR A;  1ZZK A;  4NBQ A;  2E3U A;  3U1K A;  4JVY A;  4B8T A;  3AEV B;  3L7Z C;  1DTJ A;  3VKE A;  2ANN A;  4QMF B;  2JEA I;  2CTE A;  5C0X G;  4WAN A;  2BA0 A;  1WVN A;  2JVZ A;  2JE6 I;  2PY9 A;  2BL5 A;  2CTF A;  2OPU A;  1J5K A;  2CPQ A;  2YQR A;  1ZZI A;  2CTJ A;  5JEA G;  2CTM A;  5K36 G;  2JZX A;  1ZZJ A;  4AIM A;  2HH3 A;  2FMR A;  1TUA A;  2P2R A;  4IFD G;  4LIJ A;  2Z0S A;  2JA9 A;  2PQU A;  2OPV A;  4JVH A;  4WAL A;  4BA2 I;  1VIH A;  4OO1 G; 
#chains in the Genus database with same CATH topology
 2E5L H;  2CTL A;  2MJH A;  4LFB H;  1SEI A;  4JI0 H;  2M8W A;  1X4N A;  2QND A;  3JAM W;  4X64 H;  1IBL H;  1EC6 A;  2HHH H;  5A2Q W;  2O4C A;  2X06 A;  2CTK A;  2DGR A;  4H8A A;  3GAB A;  4NBQ A;  4DR1 H;  4LF4 H;  3GR5 A;  1I94 H;  4NZT M;  4JI5 H;  4DR6 H;  2K1H A;  1AN7 A;  1PQX A;  2UUC H;  2BL5 A;  2CTF A;  2FPH X;  2OPU A;  2G8Y A;  4DR3 H;  4DUZ H;  4LF7 H;  5K36 G;  3J7A K;  5DT9 A;  4AIM A;  4OD6 A;  2UXC H;  2UUA H;  4G08 A;  3KDG A;  3KDK A;  1VBI A;  4FJU A;  4DV4 H;  2VQE H;  4DR7 H;  1VIH A;  1ZTG A;  2UXD H;  4BA1 I;  3OSS D;  4LF9 H;  2LTL A;  4DV1 H;  4B8C D;  1HNZ H;  4OCH A;  4B3R H;  4DR2 H;  4AM3 A;  3FAU A;  4B3M H;  2NN6 G;  3GKU A;  5FLX W;  3QD7 X;  3SB1 A;  4GKK H;  1XNQ H;  4YY3 H;  2LF0 A;  4LF6 H;  1XNR H;  1XRH A;  1IBM H;  4JI6 H;  4JV5 H;  4B8T A;  4B3S H;  3L7Z C;  1N33 H;  4PDB A;  4FJS A;  2JVZ A;  3RF2 A;  1NXU A;  2CPQ A;  1ZZI A;  1FKA H;  2CTJ A;  5JEA G;  2JZX A;  2FMR A;  1TUA A;  4JI4 H;  2Z0S A;  2JA9 A;  2PQU A;  1FJG H;  1Z2I A;  4LF5 H;  2Y3M A;  3NCV A;  4DV3 H;  1WE8 A;  1IBK H;  4JI3 H;  1ODH A;  1DT4 A;  2ANR A;  4JI1 H;  2M6Q A;  1VIG A;  3OTO H;  1HR0 H;  2F4V H;  2UXB H;  1X4M A;  1MSZ A;  3V69 A;  1J4W A;  5IT9 W;  2ZQE A;  4NXN H;  2A1S A;  3OET A;  1S20 A;  1K1G A;  2UU9 H;  4X62 H;  1XMO H;  1V8C A;  2E3U A;  4JVY A;  2ZM6 H;  4DV2 H;  4DR4 H;  3AEV B;  3VKE A;  4DV6 H;  4QMF B;  2JEA I;  2CTE A;  2BA0 A;  2PY9 A;  4E9J A;  3EZJ A;  3J80 W;  3T1Y H;  4JI8 H;  4NXM H;  1I6U A;  2LRR A;  4LFA H;  4X65 H;  1X9Z A;  4DV5 H;  4KHP H;  2CTM A;  1HNW H;  4LF8 H;  1N34 H;  4LFC H;  3I0P A;  2UUB H;  2P2R A;  4IFD G;  4LIJ A;  1V9N A;  4WAL A;  1S03 G;  4BA2 I;  1UG8 A;  4DUY H;  1WHR A;  4GKJ H;  2VQF H;  2CPM A;  5LMN H;  1X0A A;  2VKC A;  4X66 H;  1KHM A;  2JEB I;  2CWH A;  2D9I A;  4JI7 H;  2HH2 A;  2AXY A;  4AQY H;  2PT7 G;  4B3T H;  5BR8 H;  3U1K A;  1ZZK A;  1F0X A;  2FFM A;  1XMQ H;  4K0K H;  2ANN A;  1DTJ A;  3J81 W;  4EC5 A;  5C0X G;  4WAN A;  1WVN A;  2JE6 I;  3T1H H;  1J5K A;  4DV7 H;  2CWF A;  2YQR A;  1N36 H;  1J5E H;  1WTJ A;  1ZZJ A;  4OX9 H;  4JYA H;  5LL6 b;  2HH3 A;  5IWA H;  4DV0 H;  4NZR M;  3UOE A;  1HNX H;  2LTM A;  4JVH A;  2OPV A;  4JI2 H;  1N32 H;  4YHH H;  5LMU H;  4DR5 H;  4OO1 G; 
#chains in the Genus database with same CATH homology
 1WE8 A;  4BA1 I;  2CTL A;  2MJH A;  1DT4 A;  2ANR A;  1KHM A;  2JEB I;  1VIG A;  4AM3 A;  2HH2 A;  2AXY A;  1X4M A;  1X4N A;  2NN6 G;  3V69 A;  2QND A;  1J4W A;  1K1G A;  1EC6 A;  1ZTG A;  2CTK A;  2DGR A;  1ZZK A;  4NBQ A;  2E3U A;  3U1K A;  4JVY A;  4B8T A;  3AEV B;  3L7Z C;  1DTJ A;  3VKE A;  2ANN A;  4QMF B;  2JEA I;  2CTE A;  5C0X G;  4WAN A;  2BA0 A;  1WVN A;  2JVZ A;  2JE6 I;  2PY9 A;  2BL5 A;  2CTF A;  2OPU A;  1J5K A;  2CPQ A;  2YQR A;  1ZZI A;  2CTJ A;  5JEA G;  2CTM A;  5K36 G;  2JZX A;  1ZZJ A;  4AIM A;  2HH3 A;  2FMR A;  1TUA A;  2P2R A;  4IFD G;  4LIJ A;  2Z0S A;  2JA9 A;  2PQU A;  2OPV A;  4JVH A;  4WAL A;  4BA2 I;  1VIH A;  4OO1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...