2CTEA

Solution structure of the 1st kh type i domain from human vigilin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
94
structure length
94
Chain Sequence
b'GSSGSSGDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vigilin
molecule tags Transport protein
source organism Homo sapiens
publication title Solution structure of the 1st KH type I domain from human Vigilin
rcsb
total genus 17
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2cteA01
1WE8A 1J5KA 4WALA 1TUAA 3VKEA 2NN6G 1X4MA 1VIGA 2OPUA 1J4WA 4AM3A 1K1GA 2JE6I 3AEVB 2FMRA 2BA0A 1EC6A 2QNDA 3L7ZC 4IFDG 2CTJA 2DGRA 2HH3A 2CPQA 2Z0SA 4NBQA 4B8TA 3U1KA 2ANNA 2PY9A 4BA2I 2PQUA 5JEAG 2CTMA 1ZZKA 2JEBI 1ZZJA 1DT4A 2CTEA 4JVHA 2YQRA 2JVZA 1ZTGA 2JEAI 2CTLA 2BL5A 2AXYA 2E3UA 4QMFB 1X4NA 2JA9A 2OPVA 2HH2A 2MJHA 4BA1I 4OO1G 1DTJA 1ZZIA 1KHMA 4LIJA 2P2RA 2JZXA 4JVYA 3V69A 2CTFA 4AIMA 1VIHA 5C0XG 4WANA 5K36G 2CTKA 1WVNA 2ANRA
chains in the Genus database with same CATH superfamily
4LFCH 4DV0H 4FJSA 4OD6A 4GKKH 3KDGA 1N33H 2NN6G 4NZRM 1J4WA 4JI6H 3J7AK 3AEVB 4DR3H 1SEIA 2LF0A 2HH3A 4JI5H 1I6UA 3KDKA 2UXBH 5JEAG 1ZZJA 1Z2IA 3JAMW 1FJGH 1I94H 4AQYH 2M8WA 4DR7H 1NXUA 4DV5H 1IBKH 3GKUA 2JEAI 1PQXA 2UU9H 4DR4H 3FAUA 2VQFH 4LF8H 4LFBH 4BA1I 1WHRA 1UG8A 4B3RH 3T1YH 4JVYA 4X66H 3RF2A 4LFAH 2CTFA 2UUBH 1VIHA 2M6QA 2UXDH 1ZZKA 4FJUA 1X9ZA 5BR8H 2LTMA 1J5KA 1IBMH 4X64H 4JI2H 3OTOH 3VKEA 1XNRH 1X4MA 4H8AA 1HR0H 4AM3A 1K1GA 2JE6I 2ZQEA 1J5EH 4BA2I 4B8CD 2QNDA 4YY3H 2UXCH 4DV6H 1F0XA 2FFMA 2CPQA 2FPHX 4NBQA 4JI0H 2HHHH 4LF9H 2CTMA 1DT4A 4JVHA 1N34H 2JVZA 2VKCA 4DR2H 4OX9H 1IBLH 2CTLA 2BL5A 4DUYH 1HNWH 2JA9A 1V9NA 1N32H 2A1SA 4NXNH 4DR6H 1V8CA 4KHPH 1ZZIA 4K0KH 4LIJA 4PDBA 4EC5A 3V69A 5IWAH 2CPMA 3GR5A 3SB1A 4YHHH 2FMRA 1WVNA 4NZTM 2ANRA 4JI3H 5FLXW 4WALA 3OSSD 1XNQH 5IT9W 1HNZH 3QD7X 1WTJA 2BA0A 3L7ZC 1XMQH 4IFDG 2G8YA 4NXMH 2Y3MA 2CWFA 4LF7H 4DV7H 4GKJH 4X65H 2CTEA 3J80W 1MSZA 2YQRA 1ZTGA 4LF5H 3UOEA 3OETA 4JYAH 3T1HH 4QMFB 4X62H 2OPVA 2MJHA 1HNXH 1XRHA 1DTJA 4DUZH 1KHMA 2P2RA 2X06A 4AIMA 4B3TH 5C0XG 4DV3H 2LTLA 2E3UA 3I0PA 1N36H 4JI4H 2UUCH 1WE8A 2CWHA 4G08A 3GABA 4LF6H 1TUAA 2VQEH 5LMUH 1VIGA 2OPUA 5LL6b 4OCHA 4B3MH 4LF4H 4JI8H 2F4VH 3EZJA 4JI7H 1EC6A 2CTJA 2D9IA 2DGRA 2Z0SA 4B8TA 4DR1H 2UUAH 3U1KA 1FKAH 4JI1H 1S03G 5A2QW 4DR5H 1XMOH 2PQUA 2PY9A 2ANNA 2JEBI 2PT7G 3J81W 4DV2H 2AXYA 2E5LH 4B3SH 1AN7A 1X0AA 1X4NA 4E9JA 4DV1H 2HH2A 1VBIA 3NCVA 2K1HA 2ZM6H 2LRRA 1S20A 4DV4H 4OO1G 2O4CA 5DT9A 1ODHA 2JZXA 5LMNH 5K36G 4WANA 4JV5H 2CTKA
chains in the Genus database with same CATH topology
1WE8A 1J5KA 4WALA 1TUAA 3VKEA 2NN6G 1X4MA 1VIGA 2OPUA 1J4WA 4AM3A 1K1GA 2JE6I 3AEVB 2FMRA 2BA0A 1EC6A 2QNDA 3L7ZC 4IFDG 2CTJA 2DGRA 2HH3A 2CPQA 2Z0SA 4NBQA 4B8TA 3U1KA 2ANNA 2PY9A 4BA2I 2PQUA 5JEAG 2CTMA 1ZZKA 2JEBI 1ZZJA 1DT4A 2CTEA 4JVHA 2YQRA 2JVZA 1ZTGA 2JEAI 2CTLA 2BL5A 2AXYA 2E3UA 4QMFB 1X4NA 2JA9A 2OPVA 2HH2A 2MJHA 4BA1I 4OO1G 1DTJA 1ZZIA 1KHMA 4LIJA 2P2RA 2JZXA 4JVYA 3V69A 2CTFA 4AIMA 1VIHA 5C0XG 4WANA 5K36G 2CTKA 1WVNA 2ANRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WE8 A;  1J5K A;  4WAL A;  1TUA A;  3VKE A;  2NN6 G;  1X4M A;  1VIG A;  2OPU A;  1J4W A;  4AM3 A;  1K1G A;  2JE6 I;  3AEV B;  2FMR A;  2BA0 A;  1EC6 A;  2QND A;  3L7Z C;  4IFD G;  2CTJ A;  2DGR A;  2HH3 A;  2CPQ A;  2Z0S A;  4NBQ A;  4B8T A;  3U1K A;  2ANN A;  2PY9 A;  4BA2 I;  2PQU A;  5JEA G;  2CTM A;  1ZZK A;  2JEB I;  1ZZJ A;  1DT4 A;  2CTE A;  4JVH A;  2YQR A;  2JVZ A;  1ZTG A;  2JEA I;  2CTL A;  2BL5 A;  2AXY A;  2E3U A;  4QMF B;  1X4N A;  2JA9 A;  2OPV A;  2HH2 A;  2MJH A;  4BA1 I;  4OO1 G;  1DTJ A;  1ZZI A;  1KHM A;  4LIJ A;  2P2R A;  2JZX A;  4JVY A;  3V69 A;  2CTF A;  4AIM A;  1VIH A;  5C0X G;  4WAN A;  5K36 G;  2CTK A;  1WVN A;  2ANR A; 
#chains in the Genus database with same CATH topology
 4LFC H;  4DV0 H;  4FJS A;  4OD6 A;  4GKK H;  3KDG A;  1N33 H;  2NN6 G;  4NZR M;  1J4W A;  4JI6 H;  3J7A K;  3AEV B;  4DR3 H;  1SEI A;  2LF0 A;  2HH3 A;  4JI5 H;  1I6U A;  3KDK A;  2UXB H;  5JEA G;  1ZZJ A;  1Z2I A;  3JAM W;  1FJG H;  1I94 H;  4AQY H;  2M8W A;  4DR7 H;  1NXU A;  4DV5 H;  1IBK H;  3GKU A;  2JEA I;  1PQX A;  2UU9 H;  4DR4 H;  3FAU A;  2VQF H;  4LF8 H;  4LFB H;  4BA1 I;  1WHR A;  1UG8 A;  4B3R H;  3T1Y H;  4JVY A;  4X66 H;  3RF2 A;  4LFA H;  2CTF A;  2UUB H;  1VIH A;  2M6Q A;  2UXD H;  1ZZK A;  4FJU A;  1X9Z A;  5BR8 H;  2LTM A;  1J5K A;  1IBM H;  4X64 H;  4JI2 H;  3OTO H;  3VKE A;  1XNR H;  1X4M A;  4H8A A;  1HR0 H;  4AM3 A;  1K1G A;  2JE6 I;  2ZQE A;  1J5E H;  4BA2 I;  4B8C D;  2QND A;  4YY3 H;  2UXC H;  4DV6 H;  1F0X A;  2FFM A;  2CPQ A;  2FPH X;  4NBQ A;  4JI0 H;  2HHH H;  4LF9 H;  2CTM A;  1DT4 A;  4JVH A;  1N34 H;  2JVZ A;  2VKC A;  4DR2 H;  4OX9 H;  1IBL H;  2CTL A;  2BL5 A;  4DUY H;  1HNW H;  2JA9 A;  1V9N A;  1N32 H;  2A1S A;  4NXN H;  4DR6 H;  1V8C A;  4KHP H;  1ZZI A;  4K0K H;  4LIJ A;  4PDB A;  4EC5 A;  3V69 A;  5IWA H;  2CPM A;  3GR5 A;  3SB1 A;  4YHH H;  2FMR A;  1WVN A;  4NZT M;  2ANR A;  4JI3 H;  5FLX W;  4WAL A;  3OSS D;  1XNQ H;  5IT9 W;  1HNZ H;  3QD7 X;  1WTJ A;  2BA0 A;  3L7Z C;  1XMQ H;  4IFD G;  2G8Y A;  4NXM H;  2Y3M A;  2CWF A;  4LF7 H;  4DV7 H;  4GKJ H;  4X65 H;  2CTE A;  3J80 W;  1MSZ A;  2YQR A;  1ZTG A;  4LF5 H;  3UOE A;  3OET A;  4JYA H;  3T1H H;  4QMF B;  4X62 H;  2OPV A;  2MJH A;  1HNX H;  1XRH A;  1DTJ A;  4DUZ H;  1KHM A;  2P2R A;  2X06 A;  4AIM A;  4B3T H;  5C0X G;  4DV3 H;  2LTL A;  2E3U A;  3I0P A;  1N36 H;  4JI4 H;  2UUC H;  1WE8 A;  2CWH A;  4G08 A;  3GAB A;  4LF6 H;  1TUA A;  2VQE H;  5LMU H;  1VIG A;  2OPU A;  5LL6 b;  4OCH A;  4B3M H;  4LF4 H;  4JI8 H;  2F4V H;  3EZJ A;  4JI7 H;  1EC6 A;  2CTJ A;  2D9I A;  2DGR A;  2Z0S A;  4B8T A;  4DR1 H;  2UUA H;  3U1K A;  1FKA H;  4JI1 H;  1S03 G;  5A2Q W;  4DR5 H;  1XMO H;  2PQU A;  2PY9 A;  2ANN A;  2JEB I;  2PT7 G;  3J81 W;  4DV2 H;  2AXY A;  2E5L H;  4B3S H;  1AN7 A;  1X0A A;  1X4N A;  4E9J A;  4DV1 H;  2HH2 A;  1VBI A;  3NCV A;  2K1H A;  2ZM6 H;  2LRR A;  1S20 A;  4DV4 H;  4OO1 G;  2O4C A;  5DT9 A;  1ODH A;  2JZX A;  5LMN H;  5K36 G;  4WAN A;  4JV5 H;  2CTK A; 
#chains in the Genus database with same CATH homology
 1WE8 A;  1J5K A;  4WAL A;  1TUA A;  3VKE A;  2NN6 G;  1X4M A;  1VIG A;  2OPU A;  1J4W A;  4AM3 A;  1K1G A;  2JE6 I;  3AEV B;  2FMR A;  2BA0 A;  1EC6 A;  2QND A;  3L7Z C;  4IFD G;  2CTJ A;  2DGR A;  2HH3 A;  2CPQ A;  2Z0S A;  4NBQ A;  4B8T A;  3U1K A;  2ANN A;  2PY9 A;  4BA2 I;  2PQU A;  5JEA G;  2CTM A;  1ZZK A;  2JEB I;  1ZZJ A;  1DT4 A;  2CTE A;  4JVH A;  2YQR A;  2JVZ A;  1ZTG A;  2JEA I;  2CTL A;  2BL5 A;  2AXY A;  2E3U A;  4QMF B;  1X4N A;  2JA9 A;  2OPV A;  2HH2 A;  2MJH A;  4BA1 I;  4OO1 G;  1DTJ A;  1ZZI A;  1KHM A;  4LIJ A;  2P2R A;  2JZX A;  4JVY A;  3V69 A;  2CTF A;  4AIM A;  1VIH A;  5C0X G;  4WAN A;  5K36 G;  2CTK A;  1WVN A;  2ANR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...