2CTEA

Solution structure of the 1st kh type i domain from human vigilin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
94
structure length
94
Chain Sequence
GSSGSSGDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vigilin
publication title Solution structure of the 1st KH type I domain from human Vigilin
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 17
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2cteA01
2FMRA 2AXYA 2CTKA 2HH2A 1VIHA 4NBQA 1ZZIA 1ZZJA 2QNDA 3VKEA 5K36G 1X4NA 2ANRA 2DGRA 2BA0A 1J4WA 1K1GA 5JEAG 4OO1G 1WE8A 1X4MA 1WVNA 3AEVB 4JVYA 2JEAI 4B8TA 4QMFB 2CTLA 3L7ZC 4AM3A 1VIGA 2OPUA 1KHMA 2JZXA 4AIMA 1EC6A 4WALA 1ZZKA 2JA9A 2E3UA 2JVZA 2YQRA 4BA2I 2JEBI 3U1KA 2JE6I 2MJHA 2ANNA 4BA1I 1J5KA 2PQUA 2CTJA 2CTEA 1TUAA 2PY9A 2NN6G 4IFDG 4WANA 1DTJA 2CPQA 1DT4A 2CTMA 2OPVA 4LIJA 1ZTGA 3V69A 5C0XG 2BL5A 2P2RA 2CTFA 2HH3A 2Z0SA 4JVHA
chains in the Genus database with same CATH superfamily
4JI8H 4JI4H 4LF9H 4NBQA 3OTOH 3UOEA 4DV1H 1ZZJA 2M6QA 4B3SH 2BA0A 5JEAG 4OO1G 4DV0H 5IT9W 4X62H 1XNQH 3RF2A 3J80W 1HNWH 2CTLA 1VBIA 2HHHH 1FJGH 1V9NA 4AM3A 2PT7G 2UUBH 2O4CA 4DR1H 1ODHA 1J5EH 4JI7H 3NCVA 4NXNH 2UUAH 4JYAH 2VQEH 2YQRA 2JVZA 2PQUA 4B3RH 4NXMH 4JV5H 4WANA 4X64H 2G8YA 1DTJA 4JI6H 3SB1A 2UUCH 1DT4A 2OPVA 4B3TH 3V69A 1XRHA 2BL5A 2M8WA 4DV7H 1XMOH 2CTFA 1KHMA 2MJHA 1NXUA 2CWFA 1VIHA 1ZZIA 1F0XA 2QNDA 4NZRM 4OD6A 1X4NA 5LL6b 1XMQH 4JI3H 1N36H 1J4WA 4DV4H 1K1GA 4DR7H 1PQXA 4DV6H 4DR2H 1FKAH 1XNRH 2JEAI 2LRRA 2UU9H 4LFAH 4K0KH 1VIGA 2OPUA 4DUZH 2UXBH 3GKUA 1EC6A 3OSSD 1SEIA 2VKCA 4DR5H 1ZZKA 1MSZA 1N32H 1HNXH 4YY3H 2VQFH 2CWHA 4FJUA 4LF8H 3KDKA 4NZTM 2ANNA 1J5KA 2F4VH 2LF0A 3GABA 3T1HH 4IFDG 4JI0H 2LTLA 4FJSA 5C0XG 1IBKH 2P2RA 3KDGA 2HH3A 2Z0SA 4JVHA 5BR8H 2FMRA 2AXYA 4H8AA 5LMUH 2HH2A 4G08A 1I94H 4LFCH 1I6UA 4YHHH 4LF7H 5K36G 4OCHA 2LTMA 2DGRA 1UG8A 5DT9A 5FLXW 3FAUA 1WE8A 5IWAH 3OETA 1WVNA 4JI2H 3T1YH 4KHPH 4JVYA 4QMFB 3L7ZC 1HR0H 4LFBH 4DV2H 2JZXA 4DUYH 2UXCH 3J7AK 4WALA 2FFMA 3GR5A 4PDBA 4BA2I 5A2QW 2PY9A 2NN6G 2CPQA 2Y3MA 1ZTGA 4DR3H 4B3MH 1X9ZA 4JI5H 4GKKH 4B8CD 3EZJA 2D9IA 4LF6H 4X65H 2UXDH 4DR6H 2CTKA 2ZM6H 3VKEA 3QD7X 2A1SA 2ANRA 4DR4H 2K1HA 1S20A 3JAMW 1X4MA 1WHRA 4AQYH 3AEVB 2FPHX 4DV3H 2E5LH 4B8TA 2ZQEA 4JI1H 3I0PA 1IBLH 2X06A 4AIMA 4DV5H 4OX9H 4E9JA 2CPMA 2JA9A 3J81W 5LMNH 1AN7A 2E3UA 1HNZH 1IBMH 2JEBI 3U1KA 2JE6I 1N33H 4BA1I 1TUAA 1WTJA 2CTJA 2CTEA 4GKJH 4LF5H 4LF4H 2CTMA 4EC5A 1X0AA 1V8CA 4X66H 1N34H 1S03G 1Z2IA 4LIJA
chains in the Genus database with same CATH topology
2FMRA 2AXYA 2CTKA 2HH2A 1VIHA 4NBQA 1ZZIA 1ZZJA 2QNDA 3VKEA 5K36G 1X4NA 2ANRA 2DGRA 2BA0A 1J4WA 1K1GA 5JEAG 4OO1G 1WE8A 1X4MA 1WVNA 3AEVB 4JVYA 2JEAI 4B8TA 4QMFB 2CTLA 3L7ZC 4AM3A 1VIGA 2OPUA 1KHMA 2JZXA 4AIMA 1EC6A 4WALA 1ZZKA 2JA9A 2E3UA 2JVZA 2YQRA 4BA2I 2JEBI 3U1KA 2JE6I 2MJHA 2ANNA 4BA1I 1J5KA 2PQUA 2CTJA 2CTEA 1TUAA 2PY9A 2NN6G 4IFDG 4WANA 1DTJA 2CPQA 1DT4A 2CTMA 2OPVA 4LIJA 1ZTGA 3V69A 5C0XG 2BL5A 2P2RA 2CTFA 2HH3A 2Z0SA 4JVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FMR A;  2AXY A;  2CTK A;  2HH2 A;  1VIH A;  4NBQ A;  1ZZI A;  1ZZJ A;  2QND A;  3VKE A;  5K36 G;  1X4N A;  2ANR A;  2DGR A;  2BA0 A;  1J4W A;  1K1G A;  5JEA G;  4OO1 G;  1WE8 A;  1X4M A;  1WVN A;  3AEV B;  4JVY A;  2JEA I;  4B8T A;  4QMF B;  2CTL A;  3L7Z C;  4AM3 A;  1VIG A;  2OPU A;  1KHM A;  2JZX A;  4AIM A;  1EC6 A;  4WAL A;  1ZZK A;  2JA9 A;  2E3U A;  2JVZ A;  2YQR A;  4BA2 I;  2JEB I;  3U1K A;  2JE6 I;  2MJH A;  2ANN A;  4BA1 I;  1J5K A;  2PQU A;  2CTJ A;  2CTE A;  1TUA A;  2PY9 A;  2NN6 G;  4IFD G;  4WAN A;  1DTJ A;  2CPQ A;  1DT4 A;  2CTM A;  2OPV A;  4LIJ A;  1ZTG A;  3V69 A;  5C0X G;  2BL5 A;  2P2R A;  2CTF A;  2HH3 A;  2Z0S A;  4JVH A; 
#chains in the Genus database with same CATH topology
 4JI8 H;  4JI4 H;  4LF9 H;  4NBQ A;  3OTO H;  3UOE A;  4DV1 H;  1ZZJ A;  2M6Q A;  4B3S H;  2BA0 A;  5JEA G;  4OO1 G;  4DV0 H;  5IT9 W;  4X62 H;  1XNQ H;  3RF2 A;  3J80 W;  1HNW H;  2CTL A;  1VBI A;  2HHH H;  1FJG H;  1V9N A;  4AM3 A;  2PT7 G;  2UUB H;  2O4C A;  4DR1 H;  1ODH A;  1J5E H;  4JI7 H;  3NCV A;  4NXN H;  2UUA H;  4JYA H;  2VQE H;  2YQR A;  2JVZ A;  2PQU A;  4B3R H;  4NXM H;  4JV5 H;  4WAN A;  4X64 H;  2G8Y A;  1DTJ A;  4JI6 H;  3SB1 A;  2UUC H;  1DT4 A;  2OPV A;  4B3T H;  3V69 A;  1XRH A;  2BL5 A;  2M8W A;  4DV7 H;  1XMO H;  2CTF A;  1KHM A;  2MJH A;  1NXU A;  2CWF A;  1VIH A;  1ZZI A;  1F0X A;  2QND A;  4NZR M;  4OD6 A;  1X4N A;  5LL6 b;  1XMQ H;  4JI3 H;  1N36 H;  1J4W A;  4DV4 H;  1K1G A;  4DR7 H;  1PQX A;  4DV6 H;  4DR2 H;  1FKA H;  1XNR H;  2JEA I;  2LRR A;  2UU9 H;  4LFA H;  4K0K H;  1VIG A;  2OPU A;  4DUZ H;  2UXB H;  3GKU A;  1EC6 A;  3OSS D;  1SEI A;  2VKC A;  4DR5 H;  1ZZK A;  1MSZ A;  1N32 H;  1HNX H;  4YY3 H;  2VQF H;  2CWH A;  4FJU A;  4LF8 H;  3KDK A;  4NZT M;  2ANN A;  1J5K A;  2F4V H;  2LF0 A;  3GAB A;  3T1H H;  4IFD G;  4JI0 H;  2LTL A;  4FJS A;  5C0X G;  1IBK H;  2P2R A;  3KDG A;  2HH3 A;  2Z0S A;  4JVH A;  5BR8 H;  2FMR A;  2AXY A;  4H8A A;  5LMU H;  2HH2 A;  4G08 A;  1I94 H;  4LFC H;  1I6U A;  4YHH H;  4LF7 H;  5K36 G;  4OCH A;  2LTM A;  2DGR A;  1UG8 A;  5DT9 A;  5FLX W;  3FAU A;  1WE8 A;  5IWA H;  3OET A;  1WVN A;  4JI2 H;  3T1Y H;  4KHP H;  4JVY A;  4QMF B;  3L7Z C;  1HR0 H;  4LFB H;  4DV2 H;  2JZX A;  4DUY H;  2UXC H;  3J7A K;  4WAL A;  2FFM A;  3GR5 A;  4PDB A;  4BA2 I;  5A2Q W;  2PY9 A;  2NN6 G;  2CPQ A;  2Y3M A;  1ZTG A;  4DR3 H;  4B3M H;  1X9Z A;  4JI5 H;  4GKK H;  4B8C D;  3EZJ A;  2D9I A;  4LF6 H;  4X65 H;  2UXD H;  4DR6 H;  2CTK A;  2ZM6 H;  3VKE A;  3QD7 X;  2A1S A;  2ANR A;  4DR4 H;  2K1H A;  1S20 A;  3JAM W;  1X4M A;  1WHR A;  4AQY H;  3AEV B;  2FPH X;  4DV3 H;  2E5L H;  4B8T A;  2ZQE A;  4JI1 H;  3I0P A;  1IBL H;  2X06 A;  4AIM A;  4DV5 H;  4OX9 H;  4E9J A;  2CPM A;  2JA9 A;  3J81 W;  5LMN H;  1AN7 A;  2E3U A;  1HNZ H;  1IBM H;  2JEB I;  3U1K A;  2JE6 I;  1N33 H;  4BA1 I;  1TUA A;  1WTJ A;  2CTJ A;  2CTE A;  4GKJ H;  4LF5 H;  4LF4 H;  2CTM A;  4EC5 A;  1X0A A;  1V8C A;  4X66 H;  1N34 H;  1S03 G;  1Z2I A;  4LIJ A; 
#chains in the Genus database with same CATH homology
 2FMR A;  2AXY A;  2CTK A;  2HH2 A;  1VIH A;  4NBQ A;  1ZZI A;  1ZZJ A;  2QND A;  3VKE A;  5K36 G;  1X4N A;  2ANR A;  2DGR A;  2BA0 A;  1J4W A;  1K1G A;  5JEA G;  4OO1 G;  1WE8 A;  1X4M A;  1WVN A;  3AEV B;  4JVY A;  2JEA I;  4B8T A;  4QMF B;  2CTL A;  3L7Z C;  4AM3 A;  1VIG A;  2OPU A;  1KHM A;  2JZX A;  4AIM A;  1EC6 A;  4WAL A;  1ZZK A;  2JA9 A;  2E3U A;  2JVZ A;  2YQR A;  4BA2 I;  2JEB I;  3U1K A;  2JE6 I;  2MJH A;  2ANN A;  4BA1 I;  1J5K A;  2PQU A;  2CTJ A;  2CTE A;  1TUA A;  2PY9 A;  2NN6 G;  4IFD G;  4WAN A;  1DTJ A;  2CPQ A;  1DT4 A;  2CTM A;  2OPV A;  4LIJ A;  1ZTG A;  3V69 A;  5C0X G;  2BL5 A;  2P2R A;  2CTF A;  2HH3 A;  2Z0S A;  4JVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...