2CTEA

Solution structure of the 1st kh type i domain from human vigilin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
94
structure length
94
Chain Sequence
GSSGSSGDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Vigilin
publication title Solution structure of the 1st KH type I domain from human Vigilin
rcsb
source organism Homo sapiens
total genus 17
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2cteA01
1TUAA 2CTMA 1J4WA 2CPQA 2CTLA 2PY9A 2HH2A 1WE8A 2CTEA 4JVYA 1J5KA 4BA1I 3AEVB 4BA2I 3L7ZC 2Z0SA 1DT4A 5K36G 2FMRA 1EC6A 4QMFB 2JZXA 2NN6G 4AIMA 1ZZJA 1K1GA 4JVHA 1VIGA 2HH3A 2JA9A 2YQRA 2JEAI 4WALA 2DGRA 2JVZA 1ZZKA 4IFDG 2QNDA 1VIHA 1ZZIA 2OPUA 2PQUA 3V69A 1KHMA 1WVNA 2CTJA 2JE6I 2JEBI 5JEAG 2AXYA 1ZTGA 1X4MA 2OPVA 2E3UA 2CTKA 3VKEA 2ANNA 2ANRA 4WANA 2CTFA 2BL5A 2MJHA 1DTJA 4AM3A 3U1KA 4NBQA 4B8TA 5C0XG 4LIJA 4OO1G 1X4NA 2BA0A 2P2RA
chains in the Genus database with same CATH superfamily
1N33H 4YHHH 5DT9A 4KHPH 2PY9A 4JI0H 4DR2H 2Y3MA 4JYAH 1MSZA 2CTEA 4JV5H 4X66H 1AN7A 5FLXW 1N34H 4DV5H 4B3MH 2Z0SA 3OTOH 1WHRA 2FMRA 4QMFB 1ODHA 2VKCA 4JI2H 1HR0H 1Z2IA 2X06A 2HH3A 2D9IA 1ZZKA 4E9JA 2ZM6H 5A2QW 2LF0A 1I94H 4LF7H 2OPUA 1XNQH 4DR6H 1X0AA 4DUZH 2UUCH 4DV1H 3NCVA 4JVHA 1X4MA 2E5LH 1N36H 2UUAH 3J7AK 2FFMA 5IT9W 1UG8A 3T1YH 5BR8H 4DV7H 1TUAA 2CTLA 4LF9H 2UXDH 4LFBH 3GKUA 4X65H 4BA2I 4LF5H 5K36G 4NXMH 4DUYH 1HNWH 3FAUA 3JAMW 1K1GA 3SB1A 1VIGA 4B3SH 2YQRA 4WALA 2CWHA 4AQYH 4DV2H 2QNDA 4H8AA 2PQUA 1HNXH 2CTJA 2CWFA 2JE6I 1X9ZA 4B8CD 4DV6H 2OPVA 2ANNA 3VKEA 4B3TH 4JI5H 2UXCH 4WANA 2BL5A 3OSSD 3U1KA 4NXNH 1XMQH 1XRHA 4LIJA 2HHHH 4BA1I 4G08A 2P2RA 3GABA 1J4WA 1HNZH 2CPQA 4EC5A 4JI4H 3EZJA 4K0KH 4PDBA 4JVYA 4X62H 3OETA 1J5KA 4OCHA 3AEVB 3L7ZC 4NZTM 4YY3H 2VQFH 4LF8H 2JZXA 2NN6G 3I0PA 3RF2A 4AIMA 4LFCH 4DR1H 1V9NA 1NXUA 4GKKH 2F4VH 3T1HH 2JVZA 2CPMA 4LFAH 3UOEA 3J80W 2UU9H 1I6UA 3V69A 2UXBH 5LL6b 2PT7G 1IBMH 5JEAG 4DR3H 2VQEH 1ZTGA 2E3UA 5IWAH 4X64H 1XNRH 2MJHA 3GR5A 4DR4H 1N32H 1VBIA 4NBQA 4B8TA 4GKJH 3KDKA 2LTMA 5C0XG 1FKAH 4OX9H 4OD6A 2M8WA 4FJSA 2M6QA 2BA0A 1S20A 1J5EH 2CTMA 2K1HA 4LF4H 2FPHX 2HH2A 1WE8A 4LF6H 1SEIA 4DV0H 1DT4A 4DV4H 4JI1H 1EC6A 2LTLA 2LRRA 5LMNH 1ZZJA 2G8YA 1WTJA 2JA9A 2JEAI 3KDGA 2DGRA 2UUBH 4NZRM 1S03G 4IFDG 1VIHA 4JI6H 1ZZIA 4FJUA 2A1SA 1IBLH 4B3RH 1KHMA 1WVNA 4DR7H 1PQXA 4DV3H 1XMOH 2O4CA 2JEBI 3QD7X 2ZQEA 2AXYA 1F0XA 5LMUH 2CTKA 4JI8H 3J81W 2ANRA 2CTFA 1V8CA 1DTJA 4AM3A 4DR5H 1IBKH 4JI3H 4OO1G 1X4NA 4JI7H 1FJGH
chains in the Genus database with same CATH topology
1TUAA 2CTMA 1J4WA 2CPQA 2CTLA 2PY9A 2HH2A 1WE8A 2CTEA 4JVYA 1J5KA 4BA1I 3AEVB 4BA2I 3L7ZC 2Z0SA 1DT4A 5K36G 2FMRA 1EC6A 4QMFB 2JZXA 2NN6G 4AIMA 1ZZJA 1K1GA 4JVHA 1VIGA 2HH3A 2JA9A 2YQRA 2JEAI 4WALA 2DGRA 2JVZA 1ZZKA 4IFDG 2QNDA 1VIHA 1ZZIA 2OPUA 2PQUA 3V69A 1KHMA 1WVNA 2CTJA 2JE6I 2JEBI 5JEAG 2AXYA 1ZTGA 1X4MA 2OPVA 2E3UA 2CTKA 3VKEA 2ANNA 2ANRA 4WANA 2CTFA 2BL5A 2MJHA 1DTJA 4AM3A 3U1KA 4NBQA 4B8TA 5C0XG 4LIJA 4OO1G 1X4NA 2BA0A 2P2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TUA A;  2CTM A;  1J4W A;  2CPQ A;  2CTL A;  2PY9 A;  2HH2 A;  1WE8 A;  2CTE A;  4JVY A;  1J5K A;  4BA1 I;  3AEV B;  4BA2 I;  3L7Z C;  2Z0S A;  1DT4 A;  5K36 G;  2FMR A;  1EC6 A;  4QMF B;  2JZX A;  2NN6 G;  4AIM A;  1ZZJ A;  1K1G A;  4JVH A;  1VIG A;  2HH3 A;  2JA9 A;  2YQR A;  2JEA I;  4WAL A;  2DGR A;  2JVZ A;  1ZZK A;  4IFD G;  2QND A;  1VIH A;  1ZZI A;  2OPU A;  2PQU A;  3V69 A;  1KHM A;  1WVN A;  2CTJ A;  2JE6 I;  2JEB I;  5JEA G;  2AXY A;  1ZTG A;  1X4M A;  2OPV A;  2E3U A;  2CTK A;  3VKE A;  2ANN A;  2ANR A;  4WAN A;  2CTF A;  2BL5 A;  2MJH A;  1DTJ A;  4AM3 A;  3U1K A;  4NBQ A;  4B8T A;  5C0X G;  4LIJ A;  4OO1 G;  1X4N A;  2BA0 A;  2P2R A; 
#chains in the Genus database with same CATH topology
 1N33 H;  4YHH H;  5DT9 A;  4KHP H;  2PY9 A;  4JI0 H;  4DR2 H;  2Y3M A;  4JYA H;  1MSZ A;  2CTE A;  4JV5 H;  4X66 H;  1AN7 A;  5FLX W;  1N34 H;  4DV5 H;  4B3M H;  2Z0S A;  3OTO H;  1WHR A;  2FMR A;  4QMF B;  1ODH A;  2VKC A;  4JI2 H;  1HR0 H;  1Z2I A;  2X06 A;  2HH3 A;  2D9I A;  1ZZK A;  4E9J A;  2ZM6 H;  5A2Q W;  2LF0 A;  1I94 H;  4LF7 H;  2OPU A;  1XNQ H;  4DR6 H;  1X0A A;  4DUZ H;  2UUC H;  4DV1 H;  3NCV A;  4JVH A;  1X4M A;  2E5L H;  1N36 H;  2UUA H;  3J7A K;  2FFM A;  5IT9 W;  1UG8 A;  3T1Y H;  5BR8 H;  4DV7 H;  1TUA A;  2CTL A;  4LF9 H;  2UXD H;  4LFB H;  3GKU A;  4X65 H;  4BA2 I;  4LF5 H;  5K36 G;  4NXM H;  4DUY H;  1HNW H;  3FAU A;  3JAM W;  1K1G A;  3SB1 A;  1VIG A;  4B3S H;  2YQR A;  4WAL A;  2CWH A;  4AQY H;  4DV2 H;  2QND A;  4H8A A;  2PQU A;  1HNX H;  2CTJ A;  2CWF A;  2JE6 I;  1X9Z A;  4B8C D;  4DV6 H;  2OPV A;  2ANN A;  3VKE A;  4B3T H;  4JI5 H;  2UXC H;  4WAN A;  2BL5 A;  3OSS D;  3U1K A;  4NXN H;  1XMQ H;  1XRH A;  4LIJ A;  2HHH H;  4BA1 I;  4G08 A;  2P2R A;  3GAB A;  1J4W A;  1HNZ H;  2CPQ A;  4EC5 A;  4JI4 H;  3EZJ A;  4K0K H;  4PDB A;  4JVY A;  4X62 H;  3OET A;  1J5K A;  4OCH A;  3AEV B;  3L7Z C;  4NZT M;  4YY3 H;  2VQF H;  4LF8 H;  2JZX A;  2NN6 G;  3I0P A;  3RF2 A;  4AIM A;  4LFC H;  4DR1 H;  1V9N A;  1NXU A;  4GKK H;  2F4V H;  3T1H H;  2JVZ A;  2CPM A;  4LFA H;  3UOE A;  3J80 W;  2UU9 H;  1I6U A;  3V69 A;  2UXB H;  5LL6 b;  2PT7 G;  1IBM H;  5JEA G;  4DR3 H;  2VQE H;  1ZTG A;  2E3U A;  5IWA H;  4X64 H;  1XNR H;  2MJH A;  3GR5 A;  4DR4 H;  1N32 H;  1VBI A;  4NBQ A;  4B8T A;  4GKJ H;  3KDK A;  2LTM A;  5C0X G;  1FKA H;  4OX9 H;  4OD6 A;  2M8W A;  4FJS A;  2M6Q A;  2BA0 A;  1S20 A;  1J5E H;  2CTM A;  2K1H A;  4LF4 H;  2FPH X;  2HH2 A;  1WE8 A;  4LF6 H;  1SEI A;  4DV0 H;  1DT4 A;  4DV4 H;  4JI1 H;  1EC6 A;  2LTL A;  2LRR A;  5LMN H;  1ZZJ A;  2G8Y A;  1WTJ A;  2JA9 A;  2JEA I;  3KDG A;  2DGR A;  2UUB H;  4NZR M;  1S03 G;  4IFD G;  1VIH A;  4JI6 H;  1ZZI A;  4FJU A;  2A1S A;  1IBL H;  4B3R H;  1KHM A;  1WVN A;  4DR7 H;  1PQX A;  4DV3 H;  1XMO H;  2O4C A;  2JEB I;  3QD7 X;  2ZQE A;  2AXY A;  1F0X A;  5LMU H;  2CTK A;  4JI8 H;  3J81 W;  2ANR A;  2CTF A;  1V8C A;  1DTJ A;  4AM3 A;  4DR5 H;  1IBK H;  4JI3 H;  4OO1 G;  1X4N A;  4JI7 H;  1FJG H; 
#chains in the Genus database with same CATH homology
 1TUA A;  2CTM A;  1J4W A;  2CPQ A;  2CTL A;  2PY9 A;  2HH2 A;  1WE8 A;  2CTE A;  4JVY A;  1J5K A;  4BA1 I;  3AEV B;  4BA2 I;  3L7Z C;  2Z0S A;  1DT4 A;  5K36 G;  2FMR A;  1EC6 A;  4QMF B;  2JZX A;  2NN6 G;  4AIM A;  1ZZJ A;  1K1G A;  4JVH A;  1VIG A;  2HH3 A;  2JA9 A;  2YQR A;  2JEA I;  4WAL A;  2DGR A;  2JVZ A;  1ZZK A;  4IFD G;  2QND A;  1VIH A;  1ZZI A;  2OPU A;  2PQU A;  3V69 A;  1KHM A;  1WVN A;  2CTJ A;  2JE6 I;  2JEB I;  5JEA G;  2AXY A;  1ZTG A;  1X4M A;  2OPV A;  2E3U A;  2CTK A;  3VKE A;  2ANN A;  2ANR A;  4WAN A;  2CTF A;  2BL5 A;  2MJH A;  1DTJ A;  4AM3 A;  3U1K A;  4NBQ A;  4B8T A;  5C0X G;  4LIJ A;  4OO1 G;  1X4N A;  2BA0 A;  2P2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...