2FMRA

Kh1 from the fragile x protein fmr1, nmr, 18 structures
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
65
structure length
65
Chain Sequence
ASRFHEQFIVREDLMGLAIGTHGANIQQARKVPGVTAIDLDEDTCTFHIYGEDQDAVKKARSFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords FMR1 PROTEIN
publication title The solution structure of the first KH domain of FMR1, the protein responsible for the fragile X syndrome.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 1997-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2fmrA00
5K36G 1DT4A 2E3UA 4AM3A 1ZZKA 4WALA 2PY9A 2AXYA 1VIHA 2JVZA 3L7ZC 2CTJA 2HH3A 2QNDA 1ZTGA 2JEAI 1WVNA 1ZZIA 1DTJA 1TUAA 2P2RA 2CPQA 2CTEA 1KHMA 2OPUA 4B8TA 2JE6I 4WANA 4OO1G 2ANRA 1J5KA 4LIJA 2NN6G 1J4WA 2CTLA 2DGRA 2MJHA 4JVYA 2YQRA 4IFDG 2BL5A 2CTFA 1VIGA 2CTMA 4JVHA 2ANNA 4QMFB 2Z0SA 4BA1I 4NBQA 2HH2A 4BA2I 1X4MA 2FMRA 3V69A 1EC6A 3VKEA 1ZZJA 2JA9A 2JZXA 1X4NA 2JEBI 2OPVA 5JEAG 1K1GA 2PQUA 3AEVB 5C0XG 2CTKA 2BA0A 4AIMA 3U1KA 1WE8A
chains in the Genus database with same CATH superfamily
1VBIA 1DT4A 4DR7H 3T1HH 4DUZH 2VKCA 1FKAH 3L7ZC 4JI5H 1XNRH 1N36H 1UG8A 4JV5H 2JEAI 4OX9H 1KHMA 1Z2IA 3NCVA 1TUAA 4JI2H 2CPQA 3J81W 4DV1H 5IWAH 2OPUA 2UUCH 1XNQH 5LL6b 1HNWH 3GABA 4OO1G 1V9NA 4LIJA 4K0KH 1N33H 1S03G 2YQRA 2BL5A 2CTFA 1VIGA 4LFAH 3J7AK 1SEIA 4GKJH 4BA1I 2Z0SA 3I0PA 4DR4H 4OD6A 1X9ZA 1N34H 2JA9A 3KDKA 1X4NA 5JEAG 4DV3H 1HR0H 4DV4H 4FJUA 2G8YA 4B3SH 1ODHA 1F0XA 1HNZH 4JI3H 4LF7H 4B3TH 2UXCH 2CWHA 4DUYH 1WHRA 4WALA 4LFBH 1XRHA 2AXYA 5BR8H 1IBLH 4LF8H 2X06A 3J80W 4DV5H 5A2QW 4JI7H 2HH3A 3JAMW 1DTJA 4LF6H 2VQFH 4DV2H 3GR5A 1J5KA 2NN6G 4DR2H 1J4WA 2CTLA 2DGRA 3OETA 1XMQH 2FPHX 4AQYH 3QD7X 2Y3MA 4B3MH 4B3RH 4JI6H 1FJGH 2D9IA 4JI0H 4X66H 2HH2A 3OSSD 1NXUA 2UU9H 4BA2I 4YY3H 1EC6A 3VKEA 4DV0H 2JZXA 2OPVA 2FFMA 2PQUA 4H8AA 4JI8H 3AEVB 2VQEH 4DR3H 2O4CA 2BA0A 4AIMA 4JI1H 3OTOH 5K36G 4DR5H 2E3UA 4OCHA 4AM3A 1I6UA 1ZZKA 2M6QA 4KHPH 1S20A 1VIHA 2JVZA 5DT9A 4E9JA 4LFCH 1WVNA 2LTMA 2P2RA 2CTEA 1XMOH 1J5EH 4B8TA 4WANA 4DV6H 5FLXW 4GKKH 4DR1H 4NXNH 1IBKH 4X62H 2F4VH 3KDGA 1X0AA 2CWFA 1I94H 4JVHA 2M8WA 4JYAH 1PQXA 4NBQA 2PT7G 3SB1A 3T1YH 4NZRM 4B8CD 1ZZJA 4YHHH 2K1HA 4NZTM 5LMUH 4JI4H 2LF0A 2UUBH 5IT9W 1WE8A 3UOEA 4EC5A 4G08A 1HNXH 3EZJA 2ZM6H 2PY9A 1WTJA 2CTJA 2QNDA 1ZTGA 1ZZIA 2HHHH 2JE6I 4LF5H 5LMNH 2ANRA 2ZQEA 2CPMA 2MJHA 1AN7A 2E5LH 3FAUA 4JVYA 4FJSA 4DV7H 4IFDG 4PDBA 2CTMA 3RF2A 2A1SA 2ANNA 4QMFB 2UUAH 4X65H 4LF4H 1MSZA 1IBMH 4NXMH 1X4MA 2FMRA 3V69A 4DR6H 4LF9H 2UXBH 1K1GA 1V8CA 2JEBI 2UXDH 2LTLA 5C0XG 2CTKA 1N32H 3GKUA 2LRRA 3U1KA 4X64H
chains in the Genus database with same CATH topology
5K36G 1DT4A 2E3UA 4AM3A 1ZZKA 4WALA 2PY9A 2AXYA 1VIHA 2JVZA 3L7ZC 2CTJA 2HH3A 2QNDA 1ZTGA 2JEAI 1WVNA 1ZZIA 1DTJA 1TUAA 2P2RA 2CPQA 2CTEA 1KHMA 2OPUA 4B8TA 2JE6I 4WANA 4OO1G 2ANRA 1J5KA 4LIJA 2NN6G 1J4WA 2CTLA 2DGRA 2MJHA 4JVYA 2YQRA 4IFDG 2BL5A 2CTFA 1VIGA 2CTMA 4JVHA 2ANNA 4QMFB 2Z0SA 4BA1I 4NBQA 2HH2A 4BA2I 1X4MA 2FMRA 3V69A 1EC6A 3VKEA 1ZZJA 2JA9A 2JZXA 1X4NA 2JEBI 2OPVA 5JEAG 1K1GA 2PQUA 3AEVB 5C0XG 2CTKA 2BA0A 4AIMA 3U1KA 1WE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K36 G;  1DT4 A;  2E3U A;  4AM3 A;  1ZZK A;  4WAL A;  2PY9 A;  2AXY A;  1VIH A;  2JVZ A;  3L7Z C;  2CTJ A;  2HH3 A;  2QND A;  1ZTG A;  2JEA I;  1WVN A;  1ZZI A;  1DTJ A;  1TUA A;  2P2R A;  2CPQ A;  2CTE A;  1KHM A;  2OPU A;  4B8T A;  2JE6 I;  4WAN A;  4OO1 G;  2ANR A;  1J5K A;  4LIJ A;  2NN6 G;  1J4W A;  2CTL A;  2DGR A;  2MJH A;  4JVY A;  2YQR A;  4IFD G;  2BL5 A;  2CTF A;  1VIG A;  2CTM A;  4JVH A;  2ANN A;  4QMF B;  2Z0S A;  4BA1 I;  4NBQ A;  2HH2 A;  4BA2 I;  1X4M A;  2FMR A;  3V69 A;  1EC6 A;  3VKE A;  1ZZJ A;  2JA9 A;  2JZX A;  1X4N A;  2JEB I;  2OPV A;  5JEA G;  1K1G A;  2PQU A;  3AEV B;  5C0X G;  2CTK A;  2BA0 A;  4AIM A;  3U1K A;  1WE8 A; 
#chains in the Genus database with same CATH topology
 1VBI A;  1DT4 A;  4DR7 H;  3T1H H;  4DUZ H;  2VKC A;  1FKA H;  3L7Z C;  4JI5 H;  1XNR H;  1N36 H;  1UG8 A;  4JV5 H;  2JEA I;  4OX9 H;  1KHM A;  1Z2I A;  3NCV A;  1TUA A;  4JI2 H;  2CPQ A;  3J81 W;  4DV1 H;  5IWA H;  2OPU A;  2UUC H;  1XNQ H;  5LL6 b;  1HNW H;  3GAB A;  4OO1 G;  1V9N A;  4LIJ A;  4K0K H;  1N33 H;  1S03 G;  2YQR A;  2BL5 A;  2CTF A;  1VIG A;  4LFA H;  3J7A K;  1SEI A;  4GKJ H;  4BA1 I;  2Z0S A;  3I0P A;  4DR4 H;  4OD6 A;  1X9Z A;  1N34 H;  2JA9 A;  3KDK A;  1X4N A;  5JEA G;  4DV3 H;  1HR0 H;  4DV4 H;  4FJU A;  2G8Y A;  4B3S H;  1ODH A;  1F0X A;  1HNZ H;  4JI3 H;  4LF7 H;  4B3T H;  2UXC H;  2CWH A;  4DUY H;  1WHR A;  4WAL A;  4LFB H;  1XRH A;  2AXY A;  5BR8 H;  1IBL H;  4LF8 H;  2X06 A;  3J80 W;  4DV5 H;  5A2Q W;  4JI7 H;  2HH3 A;  3JAM W;  1DTJ A;  4LF6 H;  2VQF H;  4DV2 H;  3GR5 A;  1J5K A;  2NN6 G;  4DR2 H;  1J4W A;  2CTL A;  2DGR A;  3OET A;  1XMQ H;  2FPH X;  4AQY H;  3QD7 X;  2Y3M A;  4B3M H;  4B3R H;  4JI6 H;  1FJG H;  2D9I A;  4JI0 H;  4X66 H;  2HH2 A;  3OSS D;  1NXU A;  2UU9 H;  4BA2 I;  4YY3 H;  1EC6 A;  3VKE A;  4DV0 H;  2JZX A;  2OPV A;  2FFM A;  2PQU A;  4H8A A;  4JI8 H;  3AEV B;  2VQE H;  4DR3 H;  2O4C A;  2BA0 A;  4AIM A;  4JI1 H;  3OTO H;  5K36 G;  4DR5 H;  2E3U A;  4OCH A;  4AM3 A;  1I6U A;  1ZZK A;  2M6Q A;  4KHP H;  1S20 A;  1VIH A;  2JVZ A;  5DT9 A;  4E9J A;  4LFC H;  1WVN A;  2LTM A;  2P2R A;  2CTE A;  1XMO H;  1J5E H;  4B8T A;  4WAN A;  4DV6 H;  5FLX W;  4GKK H;  4DR1 H;  4NXN H;  1IBK H;  4X62 H;  2F4V H;  3KDG A;  1X0A A;  2CWF A;  1I94 H;  4JVH A;  2M8W A;  4JYA H;  1PQX A;  4NBQ A;  2PT7 G;  3SB1 A;  3T1Y H;  4NZR M;  4B8C D;  1ZZJ A;  4YHH H;  2K1H A;  4NZT M;  5LMU H;  4JI4 H;  2LF0 A;  2UUB H;  5IT9 W;  1WE8 A;  3UOE A;  4EC5 A;  4G08 A;  1HNX H;  3EZJ A;  2ZM6 H;  2PY9 A;  1WTJ A;  2CTJ A;  2QND A;  1ZTG A;  1ZZI A;  2HHH H;  2JE6 I;  4LF5 H;  5LMN H;  2ANR A;  2ZQE A;  2CPM A;  2MJH A;  1AN7 A;  2E5L H;  3FAU A;  4JVY A;  4FJS A;  4DV7 H;  4IFD G;  4PDB A;  2CTM A;  3RF2 A;  2A1S A;  2ANN A;  4QMF B;  2UUA H;  4X65 H;  4LF4 H;  1MSZ A;  1IBM H;  4NXM H;  1X4M A;  2FMR A;  3V69 A;  4DR6 H;  4LF9 H;  2UXB H;  1K1G A;  1V8C A;  2JEB I;  2UXD H;  2LTL A;  5C0X G;  2CTK A;  1N32 H;  3GKU A;  2LRR A;  3U1K A;  4X64 H; 
#chains in the Genus database with same CATH homology
 5K36 G;  1DT4 A;  2E3U A;  4AM3 A;  1ZZK A;  4WAL A;  2PY9 A;  2AXY A;  1VIH A;  2JVZ A;  3L7Z C;  2CTJ A;  2HH3 A;  2QND A;  1ZTG A;  2JEA I;  1WVN A;  1ZZI A;  1DTJ A;  1TUA A;  2P2R A;  2CPQ A;  2CTE A;  1KHM A;  2OPU A;  4B8T A;  2JE6 I;  4WAN A;  4OO1 G;  2ANR A;  1J5K A;  4LIJ A;  2NN6 G;  1J4W A;  2CTL A;  2DGR A;  2MJH A;  4JVY A;  2YQR A;  4IFD G;  2BL5 A;  2CTF A;  1VIG A;  2CTM A;  4JVH A;  2ANN A;  4QMF B;  2Z0S A;  4BA1 I;  4NBQ A;  2HH2 A;  4BA2 I;  1X4M A;  2FMR A;  3V69 A;  1EC6 A;  3VKE A;  1ZZJ A;  2JA9 A;  2JZX A;  1X4N A;  2JEB I;  2OPV A;  5JEA G;  1K1G A;  2PQU A;  3AEV B;  5C0X G;  2CTK A;  2BA0 A;  4AIM A;  3U1K A;  1WE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...