2FMRA

Kh1 from the fragile x protein fmr1, nmr, 18 structures
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
65
structure length
65
Chain Sequence
ASRFHEQFIVREDLMGLAIGTHGANIQQARKVPGVTAIDLDEDTCTFHIYGEDQDAVKKARSFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMR1 PROTEIN
publication title The solution structure of the first KH domain of FMR1, the protein responsible for the fragile X syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 8
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 1997-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2fmrA00
1EC6A 2ANRA 5JEAG 2FMRA 2PY9A 1WE8A 3L7ZC 4LIJA 2MJHA 2JEAI 2JZXA 1WVNA 2HH2A 2ANNA 2Z0SA 1K1GA 2AXYA 3AEVB 1VIGA 2BL5A 1ZZIA 2BA0A 2DGRA 2JEBI 3VKEA 4JVHA 5K36G 2CPQA 5C0XG 2CTMA 2PQUA 4BA2I 4WANA 4JVYA 2CTEA 4QMFB 2NN6G 3V69A 1J5KA 4OO1G 2YQRA 4AM3A 1DTJA 1DT4A 2QNDA 2OPUA 3U1KA 1KHMA 2OPVA 2CTFA 2HH3A 4B8TA 1X4MA 2E3UA 4BA1I 1J4WA 2CTLA 4NBQA 2JE6I 1ZTGA 4AIMA 2P2RA 1VIHA 1ZZKA 4IFDG 1ZZJA 2JA9A 2JVZA 1TUAA 2CTKA 2CTJA 1X4NA 4WALA
chains in the Genus database with same CATH superfamily
5JEAG 3UOEA 3L7ZC 4LIJA 4DR3H 1XMQH 1IBMH 1WVNA 2ANNA 2Z0SA 2E5LH 1HNWH 4FJUA 1ZZIA 2DGRA 1J5EH 4KHPH 5DT9A 5C0XG 2CTMA 4OX9H 4DV3H 2CTEA 1FJGH 4YY3H 3V69A 4NZTM 4FJSA 3GABA 4JI0H 1N32H 4LFAH 2LF0A 3RF2A 1WHRA 1DTJA 1MSZA 1DT4A 2QNDA 3OETA 4B3MH 1NXUA 1V9NA 4JYAH 2P2RA 1SEIA 4NBQA 4AIMA 4JI1H 4LF5H 1ZZKA 2G8YA 4X66H 4X62H 4DV6H 2UXCH 4IFDG 2LTMA 2CPMA 4JI2H 1IBKH 2M6QA 1TUAA 5FLXW 4LFBH 1AN7A 4NXMH 4WALA 4LF6H 2ANRA 4GKKH 4YHHH 2CWHA 2ZM6H 3EZJA 2PY9A 3FAUA 4OCHA 2JZXA 4JI6H 2HH2A 4DR7H 2UXDH 3OTOH 1HNXH 2M8WA 1VIGA 1ODHA 2BL5A 2BA0A 2JEBI 4OD6A 2A1SA 1FKAH 5A2QW 2VQFH 3KDGA 1UG8A 2UUAH 2ZQEA 4LF4H 1S03G 4LF9H 1X9ZA 2K1HA 4JI4H 4DUYH 2YQRA 2LRRA 4AM3A 1XNRH 3GKUA 2UXBH 2O4CA 2OPVA 4B8TA 1N33H 1X4MA 4BA1I 2CWFA 4X65H 1VIHA 4DV7H 1X0AA 3NCVA 1XMOH 2VKCA 2JA9A 5LMNH 2VQEH 4DR4H 5IWAH 2UUCH 2UUBH 4X64H 1N34H 2MJHA 4JI3H 2X06A 1K1GA 3AEVB 4LF8H 2PT7G 1PQXA 3VKEA 4H8AA 5K36G 2CPQA 4G08A 4NXNH 4WANA 4JVYA 1IBLH 4DR2H 4JI8H 4NZRM 1WTJA 4B3RH 3J7AK 1J5KA 3T1HH 4JV5H 4OO1G 3T1YH 5LL6b 4PDBA 1I94H 4B8CD 4DV0H 4DR5H 2OPUA 3U1KA 1KHMA 4DUZH 2E3UA 1J4WA 3QD7X 3J80W 2CTLA 4LFCH 2JE6I 2LTLA 2F4VH 4DR6H 1V8CA 3GR5A 4DR1H 1Z2IA 1VBIA 2Y3MA 3SB1A 5BR8H 4DV4H 1S20A 4B3SH 3I0PA 4EC5A 4K0KH 1XNQH 1EC6A 2FMRA 2FPHX 1WE8A 4DV5H 2JEAI 2FFMA 3J81W 2AXYA 2HHHH 4JI7H 4JVHA 2PQUA 4B3TH 4BA2I 4DV1H 3JAMW 1HR0H 4QMFB 2NN6G 5LMUH 1N36H 4E9JA 4AQYH 1XRHA 4DV2H 4GKJH 5IT9W 2CTFA 2HH3A 3KDKA 1ZTGA 4LF7H 1HNZH 3OSSD 1I6UA 1ZZJA 2JVZA 2CTKA 4JI5H 2CTJA 1X4NA 2UU9H 2D9IA 1F0XA
chains in the Genus database with same CATH topology
1EC6A 2ANRA 5JEAG 2FMRA 2PY9A 1WE8A 3L7ZC 4LIJA 2MJHA 2JEAI 2JZXA 1WVNA 2HH2A 2ANNA 2Z0SA 1K1GA 2AXYA 3AEVB 1VIGA 2BL5A 1ZZIA 2BA0A 2DGRA 2JEBI 3VKEA 4JVHA 5K36G 2CPQA 5C0XG 2CTMA 2PQUA 4BA2I 4WANA 4JVYA 2CTEA 4QMFB 2NN6G 3V69A 1J5KA 4OO1G 2YQRA 4AM3A 1DTJA 1DT4A 2QNDA 2OPUA 3U1KA 1KHMA 2OPVA 2CTFA 2HH3A 4B8TA 1X4MA 2E3UA 4BA1I 1J4WA 2CTLA 4NBQA 2JE6I 1ZTGA 4AIMA 2P2RA 1VIHA 1ZZKA 4IFDG 1ZZJA 2JA9A 2JVZA 1TUAA 2CTKA 2CTJA 1X4NA 4WALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EC6 A;  2ANR A;  5JEA G;  2FMR A;  2PY9 A;  1WE8 A;  3L7Z C;  4LIJ A;  2MJH A;  2JEA I;  2JZX A;  1WVN A;  2HH2 A;  2ANN A;  2Z0S A;  1K1G A;  2AXY A;  3AEV B;  1VIG A;  2BL5 A;  1ZZI A;  2BA0 A;  2DGR A;  2JEB I;  3VKE A;  4JVH A;  5K36 G;  2CPQ A;  5C0X G;  2CTM A;  2PQU A;  4BA2 I;  4WAN A;  4JVY A;  2CTE A;  4QMF B;  2NN6 G;  3V69 A;  1J5K A;  4OO1 G;  2YQR A;  4AM3 A;  1DTJ A;  1DT4 A;  2QND A;  2OPU A;  3U1K A;  1KHM A;  2OPV A;  2CTF A;  2HH3 A;  4B8T A;  1X4M A;  2E3U A;  4BA1 I;  1J4W A;  2CTL A;  4NBQ A;  2JE6 I;  1ZTG A;  4AIM A;  2P2R A;  1VIH A;  1ZZK A;  4IFD G;  1ZZJ A;  2JA9 A;  2JVZ A;  1TUA A;  2CTK A;  2CTJ A;  1X4N A;  4WAL A; 
#chains in the Genus database with same CATH topology
 5JEA G;  3UOE A;  3L7Z C;  4LIJ A;  4DR3 H;  1XMQ H;  1IBM H;  1WVN A;  2ANN A;  2Z0S A;  2E5L H;  1HNW H;  4FJU A;  1ZZI A;  2DGR A;  1J5E H;  4KHP H;  5DT9 A;  5C0X G;  2CTM A;  4OX9 H;  4DV3 H;  2CTE A;  1FJG H;  4YY3 H;  3V69 A;  4NZT M;  4FJS A;  3GAB A;  4JI0 H;  1N32 H;  4LFA H;  2LF0 A;  3RF2 A;  1WHR A;  1DTJ A;  1MSZ A;  1DT4 A;  2QND A;  3OET A;  4B3M H;  1NXU A;  1V9N A;  4JYA H;  2P2R A;  1SEI A;  4NBQ A;  4AIM A;  4JI1 H;  4LF5 H;  1ZZK A;  2G8Y A;  4X66 H;  4X62 H;  4DV6 H;  2UXC H;  4IFD G;  2LTM A;  2CPM A;  4JI2 H;  1IBK H;  2M6Q A;  1TUA A;  5FLX W;  4LFB H;  1AN7 A;  4NXM H;  4WAL A;  4LF6 H;  2ANR A;  4GKK H;  4YHH H;  2CWH A;  2ZM6 H;  3EZJ A;  2PY9 A;  3FAU A;  4OCH A;  2JZX A;  4JI6 H;  2HH2 A;  4DR7 H;  2UXD H;  3OTO H;  1HNX H;  2M8W A;  1VIG A;  1ODH A;  2BL5 A;  2BA0 A;  2JEB I;  4OD6 A;  2A1S A;  1FKA H;  5A2Q W;  2VQF H;  3KDG A;  1UG8 A;  2UUA H;  2ZQE A;  4LF4 H;  1S03 G;  4LF9 H;  1X9Z A;  2K1H A;  4JI4 H;  4DUY H;  2YQR A;  2LRR A;  4AM3 A;  1XNR H;  3GKU A;  2UXB H;  2O4C A;  2OPV A;  4B8T A;  1N33 H;  1X4M A;  4BA1 I;  2CWF A;  4X65 H;  1VIH A;  4DV7 H;  1X0A A;  3NCV A;  1XMO H;  2VKC A;  2JA9 A;  5LMN H;  2VQE H;  4DR4 H;  5IWA H;  2UUC H;  2UUB H;  4X64 H;  1N34 H;  2MJH A;  4JI3 H;  2X06 A;  1K1G A;  3AEV B;  4LF8 H;  2PT7 G;  1PQX A;  3VKE A;  4H8A A;  5K36 G;  2CPQ A;  4G08 A;  4NXN H;  4WAN A;  4JVY A;  1IBL H;  4DR2 H;  4JI8 H;  4NZR M;  1WTJ A;  4B3R H;  3J7A K;  1J5K A;  3T1H H;  4JV5 H;  4OO1 G;  3T1Y H;  5LL6 b;  4PDB A;  1I94 H;  4B8C D;  4DV0 H;  4DR5 H;  2OPU A;  3U1K A;  1KHM A;  4DUZ H;  2E3U A;  1J4W A;  3QD7 X;  3J80 W;  2CTL A;  4LFC H;  2JE6 I;  2LTL A;  2F4V H;  4DR6 H;  1V8C A;  3GR5 A;  4DR1 H;  1Z2I A;  1VBI A;  2Y3M A;  3SB1 A;  5BR8 H;  4DV4 H;  1S20 A;  4B3S H;  3I0P A;  4EC5 A;  4K0K H;  1XNQ H;  1EC6 A;  2FMR A;  2FPH X;  1WE8 A;  4DV5 H;  2JEA I;  2FFM A;  3J81 W;  2AXY A;  2HHH H;  4JI7 H;  4JVH A;  2PQU A;  4B3T H;  4BA2 I;  4DV1 H;  3JAM W;  1HR0 H;  4QMF B;  2NN6 G;  5LMU H;  1N36 H;  4E9J A;  4AQY H;  1XRH A;  4DV2 H;  4GKJ H;  5IT9 W;  2CTF A;  2HH3 A;  3KDK A;  1ZTG A;  4LF7 H;  1HNZ H;  3OSS D;  1I6U A;  1ZZJ A;  2JVZ A;  2CTK A;  4JI5 H;  2CTJ A;  1X4N A;  2UU9 H;  2D9I A;  1F0X A; 
#chains in the Genus database with same CATH homology
 1EC6 A;  2ANR A;  5JEA G;  2FMR A;  2PY9 A;  1WE8 A;  3L7Z C;  4LIJ A;  2MJH A;  2JEA I;  2JZX A;  1WVN A;  2HH2 A;  2ANN A;  2Z0S A;  1K1G A;  2AXY A;  3AEV B;  1VIG A;  2BL5 A;  1ZZI A;  2BA0 A;  2DGR A;  2JEB I;  3VKE A;  4JVH A;  5K36 G;  2CPQ A;  5C0X G;  2CTM A;  2PQU A;  4BA2 I;  4WAN A;  4JVY A;  2CTE A;  4QMF B;  2NN6 G;  3V69 A;  1J5K A;  4OO1 G;  2YQR A;  4AM3 A;  1DTJ A;  1DT4 A;  2QND A;  2OPU A;  3U1K A;  1KHM A;  2OPV A;  2CTF A;  2HH3 A;  4B8T A;  1X4M A;  2E3U A;  4BA1 I;  1J4W A;  2CTL A;  4NBQ A;  2JE6 I;  1ZTG A;  4AIM A;  2P2R A;  1VIH A;  1ZZK A;  4IFD G;  1ZZJ A;  2JA9 A;  2JVZ A;  1TUA A;  2CTK A;  2CTJ A;  1X4N A;  4WAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...