1WTJA

Crystal structure of delta1-piperideine-2-carboxylate reductase from pseudomonas syringae pvar.tomato
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
332
Chain Sequence
b'TQTVSYPQLIDLLRRIFVVHGTSPEVADVLAENCASAQRDGSHSHGIFRIPGYLSSLASGWVDGKAVPVVEDVGAAFVRVDACNGFAQPALAAARSLLIDKARSAGVAILAIRGSHHFAALWPDVEPFAEQGLVALSMVNSMTCVVPHGARQPLFGTNPIAFGAPRAGGEPIVFDLATSAIAHGDVQIAAREGRLLPAGMGVDRDGLPTQEPRAILDGGALLPFGGHKGSALSMMVELLAAGLTGGNFSFEFDWSKHPGAQTPWTGQLLIVIDPDKGAGQHFAQRSEELVRQLHGVGQERLPGDRRYLERARSMAHGIVIAQADLERLQELA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ureidoglycolate dehydrogenase
publication title Crystal structures of Delta1-piperideine-2-carboxylate/Delta1-pyrroline-2-carboxylate reductase belonging to a new family of NAD(P)H-dependent oxidoreductases: conformational change, substrate recognition, and stereochemistry of the reaction
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
total genus 111
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.4.1.17: N-methylalanine dehydrogenase.
pdb deposition date 2004-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 1wtjA01
3.30.60.50 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Hypothetical oxidoreductase yiak; domain 3 1wtjA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 1wtjA02
3I0PA 1V9NA 3UOEA 1X0AA 2G8YA 4FJSA 1VBIA 1WTJA 1NXUA 1Z2IA 2CWHA 4FJUA 1S20A 4H8AA 1XRHA 2CWFA 2X06A
chains in the Genus database with same CATH superfamily
1X0AA 1V1HA 2SGEI 4LFBH 1XA6A 4E1RA 1R79A 4UXHA 2N71A 3UGLA 1NXUA 2E5RA 1FKAH 4DV0H 3MEKA 4A24A 2E3UA 2OPUA 4DUYH 5FUXA 3HH2C 1TBOA 2OPVA 4LF7H 1PCEA 1ODHA 5E3QA 5HQ8A 4OX9H 3RF2A 3AEVB 2Z0SA 2ROWA 3OVOA 4NXNH 4B8CD 3UFFA 2DKVA 1XNQH 1N36H 1PTQA 5DT9A 1OMTA 3QWPA 2YQPA 3CXLA 2E73A 2FFMA 1J4WA 1DS3I 2RC4A 3I0PA 2CTEA 3OXGA 1X4SA 1V8CA 2LEOA 1PPFI 2ENNA 2E5LH 2UUCH 2JEBI 1M8BA 2N17A 4AIMA 2F3CI 1W4RA 4FJSA 2CTMA 5LL6b 4X65H 4WALA 4B3MH 4JI0H 3KDGA 1W3SA 3QD7X 4L9MA 4JI4H 2YQRA 2OZUA 2BL5A 3VE5A 2KCXA 1IBMH 2WGCA 1Y8FA 2LRRA 4K0KH 1CGII 3U1KA 1WHRA 2GKRI 2L8EA 5A2QW 3R5AA 4KHPH 4SGBI 2LTLA 4DUZH 4NXMH 2GKVA 5DAEA 3TOAA 4B3RH 4JCVE 4OO1G 4DR4H 2HH2A 3GKUA 3OTOH 2DGRA 3E59A 2CWGA 3NCVA 2KMOA 4G08A 1X4MA 2CPQA 4DR5H 2HH3A 5LMNH 1CT0I 4YY3H 5FUVA 2BA0A 2PQUA 4BA1I 2N1AB 2LUYA 4LF6H 2P2RA 4OCHA 3KDKA 5IWAH 2CWHA 2NN6G 4DV7H 1S03G 4UXIA 1PTRA 2N52A 1V9NA 4DV4H 1RFHA 2ELIA 4WANA 4H8AA 1VDDA 2X06A 1ULNA 4PDBA 1UHAA 2JE6I 1K7TA 4FJUA 2UZ3A 1MJ9A 2CJSC 5JHWC 1N32H 2AXYA 2L7XA 4DNCA 1YU6C 1SGRI 1DS2I 2ANRA 5FUWA 2JA9A 2UXDH 1VIGA 2M8WA 2XRCA 1N34H 5J8CA 5EX0A 4JI5H 2ENZA 4NBQA 4QMFB 1J5KA 2CTKA 2KMPA 1WGTA 4X62H 4B3TH 1OYVI 2K9HA 4E1PA 1DT4A 1XX6A 1I94H 2G8YA 1SGPI 4JI8H 2NU4I 3E2IA 2A1SA 2UU9H 3TO9A 4B3SH 3SGBI 1IBKH 3J81W 2B0UC 3FSXA 1P9GA 1PJUA 4JVHA 2QQ0A 3J7AK 1Z7KB 2ANNA 2CTLA 5C0XG 4E9JA 4DR7H 2OD1A 2J87A 4DV2H 1WE8A 2JA1A 2LB7A 2ODDA 4BA2I 3FSYA 4GKJH 1UG8A 3GABA 3GR5A 3UEJA 5LMUH 1XMQH 4EC5A 3UEYA 5E3PA 2UUBH 1BUSA 1KBFA 2CTJA 1SGNI 1SEIA 2WVJA 4YHHH 1ZZKA 2ORWA 2GKTI 5FLXW 3TOBA 3SEKC 2VKCA 2QPOA 1HR0H 2KMRA 2JVZA 2JW6A 4FKDA 4WP4A 1TBRR 4DV1H 2V1CA 4JYAH 1XRHA 1U5KA 1ZTGA 1OVOA 2VQFH 4X66H 1TIHA 2WCYA 1TGSI 2PQ8A 1K7VA 4JI1H 1UVFA 4JVYA 3OXLA 1LR8A 2UXBH 4OD6A 1HNXH 3VDPA 2CWFA 3UGDA 2YUUA 2HHHH 2ERWA 1XBTA 1UUCA 3JAMW 1WKXA 1N33H 5EX3A 4AQYH 2DIPA 3UGIA 2GVIA 2QQDA 1TUSA 5E3RA 4DV6H 5FUYA 2UVOA 3UOEA 2Y0MA 2D9IA 3OSSD 3SGQI 1KMAA 2M5XA 4GI3C 4JI7H 1IBLH 2A20A 1S20A 5K36G 3OL0A 3V69A 3KY9A 4B8TA 1IW4A 2K1HA 1ULMA 7WGAA 1FY7A 4GKKH 1Q9BA 1HEVA 2MJHA 4DR6H 1VBIA 1X4NA 1CE3A 2JEAI 1LR9A 1F0XA 2O4CA 1NUBA 1FYBA 4LIJA 3R5BA 2LF0A 1UVGA 2UUAH 4LF4H 3FC3A 1IY5A 4OVOA 1HNWH 1HNZH 5HI7A 4DR1H 1K7UA 4NZTM 1M8CA 2SGPI 1LR7A 2V53A 1CT4I 1MT1A 3L7ZC 2Y3MA 1FARA 1J5EH 1V1IA 1H0ZA 2PY9A 2FPHX 2M6QA 1MJAA 1KBEA 2VQEH 1FAQA 1YTPA 2VRWB 1BMOA 1HPTA 2QQCA 2SGFI 4X64H 1XNRH 1Y1BA 4DR2H 2QQEA 2V1CC 2B8TA 4LF9H 3QAHA 1MJBA 1SGDI 1TOTA 2RIJA 3B4VC 2F4VH 4JV5H 3SB1A 1TBNA 1AN7A 3GOXA 3BJIA 2JZXA 2JZMA 4LFCH 3R5CA 2ZM6H 2NU2I 1TBQR 2JYYA 4JI2H 1ULKA 2LTMA 4NZRM 2CTFA 3RU0A 1P9ZA 3EZJA 3FAUA 1FJGH 1TURA 2CPMA 2OVOA 4HGUA 1HJAI 1N13A 1WGCA 2UXCH 1ZZJA 1XMOH 3T1YH 1EC6A 1PQXA 3PDNA 5BR8H 3D00A 1WVNA 1SGYI 3T1HH 4B6DA 1TUAA 1CT2I 4DR3H 1ZZIA 2X3TA 1IY6A 5CCMA 5JEAG 5IT9W 3VDUA 1DTJA 2BUSA 3TJQA 4AMLA 1SGQI 1K1GA 1KHMA 4DV5H 3QTLD 4LF8H 3VKEA 9WGAA 4MPIA 5CCLA 2J9RA 1MSZA 2JXDA 2FMRA 2ZQEA 4JI3H 3OETA 4LF5H 2W0TA 1Z2IA 5J8FA 3OXFA 1Y1CA 1CHOI 2GIVA 1X74A 2OU2A 2SGQI 1WTJA 4JI6H 2NU3I 2NU1I 2ORVA 4DV3H 2SGDI 2ARPF 2KMQA 1I6UA 1OMUA 1R0RI 3TO6A 2X52A 3TO7A 3R5DA 1CGJI 4AM3A 2NU0I 2DB6A 1HDLA 2P6AC 1SGEI 1CSOI 2PT7G 4LFAH 1X9ZA 2QNDA 1VIHA 2FNFX 4UXJA 3J80W 4IFDG 1AN1I
chains in the Genus database with same CATH topology
3I0PA 1V9NA 3UOEA 1X0AA 2G8YA 4FJSA 1VBIA 1WTJA 1NXUA 1Z2IA 2CWHA 4FJUA 1S20A 4H8AA 1XRHA 2CWFA 2X06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0P A;  1V9N A;  3UOE A;  1X0A A;  2G8Y A;  4FJS A;  1VBI A;  1WTJ A;  1NXU A;  1Z2I A;  2CWH A;  4FJU A;  1S20 A;  4H8A A;  1XRH A;  2CWF A;  2X06 A; 
#chains in the Genus database with same CATH topology
 1X0A A;  1V1H A;  2SGE I;  4LFB H;  1XA6 A;  4E1R A;  1R79 A;  4UXH A;  2N71 A;  3UGL A;  1NXU A;  2E5R A;  1FKA H;  4DV0 H;  3MEK A;  4A24 A;  2E3U A;  2OPU A;  4DUY H;  5FUX A;  3HH2 C;  1TBO A;  2OPV A;  4LF7 H;  1PCE A;  1ODH A;  5E3Q A;  5HQ8 A;  4OX9 H;  3RF2 A;  3AEV B;  2Z0S A;  2ROW A;  3OVO A;  4NXN H;  4B8C D;  3UFF A;  2DKV A;  1XNQ H;  1N36 H;  1PTQ A;  5DT9 A;  1OMT A;  3QWP A;  2YQP A;  3CXL A;  2E73 A;  2FFM A;  1J4W A;  1DS3 I;  2RC4 A;  3I0P A;  2CTE A;  3OXG A;  1X4S A;  1V8C A;  2LEO A;  1PPF I;  2ENN A;  2E5L H;  2UUC H;  2JEB I;  1M8B A;  2N17 A;  4AIM A;  2F3C I;  1W4R A;  4FJS A;  2CTM A;  5LL6 b;  4X65 H;  4WAL A;  4B3M H;  4JI0 H;  3KDG A;  1W3S A;  3QD7 X;  4L9M A;  4JI4 H;  2YQR A;  2OZU A;  2BL5 A;  3VE5 A;  2KCX A;  1IBM H;  2WGC A;  1Y8F A;  2LRR A;  4K0K H;  1CGI I;  3U1K A;  1WHR A;  2GKR I;  2L8E A;  5A2Q W;  3R5A A;  4KHP H;  4SGB I;  2LTL A;  4DUZ H;  4NXM H;  2GKV A;  5DAE A;  3TOA A;  4B3R H;  4JCV E;  4OO1 G;  4DR4 H;  2HH2 A;  3GKU A;  3OTO H;  2DGR A;  3E59 A;  2CWG A;  3NCV A;  2KMO A;  4G08 A;  1X4M A;  2CPQ A;  4DR5 H;  2HH3 A;  5LMN H;  1CT0 I;  4YY3 H;  5FUV A;  2BA0 A;  2PQU A;  4BA1 I;  2N1A B;  2LUY A;  4LF6 H;  2P2R A;  4OCH A;  3KDK A;  5IWA H;  2CWH A;  2NN6 G;  4DV7 H;  1S03 G;  4UXI A;  1PTR A;  2N52 A;  1V9N A;  4DV4 H;  1RFH A;  2ELI A;  4WAN A;  4H8A A;  1VDD A;  2X06 A;  1ULN A;  4PDB A;  1UHA A;  2JE6 I;  1K7T A;  4FJU A;  2UZ3 A;  1MJ9 A;  2CJS C;  5JHW C;  1N32 H;  2AXY A;  2L7X A;  4DNC A;  1YU6 C;  1SGR I;  1DS2 I;  2ANR A;  5FUW A;  2JA9 A;  2UXD H;  1VIG A;  2M8W A;  2XRC A;  1N34 H;  5J8C A;  5EX0 A;  4JI5 H;  2ENZ A;  4NBQ A;  4QMF B;  1J5K A;  2CTK A;  2KMP A;  1WGT A;  4X62 H;  4B3T H;  1OYV I;  2K9H A;  4E1P A;  1DT4 A;  1XX6 A;  1I94 H;  2G8Y A;  1SGP I;  4JI8 H;  2NU4 I;  3E2I A;  2A1S A;  2UU9 H;  3TO9 A;  4B3S H;  3SGB I;  1IBK H;  3J81 W;  2B0U C;  3FSX A;  1P9G A;  1PJU A;  4JVH A;  2QQ0 A;  3J7A K;  1Z7K B;  2ANN A;  2CTL A;  5C0X G;  4E9J A;  4DR7 H;  2OD1 A;  2J87 A;  4DV2 H;  1WE8 A;  2JA1 A;  2LB7 A;  2ODD A;  4BA2 I;  3FSY A;  4GKJ H;  1UG8 A;  3GAB A;  3GR5 A;  3UEJ A;  5LMU H;  1XMQ H;  4EC5 A;  3UEY A;  5E3P A;  2UUB H;  1BUS A;  1KBF A;  2CTJ A;  1SGN I;  1SEI A;  2WVJ A;  4YHH H;  1ZZK A;  2ORW A;  2GKT I;  5FLX W;  3TOB A;  3SEK C;  2VKC A;  2QPO A;  1HR0 H;  2KMR A;  2JVZ A;  2JW6 A;  4FKD A;  4WP4 A;  1TBR R;  4DV1 H;  2V1C A;  4JYA H;  1XRH A;  1U5K A;  1ZTG A;  1OVO A;  2VQF H;  4X66 H;  1TIH A;  2WCY A;  1TGS I;  2PQ8 A;  1K7V A;  4JI1 H;  1UVF A;  4JVY A;  3OXL A;  1LR8 A;  2UXB H;  4OD6 A;  1HNX H;  3VDP A;  2CWF A;  3UGD A;  2YUU A;  2HHH H;  2ERW A;  1XBT A;  1UUC A;  3JAM W;  1WKX A;  1N33 H;  5EX3 A;  4AQY H;  2DIP A;  3UGI A;  2GVI A;  2QQD A;  1TUS A;  5E3R A;  4DV6 H;  5FUY A;  2UVO A;  3UOE A;  2Y0M A;  2D9I A;  3OSS D;  3SGQ I;  1KMA A;  2M5X A;  4GI3 C;  4JI7 H;  1IBL H;  2A20 A;  1S20 A;  5K36 G;  3OL0 A;  3V69 A;  3KY9 A;  4B8T A;  1IW4 A;  2K1H A;  1ULM A;  7WGA A;  1FY7 A;  4GKK H;  1Q9B A;  1HEV A;  2MJH A;  4DR6 H;  1VBI A;  1X4N A;  1CE3 A;  2JEA I;  1LR9 A;  1F0X A;  2O4C A;  1NUB A;  1FYB A;  4LIJ A;  3R5B A;  2LF0 A;  1UVG A;  2UUA H;  4LF4 H;  3FC3 A;  1IY5 A;  4OVO A;  1HNW H;  1HNZ H;  5HI7 A;  4DR1 H;  1K7U A;  4NZT M;  1M8C A;  2SGP I;  1LR7 A;  2V53 A;  1CT4 I;  1MT1 A;  3L7Z C;  2Y3M A;  1FAR A;  1J5E H;  1V1I A;  1H0Z A;  2PY9 A;  2FPH X;  2M6Q A;  1MJA A;  1KBE A;  2VQE H;  1FAQ A;  1YTP A;  2VRW B;  1BMO A;  1HPT A;  2QQC A;  2SGF I;  4X64 H;  1XNR H;  1Y1B A;  4DR2 H;  2QQE A;  2V1C C;  2B8T A;  4LF9 H;  3QAH A;  1MJB A;  1SGD I;  1TOT A;  2RIJ A;  3B4V C;  2F4V H;  4JV5 H;  3SB1 A;  1TBN A;  1AN7 A;  3GOX A;  3BJI A;  2JZX A;  2JZM A;  4LFC H;  3R5C A;  2ZM6 H;  2NU2 I;  1TBQ R;  2JYY A;  4JI2 H;  1ULK A;  2LTM A;  4NZR M;  2CTF A;  3RU0 A;  1P9Z A;  3EZJ A;  3FAU A;  1FJG H;  1TUR A;  2CPM A;  2OVO A;  4HGU A;  1HJA I;  1N13 A;  1WGC A;  2UXC H;  1ZZJ A;  1XMO H;  3T1Y H;  1EC6 A;  1PQX A;  3PDN A;  5BR8 H;  3D00 A;  1WVN A;  1SGY I;  3T1H H;  4B6D A;  1TUA A;  1CT2 I;  4DR3 H;  1ZZI A;  2X3T A;  1IY6 A;  5CCM A;  5JEA G;  5IT9 W;  3VDU A;  1DTJ A;  2BUS A;  3TJQ A;  4AML A;  1SGQ I;  1K1G A;  1KHM A;  4DV5 H;  3QTL D;  4LF8 H;  3VKE A;  9WGA A;  4MPI A;  5CCL A;  2J9R A;  1MSZ A;  2JXD A;  2FMR A;  2ZQE A;  4JI3 H;  3OET A;  4LF5 H;  2W0T A;  1Z2I A;  5J8F A;  3OXF A;  1Y1C A;  1CHO I;  2GIV A;  1X74 A;  2OU2 A;  2SGQ I;  1WTJ A;  4JI6 H;  2NU3 I;  2NU1 I;  2ORV A;  4DV3 H;  2SGD I;  2ARP F;  2KMQ A;  1I6U A;  1OMU A;  1R0R I;  3TO6 A;  2X52 A;  3TO7 A;  3R5D A;  1CGJ I;  4AM3 A;  2NU0 I;  2DB6 A;  1HDL A;  2P6A C;  1SGE I;  1CSO I;  2PT7 G;  4LFA H;  1X9Z A;  2QND A;  1VIH A;  2FNF X;  4UXJ A;  3J80 W;  4IFD G;  1AN1 I; 
#chains in the Genus database with same CATH homology
 3I0P A;  1V9N A;  3UOE A;  1X0A A;  2G8Y A;  4FJS A;  1VBI A;  1WTJ A;  1NXU A;  1Z2I A;  2CWH A;  4FJU A;  1S20 A;  4H8A A;  1XRH A;  2CWF A;  2X06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...