1WTJA

Crystal structure of delta1-piperideine-2-carboxylate reductase from pseudomonas syringae pvar.tomato
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
332
Chain Sequence
TQTVSYPQLIDLLRRIFVVHGTSPEVADVLAENCASAQRDGSHSHGIFRIPGYLSSLASGWVDGKAVPVVEDVGAAFVRVDACNGFAQPALAAARSLLIDKARSAGVAILAIRGSHHFAALWPDVEPFAEQGLVALSMVNSMTCVVPHGARQPLFGTNPIAFGAPRAGGEPIVFDLATSAIAHGDVQIAAREGRLLPAGMGVDRDGLPTQEPRAILDGGALLPFGGHKGSALSMMVELLAAGLTGGNFSFEFDWSKHPGAQTPWTGQLLIVIDPDKGAGQHFAQRSEELVRQLHGVGQERLPGDRRYLERARSMAHGIVIAQADLERLQELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ureidoglycolate dehydrogenase
publication title Crystal structures of Delta1-piperideine-2-carboxylate/Delta1-pyrroline-2-carboxylate reductase belonging to a new family of NAD(P)H-dependent oxidoreductases: conformational change, substrate recognition, and stereochemistry of the reaction
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
total genus 111
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.4.1.17: N-methylalanine dehydrogenase.
pdb deposition date 2004-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 1wtjA01
3.30.60.50 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Hypothetical oxidoreductase yiak; domain 3 1wtjA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 1wtjA02
2G8YA 1XRHA 1S20A 1Z2IA 1X0AA 4FJUA 3I0PA 1NXUA 4FJSA 1WTJA 2CWFA 4H8AA 2CWHA 3UOEA 1V9NA 2X06A 1VBIA
chains in the Genus database with same CATH superfamily
2G8YA 4AMLA 2VQEH 5EX0A 1Z2IA 1TBQR 4B8TA 2UXDH 2FPHX 2P2RA 1V1IA 2NN6G 4DV1H 1MJAA 5DAEA 1SGQI 1XNQH 2E73A 2RC4A 2P6AC 1P9ZA 4UXIA 2CPQA 3D00A 2DIPA 4X64H 2ANNA 3OTOH 1PPFI 4OVOA 4NBQA 4K0KH 2OD1A 1XNRH 1HEVA 3PDNA 2N17A 2KMRA 2JEAI 3FSYA 2CWGA 1WGCA 2E5LH 2W0TA 4DR5H 3B4VC 1TBRR 3OETA 4DR4H 4B3SH 4OX9H 1UVGA 3OL0A 3UFFA 2ORVA 4DR6H 3GOXA 2KCXA 1XMQH 1HR0H 1ZZIA 1J5EH 3OSSD 1TOTA 2CJSC 4LF5H 3J7AK 4JI4H 5E3RA 1K7VA 1SGYI 5HI7A 4LF9H 1CSOI 1N34H 2X52A 2SGFI 1HNWH 4DV0H 4DR2H 2QQCA 2SGQI 4PDBA 3KY9A 4JI0H 4DUZH 1W4RA 4H8AA 2GIVA 3RU0A 3HH2C 4DV4H 2A20A 4LFCH 4JVHA 2ANRA 3FSXA 2CTFA 1MSZA 1N33H 4G08A 2UU9H 3U1KA 1MT1A 2CWFA 2GVIA 1N32H 4LF4H 4LF6H 2OPUA 2AXYA 1J5KA 1I6UA 2LB7A 3TOAA 3UEYA 1HNZH 1XBTA 4OCHA 1EC6A 5FLXW 3J81W 3VDUA 1W3SA 4FJUA 2JW6A 1VIHA 2NU4I 5FUXA 1DS2I 3SB1A 2Y0MA 4OD6A 4DV3H 3UGLA 2CTJA 4DR3H 5BR8H 1U5KA 7WGAA 2Z0SA 2E3UA 4NZTM 2HH3A 1X4SA 2JZMA 4JI7H 1K1GA 4BA2I 1XA6A 4WANA 1SEIA 3TO7A 2V1CC 1CE3A 2UUAH 1TIHA 1HPTA 2KMQA 1PTRA 1K7TA 2WVJA 4JI2H 3E2IA 2CTMA 1H0ZA 3R5AA 4NXNH 1CT2I 1Y8FA 4DV7H 1AN7A 1IBKH 1OMTA 3TJQA 4E9JA 2OZUA 1XMOH 2M8WA 1OVOA 4FKDA 3T1YH 5A2QW 4A24A 1OMUA 3T1HH 3UOEA 2X06A 1TUAA 4GKJH 2RIJA 2QQDA 2GKRI 2NU3I 2UZ3A 1WGTA 3SGQI 4JI3H 2MJHA 1NXUA 4DV2H 4LIJA 1HNXH 4DR1H 3TO6A 1S20A 2K9HA 5E3PA 2WGCA 4DR7H 1R79A 4UXHA 1RFHA 2PT7G 1VIGA 2YUUA 2ENNA 3QWPA 1K7UA 5CCLA 4X66H 9WGAA 2QQEA 1I94H 2ZQEA 3OXGA 5IWAH 2J87A 2LTLA 1IY5A 2SGEI 1HDLA 1X74A 1FJGH 4LF8H 1Q9BA 3NCVA 2JZXA 3VDPA 2DB6A 3RF2A 1TBNA 1YTPA 2ZM6H 1SGEI 4BA1I 1ULNA 2M6QA 2GKTI 3OXFA 5K36G 2V53A 1NUBA 2JA9A 4JYAH 3JAMW 2L7XA 3J80W 5DT9A 4NXMH 2CTEA 4DUYH 1N36H 3UGIA 1OYVI 2F3CI 1HJAI 1PJUA 2UUBH 2PQ8A 3TOBA 2F4VH 4JI1H 5HQ8A 1X4NA 1X9ZA 1FY7A 1KHMA 1WHRA 2CTKA 1TUSA 4JV5H 2ARPF 1FKAH 3CXLA 2VKCA 5FUVA 2L8EA 2OU2A 1UUCA 4IFDG 1WVNA 2LRRA 1PTQA 4LF7H 1P9GA 5EX3A 2NU0I 2X3TA 4LFBH 3R5CA 4X65H 2YQPA 2NU2I 3VKEA 2JXDA 5LMUH 3BJIA 2CWHA 2QQ0A 4DNCA 4E1RA 2OVOA 5FUYA 4JI5H 4JCVE 5IT9W 2Y3MA 4HGUA 2ENZA 1Z7KB 2A1SA 5CCMA 4QMFB 1KBEA 1V8CA 4B3MH 1M8CA 1Y1BA 3UGDA 3E59A 4B8CD 2B0UC 2CPMA 1IBLH 1SGRI 4JI6H 3R5DA 1TURA 2KMOA 2PQUA 2UVOA 1WE8A 4AM3A 1MJBA 1ULMA 1X4MA 1R0RI 3GKUA 3FC3A 2FFMA 3EZJA 3TO9A 1LR8A 1YU6C 2BA0A 1MJ9A 3FAUA 2DKVA 3AEVB 1LR7A 2ERWA 3OVOA 2ELIA 1LR9A 1KBFA 1J4WA 1CGJI 1IY6A 1SGDI 4WP4A 2VRWB 2LF0A 3R5BA 2M5XA 5E3QA 2VQFH 2LEOA 1TBOA 1IW4A 2LUYA 3KDGA 1UG8A 3L7ZC 2N1AB 1V9NA 3VE5A 1KMAA 3V69A 4DV6H 1M8BA 2N71A 2LTMA 1AN1I 1FAQA 1XRHA 1FYBA 2WCYA 5JEAG 1ULKA 1F0XA 2HH2A 1SGNI 2KMPA 1BUSA 4EC5A 1VBIA 5FUWA 1ZZJA 1X0AA 1VDDA 2FNFX 1WTJA 1WKXA 4E1PA 1DS3I 4JI8H 3KDKA 4KHPH 3MEKA 1V1HA 2JE6I 2GKVA 4MPIA 2FMRA 4X62H 2ORWA 4OO1G 2JA1A 3OXLA 2K1HA 1SGPI 2E5RA 2ROWA 5LL6b 1TGSI 1ZZKA 3I0PA 1UHAA 2UXBH 4AIMA 3QTLD 4SGBI 2J9RA 2JVZA 1ZTGA 4UXJA 2BUSA 5JHWC 2B8TA 2BL5A 2D9IA 1N13A 3GR5A 4L9MA 4JVYA 2UXCH 2CTLA 2SGPI 5J8CA 4B3RH 1S03G 2N52A 4GI3C 2SGDI 1XX6A 2ODDA 5LMNH 4B6DA 3QD7X 4FJSA 4AQYH 1CT4I 2YQRA 1FARA 2V1CA 4WALA 5C0XG 1CGII 4YY3H 4YHHH 2XRCA 3UEJA 2UUCH 2QNDA 4NZRM 4B3TH 4DV5H 1IBMH 2DGRA 2JEBI 1PCEA 2OPVA 5J8FA 2JYYA 3QAHA 2QPOA 1UVFA 3GABA 1BMOA 2O4CA 1CT0I 1DTJA 1DT4A 1Y1CA 1CHOI 2NU1I 4LFAH 1PQXA 2HHHH 3SGBI 3SEKC 1ODHA 2PY9A 4GKKH
chains in the Genus database with same CATH topology
2G8YA 1XRHA 1S20A 1Z2IA 1X0AA 4FJUA 3I0PA 1NXUA 4FJSA 1WTJA 2CWFA 4H8AA 2CWHA 3UOEA 1V9NA 2X06A 1VBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G8Y A;  1XRH A;  1S20 A;  1Z2I A;  1X0A A;  4FJU A;  3I0P A;  1NXU A;  4FJS A;  1WTJ A;  2CWF A;  4H8A A;  2CWH A;  3UOE A;  1V9N A;  2X06 A;  1VBI A; 
#chains in the Genus database with same CATH topology
 2G8Y A;  4AML A;  2VQE H;  5EX0 A;  1Z2I A;  1TBQ R;  4B8T A;  2UXD H;  2FPH X;  2P2R A;  1V1I A;  2NN6 G;  4DV1 H;  1MJA A;  5DAE A;  1SGQ I;  1XNQ H;  2E73 A;  2RC4 A;  2P6A C;  1P9Z A;  4UXI A;  2CPQ A;  3D00 A;  2DIP A;  4X64 H;  2ANN A;  3OTO H;  1PPF I;  4OVO A;  4NBQ A;  4K0K H;  2OD1 A;  1XNR H;  1HEV A;  3PDN A;  2N17 A;  2KMR A;  2JEA I;  3FSY A;  2CWG A;  1WGC A;  2E5L H;  2W0T A;  4DR5 H;  3B4V C;  1TBR R;  3OET A;  4DR4 H;  4B3S H;  4OX9 H;  1UVG A;  3OL0 A;  3UFF A;  2ORV A;  4DR6 H;  3GOX A;  2KCX A;  1XMQ H;  1HR0 H;  1ZZI A;  1J5E H;  3OSS D;  1TOT A;  2CJS C;  4LF5 H;  3J7A K;  4JI4 H;  5E3R A;  1K7V A;  1SGY I;  5HI7 A;  4LF9 H;  1CSO I;  1N34 H;  2X52 A;  2SGF I;  1HNW H;  4DV0 H;  4DR2 H;  2QQC A;  2SGQ I;  4PDB A;  3KY9 A;  4JI0 H;  4DUZ H;  1W4R A;  4H8A A;  2GIV A;  3RU0 A;  3HH2 C;  4DV4 H;  2A20 A;  4LFC H;  4JVH A;  2ANR A;  3FSX A;  2CTF A;  1MSZ A;  1N33 H;  4G08 A;  2UU9 H;  3U1K A;  1MT1 A;  2CWF A;  2GVI A;  1N32 H;  4LF4 H;  4LF6 H;  2OPU A;  2AXY A;  1J5K A;  1I6U A;  2LB7 A;  3TOA A;  3UEY A;  1HNZ H;  1XBT A;  4OCH A;  1EC6 A;  5FLX W;  3J81 W;  3VDU A;  1W3S A;  4FJU A;  2JW6 A;  1VIH A;  2NU4 I;  5FUX A;  1DS2 I;  3SB1 A;  2Y0M A;  4OD6 A;  4DV3 H;  3UGL A;  2CTJ A;  4DR3 H;  5BR8 H;  1U5K A;  7WGA A;  2Z0S A;  2E3U A;  4NZT M;  2HH3 A;  1X4S A;  2JZM A;  4JI7 H;  1K1G A;  4BA2 I;  1XA6 A;  4WAN A;  1SEI A;  3TO7 A;  2V1C C;  1CE3 A;  2UUA H;  1TIH A;  1HPT A;  2KMQ A;  1PTR A;  1K7T A;  2WVJ A;  4JI2 H;  3E2I A;  2CTM A;  1H0Z A;  3R5A A;  4NXN H;  1CT2 I;  1Y8F A;  4DV7 H;  1AN7 A;  1IBK H;  1OMT A;  3TJQ A;  4E9J A;  2OZU A;  1XMO H;  2M8W A;  1OVO A;  4FKD A;  3T1Y H;  5A2Q W;  4A24 A;  1OMU A;  3T1H H;  3UOE A;  2X06 A;  1TUA A;  4GKJ H;  2RIJ A;  2QQD A;  2GKR I;  2NU3 I;  2UZ3 A;  1WGT A;  3SGQ I;  4JI3 H;  2MJH A;  1NXU A;  4DV2 H;  4LIJ A;  1HNX H;  4DR1 H;  3TO6 A;  1S20 A;  2K9H A;  5E3P A;  2WGC A;  4DR7 H;  1R79 A;  4UXH A;  1RFH A;  2PT7 G;  1VIG A;  2YUU A;  2ENN A;  3QWP A;  1K7U A;  5CCL A;  4X66 H;  9WGA A;  2QQE A;  1I94 H;  2ZQE A;  3OXG A;  5IWA H;  2J87 A;  2LTL A;  1IY5 A;  2SGE I;  1HDL A;  1X74 A;  1FJG H;  4LF8 H;  1Q9B A;  3NCV A;  2JZX A;  3VDP A;  2DB6 A;  3RF2 A;  1TBN A;  1YTP A;  2ZM6 H;  1SGE I;  4BA1 I;  1ULN A;  2M6Q A;  2GKT I;  3OXF A;  5K36 G;  2V53 A;  1NUB A;  2JA9 A;  4JYA H;  3JAM W;  2L7X A;  3J80 W;  5DT9 A;  4NXM H;  2CTE A;  4DUY H;  1N36 H;  3UGI A;  1OYV I;  2F3C I;  1HJA I;  1PJU A;  2UUB H;  2PQ8 A;  3TOB A;  2F4V H;  4JI1 H;  5HQ8 A;  1X4N A;  1X9Z A;  1FY7 A;  1KHM A;  1WHR A;  2CTK A;  1TUS A;  4JV5 H;  2ARP F;  1FKA H;  3CXL A;  2VKC A;  5FUV A;  2L8E A;  2OU2 A;  1UUC A;  4IFD G;  1WVN A;  2LRR A;  1PTQ A;  4LF7 H;  1P9G A;  5EX3 A;  2NU0 I;  2X3T A;  4LFB H;  3R5C A;  4X65 H;  2YQP A;  2NU2 I;  3VKE A;  2JXD A;  5LMU H;  3BJI A;  2CWH A;  2QQ0 A;  4DNC A;  4E1R A;  2OVO A;  5FUY A;  4JI5 H;  4JCV E;  5IT9 W;  2Y3M A;  4HGU A;  2ENZ A;  1Z7K B;  2A1S A;  5CCM A;  4QMF B;  1KBE A;  1V8C A;  4B3M H;  1M8C A;  1Y1B A;  3UGD A;  3E59 A;  4B8C D;  2B0U C;  2CPM A;  1IBL H;  1SGR I;  4JI6 H;  3R5D A;  1TUR A;  2KMO A;  2PQU A;  2UVO A;  1WE8 A;  4AM3 A;  1MJB A;  1ULM A;  1X4M A;  1R0R I;  3GKU A;  3FC3 A;  2FFM A;  3EZJ A;  3TO9 A;  1LR8 A;  1YU6 C;  2BA0 A;  1MJ9 A;  3FAU A;  2DKV A;  3AEV B;  1LR7 A;  2ERW A;  3OVO A;  2ELI A;  1LR9 A;  1KBF A;  1J4W A;  1CGJ I;  1IY6 A;  1SGD I;  4WP4 A;  2VRW B;  2LF0 A;  3R5B A;  2M5X A;  5E3Q A;  2VQF H;  2LEO A;  1TBO A;  1IW4 A;  2LUY A;  3KDG A;  1UG8 A;  3L7Z C;  2N1A B;  1V9N A;  3VE5 A;  1KMA A;  3V69 A;  4DV6 H;  1M8B A;  2N71 A;  2LTM A;  1AN1 I;  1FAQ A;  1XRH A;  1FYB A;  2WCY A;  5JEA G;  1ULK A;  1F0X A;  2HH2 A;  1SGN I;  2KMP A;  1BUS A;  4EC5 A;  1VBI A;  5FUW A;  1ZZJ A;  1X0A A;  1VDD A;  2FNF X;  1WTJ A;  1WKX A;  4E1P A;  1DS3 I;  4JI8 H;  3KDK A;  4KHP H;  3MEK A;  1V1H A;  2JE6 I;  2GKV A;  4MPI A;  2FMR A;  4X62 H;  2ORW A;  4OO1 G;  2JA1 A;  3OXL A;  2K1H A;  1SGP I;  2E5R A;  2ROW A;  5LL6 b;  1TGS I;  1ZZK A;  3I0P A;  1UHA A;  2UXB H;  4AIM A;  3QTL D;  4SGB I;  2J9R A;  2JVZ A;  1ZTG A;  4UXJ A;  2BUS A;  5JHW C;  2B8T A;  2BL5 A;  2D9I A;  1N13 A;  3GR5 A;  4L9M A;  4JVY A;  2UXC H;  2CTL A;  2SGP I;  5J8C A;  4B3R H;  1S03 G;  2N52 A;  4GI3 C;  2SGD I;  1XX6 A;  2ODD A;  5LMN H;  4B6D A;  3QD7 X;  4FJS A;  4AQY H;  1CT4 I;  2YQR A;  1FAR A;  2V1C A;  4WAL A;  5C0X G;  1CGI I;  4YY3 H;  4YHH H;  2XRC A;  3UEJ A;  2UUC H;  2QND A;  4NZR M;  4B3T H;  4DV5 H;  1IBM H;  2DGR A;  2JEB I;  1PCE A;  2OPV A;  5J8F A;  2JYY A;  3QAH A;  2QPO A;  1UVF A;  3GAB A;  1BMO A;  2O4C A;  1CT0 I;  1DTJ A;  1DT4 A;  1Y1C A;  1CHO I;  2NU1 I;  4LFA H;  1PQX A;  2HHH H;  3SGB I;  3SEK C;  1ODH A;  2PY9 A;  4GKK H; 
#chains in the Genus database with same CATH homology
 2G8Y A;  1XRH A;  1S20 A;  1Z2I A;  1X0A A;  4FJU A;  3I0P A;  1NXU A;  4FJS A;  1WTJ A;  2CWF A;  4H8A A;  2CWH A;  3UOE A;  1V9N A;  2X06 A;  1VBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...