1WTJA

Crystal structure of delta1-piperideine-2-carboxylate reductase from pseudomonas syringae pvar.tomato
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
332
Chain Sequence
b'TQTVSYPQLIDLLRRIFVVHGTSPEVADVLAENCASAQRDGSHSHGIFRIPGYLSSLASGWVDGKAVPVVEDVGAAFVRVDACNGFAQPALAAARSLLIDKARSAGVAILAIRGSHHFAALWPDVEPFAEQGLVALSMVNSMTCVVPHGARQPLFGTNPIAFGAPRAGGEPIVFDLATSAIAHGDVQIAAREGRLLPAGMGVDRDGLPTQEPRAILDGGALLPFGGHKGSALSMMVELLAAGLTGGNFSFEFDWSKHPGAQTPWTGQLLIVIDPDKGAGQHFAQRSEELVRQLHGVGQERLPGDRRYLERARSMAHGIVIAQADLERLQELA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ureidoglycolate dehydrogenase
molecule tags Oxidoreductase
source organism Pseudomonas syringae pv. tomato
publication title Crystal structures of Delta1-piperideine-2-carboxylate/Delta1-pyrroline-2-carboxylate reductase belonging to a new family of NAD(P)H-dependent oxidoreductases: conformational change, substrate recognition, and stereochemistry of the reaction
pubmed doi rcsb
total genus 111
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.4.1.17: N-methylalanine dehydrogenase.
pdb deposition date 2004-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 1wtjA01
3.30.60.50 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Hypothetical oxidoreductase yiak; domain 3 1wtjA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 1wtjA02
4FJUA 1S20A 1XRHA 2CWHA 2G8YA 4FJSA 1NXUA 3UOEA 1Z2IA 2CWFA 2X06A 3I0PA 4H8AA 1X0AA 1V9NA 1WTJA 1VBIA
chains in the Genus database with same CATH superfamily
1KMAA 1XX6A 1N33H 2NN6G 1P9ZA 1UVGA 4NZRM 4JI6H 3J7AK 1SEIA 2LF0A 2J87A 3CXLA 2RIJA 2YUUA 1FJGH 4E1RA 4AQYH 1KBEA 1NXUA 2N1AB 4DR4H 1AN1I 4BA1I 1UG8A 4X66H 4LFAH 2UUBH 1VIHA 1TBOA 1X9ZA 2OVOA 1XBTA 3VKEA 2ELIA 1M8BA 4H8AA 1X4MA 1TBQR 4AM3A 2ZQEA 1CGII 2UXCH 1IW4A 4NBQA 2FPHX 1OYVI 2JW6A 4LF9H 2SGFI 2KMRA 4JVHA 2JVZA 1R0RI 2VKCA 2CTLA 5DAEA 2SGQI 1SGDI 5EX3A 3SEKC 2FNFX 4KHPH 1ZZIA 5IWAH 3VDPA 4WALA 3MEKA 5IT9W 1WTJA 5HQ8A 1V1IA 2RC4A 3D00A 2BA0A 1XMQH 4LF7H 4X65H 1P9GA 3J80W 1ZTGA 4JYAH 2OPVA 4OVOA 1XRHA 1DTJA 4DUZH 2P2RA 3FSYA 4DV3H 1N13A 3I0PA 2DKVA 4JI4H 2ROWA 2CWHA 2SGDI 1TUAA 1SGNI 2B0UC 4DR1H 4B8TA 4JI1H 3UGIA 2K9HA 5A2QW 1K7TA 2CWGA 1ULKA 4SGBI 4DNCA 2W0TA 2AXYA 1SGQI 2ZM6H 4WANA 4WP4A 4JV5H 4LFCH 4UXJA 2DIPA 4OD6A 4GKKH 2ENNA 1J4WA 3AEVB 4DR3H 1CE3A 2HH3A 1I6UA 3KDKA 2UXBH 1X4SA 3PDNA 5JEAG 1ZZJA 1TURA 1I94H 1V1HA 3TO7A 4DV5H 1IBKH 3GKUA 2UU9H 1K7VA 1PTRA 4JCVE 2QQEA 2E5RA 2VRWB 1ZZKA 1U5KA 4FJUA 1PPFI 2V1CC 2LTMA 1IBMH 4JI2H 3OTOH 1XNRH 3R5BA 1K1GA 2JE6I 1Y1CA 2GKTI 2QNDA 4YY3H 2GVIA 2BUSA 4DV6H 5J8FA 2QQ0A 3HH2C 4JI0H 3UGDA 2SGPI 2HHHH 2M5XA 1DT4A 2X52A 1N34H 1DS3I 1IBLH 2BL5A 4DUYH 1V9NA 1TBNA 1N32H 4DR6H 3QTLD 4LIJA 4EC5A 2NU1I 2XRCA 4YHHH 1WVNA 4MPIA 1XNQH 1HNZH 2ORVA 2Y0MA 2OD1A 5E3RA 3VE5A 3L7ZC 4IFDG 2Y3MA 1CT0I 2CWFA 3R5AA 4GKJH 1Y8FA 2GIVA 1MSZA 2YQRA 3T1HH 1MJ9A 2ODDA 9WGAA 3UFFA 2MJHA 1W4RA 1HNXH 1KHMA 2X06A 4AIMA 3OXGA 4B3TH 2N52A 1N36H 2WGCA 2UUCH 2P6AC 1MT1A 5LMUH 1WKXA 4OCHA 4LF4H 2NU4I 3TO9A 3TOBA 3EZJA 4JI7H 1EC6A 2ARPF 2CTJA 2ANNA 1FKAH 1R79A 4DR5H 2PQUA 3UGLA 2JEBI 2LUYA 2PT7G 4DV2H 1AN7A 4E9JA 1RFHA 1CT4I 2LB7A 2K1HA 3NCVA 4DV4H 2QQCA 2O4CA 2F3CI 2JZXA 1SGEI 5LMNH 2CTKA 4DV0H 3E59A 1LR9A 3FSXA 5EX0A 2JZMA 3KY9A 1UVFA 1HDLA 1M8CA 1MJBA 1TGSI 3JAMW 1PTQA 2M8WA 2LEOA 3FAUA 2VQFH 4LF8H 1ULNA 1WHRA 3OVOA 3T1YH 3RF2A 2CTFA 4X64H 2N17A 1TUSA 1FAQA 4B8CD 1F0XA 2FFMA 2V53A 2GKRI 1OVOA 3OXFA 1HPTA 1HNWH 4NXNH 4B6DA 1FARA 4K0KH 3FC3A 2KMQA 4PDBA 2PQ8A 1UHAA 3E2IA 4HGUA 3V69A 2CPMA 3GR5A 3SB1A 4NZTM 2ANRA 2OZUA 3TO6A 5FLXW 3OSSD 2UZ3A 1Y1BA 4NXMH 4DV7H 1IY6A 1W3SA 3UOEA 3OETA 1BMOA 1CSOI 4QMFB 4X62H 1PJUA 4UXIA 1FYBA 1DS2I 3R5DA 3B4VC 3TOAA 1H0ZA 1VDDA 2E3UA 2ERWA 1WE8A 4G08A 4LF6H 1TIHA 2KCXA 2OPUA 2F4VH 5FUXA 2NU2I 2Z0SA 3U1KA 1S03G 2PY9A 2V1CA 1UUCA 1SGPI 3QWPA 2J9RA 5CCLA 2E5LH 4B3SH 5E3PA 1X0AA 4DV1H 2HH2A 1VBIA 2WCYA 5E3QA 1CHOI 5DT9A 1OMUA 2SGEI 2NU3I 5K36G 3GOXA 4FJSA 3KDGA 2E73A 2A20A 3R5CA 5FUYA 4JI5H 1YU6C 1Z2IA 3SGQI 5JHWC 1XA6A 4DR7H 2JEAI 1PQXA 4E1PA 4A24A 5FUVA 4LFBH 1TBRR 4B3RH 1Q9BA 3QAHA 4JVYA 2L8EA 2M6QA 2UXDH 5BR8H 3UEJA 2KMOA 1J5KA 1YTPA 1HR0H 2GKVA 1LR7A 1SGRI 4AMLA 1J5EH 5FUWA 2CPQA 3UEYA 5CCMA 2CTMA 7WGAA 4DR2H 2ENZA 4OX9H 1NUBA 2JA9A 1Z7KB 2A1SA 1V8CA 4GI3C 3SGBI 2JA1A 1K7UA 2JYYA 1TOTA 2FMRA 2JXDA 1WGTA 4JI3H 1X74A 1PCEA 2KMPA 3QD7X 2ORWA 3BJIA 1SGYI 2G8YA 4L9MA 1BUSA 2UVOA 2WVJA 1FY7A 3VDUA 2CTEA 2L7XA 4LF5H 2QPOA 2N71A 2CJSC 1HEVA 5J8CA 1CGJI 1IY5A 5C0XG 2LTLA 3TJQA 2YQPA 1WGCA 3GABA 2VQEH 4UXHA 2DB6A 1VIGA 1OMTA 5LL6b 4B3MH 4JI8H 3RU0A 1CT2I 5HI7A 2DGRA 2D9IA 2UUAH 4BA2I 2X3TA 1XMOH 3J81W 1MJAA 2QQDA 1HJAI 2B8TA 4FKDA 1X4NA 4OO1G 1ULMA 2LRRA 1S20A 2OU2A 1KBFA 1ODHA 2NU0I 1LR8A 3OL0A 3OXLA
chains in the Genus database with same CATH topology
4FJUA 1S20A 1XRHA 2CWHA 2G8YA 4FJSA 1NXUA 3UOEA 1Z2IA 2CWFA 2X06A 3I0PA 4H8AA 1X0AA 1V9NA 1WTJA 1VBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJU A;  1S20 A;  1XRH A;  2CWH A;  2G8Y A;  4FJS A;  1NXU A;  3UOE A;  1Z2I A;  2CWF A;  2X06 A;  3I0P A;  4H8A A;  1X0A A;  1V9N A;  1WTJ A;  1VBI A; 
#chains in the Genus database with same CATH topology
 1KMA A;  1XX6 A;  1N33 H;  2NN6 G;  1P9Z A;  1UVG A;  4NZR M;  4JI6 H;  3J7A K;  1SEI A;  2LF0 A;  2J87 A;  3CXL A;  2RIJ A;  2YUU A;  1FJG H;  4E1R A;  4AQY H;  1KBE A;  1NXU A;  2N1A B;  4DR4 H;  1AN1 I;  4BA1 I;  1UG8 A;  4X66 H;  4LFA H;  2UUB H;  1VIH A;  1TBO A;  1X9Z A;  2OVO A;  1XBT A;  3VKE A;  2ELI A;  1M8B A;  4H8A A;  1X4M A;  1TBQ R;  4AM3 A;  2ZQE A;  1CGI I;  2UXC H;  1IW4 A;  4NBQ A;  2FPH X;  1OYV I;  2JW6 A;  4LF9 H;  2SGF I;  2KMR A;  4JVH A;  2JVZ A;  1R0R I;  2VKC A;  2CTL A;  5DAE A;  2SGQ I;  1SGD I;  5EX3 A;  3SEK C;  2FNF X;  4KHP H;  1ZZI A;  5IWA H;  3VDP A;  4WAL A;  3MEK A;  5IT9 W;  1WTJ A;  5HQ8 A;  1V1I A;  2RC4 A;  3D00 A;  2BA0 A;  1XMQ H;  4LF7 H;  4X65 H;  1P9G A;  3J80 W;  1ZTG A;  4JYA H;  2OPV A;  4OVO A;  1XRH A;  1DTJ A;  4DUZ H;  2P2R A;  3FSY A;  4DV3 H;  1N13 A;  3I0P A;  2DKV A;  4JI4 H;  2ROW A;  2CWH A;  2SGD I;  1TUA A;  1SGN I;  2B0U C;  4DR1 H;  4B8T A;  4JI1 H;  3UGI A;  2K9H A;  5A2Q W;  1K7T A;  2CWG A;  1ULK A;  4SGB I;  4DNC A;  2W0T A;  2AXY A;  1SGQ I;  2ZM6 H;  4WAN A;  4WP4 A;  4JV5 H;  4LFC H;  4UXJ A;  2DIP A;  4OD6 A;  4GKK H;  2ENN A;  1J4W A;  3AEV B;  4DR3 H;  1CE3 A;  2HH3 A;  1I6U A;  3KDK A;  2UXB H;  1X4S A;  3PDN A;  5JEA G;  1ZZJ A;  1TUR A;  1I94 H;  1V1H A;  3TO7 A;  4DV5 H;  1IBK H;  3GKU A;  2UU9 H;  1K7V A;  1PTR A;  4JCV E;  2QQE A;  2E5R A;  2VRW B;  1ZZK A;  1U5K A;  4FJU A;  1PPF I;  2V1C C;  2LTM A;  1IBM H;  4JI2 H;  3OTO H;  1XNR H;  3R5B A;  1K1G A;  2JE6 I;  1Y1C A;  2GKT I;  2QND A;  4YY3 H;  2GVI A;  2BUS A;  4DV6 H;  5J8F A;  2QQ0 A;  3HH2 C;  4JI0 H;  3UGD A;  2SGP I;  2HHH H;  2M5X A;  1DT4 A;  2X52 A;  1N34 H;  1DS3 I;  1IBL H;  2BL5 A;  4DUY H;  1V9N A;  1TBN A;  1N32 H;  4DR6 H;  3QTL D;  4LIJ A;  4EC5 A;  2NU1 I;  2XRC A;  4YHH H;  1WVN A;  4MPI A;  1XNQ H;  1HNZ H;  2ORV A;  2Y0M A;  2OD1 A;  5E3R A;  3VE5 A;  3L7Z C;  4IFD G;  2Y3M A;  1CT0 I;  2CWF A;  3R5A A;  4GKJ H;  1Y8F A;  2GIV A;  1MSZ A;  2YQR A;  3T1H H;  1MJ9 A;  2ODD A;  9WGA A;  3UFF A;  2MJH A;  1W4R A;  1HNX H;  1KHM A;  2X06 A;  4AIM A;  3OXG A;  4B3T H;  2N52 A;  1N36 H;  2WGC A;  2UUC H;  2P6A C;  1MT1 A;  5LMU H;  1WKX A;  4OCH A;  4LF4 H;  2NU4 I;  3TO9 A;  3TOB A;  3EZJ A;  4JI7 H;  1EC6 A;  2ARP F;  2CTJ A;  2ANN A;  1FKA H;  1R79 A;  4DR5 H;  2PQU A;  3UGL A;  2JEB I;  2LUY A;  2PT7 G;  4DV2 H;  1AN7 A;  4E9J A;  1RFH A;  1CT4 I;  2LB7 A;  2K1H A;  3NCV A;  4DV4 H;  2QQC A;  2O4C A;  2F3C I;  2JZX A;  1SGE I;  5LMN H;  2CTK A;  4DV0 H;  3E59 A;  1LR9 A;  3FSX A;  5EX0 A;  2JZM A;  3KY9 A;  1UVF A;  1HDL A;  1M8C A;  1MJB A;  1TGS I;  3JAM W;  1PTQ A;  2M8W A;  2LEO A;  3FAU A;  2VQF H;  4LF8 H;  1ULN A;  1WHR A;  3OVO A;  3T1Y H;  3RF2 A;  2CTF A;  4X64 H;  2N17 A;  1TUS A;  1FAQ A;  4B8C D;  1F0X A;  2FFM A;  2V53 A;  2GKR I;  1OVO A;  3OXF A;  1HPT A;  1HNW H;  4NXN H;  4B6D A;  1FAR A;  4K0K H;  3FC3 A;  2KMQ A;  4PDB A;  2PQ8 A;  1UHA A;  3E2I A;  4HGU A;  3V69 A;  2CPM A;  3GR5 A;  3SB1 A;  4NZT M;  2ANR A;  2OZU A;  3TO6 A;  5FLX W;  3OSS D;  2UZ3 A;  1Y1B A;  4NXM H;  4DV7 H;  1IY6 A;  1W3S A;  3UOE A;  3OET A;  1BMO A;  1CSO I;  4QMF B;  4X62 H;  1PJU A;  4UXI A;  1FYB A;  1DS2 I;  3R5D A;  3B4V C;  3TOA A;  1H0Z A;  1VDD A;  2E3U A;  2ERW A;  1WE8 A;  4G08 A;  4LF6 H;  1TIH A;  2KCX A;  2OPU A;  2F4V H;  5FUX A;  2NU2 I;  2Z0S A;  3U1K A;  1S03 G;  2PY9 A;  2V1C A;  1UUC A;  1SGP I;  3QWP A;  2J9R A;  5CCL A;  2E5L H;  4B3S H;  5E3P A;  1X0A A;  4DV1 H;  2HH2 A;  1VBI A;  2WCY A;  5E3Q A;  1CHO I;  5DT9 A;  1OMU A;  2SGE I;  2NU3 I;  5K36 G;  3GOX A;  4FJS A;  3KDG A;  2E73 A;  2A20 A;  3R5C A;  5FUY A;  4JI5 H;  1YU6 C;  1Z2I A;  3SGQ I;  5JHW C;  1XA6 A;  4DR7 H;  2JEA I;  1PQX A;  4E1P A;  4A24 A;  5FUV A;  4LFB H;  1TBR R;  4B3R H;  1Q9B A;  3QAH A;  4JVY A;  2L8E A;  2M6Q A;  2UXD H;  5BR8 H;  3UEJ A;  2KMO A;  1J5K A;  1YTP A;  1HR0 H;  2GKV A;  1LR7 A;  1SGR I;  4AML A;  1J5E H;  5FUW A;  2CPQ A;  3UEY A;  5CCM A;  2CTM A;  7WGA A;  4DR2 H;  2ENZ A;  4OX9 H;  1NUB A;  2JA9 A;  1Z7K B;  2A1S A;  1V8C A;  4GI3 C;  3SGB I;  2JA1 A;  1K7U A;  2JYY A;  1TOT A;  2FMR A;  2JXD A;  1WGT A;  4JI3 H;  1X74 A;  1PCE A;  2KMP A;  3QD7 X;  2ORW A;  3BJI A;  1SGY I;  2G8Y A;  4L9M A;  1BUS A;  2UVO A;  2WVJ A;  1FY7 A;  3VDU A;  2CTE A;  2L7X A;  4LF5 H;  2QPO A;  2N71 A;  2CJS C;  1HEV A;  5J8C A;  1CGJ I;  1IY5 A;  5C0X G;  2LTL A;  3TJQ A;  2YQP A;  1WGC A;  3GAB A;  2VQE H;  4UXH A;  2DB6 A;  1VIG A;  1OMT A;  5LL6 b;  4B3M H;  4JI8 H;  3RU0 A;  1CT2 I;  5HI7 A;  2DGR A;  2D9I A;  2UUA H;  4BA2 I;  2X3T A;  1XMO H;  3J81 W;  1MJA A;  2QQD A;  1HJA I;  2B8T A;  4FKD A;  1X4N A;  4OO1 G;  1ULM A;  2LRR A;  1S20 A;  2OU2 A;  1KBF A;  1ODH A;  2NU0 I;  1LR8 A;  3OL0 A;  3OXL A; 
#chains in the Genus database with same CATH homology
 4FJU A;  1S20 A;  1XRH A;  2CWH A;  2G8Y A;  4FJS A;  1NXU A;  3UOE A;  1Z2I A;  2CWF A;  2X06 A;  3I0P A;  4H8A A;  1X0A A;  1V9N A;  1WTJ A;  1VBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...