1WTJA

Crystal structure of delta1-piperideine-2-carboxylate reductase from pseudomonas syringae pvar.tomato
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
332
Chain Sequence
TQTVSYPQLIDLLRRIFVVHGTSPEVADVLAENCASAQRDGSHSHGIFRIPGYLSSLASGWVDGKAVPVVEDVGAAFVRVDACNGFAQPALAAARSLLIDKARSAGVAILAIRGSHHFAALWPDVEPFAEQGLVALSMVNSMTCVVPHGARQPLFGTNPIAFGAPRAGGEPIVFDLATSAIAHGDVQIAAREGRLLPAGMGVDRDGLPTQEPRAILDGGALLPFGGHKGSALSMMVELLAAGLTGGNFSFEFDWSKHPGAQTPWTGQLLIVIDPDKGAGQHFAQRSEELVRQLHGVGQERLPGDRRYLERARSMAHGIVIAQADLERLQELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ureidoglycolate dehydrogenase
publication title Crystal structures of Delta1-piperideine-2-carboxylate/Delta1-pyrroline-2-carboxylate reductase belonging to a new family of NAD(P)H-dependent oxidoreductases: conformational change, substrate recognition, and stereochemistry of the reaction
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
total genus 111
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.4.1.17: N-methylalanine dehydrogenase.
pdb deposition date 2004-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 1wtjA01
3.30.60.50 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Hypothetical oxidoreductase yiak; domain 3 1wtjA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 1wtjA02
1S20A 1VBIA 1XRHA 2CWFA 4FJUA 4H8AA 1Z2IA 1WTJA 2CWHA 2X06A 1V9NA 1X0AA 4FJSA 3UOEA 1NXUA 3I0PA 2G8YA
chains in the Genus database with same CATH superfamily
1UG8A 2PY9A 4JV5H 2CTLA 4WP4A 3SGBI 3GABA 1Y1BA 1WHRA 1J4WA 5J8FA 4E1PA 4DR3H 2JEAI 2LUYA 4FJSA 1XX6A 3PDNA 2QQDA 1V8CA 4BA1I 4OX9H 3UOEA 2YUUA 4DV6H 2P6AC 4GKJH 4JI8H 2ELIA 1KBFA 4JCVE 1TGSI 4LFCH 2JA1A 2CTJA 4UXHA 1S03G 1TBOA 2FMRA 1IW4A 5LMUH 4LF7H 1WKXA 1IY5A 5LMNH 4BA2I 2F4VH 1X0AA 2LF0A 2UXDH 3TOBA 3T1HH 1U5KA 2OPUA 3B4VC 4X65H 1FKAH 1TBQR 3VE5A 2CPMA 1CT4I 1FARA 1MSZA 2X06A 4IFDG 1TIHA 3TO7A 3RF2A 4JI0H 4G08A 3KY9A 1LR7A 1SGDI 2UU9H 4SGBI 2BA0A 2CJSC 5DT9A 1R0RI 4DR7H 3UGIA 2V53A 4B3SH 1OYVI 1ZZKA 4DR1H 2B0UC 2KMQA 3KDKA 3FSYA 2JE6I 1IY6A 1YTPA 1WGCA 1CSOI 1S20A 2ROWA 1CT0I 5E3PA 3L7ZC 1HR0H 4LF6H 1FAQA 2JZMA 2K1HA 1P9ZA 1X4NA 3OXGA 1DT4A 1F0XA 1IBKH 1UVFA 1V1HA 4DNCA 1UHAA 2N17A 3GR5A 1J5EH 2L8EA 4AMLA 1OVOA 2X52A 4YY3H 1FYBA 1PQXA 1XMOH 4JVYA 3NCVA 3QAHA 3E2IA 1SGPI 1AN1I 3U1KA 2VKCA 2M5XA 5EX0A 1RFHA 1MJBA 1VBIA 4DV1H 2A1SA 1FJGH 1YU6C 3VDUA 1ULNA 1VIHA 2W0TA 2GKTI 4LF9H 4YHHH 1EC6A 5FUVA 2K9HA 1PTRA 2UUCH 2B8TA 1X4MA 1K7TA 1K7VA 3J81W 1XMQH 4LF5H 2SGFI 3QWPA 2P2RA 1FY7A 5FUYA 3KDGA 2G8YA 5E3QA 4DR6H 3SB1A 1XNQH 1NXUA 2CWGA 2VQEH 2OD1A 4JI7H 2ANRA 2UUBH 3UGLA 2ENNA 2Z0SA 1SGQI 4B8CD 1M8CA 2NU0I 3R5CA 2JEBI 1I94H 1XNRH 2O4CA 1TBNA 3TJQA 5J8CA 1OMTA 1LR9A 2DGRA 1IBMH 3FC3A 1W4RA 2UVOA 4OD6A 2SGDI 2CTEA 4X62H 1BMOA 2WVJA 1PTQA 5JEAG 1N36H 1HNWH 5K36G 1SGRI 1WGTA 3R5BA 4OCHA 3TO9A 1Y1CA 2E3UA 1P9GA 2V1CC 2E5LH 2A20A 4DV3H 4JI3H 5BR8H 1X9ZA 4X64H 4K0KH 2KCXA 4LIJA 2KMOA 5IT9W 4DV0H 1CGJI 5FUWA 1NUBA 2UUAH 5CCLA 2M6QA 1R79A 1M8BA 1IBLH 4DR2H 2MJHA 1SGNI 2N52A 3UFFA 2OU2A 4LFAH 2ZM6H 2CTKA 2SGPI 3OETA 1WVNA 2PQ8A 2ARPF 4OO1G 3D00A 1MT1A 2JA9A 3GKUA 3VKEA 1N34H 4JVHA 3CXLA 1WE8A 2Y3MA 3TO6A 4JI6H 2JYYA 1Z2IA 1J5KA 1SGYI 9WGAA 1KHMA 4B3TH 1Y8FA 2J87A 2DKVA 2PQUA 3I0PA 5A2QW 5HQ8A 3OXFA 1KBEA 1V9NA 1UUCA 2LTLA 1XBTA 2GKVA 1HPTA 4DUYH 4NZTM 5C0XG 2ORVA 4B6DA 1TUSA 1DTJA 1K1GA 1ZZIA 4NXNH 5LL6b 3FAUA 2YQPA 4KHPH 3FSXA 5FLXW 2ODDA 4DR5H 1XRHA 2NU2I 1UVGA 1WTJA 1H0ZA 4EC5A 2FNFX 4QMFB 2ENZA 1ULMA 5EX3A 1Z7KB 2LRRA 1HDLA 1BUSA 2SGEI 1LR8A 1X74A 1HNZH 1TURA 2KMRA 2L7XA 4LFBH 2GIVA 3HH2C 2OZUA 2HH3A 2CTMA 3UEYA 3R5DA 2CWFA 3J7AK 4JI4H 1DS3I 5DAEA 1W3SA 2PT7G 4DV5H 2HH2A 1ULKA 3OXLA 3VDPA 3EZJA 1V1IA 1SEIA 1HEVA 5IWAH 5CCMA 2FFMA 2CPQA 2J9RA 2OVOA 1CT2I 1MJ9A 3OTOH 4LF4H 4UXJA 1DS2I 1Q9BA 4H8AA 1CGII 2XRCA 1N32H 4JI5H 2JXDA 2UZ3A 1I6UA 4HGUA 1TOTA 2N71A 1VIGA 4DV7H 4JYAH 5HI7A 4B8TA 3GOXA 2OPVA 2X3TA 1XA6A 2GKRI 4X66H 2SGQI 1VDDA 1KMAA 1AN7A 4FKDA 3R5AA 2N1AB 3MEKA 4A24A 4DR4H 3OL0A 2F3CI 1CHOI 4AQYH 4NXMH 4WANA 4JI1H 2E73A 2Y0MA 2WGCA 2DB6A 4NZRM 2M8WA 4B3RH 2BL5A 3SGQI 2V1CA 1PCEA 1HNXH 2CWHA 4JI2H 3QTLD 2QQEA 4DV2H 1ODHA 3UGDA 3E59A 2QQCA 3SEKC 2NN6G 2UXCH 4OVOA 4UXIA 4AM3A 4LF8H 2LTMA 1OMUA 2VRWB 3OSSD 2QNDA 4PDBA 1SGEI 1N33H 4NBQA 4DV4H 2E5RA 2D9IA 2FPHX 1ZTGA 3J80W 3UEJA 2NU3I 3QD7X 7WGAA 3JAMW 1PJUA 4MPIA 2WCYA 2DIPA 1HJAI 2ORWA 2JW6A 2KMPA 1TUAA 2NU1I 2LEOA 2AXYA 1TBRR 2ERWA 1N13A 2ANNA 1PPFI 2BUSA 2JZXA 4WALA 1CE3A 3V69A 3BJIA 2RC4A 4E9JA 2NU4I 1X4SA 5FUXA 1K7UA 2CTFA 2JVZA 4FJUA 4E1RA 3T1YH 1ZZJA 2ZQEA 2LB7A 3RU0A 3OVOA 5JHWC 3TOAA 4B3MH 2QPOA 4GKKH 5E3RA 2YQRA 2VQFH 2HHHH 2GVIA 2UXBH 2QQ0A 4GI3C 4L9MA 1MJAA 4DUZH 2RIJA 4AIMA 3AEVB
chains in the Genus database with same CATH topology
1S20A 1VBIA 1XRHA 2CWFA 4FJUA 4H8AA 1Z2IA 1WTJA 2CWHA 2X06A 1V9NA 1X0AA 4FJSA 3UOEA 1NXUA 3I0PA 2G8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S20 A;  1VBI A;  1XRH A;  2CWF A;  4FJU A;  4H8A A;  1Z2I A;  1WTJ A;  2CWH A;  2X06 A;  1V9N A;  1X0A A;  4FJS A;  3UOE A;  1NXU A;  3I0P A;  2G8Y A; 
#chains in the Genus database with same CATH topology
 1UG8 A;  2PY9 A;  4JV5 H;  2CTL A;  4WP4 A;  3SGB I;  3GAB A;  1Y1B A;  1WHR A;  1J4W A;  5J8F A;  4E1P A;  4DR3 H;  2JEA I;  2LUY A;  4FJS A;  1XX6 A;  3PDN A;  2QQD A;  1V8C A;  4BA1 I;  4OX9 H;  3UOE A;  2YUU A;  4DV6 H;  2P6A C;  4GKJ H;  4JI8 H;  2ELI A;  1KBF A;  4JCV E;  1TGS I;  4LFC H;  2JA1 A;  2CTJ A;  4UXH A;  1S03 G;  1TBO A;  2FMR A;  1IW4 A;  5LMU H;  4LF7 H;  1WKX A;  1IY5 A;  5LMN H;  4BA2 I;  2F4V H;  1X0A A;  2LF0 A;  2UXD H;  3TOB A;  3T1H H;  1U5K A;  2OPU A;  3B4V C;  4X65 H;  1FKA H;  1TBQ R;  3VE5 A;  2CPM A;  1CT4 I;  1FAR A;  1MSZ A;  2X06 A;  4IFD G;  1TIH A;  3TO7 A;  3RF2 A;  4JI0 H;  4G08 A;  3KY9 A;  1LR7 A;  1SGD I;  2UU9 H;  4SGB I;  2BA0 A;  2CJS C;  5DT9 A;  1R0R I;  4DR7 H;  3UGI A;  2V53 A;  4B3S H;  1OYV I;  1ZZK A;  4DR1 H;  2B0U C;  2KMQ A;  3KDK A;  3FSY A;  2JE6 I;  1IY6 A;  1YTP A;  1WGC A;  1CSO I;  1S20 A;  2ROW A;  1CT0 I;  5E3P A;  3L7Z C;  1HR0 H;  4LF6 H;  1FAQ A;  2JZM A;  2K1H A;  1P9Z A;  1X4N A;  3OXG A;  1DT4 A;  1F0X A;  1IBK H;  1UVF A;  1V1H A;  4DNC A;  1UHA A;  2N17 A;  3GR5 A;  1J5E H;  2L8E A;  4AML A;  1OVO A;  2X52 A;  4YY3 H;  1FYB A;  1PQX A;  1XMO H;  4JVY A;  3NCV A;  3QAH A;  3E2I A;  1SGP I;  1AN1 I;  3U1K A;  2VKC A;  2M5X A;  5EX0 A;  1RFH A;  1MJB A;  1VBI A;  4DV1 H;  2A1S A;  1FJG H;  1YU6 C;  3VDU A;  1ULN A;  1VIH A;  2W0T A;  2GKT I;  4LF9 H;  4YHH H;  1EC6 A;  5FUV A;  2K9H A;  1PTR A;  2UUC H;  2B8T A;  1X4M A;  1K7T A;  1K7V A;  3J81 W;  1XMQ H;  4LF5 H;  2SGF I;  3QWP A;  2P2R A;  1FY7 A;  5FUY A;  3KDG A;  2G8Y A;  5E3Q A;  4DR6 H;  3SB1 A;  1XNQ H;  1NXU A;  2CWG A;  2VQE H;  2OD1 A;  4JI7 H;  2ANR A;  2UUB H;  3UGL A;  2ENN A;  2Z0S A;  1SGQ I;  4B8C D;  1M8C A;  2NU0 I;  3R5C A;  2JEB I;  1I94 H;  1XNR H;  2O4C A;  1TBN A;  3TJQ A;  5J8C A;  1OMT A;  1LR9 A;  2DGR A;  1IBM H;  3FC3 A;  1W4R A;  2UVO A;  4OD6 A;  2SGD I;  2CTE A;  4X62 H;  1BMO A;  2WVJ A;  1PTQ A;  5JEA G;  1N36 H;  1HNW H;  5K36 G;  1SGR I;  1WGT A;  3R5B A;  4OCH A;  3TO9 A;  1Y1C A;  2E3U A;  1P9G A;  2V1C C;  2E5L H;  2A20 A;  4DV3 H;  4JI3 H;  5BR8 H;  1X9Z A;  4X64 H;  4K0K H;  2KCX A;  4LIJ A;  2KMO A;  5IT9 W;  4DV0 H;  1CGJ I;  5FUW A;  1NUB A;  2UUA H;  5CCL A;  2M6Q A;  1R79 A;  1M8B A;  1IBL H;  4DR2 H;  2MJH A;  1SGN I;  2N52 A;  3UFF A;  2OU2 A;  4LFA H;  2ZM6 H;  2CTK A;  2SGP I;  3OET A;  1WVN A;  2PQ8 A;  2ARP F;  4OO1 G;  3D00 A;  1MT1 A;  2JA9 A;  3GKU A;  3VKE A;  1N34 H;  4JVH A;  3CXL A;  1WE8 A;  2Y3M A;  3TO6 A;  4JI6 H;  2JYY A;  1Z2I A;  1J5K A;  1SGY I;  9WGA A;  1KHM A;  4B3T H;  1Y8F A;  2J87 A;  2DKV A;  2PQU A;  3I0P A;  5A2Q W;  5HQ8 A;  3OXF A;  1KBE A;  1V9N A;  1UUC A;  2LTL A;  1XBT A;  2GKV A;  1HPT A;  4DUY H;  4NZT M;  5C0X G;  2ORV A;  4B6D A;  1TUS A;  1DTJ A;  1K1G A;  1ZZI A;  4NXN H;  5LL6 b;  3FAU A;  2YQP A;  4KHP H;  3FSX A;  5FLX W;  2ODD A;  4DR5 H;  1XRH A;  2NU2 I;  1UVG A;  1WTJ A;  1H0Z A;  4EC5 A;  2FNF X;  4QMF B;  2ENZ A;  1ULM A;  5EX3 A;  1Z7K B;  2LRR A;  1HDL A;  1BUS A;  2SGE I;  1LR8 A;  1X74 A;  1HNZ H;  1TUR A;  2KMR A;  2L7X A;  4LFB H;  2GIV A;  3HH2 C;  2OZU A;  2HH3 A;  2CTM A;  3UEY A;  3R5D A;  2CWF A;  3J7A K;  4JI4 H;  1DS3 I;  5DAE A;  1W3S A;  2PT7 G;  4DV5 H;  2HH2 A;  1ULK A;  3OXL A;  3VDP A;  3EZJ A;  1V1I A;  1SEI A;  1HEV A;  5IWA H;  5CCM A;  2FFM A;  2CPQ A;  2J9R A;  2OVO A;  1CT2 I;  1MJ9 A;  3OTO H;  4LF4 H;  4UXJ A;  1DS2 I;  1Q9B A;  4H8A A;  1CGI I;  2XRC A;  1N32 H;  4JI5 H;  2JXD A;  2UZ3 A;  1I6U A;  4HGU A;  1TOT A;  2N71 A;  1VIG A;  4DV7 H;  4JYA H;  5HI7 A;  4B8T A;  3GOX A;  2OPV A;  2X3T A;  1XA6 A;  2GKR I;  4X66 H;  2SGQ I;  1VDD A;  1KMA A;  1AN7 A;  4FKD A;  3R5A A;  2N1A B;  3MEK A;  4A24 A;  4DR4 H;  3OL0 A;  2F3C I;  1CHO I;  4AQY H;  4NXM H;  4WAN A;  4JI1 H;  2E73 A;  2Y0M A;  2WGC A;  2DB6 A;  4NZR M;  2M8W A;  4B3R H;  2BL5 A;  3SGQ I;  2V1C A;  1PCE A;  1HNX H;  2CWH A;  4JI2 H;  3QTL D;  2QQE A;  4DV2 H;  1ODH A;  3UGD A;  3E59 A;  2QQC A;  3SEK C;  2NN6 G;  2UXC H;  4OVO A;  4UXI A;  4AM3 A;  4LF8 H;  2LTM A;  1OMU A;  2VRW B;  3OSS D;  2QND A;  4PDB A;  1SGE I;  1N33 H;  4NBQ A;  4DV4 H;  2E5R A;  2D9I A;  2FPH X;  1ZTG A;  3J80 W;  3UEJ A;  2NU3 I;  3QD7 X;  7WGA A;  3JAM W;  1PJU A;  4MPI A;  2WCY A;  2DIP A;  1HJA I;  2ORW A;  2JW6 A;  2KMP A;  1TUA A;  2NU1 I;  2LEO A;  2AXY A;  1TBR R;  2ERW A;  1N13 A;  2ANN A;  1PPF I;  2BUS A;  2JZX A;  4WAL A;  1CE3 A;  3V69 A;  3BJI A;  2RC4 A;  4E9J A;  2NU4 I;  1X4S A;  5FUX A;  1K7U A;  2CTF A;  2JVZ A;  4FJU A;  4E1R A;  3T1Y H;  1ZZJ A;  2ZQE A;  2LB7 A;  3RU0 A;  3OVO A;  5JHW C;  3TOA A;  4B3M H;  2QPO A;  4GKK H;  5E3R A;  2YQR A;  2VQF H;  2HHH H;  2GVI A;  2UXB H;  2QQ0 A;  4GI3 C;  4L9M A;  1MJA A;  4DUZ H;  2RIJ A;  4AIM A;  3AEV B; 
#chains in the Genus database with same CATH homology
 1S20 A;  1VBI A;  1XRH A;  2CWF A;  4FJU A;  4H8A A;  1Z2I A;  1WTJ A;  2CWH A;  2X06 A;  1V9N A;  1X0A A;  4FJS A;  3UOE A;  1NXU A;  3I0P A;  2G8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...