1WTJA

Crystal structure of delta1-piperideine-2-carboxylate reductase from pseudomonas syringae pvar.tomato
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
332
Chain Sequence
TQTVSYPQLIDLLRRIFVVHGTSPEVADVLAENCASAQRDGSHSHGIFRIPGYLSSLASGWVDGKAVPVVEDVGAAFVRVDACNGFAQPALAAARSLLIDKARSAGVAILAIRGSHHFAALWPDVEPFAEQGLVALSMVNSMTCVVPHGARQPLFGTNPIAFGAPRAGGEPIVFDLATSAIAHGDVQIAAREGRLLPAGMGVDRDGLPTQEPRAILDGGALLPFGGHKGSALSMMVELLAAGLTGGNFSFEFDWSKHPGAQTPWTGQLLIVIDPDKGAGQHFAQRSEELVRQLHGVGQERLPGDRRYLERARSMAHGIVIAQADLERLQELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Delta1-piperideine-2-carboxylate/Delta1-pyrroline-2-carboxylate reductase belonging to a new family of NAD(P)H-dependent oxidoreductases: conformational change, substrate recognition, and stereochemistry of the reaction
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
molecule keywords ureidoglycolate dehydrogenase
total genus 111
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.4.1.17: N-methylalanine dehydrogenase.
pdb deposition date 2004-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 1wtjA01
3.30.60.50 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Hypothetical oxidoreductase yiak; domain 3 1wtjA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 1wtjA02
2CWFA 1S20A 1NXUA 1WTJA 1V9NA 1Z2IA 4H8AA 3I0PA 2G8YA 4FJSA 3UOEA 1XRHA 4FJUA 1VBIA 2X06A 1X0AA 2CWHA
chains in the Genus database with same CATH superfamily
2SGEI 3OXFA 5E3RA 2B8TA 3T1HH 3KDGA 1TBNA 4B8TA 1SGQI 1UUCA 1HPTA 4DV5H 2X52A 3UGIA 4DR6H 3UEJA 4LIJA 2LUYA 4DV4H 1SEIA 1NXUA 3OXGA 3SB1A 3MEKA 2E3UA 1M8CA 4SGBI 4DV1H 1BMOA 2SGFI 2RC4A 4H8AA 1XRHA 4LF4H 2CTEA 5J8FA 3FAUA 2LEOA 2J87A 3FSYA 1Z7KB 1FARA 2D9IA 1CT4I 2UVOA 2XRCA 1XMOH 4JI7H 1V1HA 2JE6I 1W3SA 3B4VC 3KY9A 1K7UA 4B6DA 2JA1A 3SEKC 4EC5A 4GKJH 2WGCA 1WGTA 5EX3A 1MJBA 4DV3H 2DKVA 1XNQH 2GKVA 1AN1I 2NU1I 4JI2H 4E9JA 2GKRI 4AM3A 3RF2A 1PQXA 3UEYA 2ORVA 3QAHA 5E3QA 1CHOI 4JYAH 2CWGA 3VKEA 4B3MH 1UVGA 2CWFA 2KMRA 1R79A 1ULKA 3JAMW 3GR5A 1PTRA 3TO6A 2F3CI 4AQYH 2M8WA 1HR0H 4LFAH 5K36G 1UHAA 1PTQA 3QTLD 1FKAH 3J80W 4JCVE 1WVNA 1ULNA 1X4NA 4X65H 1YTPA 5LMNH 1IW4A 4OVOA 2PT7G 2M6QA 1N36H 2MJHA 1TGSI 1TURA 1LR9A 1IY5A 5FLXW 1MJAA 2ERWA 2L8EA 1IBMH 1ZTGA 4K0KH 2BA0A 4YHHH 3SGQI 2E5LH 3E2IA 1UVFA 1TIHA 2A20A 2N71A 1UG8A 4LF7H 2PQUA 1DT4A 2V53A 1F0XA 5JHWC 9WGAA 3OSSD 4X64H 2QNDA 1FYBA 1I6UA 5A2QW 1J4WA 1CGJI 2CTJA 5LMUH 2KMQA 1KMAA 2O4CA 2UXDH 5HQ8A 2P6AC 4DV2H 4JI1H 5CCMA 2W0TA 2JZXA 4DV0H 2DB6A 4NBQA 1PPFI 2YQPA 1PCEA 1CT2I 3VDUA 1DS2I 2JXDA 2OVOA 1R0RI 2N1AB 3OL0A 4NZRM 2ENZA 2VRWB 1HEVA 2JVZA 1WKXA 1HJAI 3OTOH 4L9MA 3E59A 2Y0MA 1EC6A 1NUBA 5JEAG 1VIGA 2WVJA 2NU2I 3OVOA 1P9ZA 1TUSA 2NU0I 2M5XA 5FUYA 1X0AA 3L7ZC 4FJSA 2VQEH 1VBIA 3AEVB 4HGUA 1CGII 1H0ZA 2OPUA 4WANA 2BUSA 2SGQI 4JV5H 1SGEI 2ZM6H 1XA6A 3HH2C 2ROWA 2A1SA 4JI6H 3KDKA 1VDDA 4B3SH 4UXJA 2QQCA 1KBFA 2N17A 1J5EH 1LR7A 2NU3I 4DR7H 1Y1CA 2BL5A 4QMFB 4JVHA 5CCLA 4DNCA 1OMUA 2VKCA 4DUZH 2V1CC 4LF9H 1Y1BA 2K9HA 2OZUA 3RU0A 3PDNA 2K1HA 5BR8H 2FNFX 4LF6H 2X06A 3CXLA 3FSXA 1OYVI 1ZZJA 1BUSA 4LF5H 1LR8A 4WALA 4FJUA 2X3TA 4GI3C 5LL6b 1SGRI 3GOXA 4DV6H 4OX9H 2OD1A 4UXIA 1X74A 1AN7A 4BA2I 2QQDA 4A24A 2VQFH 3UFFA 1XMQH 2KMPA 1KBEA 1W4RA 4YY3H 2J9RA 4JI4H 1ODHA 4JI0H 2UXCH 2ELIA 2SGDI 1S20A 3D00A 2CTMA 2F4VH 1MSZA 5HI7A 1FJGH 5DAEA 4OD6A 1J5KA 1WGCA 2QQEA 4BA1I 1MT1A 1YU6C 2JA9A 2UUCH 4OO1G 4AMLA 2UU9H 2RIJA 5EX0A 4DR4H 2L7XA 3UOEA 2JW6A 1K7TA 2PY9A 2FPHX 4LFBH 3VE5A 3TOBA 4NXNH 3R5BA 1IBKH 4FKDA 3QWPA 2CTLA 2ANNA 1TBOA 2G8YA 1TUAA 4X62H 1CE3A 1CT0I 2P2RA 2ORWA 3TJQA 3NCVA 4E1PA 1TBRR 1P9GA 1FY7A 2E5RA 2JEBI 2KCXA 1KHMA 1TOTA 2OPVA 1N33H 2DGRA 2HH3A 5IWAH 3UGDA 1V8CA 3R5DA 1TBQR 1RFHA 1Y8FA 1DS3I 2ENNA 3J81W 4B3RH 2JEAI 4DR3H 2JYYA 4UXHA 2GVIA 1XX6A 1OMTA 1ZZIA 2HHHH 2DIPA 2UUBH 7WGAA 5FUWA 2AXYA 2UXBH 1WTJA 3UGLA 2QQ0A 3I0PA 1K7VA 3R5CA 1ULMA 1SGYI 5J8CA 1HNXH 4PDBA 2FMRA 4JI3H 2YUUA 3TO9A 1XNRH 2SGPI 4JI5H 2PQ8A 1N13A 5C0XG 2B0UC 2ODDA 3TOAA 2ANRA 1X4SA 2CPMA 1DTJA 1WHRA 2KMOA 1S03G 3OETA 2LB7A 1X4MA 4NZTM 4DR5H 2CWHA 4IFDG 1M8BA 2NN6G 1ZZKA 1OVOA 2E73A 2LRRA 2OU2A 3SGBI 1SGNI 5FUXA 3GABA 2LF0A 2LTMA 3FC3A 4WP4A 4JVYA 2JZMA 3BJIA 4AIMA 5FUVA 2Z0SA 4DUYH 4B3TH 3EZJA 4DR1H 3OXLA 1MJ9A 1FAQA 2CTKA 2QPOA 1PJUA 2CTFA 3TO7A 4GKKH 1I94H 5DT9A 1N32H 4MPIA 1U5KA 1IY6A 4NXMH 2GKTI 2HH2A 1V1IA 2LTLA 4KHPH 4B8CD 2WCYA 3R5AA 2UZ3A 1HDLA 2N52A 1CSOI 4LF8H 3GKUA 2NU4I 4X66H 1HNZH 1K1GA 1N34H 2UUAH 3U1KA 4JI8H 4E1RA 2ARPF 3QD7X 1HNWH 4G08A 4DR2H 2CPQA 1V9NA 1Z2IA 5E3PA 2FFMA 1VIHA 4LFCH 3T1YH 5IT9W 2V1CA 2ZQEA 1X9ZA 1SGDI 2CJSC 2GIVA 2Y3MA 3V69A 4DV7H 3VDPA 1Q9BA 3J7AK 2YQRA 1XBTA 4OCHA 1IBLH 1SGPI 1WE8A
chains in the Genus database with same CATH topology
2CWFA 1S20A 1NXUA 1WTJA 1V9NA 1Z2IA 4H8AA 3I0PA 2G8YA 4FJSA 3UOEA 1XRHA 4FJUA 1VBIA 2X06A 1X0AA 2CWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWF A;  1S20 A;  1NXU A;  1WTJ A;  1V9N A;  1Z2I A;  4H8A A;  3I0P A;  2G8Y A;  4FJS A;  3UOE A;  1XRH A;  4FJU A;  1VBI A;  2X06 A;  1X0A A;  2CWH A; 
#chains in the Genus database with same CATH topology
 2SGE I;  3OXF A;  5E3R A;  2B8T A;  3T1H H;  3KDG A;  1TBN A;  4B8T A;  1SGQ I;  1UUC A;  1HPT A;  4DV5 H;  2X52 A;  3UGI A;  4DR6 H;  3UEJ A;  4LIJ A;  2LUY A;  4DV4 H;  1SEI A;  1NXU A;  3OXG A;  3SB1 A;  3MEK A;  2E3U A;  1M8C A;  4SGB I;  4DV1 H;  1BMO A;  2SGF I;  2RC4 A;  4H8A A;  1XRH A;  4LF4 H;  2CTE A;  5J8F A;  3FAU A;  2LEO A;  2J87 A;  3FSY A;  1Z7K B;  1FAR A;  2D9I A;  1CT4 I;  2UVO A;  2XRC A;  1XMO H;  4JI7 H;  1V1H A;  2JE6 I;  1W3S A;  3B4V C;  3KY9 A;  1K7U A;  4B6D A;  2JA1 A;  3SEK C;  4EC5 A;  4GKJ H;  2WGC A;  1WGT A;  5EX3 A;  1MJB A;  4DV3 H;  2DKV A;  1XNQ H;  2GKV A;  1AN1 I;  2NU1 I;  4JI2 H;  4E9J A;  2GKR I;  4AM3 A;  3RF2 A;  1PQX A;  3UEY A;  2ORV A;  3QAH A;  5E3Q A;  1CHO I;  4JYA H;  2CWG A;  3VKE A;  4B3M H;  1UVG A;  2CWF A;  2KMR A;  1R79 A;  1ULK A;  3JAM W;  3GR5 A;  1PTR A;  3TO6 A;  2F3C I;  4AQY H;  2M8W A;  1HR0 H;  4LFA H;  5K36 G;  1UHA A;  1PTQ A;  3QTL D;  1FKA H;  3J80 W;  4JCV E;  1WVN A;  1ULN A;  1X4N A;  4X65 H;  1YTP A;  5LMN H;  1IW4 A;  4OVO A;  2PT7 G;  2M6Q A;  1N36 H;  2MJH A;  1TGS I;  1TUR A;  1LR9 A;  1IY5 A;  5FLX W;  1MJA A;  2ERW A;  2L8E A;  1IBM H;  1ZTG A;  4K0K H;  2BA0 A;  4YHH H;  3SGQ I;  2E5L H;  3E2I A;  1UVF A;  1TIH A;  2A20 A;  2N71 A;  1UG8 A;  4LF7 H;  2PQU A;  1DT4 A;  2V53 A;  1F0X A;  5JHW C;  9WGA A;  3OSS D;  4X64 H;  2QND A;  1FYB A;  1I6U A;  5A2Q W;  1J4W A;  1CGJ I;  2CTJ A;  5LMU H;  2KMQ A;  1KMA A;  2O4C A;  2UXD H;  5HQ8 A;  2P6A C;  4DV2 H;  4JI1 H;  5CCM A;  2W0T A;  2JZX A;  4DV0 H;  2DB6 A;  4NBQ A;  1PPF I;  2YQP A;  1PCE A;  1CT2 I;  3VDU A;  1DS2 I;  2JXD A;  2OVO A;  1R0R I;  2N1A B;  3OL0 A;  4NZR M;  2ENZ A;  2VRW B;  1HEV A;  2JVZ A;  1WKX A;  1HJA I;  3OTO H;  4L9M A;  3E59 A;  2Y0M A;  1EC6 A;  1NUB A;  5JEA G;  1VIG A;  2WVJ A;  2NU2 I;  3OVO A;  1P9Z A;  1TUS A;  2NU0 I;  2M5X A;  5FUY A;  1X0A A;  3L7Z C;  4FJS A;  2VQE H;  1VBI A;  3AEV B;  4HGU A;  1CGI I;  1H0Z A;  2OPU A;  4WAN A;  2BUS A;  2SGQ I;  4JV5 H;  1SGE I;  2ZM6 H;  1XA6 A;  3HH2 C;  2ROW A;  2A1S A;  4JI6 H;  3KDK A;  1VDD A;  4B3S H;  4UXJ A;  2QQC A;  1KBF A;  2N17 A;  1J5E H;  1LR7 A;  2NU3 I;  4DR7 H;  1Y1C A;  2BL5 A;  4QMF B;  4JVH A;  5CCL A;  4DNC A;  1OMU A;  2VKC A;  4DUZ H;  2V1C C;  4LF9 H;  1Y1B A;  2K9H A;  2OZU A;  3RU0 A;  3PDN A;  2K1H A;  5BR8 H;  2FNF X;  4LF6 H;  2X06 A;  3CXL A;  3FSX A;  1OYV I;  1ZZJ A;  1BUS A;  4LF5 H;  1LR8 A;  4WAL A;  4FJU A;  2X3T A;  4GI3 C;  5LL6 b;  1SGR I;  3GOX A;  4DV6 H;  4OX9 H;  2OD1 A;  4UXI A;  1X74 A;  1AN7 A;  4BA2 I;  2QQD A;  4A24 A;  2VQF H;  3UFF A;  1XMQ H;  2KMP A;  1KBE A;  1W4R A;  4YY3 H;  2J9R A;  4JI4 H;  1ODH A;  4JI0 H;  2UXC H;  2ELI A;  2SGD I;  1S20 A;  3D00 A;  2CTM A;  2F4V H;  1MSZ A;  5HI7 A;  1FJG H;  5DAE A;  4OD6 A;  1J5K A;  1WGC A;  2QQE A;  4BA1 I;  1MT1 A;  1YU6 C;  2JA9 A;  2UUC H;  4OO1 G;  4AML A;  2UU9 H;  2RIJ A;  5EX0 A;  4DR4 H;  2L7X A;  3UOE A;  2JW6 A;  1K7T A;  2PY9 A;  2FPH X;  4LFB H;  3VE5 A;  3TOB A;  4NXN H;  3R5B A;  1IBK H;  4FKD A;  3QWP A;  2CTL A;  2ANN A;  1TBO A;  2G8Y A;  1TUA A;  4X62 H;  1CE3 A;  1CT0 I;  2P2R A;  2ORW A;  3TJQ A;  3NCV A;  4E1P A;  1TBR R;  1P9G A;  1FY7 A;  2E5R A;  2JEB I;  2KCX A;  1KHM A;  1TOT A;  2OPV A;  1N33 H;  2DGR A;  2HH3 A;  5IWA H;  3UGD A;  1V8C A;  3R5D A;  1TBQ R;  1RFH A;  1Y8F A;  1DS3 I;  2ENN A;  3J81 W;  4B3R H;  2JEA I;  4DR3 H;  2JYY A;  4UXH A;  2GVI A;  1XX6 A;  1OMT A;  1ZZI A;  2HHH H;  2DIP A;  2UUB H;  7WGA A;  5FUW A;  2AXY A;  2UXB H;  1WTJ A;  3UGL A;  2QQ0 A;  3I0P A;  1K7V A;  3R5C A;  1ULM A;  1SGY I;  5J8C A;  1HNX H;  4PDB A;  2FMR A;  4JI3 H;  2YUU A;  3TO9 A;  1XNR H;  2SGP I;  4JI5 H;  2PQ8 A;  1N13 A;  5C0X G;  2B0U C;  2ODD A;  3TOA A;  2ANR A;  1X4S A;  2CPM A;  1DTJ A;  1WHR A;  2KMO A;  1S03 G;  3OET A;  2LB7 A;  1X4M A;  4NZT M;  4DR5 H;  2CWH A;  4IFD G;  1M8B A;  2NN6 G;  1ZZK A;  1OVO A;  2E73 A;  2LRR A;  2OU2 A;  3SGB I;  1SGN I;  5FUX A;  3GAB A;  2LF0 A;  2LTM A;  3FC3 A;  4WP4 A;  4JVY A;  2JZM A;  3BJI A;  4AIM A;  5FUV A;  2Z0S A;  4DUY H;  4B3T H;  3EZJ A;  4DR1 H;  3OXL A;  1MJ9 A;  1FAQ A;  2CTK A;  2QPO A;  1PJU A;  2CTF A;  3TO7 A;  4GKK H;  1I94 H;  5DT9 A;  1N32 H;  4MPI A;  1U5K A;  1IY6 A;  4NXM H;  2GKT I;  2HH2 A;  1V1I A;  2LTL A;  4KHP H;  4B8C D;  2WCY A;  3R5A A;  2UZ3 A;  1HDL A;  2N52 A;  1CSO I;  4LF8 H;  3GKU A;  2NU4 I;  4X66 H;  1HNZ H;  1K1G A;  1N34 H;  2UUA H;  3U1K A;  4JI8 H;  4E1R A;  2ARP F;  3QD7 X;  1HNW H;  4G08 A;  4DR2 H;  2CPQ A;  1V9N A;  1Z2I A;  5E3P A;  2FFM A;  1VIH A;  4LFC H;  3T1Y H;  5IT9 W;  2V1C A;  2ZQE A;  1X9Z A;  1SGD I;  2CJS C;  2GIV A;  2Y3M A;  3V69 A;  4DV7 H;  3VDP A;  1Q9B A;  3J7A K;  2YQR A;  1XBT A;  4OCH A;  1IBL H;  1SGP I;  1WE8 A; 
#chains in the Genus database with same CATH homology
 2CWF A;  1S20 A;  1NXU A;  1WTJ A;  1V9N A;  1Z2I A;  4H8A A;  3I0P A;  2G8Y A;  4FJS A;  3UOE A;  1XRH A;  4FJU A;  1VBI A;  2X06 A;  1X0A A;  2CWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...