2PQUA

Crystal structure of kh1 domain of human pcbp2 complexed to single-stranded 12-mer telomeric dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
72
structure length
72
Chain Sequence
KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna and dna binding protein/dna
molecule keywords 12-mer C-rich strand of human telomeric DNA
publication title X-ray crystallographic and NMR studies of protein-protein and protein-nucleic acid interactions involving the KH domains from human poly(C)-binding protein-2.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2pquA00
4IFDG 1TUAA 1KHMA 3L7ZC 1ZZKA 4WALA 2FMRA 1VIGA 4NBQA 2CTMA 4B8TA 2CTJA 1DTJA 2CPQA 4LIJA 4QMFB 3VKEA 4AM3A 4BA1I 2P2RA 2MJHA 1VIHA 2JVZA 2JZXA 2NN6G 2JEAI 1X4NA 2JE6I 4JVYA 4OO1G 2CTFA 2HH3A 1DT4A 1K1GA 2ANRA 2ANNA 2JEBI 2PQUA 2CTEA 2OPUA 4WANA 2HH2A 1ZZJA 4BA2I 1J5KA 2AXYA 2BL5A 1ZZIA 1J4WA 2YQRA 2PY9A 1ZTGA 3U1KA 1X4MA 1EC6A 1WE8A 4JVHA 2DGRA 5K36G 2BA0A 4AIMA 2OPVA 2CTKA 2E3UA 3AEVB 5JEAG 2Z0SA 2QNDA 3V69A 2JA9A 5C0XG 1WVNA 2CTLA
chains in the Genus database with same CATH superfamily
3T1HH 1V9NA 3L7ZC 4WALA 5IT9W 2CTMA 3FAUA 4B8TA 1IBMH 2CTJA 1DTJA 2CPQA 3KDGA 4LIJA 1IBLH 5BR8H 5A2QW 1XMOH 2Y3MA 2PT7G 4X66H 1J5EH 1I6UA 2CWFA 2CPMA 1MSZA 1DT4A 1HNZH 2ANNA 4OX9H 4KHPH 4H8AA 4DR3H 2G8YA 2HH2A 3OSSD 2VQEH 2AXYA 1VBIA 2ZQEA 2LF0A 3OETA 4DV0H 5FLXW 1ZTGA 3U1KA 3GR5A 1WE8A 4X62H 2BA0A 4JI0H 4AIMA 4B3TH 2E3UA 3EZJA 3JAMW 2LTMA 4OD6A 1IBKH 3V69A 5C0XG 4NXMH 4GKKH 2CTLA 4DR4H 4X64H 4JI7H 2A1SA 1VIGA 4NBQA 4JI6H 4LF7H 2UUCH 2UUAH 4JYAH 4NZTM 1PQXA 4DV5H 1SEIA 1WTJA 4LFAH 2MJHA 1X0AA 4DR6H 4PDBA 2JVZA 2JZXA 4JVYA 1X4NA 4EC5A 1N32H 3J80W 2CTFA 2VKCA 2HH3A 4DR7H 1K1GA 3KDKA 4YHHH 2JEBI 4K0KH 4DV4H 4NXNH 4WANA 4BA2I 3RF2A 1X9ZA 2BL5A 2HHHH 1J4WA 4LFCH 2F4VH 1X4MA 4JVHA 4FJUA 2CTKA 3AEVB 1F0XA 3UOEA 2LRRA 2Z0SA 4B3RH 2JA9A 2LTLA 3SB1A 1N36H 4DV2H 5LMNH 2OPVA 4DR5H 1TUAA 1XRHA 1KHMA 1FJGH 4LF6H 1S20A 2VQFH 3VKEA 4LF4H 2UXDH 4NZRM 3J7AK 4BA1I 5IWAH 3J81W 1XNQH 1N33H 1VIHA 2NN6G 2JEAI 4DV3H 2JE6I 4LFBH 4DUZH 4OO1G 4DUYH 1FKAH 4LF9H 4DV6H 3T1YH 2OPUA 2PQUA 3I0PA 1ZZJA 4JV5H 4AQYH 1ZZIA 2D9IA 2UXCH 1HR0H 1ODHA 2E5LH 2M8WA 1EC6A 2DGRA 1S03G 5K36G 4DV1H 4YY3H 2UU9H 2QNDA 2UUBH 4JI5H 1V8CA 3GABA 1HNXH 5LMUH 4JI4H 4IFDG 4OCHA 4G08A 1WHRA 1ZZKA 2FMRA 4DR2H 3QD7X 4AM3A 5DT9A 1N34H 4QMFB 2K1HA 3NCVA 2P2RA 4GKJH 4DV7H 2X06A 2ANRA 4B3MH 2ZM6H 2CTEA 2O4CA 4LF8H 1NXUA 4JI8H 2FPHX 1XMQH 1J5KA 1I94H 4E9JA 2YQRA 1AN7A 2PY9A 2FFMA 1UG8A 3OTOH 4B8CD 4B3SH 2UXBH 4DR1H 5JEAG 4JI1H 4FJSA 1HNWH 4X65H 2CWHA 1XNRH 2M6QA 4LF5H 1Z2IA 3GKUA 4JI3H 1WVNA 5LL6b 4JI2H
chains in the Genus database with same CATH topology
4IFDG 1TUAA 1KHMA 3L7ZC 1ZZKA 4WALA 2FMRA 1VIGA 4NBQA 2CTMA 4B8TA 2CTJA 1DTJA 2CPQA 4LIJA 4QMFB 3VKEA 4AM3A 4BA1I 2P2RA 2MJHA 1VIHA 2JVZA 2JZXA 2NN6G 2JEAI 1X4NA 2JE6I 4JVYA 4OO1G 2CTFA 2HH3A 1DT4A 1K1GA 2ANRA 2ANNA 2JEBI 2PQUA 2CTEA 2OPUA 4WANA 2HH2A 1ZZJA 4BA2I 1J5KA 2AXYA 2BL5A 1ZZIA 1J4WA 2YQRA 2PY9A 1ZTGA 3U1KA 1X4MA 1EC6A 1WE8A 4JVHA 2DGRA 5K36G 2BA0A 4AIMA 2OPVA 2CTKA 2E3UA 3AEVB 5JEAG 2Z0SA 2QNDA 3V69A 2JA9A 5C0XG 1WVNA 2CTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD G;  1TUA A;  1KHM A;  3L7Z C;  1ZZK A;  4WAL A;  2FMR A;  1VIG A;  4NBQ A;  2CTM A;  4B8T A;  2CTJ A;  1DTJ A;  2CPQ A;  4LIJ A;  4QMF B;  3VKE A;  4AM3 A;  4BA1 I;  2P2R A;  2MJH A;  1VIH A;  2JVZ A;  2JZX A;  2NN6 G;  2JEA I;  1X4N A;  2JE6 I;  4JVY A;  4OO1 G;  2CTF A;  2HH3 A;  1DT4 A;  1K1G A;  2ANR A;  2ANN A;  2JEB I;  2PQU A;  2CTE A;  2OPU A;  4WAN A;  2HH2 A;  1ZZJ A;  4BA2 I;  1J5K A;  2AXY A;  2BL5 A;  1ZZI A;  1J4W A;  2YQR A;  2PY9 A;  1ZTG A;  3U1K A;  1X4M A;  1EC6 A;  1WE8 A;  4JVH A;  2DGR A;  5K36 G;  2BA0 A;  4AIM A;  2OPV A;  2CTK A;  2E3U A;  3AEV B;  5JEA G;  2Z0S A;  2QND A;  3V69 A;  2JA9 A;  5C0X G;  1WVN A;  2CTL A; 
#chains in the Genus database with same CATH topology
 3T1H H;  1V9N A;  3L7Z C;  4WAL A;  5IT9 W;  2CTM A;  3FAU A;  4B8T A;  1IBM H;  2CTJ A;  1DTJ A;  2CPQ A;  3KDG A;  4LIJ A;  1IBL H;  5BR8 H;  5A2Q W;  1XMO H;  2Y3M A;  2PT7 G;  4X66 H;  1J5E H;  1I6U A;  2CWF A;  2CPM A;  1MSZ A;  1DT4 A;  1HNZ H;  2ANN A;  4OX9 H;  4KHP H;  4H8A A;  4DR3 H;  2G8Y A;  2HH2 A;  3OSS D;  2VQE H;  2AXY A;  1VBI A;  2ZQE A;  2LF0 A;  3OET A;  4DV0 H;  5FLX W;  1ZTG A;  3U1K A;  3GR5 A;  1WE8 A;  4X62 H;  2BA0 A;  4JI0 H;  4AIM A;  4B3T H;  2E3U A;  3EZJ A;  3JAM W;  2LTM A;  4OD6 A;  1IBK H;  3V69 A;  5C0X G;  4NXM H;  4GKK H;  2CTL A;  4DR4 H;  4X64 H;  4JI7 H;  2A1S A;  1VIG A;  4NBQ A;  4JI6 H;  4LF7 H;  2UUC H;  2UUA H;  4JYA H;  4NZT M;  1PQX A;  4DV5 H;  1SEI A;  1WTJ A;  4LFA H;  2MJH A;  1X0A A;  4DR6 H;  4PDB A;  2JVZ A;  2JZX A;  4JVY A;  1X4N A;  4EC5 A;  1N32 H;  3J80 W;  2CTF A;  2VKC A;  2HH3 A;  4DR7 H;  1K1G A;  3KDK A;  4YHH H;  2JEB I;  4K0K H;  4DV4 H;  4NXN H;  4WAN A;  4BA2 I;  3RF2 A;  1X9Z A;  2BL5 A;  2HHH H;  1J4W A;  4LFC H;  2F4V H;  1X4M A;  4JVH A;  4FJU A;  2CTK A;  3AEV B;  1F0X A;  3UOE A;  2LRR A;  2Z0S A;  4B3R H;  2JA9 A;  2LTL A;  3SB1 A;  1N36 H;  4DV2 H;  5LMN H;  2OPV A;  4DR5 H;  1TUA A;  1XRH A;  1KHM A;  1FJG H;  4LF6 H;  1S20 A;  2VQF H;  3VKE A;  4LF4 H;  2UXD H;  4NZR M;  3J7A K;  4BA1 I;  5IWA H;  3J81 W;  1XNQ H;  1N33 H;  1VIH A;  2NN6 G;  2JEA I;  4DV3 H;  2JE6 I;  4LFB H;  4DUZ H;  4OO1 G;  4DUY H;  1FKA H;  4LF9 H;  4DV6 H;  3T1Y H;  2OPU A;  2PQU A;  3I0P A;  1ZZJ A;  4JV5 H;  4AQY H;  1ZZI A;  2D9I A;  2UXC H;  1HR0 H;  1ODH A;  2E5L H;  2M8W A;  1EC6 A;  2DGR A;  1S03 G;  5K36 G;  4DV1 H;  4YY3 H;  2UU9 H;  2QND A;  2UUB H;  4JI5 H;  1V8C A;  3GAB A;  1HNX H;  5LMU H;  4JI4 H;  4IFD G;  4OCH A;  4G08 A;  1WHR A;  1ZZK A;  2FMR A;  4DR2 H;  3QD7 X;  4AM3 A;  5DT9 A;  1N34 H;  4QMF B;  2K1H A;  3NCV A;  2P2R A;  4GKJ H;  4DV7 H;  2X06 A;  2ANR A;  4B3M H;  2ZM6 H;  2CTE A;  2O4C A;  4LF8 H;  1NXU A;  4JI8 H;  2FPH X;  1XMQ H;  1J5K A;  1I94 H;  4E9J A;  2YQR A;  1AN7 A;  2PY9 A;  2FFM A;  1UG8 A;  3OTO H;  4B8C D;  4B3S H;  2UXB H;  4DR1 H;  5JEA G;  4JI1 H;  4FJS A;  1HNW H;  4X65 H;  2CWH A;  1XNR H;  2M6Q A;  4LF5 H;  1Z2I A;  3GKU A;  4JI3 H;  1WVN A;  5LL6 b;  4JI2 H; 
#chains in the Genus database with same CATH homology
 4IFD G;  1TUA A;  1KHM A;  3L7Z C;  1ZZK A;  4WAL A;  2FMR A;  1VIG A;  4NBQ A;  2CTM A;  4B8T A;  2CTJ A;  1DTJ A;  2CPQ A;  4LIJ A;  4QMF B;  3VKE A;  4AM3 A;  4BA1 I;  2P2R A;  2MJH A;  1VIH A;  2JVZ A;  2JZX A;  2NN6 G;  2JEA I;  1X4N A;  2JE6 I;  4JVY A;  4OO1 G;  2CTF A;  2HH3 A;  1DT4 A;  1K1G A;  2ANR A;  2ANN A;  2JEB I;  2PQU A;  2CTE A;  2OPU A;  4WAN A;  2HH2 A;  1ZZJ A;  4BA2 I;  1J5K A;  2AXY A;  2BL5 A;  1ZZI A;  1J4W A;  2YQR A;  2PY9 A;  1ZTG A;  3U1K A;  1X4M A;  1EC6 A;  1WE8 A;  4JVH A;  2DGR A;  5K36 G;  2BA0 A;  4AIM A;  2OPV A;  2CTK A;  2E3U A;  3AEV B;  5JEA G;  2Z0S A;  2QND A;  3V69 A;  2JA9 A;  5C0X G;  1WVN A;  2CTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...