2PQUA

Crystal structure of kh1 domain of human pcbp2 complexed to single-stranded 12-mer telomeric dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
72
structure length
72
Chain Sequence
b'KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12-mer C-rich strand of human telomeric DNA
molecule tags Rna and dna binding protein/dna
source organism Homo sapiens
publication title X-ray crystallographic and NMR studies of protein-protein and protein-nucleic acid interactions involving the KH domains from human poly(C)-binding protein-2.
pubmed doi rcsb
total genus 17
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2pquA00
2CTJA 2NN6G 4BA2I 4QMFB 3U1KA 4OO1G 3VKEA 4LIJA 1J5KA 4BA1I 1ZTGA 5JEAG 4WANA 4JVHA 2JVZA 2CTMA 1TUAA 2PQUA 2JA9A 2BL5A 2CPQA 1WVNA 3L7ZC 4JVYA 5K36G 1ZZIA 1DTJA 3AEVB 1X4NA 2CTLA 2OPVA 4AIMA 2JE6I 2CTFA 1ZZJA 2DGRA 2QNDA 2MJHA 1X4MA 2JEAI 2CTKA 1ZZKA 2AXYA 2ANNA 1EC6A 2E3UA 1WE8A 4WALA 2YQRA 2PY9A 1VIHA 2BA0A 1KHMA 2CTEA 4NBQA 2ANRA 2HH2A 3V69A 2OPUA 2FMRA 4AM3A 1VIGA 2HH3A 2JEBI 2Z0SA 2JZXA 4B8TA 1J4WA 1DT4A 4IFDG 2P2RA 5C0XG 1K1GA
chains in the Genus database with same CATH superfamily
1UG8A 4DR6H 1S03G 4DR3H 4X65H 1SEIA 4DR4H 4LIJA 5LMUH 3T1HH 2UUAH 2JVZA 4JI7H 3J7AK 3KDGA 2PQUA 4DV4H 2LTLA 4DUZH 5IT9W 3QD7X 4DR2H 1AN7A 5IWAH 1X4NA 4GKKH 2X06A 2JE6I 1ZZJA 1FKAH 2DGRA 4LF6H 4JVYA 4WANA 2FFMA 2AXYA 4JI3H 4WALA 4DR5H 1I94H 2UUBH 5A2QW 4JI0H 4NBQA 3KDKA 4JV5H 2FMRA 1VBIA 2JEBI 2Z0SA 4NZRM 4OD6A 4B3MH 3T1YH 1DT4A 1NXUA 4LFBH 3OSSD 4PDBA 5C0XG 2VQFH 2CWHA 2K1HA 1IBKH 4B3RH 2O4CA 2LRRA 1N32H 1ODHA 3JAMW 5JEAG 1F0XA 2G8YA 1WHRA 5BR8H 1WVNA 2CWFA 2FPHX 4LF8H 1HNXH 3EZJA 3OETA 3J80W 3AEVB 4JI2H 2LF0A 4DV3H 4OX9H 2QNDA 1X9ZA 2ZQEA 1FJGH 2F4VH 1EC6A 2ANNA 1N36H 1WE8A 2PT7G 2A1SA 1XMOH 2E5LH 4NXMH 2CTEA 4DV1H 4DR7H 2ANRA 2UUCH 2OPUA 4FJUA 4H8AA 4FJSA 1VIGA 2UXBH 5DT9A 1J4WA 4JI5H 1XNRH 4JI4H 4JVHA 1J5EH 1V9NA 3I0PA 4LFCH 1N34H 1Z2IA 4BA2I 4QMFB 4JI6H 2LTMA 2UU9H 2D9IA 3NCVA 3VKEA 4OO1G 2UXDH 1HNZH 4LF4H 4KHPH 1J5KA 1ZTGA 2M8WA 1I6UA 4JI1H 3RF2A 2CTMA 3SB1A 4X64H 4NZTM 4YHHH 2JA9A 2BL5A 1PQXA 3L7ZC 2VQEH 2CPMA 1ZZIA 2UXCH 1HNWH 4LF5H 2OPVA 4AIMA 2MJHA 2JEAI 1X4MA 2CTKA 1N33H 1XMQH 4G08A 4DV5H 2PY9A 4DV2H 3V69A 1XRHA 3UOEA 4B8CD 4AM3A 4LF7H 4LF9H 3GABA 2P2RA 3FAUA 4YY3H 2CTJA 2NN6G 3GR5A 5LL6b 3U1KA 4EC5A 4X66H 1WTJA 1S20A 4JYAH 5FLXW 4BA1I 4B3TH 3GKUA 1TUAA 3OTOH 2CPQA 2ZM6H 4DV0H 5K36G 2Y3MA 1DTJA 1V8CA 2HHHH 4B3SH 2CTLA 2CTFA 1XNQH 5LMNH 1ZZKA 4NXNH 2E3UA 1IBMH 4DR1H 2M6QA 2YQRA 1VIHA 2BA0A 4JI8H 4LFAH 1KHMA 1IBLH 1X0AA 4DV6H 4GKJH 2HH2A 4E9JA 1HR0H 2VKCA 4DV7H 4X62H 2HH3A 3J81W 4B8TA 2JZXA 4K0KH 4OCHA 4AQYH 4DUYH 4IFDG 1MSZA 1K1GA
chains in the Genus database with same CATH topology
2CTJA 2NN6G 4BA2I 4QMFB 3U1KA 4OO1G 3VKEA 4LIJA 1J5KA 4BA1I 1ZTGA 5JEAG 4WANA 4JVHA 2JVZA 2CTMA 1TUAA 2PQUA 2JA9A 2BL5A 2CPQA 1WVNA 3L7ZC 4JVYA 5K36G 1ZZIA 1DTJA 3AEVB 1X4NA 2CTLA 2OPVA 4AIMA 2JE6I 2CTFA 1ZZJA 2DGRA 2QNDA 2MJHA 1X4MA 2JEAI 2CTKA 1ZZKA 2AXYA 2ANNA 1EC6A 2E3UA 1WE8A 4WALA 2YQRA 2PY9A 1VIHA 2BA0A 1KHMA 2CTEA 4NBQA 2ANRA 2HH2A 3V69A 2OPUA 2FMRA 4AM3A 1VIGA 2HH3A 2JEBI 2Z0SA 2JZXA 4B8TA 1J4WA 1DT4A 4IFDG 2P2RA 5C0XG 1K1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTJ A;  2NN6 G;  4BA2 I;  4QMF B;  3U1K A;  4OO1 G;  3VKE A;  4LIJ A;  1J5K A;  4BA1 I;  1ZTG A;  5JEA G;  4WAN A;  4JVH A;  2JVZ A;  2CTM A;  1TUA A;  2PQU A;  2JA9 A;  2BL5 A;  2CPQ A;  1WVN A;  3L7Z C;  4JVY A;  5K36 G;  1ZZI A;  1DTJ A;  3AEV B;  1X4N A;  2CTL A;  2OPV A;  4AIM A;  2JE6 I;  2CTF A;  1ZZJ A;  2DGR A;  2QND A;  2MJH A;  1X4M A;  2JEA I;  2CTK A;  1ZZK A;  2AXY A;  2ANN A;  1EC6 A;  2E3U A;  1WE8 A;  4WAL A;  2YQR A;  2PY9 A;  1VIH A;  2BA0 A;  1KHM A;  2CTE A;  4NBQ A;  2ANR A;  2HH2 A;  3V69 A;  2OPU A;  2FMR A;  4AM3 A;  1VIG A;  2HH3 A;  2JEB I;  2Z0S A;  2JZX A;  4B8T A;  1J4W A;  1DT4 A;  4IFD G;  2P2R A;  5C0X G;  1K1G A; 
#chains in the Genus database with same CATH topology
 1UG8 A;  4DR6 H;  1S03 G;  4DR3 H;  4X65 H;  1SEI A;  4DR4 H;  4LIJ A;  5LMU H;  3T1H H;  2UUA H;  2JVZ A;  4JI7 H;  3J7A K;  3KDG A;  2PQU A;  4DV4 H;  2LTL A;  4DUZ H;  5IT9 W;  3QD7 X;  4DR2 H;  1AN7 A;  5IWA H;  1X4N A;  4GKK H;  2X06 A;  2JE6 I;  1ZZJ A;  1FKA H;  2DGR A;  4LF6 H;  4JVY A;  4WAN A;  2FFM A;  2AXY A;  4JI3 H;  4WAL A;  4DR5 H;  1I94 H;  2UUB H;  5A2Q W;  4JI0 H;  4NBQ A;  3KDK A;  4JV5 H;  2FMR A;  1VBI A;  2JEB I;  2Z0S A;  4NZR M;  4OD6 A;  4B3M H;  3T1Y H;  1DT4 A;  1NXU A;  4LFB H;  3OSS D;  4PDB A;  5C0X G;  2VQF H;  2CWH A;  2K1H A;  1IBK H;  4B3R H;  2O4C A;  2LRR A;  1N32 H;  1ODH A;  3JAM W;  5JEA G;  1F0X A;  2G8Y A;  1WHR A;  5BR8 H;  1WVN A;  2CWF A;  2FPH X;  4LF8 H;  1HNX H;  3EZJ A;  3OET A;  3J80 W;  3AEV B;  4JI2 H;  2LF0 A;  4DV3 H;  4OX9 H;  2QND A;  1X9Z A;  2ZQE A;  1FJG H;  2F4V H;  1EC6 A;  2ANN A;  1N36 H;  1WE8 A;  2PT7 G;  2A1S A;  1XMO H;  2E5L H;  4NXM H;  2CTE A;  4DV1 H;  4DR7 H;  2ANR A;  2UUC H;  2OPU A;  4FJU A;  4H8A A;  4FJS A;  1VIG A;  2UXB H;  5DT9 A;  1J4W A;  4JI5 H;  1XNR H;  4JI4 H;  4JVH A;  1J5E H;  1V9N A;  3I0P A;  4LFC H;  1N34 H;  1Z2I A;  4BA2 I;  4QMF B;  4JI6 H;  2LTM A;  2UU9 H;  2D9I A;  3NCV A;  3VKE A;  4OO1 G;  2UXD H;  1HNZ H;  4LF4 H;  4KHP H;  1J5K A;  1ZTG A;  2M8W A;  1I6U A;  4JI1 H;  3RF2 A;  2CTM A;  3SB1 A;  4X64 H;  4NZT M;  4YHH H;  2JA9 A;  2BL5 A;  1PQX A;  3L7Z C;  2VQE H;  2CPM A;  1ZZI A;  2UXC H;  1HNW H;  4LF5 H;  2OPV A;  4AIM A;  2MJH A;  2JEA I;  1X4M A;  2CTK A;  1N33 H;  1XMQ H;  4G08 A;  4DV5 H;  2PY9 A;  4DV2 H;  3V69 A;  1XRH A;  3UOE A;  4B8C D;  4AM3 A;  4LF7 H;  4LF9 H;  3GAB A;  2P2R A;  3FAU A;  4YY3 H;  2CTJ A;  2NN6 G;  3GR5 A;  5LL6 b;  3U1K A;  4EC5 A;  4X66 H;  1WTJ A;  1S20 A;  4JYA H;  5FLX W;  4BA1 I;  4B3T H;  3GKU A;  1TUA A;  3OTO H;  2CPQ A;  2ZM6 H;  4DV0 H;  5K36 G;  2Y3M A;  1DTJ A;  1V8C A;  2HHH H;  4B3S H;  2CTL A;  2CTF A;  1XNQ H;  5LMN H;  1ZZK A;  4NXN H;  2E3U A;  1IBM H;  4DR1 H;  2M6Q A;  2YQR A;  1VIH A;  2BA0 A;  4JI8 H;  4LFA H;  1KHM A;  1IBL H;  1X0A A;  4DV6 H;  4GKJ H;  2HH2 A;  4E9J A;  1HR0 H;  2VKC A;  4DV7 H;  4X62 H;  2HH3 A;  3J81 W;  4B8T A;  2JZX A;  4K0K H;  4OCH A;  4AQY H;  4DUY H;  4IFD G;  1MSZ A;  1K1G A; 
#chains in the Genus database with same CATH homology
 2CTJ A;  2NN6 G;  4BA2 I;  4QMF B;  3U1K A;  4OO1 G;  3VKE A;  4LIJ A;  1J5K A;  4BA1 I;  1ZTG A;  5JEA G;  4WAN A;  4JVH A;  2JVZ A;  2CTM A;  1TUA A;  2PQU A;  2JA9 A;  2BL5 A;  2CPQ A;  1WVN A;  3L7Z C;  4JVY A;  5K36 G;  1ZZI A;  1DTJ A;  3AEV B;  1X4N A;  2CTL A;  2OPV A;  4AIM A;  2JE6 I;  2CTF A;  1ZZJ A;  2DGR A;  2QND A;  2MJH A;  1X4M A;  2JEA I;  2CTK A;  1ZZK A;  2AXY A;  2ANN A;  1EC6 A;  2E3U A;  1WE8 A;  4WAL A;  2YQR A;  2PY9 A;  1VIH A;  2BA0 A;  1KHM A;  2CTE A;  4NBQ A;  2ANR A;  2HH2 A;  3V69 A;  2OPU A;  2FMR A;  4AM3 A;  1VIG A;  2HH3 A;  2JEB I;  2Z0S A;  2JZX A;  4B8T A;  1J4W A;  1DT4 A;  4IFD G;  2P2R A;  5C0X G;  1K1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...