2PQUA

Crystal structure of kh1 domain of human pcbp2 complexed to single-stranded 12-mer telomeric dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
72
structure length
72
Chain Sequence
KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12-mer C-rich strand of human telomeric DNA
publication title X-ray crystallographic and NMR studies of protein-protein and protein-nucleic acid interactions involving the KH domains from human poly(C)-binding protein-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna and dna binding protein/dna
total genus 17
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2pquA00
4LIJA 4JVHA 4NBQA 2AXYA 2HH2A 5C0XG 1DTJA 1J4WA 1KHMA 2PY9A 1X4MA 2NN6G 2E3UA 3VKEA 4QMFB 2JE6I 4IFDG 4WANA 1WE8A 2PQUA 3AEVB 2JVZA 2JA9A 2CTKA 1WVNA 2JZXA 4B8TA 2JEAI 2CTFA 1ZZIA 2CTJA 2ANRA 2OPVA 2CPQA 2FMRA 4OO1G 2HH3A 2OPUA 4WALA 1ZZJA 2BA0A 4JVYA 1EC6A 2Z0SA 4BA2I 5K36G 2DGRA 4BA1I 1DT4A 2JEBI 2P2RA 1X4NA 2QNDA 1J5KA 2ANNA 1VIGA 4AIMA 4AM3A 2CTLA 1TUAA 2BL5A 2YQRA 3U1KA 2CTEA 5JEAG 2MJHA 1ZZKA 3L7ZC 3V69A 1K1GA 2CTMA 1ZTGA 1VIHA
chains in the Genus database with same CATH superfamily
1PQXA 4NBQA 4X66H 1DTJA 5BR8H 2UU9H 4X65H 1AN7A 4YY3H 2PQUA 2CTKA 2JZXA 4FJUA 4LFAH 1I94H 1I6UA 4DV0H 2PT7G 4DV1H 2ZM6H 2LRRA 3KDGA 4WALA 4JI0H 2BA0A 3J7AK 4NZRM 4JVYA 4NXNH 1ZTGA 2DGRA 1DT4A 1IBKH 4OCHA 4DR1H 1MSZA 2CPMA 4DR5H 2BL5A 4JI3H 2FPHX 5JEAG 4LF4H 2LF0A 3GKUA 2A1SA 2G8YA 1S20A 1J5EH 3RF2A 2AXYA 2HH2A 1J4WA 3OTOH 1XMQH 2UXCH 2PY9A 3VKEA 4QMFB 1N36H 1XRHA 4B3SH 4JI6H 4IFDG 4WANA 3FAUA 1WVNA 3I0PA 3OETA 2JEAI 2ANRA 1XNQH 4NXMH 1VBIA 2UUCH 3EZJA 4LF7H 4B3TH 4GKKH 1V8CA 4DR4H 4DV7H 4DUZH 1HNXH 4LF5H 4KHPH 4EC5A 2ZQEA 1XMOH 1S03G 4LF6H 2VQEH 3GR5A 4LFBH 3SB1A 4DV2H 2ANNA 1Z2IA 4AM3A 4PDBA 5DT9A 4JI1H 4B8CD 4DV4H 1XNRH 1ZZKA 3V69A 2LTMA 2MJHA 4JV5H 4LF8H 4X64H 1V9NA 2CTMA 1FKAH 2UXDH 2E5LH 4FJSA 1KHMA 2HHHH 2E3UA 2Y3MA 5IWAH 1WE8A 3AEVB 2VQFH 4JI8H 3NCVA 4B8TA 3OSSD 2CTFA 1WTJA 2CTJA 2M8WA 4DV3H 1IBMH 4X62H 1ODHA 5LMNH 4LF9H 3QD7X 5LMUH 2OPUA 2VKCA 1NXUA 2K1HA 2F4VH 1EC6A 2Z0SA 1N33H 4BA1I 1F0XA 2JEBI 2P2RA 1X4NA 5FLXW 4DR3H 2QNDA 1J5KA 5IT9W 4DV6H 4JYAH 3GABA 2UUBH 1X9ZA 2LTLA 3U1KA 4DUYH 1K1GA 1HR0H 4DR6H 1IBLH 4JI4H 4LIJA 4JVHA 4H8AA 2O4CA 5C0XG 2FFMA 1X4MA 2NN6G 1HNWH 1SEIA 4E9JA 4LFCH 1UG8A 2JE6I 2X06A 2CWFA 3UOEA 4K0KH 1N32H 2JVZA 4DR7H 4OD6A 1ZZIA 2OPVA 2CPQA 4B3RH 3KDKA 3J80W 1HNZH 2FMRA 4OX9H 4JI2H 2HH3A 1ZZJA 4OO1G 1WHRA 5LL6b 4DR2H 4DV5H 4JI5H 3T1HH 4B3MH 4BA2I 5K36G 2UXBH 3J81W 4JI7H 5A2QW 2CWHA 3JAMW 4YHHH 4GKJH 1FJGH 1VIGA 4AIMA 2UUAH 2CTLA 1TUAA 2YQRA 4AQYH 2CTEA 2M6QA 2D9IA 3T1YH 3L7ZC 4G08A 2JA9A 1X0AA 1N34H 4NZTM 1VIHA
chains in the Genus database with same CATH topology
4LIJA 4JVHA 4NBQA 2AXYA 2HH2A 5C0XG 1DTJA 1J4WA 1KHMA 2PY9A 1X4MA 2NN6G 2E3UA 3VKEA 4QMFB 2JE6I 4IFDG 4WANA 1WE8A 2PQUA 3AEVB 2JVZA 2JA9A 2CTKA 1WVNA 2JZXA 4B8TA 2JEAI 2CTFA 1ZZIA 2CTJA 2ANRA 2OPVA 2CPQA 2FMRA 4OO1G 2HH3A 2OPUA 4WALA 1ZZJA 2BA0A 4JVYA 1EC6A 2Z0SA 4BA2I 5K36G 2DGRA 4BA1I 1DT4A 2JEBI 2P2RA 1X4NA 2QNDA 1J5KA 2ANNA 1VIGA 4AIMA 4AM3A 2CTLA 1TUAA 2BL5A 2YQRA 3U1KA 2CTEA 5JEAG 2MJHA 1ZZKA 3L7ZC 3V69A 1K1GA 2CTMA 1ZTGA 1VIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LIJ A;  4JVH A;  4NBQ A;  2AXY A;  2HH2 A;  5C0X G;  1DTJ A;  1J4W A;  1KHM A;  2PY9 A;  1X4M A;  2NN6 G;  2E3U A;  3VKE A;  4QMF B;  2JE6 I;  4IFD G;  4WAN A;  1WE8 A;  2PQU A;  3AEV B;  2JVZ A;  2JA9 A;  2CTK A;  1WVN A;  2JZX A;  4B8T A;  2JEA I;  2CTF A;  1ZZI A;  2CTJ A;  2ANR A;  2OPV A;  2CPQ A;  2FMR A;  4OO1 G;  2HH3 A;  2OPU A;  4WAL A;  1ZZJ A;  2BA0 A;  4JVY A;  1EC6 A;  2Z0S A;  4BA2 I;  5K36 G;  2DGR A;  4BA1 I;  1DT4 A;  2JEB I;  2P2R A;  1X4N A;  2QND A;  1J5K A;  2ANN A;  1VIG A;  4AIM A;  4AM3 A;  2CTL A;  1TUA A;  2BL5 A;  2YQR A;  3U1K A;  2CTE A;  5JEA G;  2MJH A;  1ZZK A;  3L7Z C;  3V69 A;  1K1G A;  2CTM A;  1ZTG A;  1VIH A; 
#chains in the Genus database with same CATH topology
 1PQX A;  4NBQ A;  4X66 H;  1DTJ A;  5BR8 H;  2UU9 H;  4X65 H;  1AN7 A;  4YY3 H;  2PQU A;  2CTK A;  2JZX A;  4FJU A;  4LFA H;  1I94 H;  1I6U A;  4DV0 H;  2PT7 G;  4DV1 H;  2ZM6 H;  2LRR A;  3KDG A;  4WAL A;  4JI0 H;  2BA0 A;  3J7A K;  4NZR M;  4JVY A;  4NXN H;  1ZTG A;  2DGR A;  1DT4 A;  1IBK H;  4OCH A;  4DR1 H;  1MSZ A;  2CPM A;  4DR5 H;  2BL5 A;  4JI3 H;  2FPH X;  5JEA G;  4LF4 H;  2LF0 A;  3GKU A;  2A1S A;  2G8Y A;  1S20 A;  1J5E H;  3RF2 A;  2AXY A;  2HH2 A;  1J4W A;  3OTO H;  1XMQ H;  2UXC H;  2PY9 A;  3VKE A;  4QMF B;  1N36 H;  1XRH A;  4B3S H;  4JI6 H;  4IFD G;  4WAN A;  3FAU A;  1WVN A;  3I0P A;  3OET A;  2JEA I;  2ANR A;  1XNQ H;  4NXM H;  1VBI A;  2UUC H;  3EZJ A;  4LF7 H;  4B3T H;  4GKK H;  1V8C A;  4DR4 H;  4DV7 H;  4DUZ H;  1HNX H;  4LF5 H;  4KHP H;  4EC5 A;  2ZQE A;  1XMO H;  1S03 G;  4LF6 H;  2VQE H;  3GR5 A;  4LFB H;  3SB1 A;  4DV2 H;  2ANN A;  1Z2I A;  4AM3 A;  4PDB A;  5DT9 A;  4JI1 H;  4B8C D;  4DV4 H;  1XNR H;  1ZZK A;  3V69 A;  2LTM A;  2MJH A;  4JV5 H;  4LF8 H;  4X64 H;  1V9N A;  2CTM A;  1FKA H;  2UXD H;  2E5L H;  4FJS A;  1KHM A;  2HHH H;  2E3U A;  2Y3M A;  5IWA H;  1WE8 A;  3AEV B;  2VQF H;  4JI8 H;  3NCV A;  4B8T A;  3OSS D;  2CTF A;  1WTJ A;  2CTJ A;  2M8W A;  4DV3 H;  1IBM H;  4X62 H;  1ODH A;  5LMN H;  4LF9 H;  3QD7 X;  5LMU H;  2OPU A;  2VKC A;  1NXU A;  2K1H A;  2F4V H;  1EC6 A;  2Z0S A;  1N33 H;  4BA1 I;  1F0X A;  2JEB I;  2P2R A;  1X4N A;  5FLX W;  4DR3 H;  2QND A;  1J5K A;  5IT9 W;  4DV6 H;  4JYA H;  3GAB A;  2UUB H;  1X9Z A;  2LTL A;  3U1K A;  4DUY H;  1K1G A;  1HR0 H;  4DR6 H;  1IBL H;  4JI4 H;  4LIJ A;  4JVH A;  4H8A A;  2O4C A;  5C0X G;  2FFM A;  1X4M A;  2NN6 G;  1HNW H;  1SEI A;  4E9J A;  4LFC H;  1UG8 A;  2JE6 I;  2X06 A;  2CWF A;  3UOE A;  4K0K H;  1N32 H;  2JVZ A;  4DR7 H;  4OD6 A;  1ZZI A;  2OPV A;  2CPQ A;  4B3R H;  3KDK A;  3J80 W;  1HNZ H;  2FMR A;  4OX9 H;  4JI2 H;  2HH3 A;  1ZZJ A;  4OO1 G;  1WHR A;  5LL6 b;  4DR2 H;  4DV5 H;  4JI5 H;  3T1H H;  4B3M H;  4BA2 I;  5K36 G;  2UXB H;  3J81 W;  4JI7 H;  5A2Q W;  2CWH A;  3JAM W;  4YHH H;  4GKJ H;  1FJG H;  1VIG A;  4AIM A;  2UUA H;  2CTL A;  1TUA A;  2YQR A;  4AQY H;  2CTE A;  2M6Q A;  2D9I A;  3T1Y H;  3L7Z C;  4G08 A;  2JA9 A;  1X0A A;  1N34 H;  4NZT M;  1VIH A; 
#chains in the Genus database with same CATH homology
 4LIJ A;  4JVH A;  4NBQ A;  2AXY A;  2HH2 A;  5C0X G;  1DTJ A;  1J4W A;  1KHM A;  2PY9 A;  1X4M A;  2NN6 G;  2E3U A;  3VKE A;  4QMF B;  2JE6 I;  4IFD G;  4WAN A;  1WE8 A;  2PQU A;  3AEV B;  2JVZ A;  2JA9 A;  2CTK A;  1WVN A;  2JZX A;  4B8T A;  2JEA I;  2CTF A;  1ZZI A;  2CTJ A;  2ANR A;  2OPV A;  2CPQ A;  2FMR A;  4OO1 G;  2HH3 A;  2OPU A;  4WAL A;  1ZZJ A;  2BA0 A;  4JVY A;  1EC6 A;  2Z0S A;  4BA2 I;  5K36 G;  2DGR A;  4BA1 I;  1DT4 A;  2JEB I;  2P2R A;  1X4N A;  2QND A;  1J5K A;  2ANN A;  1VIG A;  4AIM A;  4AM3 A;  2CTL A;  1TUA A;  2BL5 A;  2YQR A;  3U1K A;  2CTE A;  5JEA G;  2MJH A;  1ZZK A;  3L7Z C;  3V69 A;  1K1G A;  2CTM A;  1ZTG A;  1VIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...