2PQUA

Crystal structure of kh1 domain of human pcbp2 complexed to single-stranded 12-mer telomeric dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
72
structure length
72
Chain Sequence
KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic and NMR studies of protein-protein and protein-nucleic acid interactions involving the KH domains from human poly(C)-binding protein-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna and dna binding protein/dna
molecule keywords 12-mer C-rich strand of human telomeric DNA
total genus 17
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2pquA00
2QNDA 1ZTGA 4BA2I 4LIJA 2AXYA 2PY9A 4AM3A 4JVYA 2FMRA 1ZZIA 2CTLA 1DT4A 5K36G 2CTKA 2OPUA 3L7ZC 2NN6G 1EC6A 2MJHA 5C0XG 3AEVB 4IFDG 2JA9A 1VIHA 2CTJA 3U1KA 4WANA 2OPVA 2ANRA 4WALA 2CTFA 2Z0SA 2JEBI 3VKEA 1VIGA 4JVHA 2E3UA 1KHMA 2BL5A 2BA0A 2HH3A 1J5KA 1ZZKA 1ZZJA 2HH2A 2CTEA 3V69A 2JVZA 2CTMA 2YQRA 4BA1I 1J4WA 2CPQA 2DGRA 1WVNA 2P2RA 2JE6I 1WE8A 1X4NA 4NBQA 5JEAG 4B8TA 1DTJA 2JZXA 4QMFB 1TUAA 4AIMA 1K1GA 2PQUA 2ANNA 2JEAI 4OO1G 1X4MA
chains in the Genus database with same CATH superfamily
5BR8H 1IBLH 2QNDA 3FAUA 1IBMH 4PDBA 2X06A 2AXYA 4JVYA 2LRRA 2FMRA 4DV3H 5FLXW 2ZQEA 1I94H 3NCVA 2D9IA 3OTOH 2UUCH 2UXCH 5K36G 2OPUA 1HR0H 1S03G 3J81W 5C0XG 4IFDG 2CWHA 1VIHA 2CTJA 4E9JA 3U1KA 1X0AA 1NXUA 4B3SH 2OPVA 4DR7H 1VIGA 4JVHA 4LF8H 4JI3H 3RF2A 3J80W 4LF6H 4YHHH 2F4VH 4LF4H 1ZZJA 4DV2H 2E5LH 1J5EH 2FFMA 2CPQA 2P2RA 4JV5H 4DV0H 1S20A 4B8TA 1Z2IA 1K1GA 2ANNA 1XNQH 1WTJA 4DR3H 4B3MH 4JI5H 4JI8H 2UUBH 4LIJA 4H8AA 3SB1A 4YY3H 1HNXH 2CTLA 2A1SA 2UXDH 1WHRA 2PT7G 4GKJH 2JA9A 3OSSD 3KDKA 2UU9H 4X62H 4WANA 4FJUA 3VKEA 4JI4H 2JEBI 2CWFA 4JI1H 2E3UA 3QD7X 4B8CD 1KHMA 2BL5A 2O4CA 2BA0A 2VKCA 2LF0A 2M8WA 4K0KH 3T1YH 4LF7H 4JI6H 2CTMA 1J4WA 2DGRA 4NXNH 2G8YA 1ODHA 1UG8A 1X4NA 1V9NA 1XMOH 1AN7A 2JEAI 2FPHX 3EZJA 1X4MA 4X64H 1VBIA 4OD6A 4DV1H 1HNWH 4DR4H 1ZTGA 1V8CA 1N36H 4AM3A 1PQXA 4DV5H 1F0XA 1ZZIA 3OETA 5LL6b 4DR2H 1DT4A 1X9ZA 3JAMW 2VQFH 3L7ZC 4B3TH 2NN6G 4JI0H 2M6QA 3J7AK 4WALA 1I6UA 2Z0SA 2CPMA 4LFAH 1J5KA 1ZZKA 2HH2A 4X66H 4DR5H 1N32H 2JVZA 4BA1I 2ZM6H 1WVNA 4G08A 4KHPH 4GKKH 1MSZA 4LF9H 2JE6I 5A2QW 4NBQA 5IT9W 4EC5A 1TUAA 1HNZH 2PQUA 2LTMA 4LFBH 4JI7H 2HHHH 1SEIA 1N33H 4BA2I 3KDGA 1XNRH 2PY9A 2UUAH 2LTLA 5DT9A 4DUZH 4FJSA 3UOEA 2CTKA 4NZRM 4DV4H 4JYAH 1EC6A 2MJHA 3AEVB 3T1HH 4NZTM 4DV7H 2Y3MA 4X65H 2ANRA 4NXMH 5LMUH 2CTFA 4OCHA 4OX9H 4JI2H 1N34H 3I0PA 1FJGH 2HH3A 3GABA 4DV6H 1FKAH 1IBKH 3GKUA 4DUYH 4LFCH 2CTEA 3V69A 4LF5H 2YQRA 5IWAH 4AQYH 5LMNH 2UXBH 4B3RH 1WE8A 5JEAG 1XRHA 1DTJA 2JZXA 3GR5A 4QMFB 4AIMA 4DR6H 4OO1G 1XMQH 4DR1H 2K1HA 2VQEH
chains in the Genus database with same CATH topology
2QNDA 1ZTGA 4BA2I 4LIJA 2AXYA 2PY9A 4AM3A 4JVYA 2FMRA 1ZZIA 2CTLA 1DT4A 5K36G 2CTKA 2OPUA 3L7ZC 2NN6G 1EC6A 2MJHA 5C0XG 3AEVB 4IFDG 2JA9A 1VIHA 2CTJA 3U1KA 4WANA 2OPVA 2ANRA 4WALA 2CTFA 2Z0SA 2JEBI 3VKEA 1VIGA 4JVHA 2E3UA 1KHMA 2BL5A 2BA0A 2HH3A 1J5KA 1ZZKA 1ZZJA 2HH2A 2CTEA 3V69A 2JVZA 2CTMA 2YQRA 4BA1I 1J4WA 2CPQA 2DGRA 1WVNA 2P2RA 2JE6I 1WE8A 1X4NA 4NBQA 5JEAG 4B8TA 1DTJA 2JZXA 4QMFB 1TUAA 4AIMA 1K1GA 2PQUA 2ANNA 2JEAI 4OO1G 1X4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QND A;  1ZTG A;  4BA2 I;  4LIJ A;  2AXY A;  2PY9 A;  4AM3 A;  4JVY A;  2FMR A;  1ZZI A;  2CTL A;  1DT4 A;  5K36 G;  2CTK A;  2OPU A;  3L7Z C;  2NN6 G;  1EC6 A;  2MJH A;  5C0X G;  3AEV B;  4IFD G;  2JA9 A;  1VIH A;  2CTJ A;  3U1K A;  4WAN A;  2OPV A;  2ANR A;  4WAL A;  2CTF A;  2Z0S A;  2JEB I;  3VKE A;  1VIG A;  4JVH A;  2E3U A;  1KHM A;  2BL5 A;  2BA0 A;  2HH3 A;  1J5K A;  1ZZK A;  1ZZJ A;  2HH2 A;  2CTE A;  3V69 A;  2JVZ A;  2CTM A;  2YQR A;  4BA1 I;  1J4W A;  2CPQ A;  2DGR A;  1WVN A;  2P2R A;  2JE6 I;  1WE8 A;  1X4N A;  4NBQ A;  5JEA G;  4B8T A;  1DTJ A;  2JZX A;  4QMF B;  1TUA A;  4AIM A;  1K1G A;  2PQU A;  2ANN A;  2JEA I;  4OO1 G;  1X4M A; 
#chains in the Genus database with same CATH topology
 5BR8 H;  1IBL H;  2QND A;  3FAU A;  1IBM H;  4PDB A;  2X06 A;  2AXY A;  4JVY A;  2LRR A;  2FMR A;  4DV3 H;  5FLX W;  2ZQE A;  1I94 H;  3NCV A;  2D9I A;  3OTO H;  2UUC H;  2UXC H;  5K36 G;  2OPU A;  1HR0 H;  1S03 G;  3J81 W;  5C0X G;  4IFD G;  2CWH A;  1VIH A;  2CTJ A;  4E9J A;  3U1K A;  1X0A A;  1NXU A;  4B3S H;  2OPV A;  4DR7 H;  1VIG A;  4JVH A;  4LF8 H;  4JI3 H;  3RF2 A;  3J80 W;  4LF6 H;  4YHH H;  2F4V H;  4LF4 H;  1ZZJ A;  4DV2 H;  2E5L H;  1J5E H;  2FFM A;  2CPQ A;  2P2R A;  4JV5 H;  4DV0 H;  1S20 A;  4B8T A;  1Z2I A;  1K1G A;  2ANN A;  1XNQ H;  1WTJ A;  4DR3 H;  4B3M H;  4JI5 H;  4JI8 H;  2UUB H;  4LIJ A;  4H8A A;  3SB1 A;  4YY3 H;  1HNX H;  2CTL A;  2A1S A;  2UXD H;  1WHR A;  2PT7 G;  4GKJ H;  2JA9 A;  3OSS D;  3KDK A;  2UU9 H;  4X62 H;  4WAN A;  4FJU A;  3VKE A;  4JI4 H;  2JEB I;  2CWF A;  4JI1 H;  2E3U A;  3QD7 X;  4B8C D;  1KHM A;  2BL5 A;  2O4C A;  2BA0 A;  2VKC A;  2LF0 A;  2M8W A;  4K0K H;  3T1Y H;  4LF7 H;  4JI6 H;  2CTM A;  1J4W A;  2DGR A;  4NXN H;  2G8Y A;  1ODH A;  1UG8 A;  1X4N A;  1V9N A;  1XMO H;  1AN7 A;  2JEA I;  2FPH X;  3EZJ A;  1X4M A;  4X64 H;  1VBI A;  4OD6 A;  4DV1 H;  1HNW H;  4DR4 H;  1ZTG A;  1V8C A;  1N36 H;  4AM3 A;  1PQX A;  4DV5 H;  1F0X A;  1ZZI A;  3OET A;  5LL6 b;  4DR2 H;  1DT4 A;  1X9Z A;  3JAM W;  2VQF H;  3L7Z C;  4B3T H;  2NN6 G;  4JI0 H;  2M6Q A;  3J7A K;  4WAL A;  1I6U A;  2Z0S A;  2CPM A;  4LFA H;  1J5K A;  1ZZK A;  2HH2 A;  4X66 H;  4DR5 H;  1N32 H;  2JVZ A;  4BA1 I;  2ZM6 H;  1WVN A;  4G08 A;  4KHP H;  4GKK H;  1MSZ A;  4LF9 H;  2JE6 I;  5A2Q W;  4NBQ A;  5IT9 W;  4EC5 A;  1TUA A;  1HNZ H;  2PQU A;  2LTM A;  4LFB H;  4JI7 H;  2HHH H;  1SEI A;  1N33 H;  4BA2 I;  3KDG A;  1XNR H;  2PY9 A;  2UUA H;  2LTL A;  5DT9 A;  4DUZ H;  4FJS A;  3UOE A;  2CTK A;  4NZR M;  4DV4 H;  4JYA H;  1EC6 A;  2MJH A;  3AEV B;  3T1H H;  4NZT M;  4DV7 H;  2Y3M A;  4X65 H;  2ANR A;  4NXM H;  5LMU H;  2CTF A;  4OCH A;  4OX9 H;  4JI2 H;  1N34 H;  3I0P A;  1FJG H;  2HH3 A;  3GAB A;  4DV6 H;  1FKA H;  1IBK H;  3GKU A;  4DUY H;  4LFC H;  2CTE A;  3V69 A;  4LF5 H;  2YQR A;  5IWA H;  4AQY H;  5LMN H;  2UXB H;  4B3R H;  1WE8 A;  5JEA G;  1XRH A;  1DTJ A;  2JZX A;  3GR5 A;  4QMF B;  4AIM A;  4DR6 H;  4OO1 G;  1XMQ H;  4DR1 H;  2K1H A;  2VQE H; 
#chains in the Genus database with same CATH homology
 2QND A;  1ZTG A;  4BA2 I;  4LIJ A;  2AXY A;  2PY9 A;  4AM3 A;  4JVY A;  2FMR A;  1ZZI A;  2CTL A;  1DT4 A;  5K36 G;  2CTK A;  2OPU A;  3L7Z C;  2NN6 G;  1EC6 A;  2MJH A;  5C0X G;  3AEV B;  4IFD G;  2JA9 A;  1VIH A;  2CTJ A;  3U1K A;  4WAN A;  2OPV A;  2ANR A;  4WAL A;  2CTF A;  2Z0S A;  2JEB I;  3VKE A;  1VIG A;  4JVH A;  2E3U A;  1KHM A;  2BL5 A;  2BA0 A;  2HH3 A;  1J5K A;  1ZZK A;  1ZZJ A;  2HH2 A;  2CTE A;  3V69 A;  2JVZ A;  2CTM A;  2YQR A;  4BA1 I;  1J4W A;  2CPQ A;  2DGR A;  1WVN A;  2P2R A;  2JE6 I;  1WE8 A;  1X4N A;  4NBQ A;  5JEA G;  4B8T A;  1DTJ A;  2JZX A;  4QMF B;  1TUA A;  4AIM A;  1K1G A;  2PQU A;  2ANN A;  2JEA I;  4OO1 G;  1X4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...