2PQUA

Crystal structure of kh1 domain of human pcbp2 complexed to single-stranded 12-mer telomeric dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
72
structure length
72
Chain Sequence
KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12-mer C-rich strand of human telomeric DNA
publication title X-ray crystallographic and NMR studies of protein-protein and protein-nucleic acid interactions involving the KH domains from human poly(C)-binding protein-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna and dna binding protein/dna
total genus 17
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2pquA00
1TUAA 1WE8A 2JA9A 2CTKA 1ZZIA 2Z0SA 1X4NA 2PY9A 2AXYA 1X4MA 1J5KA 4WANA 2HH3A 2JEBI 2JEAI 1DT4A 4WALA 1VIHA 2HH2A 2ANNA 2YQRA 4NBQA 3L7ZC 2CPQA 4BA1I 3VKEA 2MJHA 3AEVB 2P2RA 4AM3A 5C0XG 3V69A 2JZXA 2OPVA 4JVYA 2CTFA 2E3UA 1ZZJA 1WVNA 5JEAG 1VIGA 1DTJA 2OPUA 4LIJA 1K1GA 1J4WA 4IFDG 4JVHA 2FMRA 2BL5A 1ZTGA 2DGRA 2CTEA 4QMFB 4B8TA 2JE6I 2CTJA 2ANRA 3U1KA 2NN6G 1EC6A 2PQUA 4BA2I 2JVZA 1KHMA 2QNDA 2CTLA 4AIMA 5K36G 2BA0A 2CTMA 1ZZKA 4OO1G
chains in the Genus database with same CATH superfamily
1V8CA 3OSSD 4B3MH 4JI5H 3RF2A 1XRHA 2O4CA 5IWAH 5A2QW 4AQYH 5FLXW 2VQEH 1ZZIA 2E5LH 2CPMA 4JI7H 4JI1H 1N32H 5BR8H 2HH3A 1DT4A 3QD7X 5LMUH 1N33H 3T1YH 2MJHA 1NXUA 4DR2H 2P2RA 4JI4H 4AM3A 3GABA 2CWHA 2VKCA 3J81W 2LTLA 2E3UA 2D9IA 2G8YA 4NXMH 4DR7H 4NXNH 4X64H 4DR4H 1V9NA 4QMFB 3NCVA 2ANRA 2ZM6H 4DV3H 4LF6H 2PT7G 1VBIA 1MSZA 5DT9A 4LFAH 3JAMW 1ZZKA 1SEIA 2K1HA 4JI8H 4DR5H 4H8AA 4G08A 4LF5H 2JA9A 4JI0H 4DV1H 4B3RH 4X66H 4GKJH 4JI6H 1HNWH 2UXBH 4DV2H 2A1SA 4DUYH 2JEBI 1ODHA 2UXCH 4LF9H 2JEAI 1I94H 2YQRA 4NBQA 3AEVB 2CPQA 3VKEA 3J7AK 5LL6b 3EZJA 4X65H 2JZXA 1X0AA 5C0XG 4DUZH 2UUCH 4B3SH 3T1HH 1ZZJA 4PDBA 3OTOH 1VIGA 2OPUA 4LIJA 2UUAH 1J4WA 1FKAH 1IBLH 1FJGH 4OX9H 4DR6H 4OD6A 4YHHH 4GKKH 1XNRH 4B8CD 2M8WA 1EC6A 2CTJA 3U1KA 2CWFA 4BA2I 2Y3MA 4K0KH 3J80W 1XMOH 4AIMA 1N34H 2CTMA 4B3TH 2ZQEA 4DV0H 2LTMA 1TUAA 3KDKA 4DV6H 2Z0SA 1X4NA 2PY9A 3OETA 1PQXA 1X4MA 1X9ZA 4NZRM 4X62H 4E9JA 3I0PA 4DV4H 4WALA 1VIHA 2HH2A 2ANNA 4LF8H 1XNQH 4BA1I 2X06A 4EC5A 4YY3H 4LFBH 4WANA 1ZTGA 1Z2IA 1WVNA 4FJUA 3KDGA 4JVHA 4LF4H 1HNXH 4LFCH 4JV5H 2M6QA 2BL5A 2FFMA 1J5EH 2DGRA 2LF0A 1S03G 2CTEA 3GR5A 4B8TA 2F4VH 2PQUA 2JVZA 1KHMA 2QNDA 4DR1H 2CTLA 4DV5H 2UU9H 5K36G 4OO1G 4FJSA 1IBMH 1WTJA 3V69A 4DR3H 4JI2H 2LRRA 4OCHA 3SB1A 2VQFH 1WE8A 1AN7A 2HHHH 2UXDH 2CTKA 4NZTM 1IBKH 2AXYA 5LMNH 1UG8A 3L7ZC 4DV7H 1N36H 4KHPH 2FPHX 5IT9W 3FAUA 3GKUA 2OPVA 1HNZH 4JVYA 3UOEA 4JI3H 2CTFA 4JYAH 1S20A 5JEAG 1DTJA 4IFDG 1K1GA 2FMRA 1I6UA 2JE6I 2NN6G 1WHRA 4LF7H 1XMQH 2BA0A 1J5KA 2UUBH 1F0XA 1HR0H
chains in the Genus database with same CATH topology
1TUAA 1WE8A 2JA9A 2CTKA 1ZZIA 2Z0SA 1X4NA 2PY9A 2AXYA 1X4MA 1J5KA 4WANA 2HH3A 2JEBI 2JEAI 1DT4A 4WALA 1VIHA 2HH2A 2ANNA 2YQRA 4NBQA 3L7ZC 2CPQA 4BA1I 3VKEA 2MJHA 3AEVB 2P2RA 4AM3A 5C0XG 3V69A 2JZXA 2OPVA 4JVYA 2CTFA 2E3UA 1ZZJA 1WVNA 5JEAG 1VIGA 1DTJA 2OPUA 4LIJA 1K1GA 1J4WA 4IFDG 4JVHA 2FMRA 2BL5A 1ZTGA 2DGRA 2CTEA 4QMFB 4B8TA 2JE6I 2CTJA 2ANRA 3U1KA 2NN6G 1EC6A 2PQUA 4BA2I 2JVZA 1KHMA 2QNDA 2CTLA 4AIMA 5K36G 2BA0A 2CTMA 1ZZKA 4OO1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TUA A;  1WE8 A;  2JA9 A;  2CTK A;  1ZZI A;  2Z0S A;  1X4N A;  2PY9 A;  2AXY A;  1X4M A;  1J5K A;  4WAN A;  2HH3 A;  2JEB I;  2JEA I;  1DT4 A;  4WAL A;  1VIH A;  2HH2 A;  2ANN A;  2YQR A;  4NBQ A;  3L7Z C;  2CPQ A;  4BA1 I;  3VKE A;  2MJH A;  3AEV B;  2P2R A;  4AM3 A;  5C0X G;  3V69 A;  2JZX A;  2OPV A;  4JVY A;  2CTF A;  2E3U A;  1ZZJ A;  1WVN A;  5JEA G;  1VIG A;  1DTJ A;  2OPU A;  4LIJ A;  1K1G A;  1J4W A;  4IFD G;  4JVH A;  2FMR A;  2BL5 A;  1ZTG A;  2DGR A;  2CTE A;  4QMF B;  4B8T A;  2JE6 I;  2CTJ A;  2ANR A;  3U1K A;  2NN6 G;  1EC6 A;  2PQU A;  4BA2 I;  2JVZ A;  1KHM A;  2QND A;  2CTL A;  4AIM A;  5K36 G;  2BA0 A;  2CTM A;  1ZZK A;  4OO1 G; 
#chains in the Genus database with same CATH topology
 1V8C A;  3OSS D;  4B3M H;  4JI5 H;  3RF2 A;  1XRH A;  2O4C A;  5IWA H;  5A2Q W;  4AQY H;  5FLX W;  2VQE H;  1ZZI A;  2E5L H;  2CPM A;  4JI7 H;  4JI1 H;  1N32 H;  5BR8 H;  2HH3 A;  1DT4 A;  3QD7 X;  5LMU H;  1N33 H;  3T1Y H;  2MJH A;  1NXU A;  4DR2 H;  2P2R A;  4JI4 H;  4AM3 A;  3GAB A;  2CWH A;  2VKC A;  3J81 W;  2LTL A;  2E3U A;  2D9I A;  2G8Y A;  4NXM H;  4DR7 H;  4NXN H;  4X64 H;  4DR4 H;  1V9N A;  4QMF B;  3NCV A;  2ANR A;  2ZM6 H;  4DV3 H;  4LF6 H;  2PT7 G;  1VBI A;  1MSZ A;  5DT9 A;  4LFA H;  3JAM W;  1ZZK A;  1SEI A;  2K1H A;  4JI8 H;  4DR5 H;  4H8A A;  4G08 A;  4LF5 H;  2JA9 A;  4JI0 H;  4DV1 H;  4B3R H;  4X66 H;  4GKJ H;  4JI6 H;  1HNW H;  2UXB H;  4DV2 H;  2A1S A;  4DUY H;  2JEB I;  1ODH A;  2UXC H;  4LF9 H;  2JEA I;  1I94 H;  2YQR A;  4NBQ A;  3AEV B;  2CPQ A;  3VKE A;  3J7A K;  5LL6 b;  3EZJ A;  4X65 H;  2JZX A;  1X0A A;  5C0X G;  4DUZ H;  2UUC H;  4B3S H;  3T1H H;  1ZZJ A;  4PDB A;  3OTO H;  1VIG A;  2OPU A;  4LIJ A;  2UUA H;  1J4W A;  1FKA H;  1IBL H;  1FJG H;  4OX9 H;  4DR6 H;  4OD6 A;  4YHH H;  4GKK H;  1XNR H;  4B8C D;  2M8W A;  1EC6 A;  2CTJ A;  3U1K A;  2CWF A;  4BA2 I;  2Y3M A;  4K0K H;  3J80 W;  1XMO H;  4AIM A;  1N34 H;  2CTM A;  4B3T H;  2ZQE A;  4DV0 H;  2LTM A;  1TUA A;  3KDK A;  4DV6 H;  2Z0S A;  1X4N A;  2PY9 A;  3OET A;  1PQX A;  1X4M A;  1X9Z A;  4NZR M;  4X62 H;  4E9J A;  3I0P A;  4DV4 H;  4WAL A;  1VIH A;  2HH2 A;  2ANN A;  4LF8 H;  1XNQ H;  4BA1 I;  2X06 A;  4EC5 A;  4YY3 H;  4LFB H;  4WAN A;  1ZTG A;  1Z2I A;  1WVN A;  4FJU A;  3KDG A;  4JVH A;  4LF4 H;  1HNX H;  4LFC H;  4JV5 H;  2M6Q A;  2BL5 A;  2FFM A;  1J5E H;  2DGR A;  2LF0 A;  1S03 G;  2CTE A;  3GR5 A;  4B8T A;  2F4V H;  2PQU A;  2JVZ A;  1KHM A;  2QND A;  4DR1 H;  2CTL A;  4DV5 H;  2UU9 H;  5K36 G;  4OO1 G;  4FJS A;  1IBM H;  1WTJ A;  3V69 A;  4DR3 H;  4JI2 H;  2LRR A;  4OCH A;  3SB1 A;  2VQF H;  1WE8 A;  1AN7 A;  2HHH H;  2UXD H;  2CTK A;  4NZT M;  1IBK H;  2AXY A;  5LMN H;  1UG8 A;  3L7Z C;  4DV7 H;  1N36 H;  4KHP H;  2FPH X;  5IT9 W;  3FAU A;  3GKU A;  2OPV A;  1HNZ H;  4JVY A;  3UOE A;  4JI3 H;  2CTF A;  4JYA H;  1S20 A;  5JEA G;  1DTJ A;  4IFD G;  1K1G A;  2FMR A;  1I6U A;  2JE6 I;  2NN6 G;  1WHR A;  4LF7 H;  1XMQ H;  2BA0 A;  1J5K A;  2UUB H;  1F0X A;  1HR0 H; 
#chains in the Genus database with same CATH homology
 1TUA A;  1WE8 A;  2JA9 A;  2CTK A;  1ZZI A;  2Z0S A;  1X4N A;  2PY9 A;  2AXY A;  1X4M A;  1J5K A;  4WAN A;  2HH3 A;  2JEB I;  2JEA I;  1DT4 A;  4WAL A;  1VIH A;  2HH2 A;  2ANN A;  2YQR A;  4NBQ A;  3L7Z C;  2CPQ A;  4BA1 I;  3VKE A;  2MJH A;  3AEV B;  2P2R A;  4AM3 A;  5C0X G;  3V69 A;  2JZX A;  2OPV A;  4JVY A;  2CTF A;  2E3U A;  1ZZJ A;  1WVN A;  5JEA G;  1VIG A;  1DTJ A;  2OPU A;  4LIJ A;  1K1G A;  1J4W A;  4IFD G;  4JVH A;  2FMR A;  2BL5 A;  1ZTG A;  2DGR A;  2CTE A;  4QMF B;  4B8T A;  2JE6 I;  2CTJ A;  2ANR A;  3U1K A;  2NN6 G;  1EC6 A;  2PQU A;  4BA2 I;  2JVZ A;  1KHM A;  2QND A;  2CTL A;  4AIM A;  5K36 G;  2BA0 A;  2CTM A;  1ZZK A;  4OO1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...