3J7AK

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
129
structure length
129
Chain Sequence
b'VRMSVLADCLKTINNAEKRGRRQVLIRPSSKVVIKFLQYMQKKGYIGSFEIVDDHRSGKIVVNLLGRINKCAVISPRYDVKLDEIEKIITSILPSRLFGHLILTTPYGIMDHEEARRKHTGGKVLGFFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
molecule tags Ribosome/inhibitor
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
total genus 30
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3j7aK01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3j7aK02
4X64H 2UUAH 4LF8H 5IWAH 1HNXH 2UXBH 4JI1H 4YHHH 1IBKH 3OTOH 4B3SH 3JAMW 2UXDH 2UXCH 4X62H 4DV5H 4LF9H 4K0KH 4DV3H 4JI0H 4DR6H 1AN7A 4DUZH 4DV4H 4DV0H 4LF4H 4LFCH 3J7AK 4JI4H 1N36H 1XMQH 1IBMH 4DR3H 4GKJH 2VQEH 1FJGH 1N32H 4JI3H 2UUCH 4JI7H 3J80W 4JI6H 3RF2A 4LF5H 5BR8H 4JV5H 4JI2H 1FKAH 4PDBA 1XNRH 1I94H 3T1HH 4B3RH 5LL6b 2UUBH 4DR5H 1HR0H 4AQYH 4JYAH 1SEIA 5FLXW 4LFAH 5IT9W 1HNWH 4LFBH 1IBLH 4DR1H 4DUYH 5LMNH 4X66H 4JI8H 1XNQH 4LF6H 3J81W 4X65H 4DV1H 4DV6H 2VQFH 1N33H 4KHPH 3T1YH 4LF7H 4NXNH 1XMOH 5A2QW 2UU9H 4DV7H 1HNZH 4B3TH 1S03G 4NXMH 1N34H 4OX9H 2F4VH 4B3MH 1J5EH 2ZM6H 2HHHH 4DR7H 4DR4H 1I6UA 4GKKH 2E5LH 4DR2H 4DV2H 4YY3H 4JI5H 5LMUH
chains in the Genus database with same CATH superfamily
5DG7A 2ALZA 4LF8H 2R87A 1B6SA 3HOWG 3H3VH 4HNUA 2VA3A 3H4BA 4U6PA 4FBTA 4JI1H 2QYZA 2NU8B 4YHHH 4BBSG 3OTOH 5EOYA 5F9NA 1Y1VA 4ZHQF 5I47A 2R8KA 4IAJA 3Q8SB 4OD6A 1M0WA 2YW2A 3SI8A 4A3JG 4X62H 2W57A 4UCVA 4RU9A 3BA9A 3MR5A 4LF9H 2CTMA 4TV9F 4YAJB 2XC9A 2W7PA 2UVRA 2LTMA 2P2RA 3RBEA 4NZRM 1KBLA 1VAJA 2R92G 5DQGA 2VUGA 1AN7A 4O3RA 2ZDGA 3GTQA 1GLVA 1RK5A 2R7LA 2FE3A 3RB6A 2QNDA 3AYHB 5KG3A 3Q8PB 3PW2A 5LOVF 2NVYA 1IBMH 4GKJH 4EGQA 2VQEH 3M4IA 1FJGH 4H8AA 5JH7F 1KC7A 2OWOA 4JI3H 2HJWA 4G08A 4J9QA 4JI7H 2R84A 3HOYG 1J4WA 1VS0A 4EBCA 1X4MA 4QMFB 4BBRG 3GQCA 4IRCA 4LF5H 2XGPA 3GTJA 2CTFA 3PR5B 3KHHA 2FKLA 2PVPA 3KAKA 3PW7A 4FBUA 2ASJA 4ETSA 3HKZA 1WCMA 4HYKA 4MTEA 2PMZE 4JI2H 4LH6A 1GSHA 2YQRA 1EZ1A 5KFZA 4BA2I 2XGQA 2ASDA 1XNRH 2R85A 4YAKB 4TQRA 3TIIA 2NU7B 1SYXB 2PT7G 2HVRA 1UNNC 4DL7A 1AUXA 3SE7A 2WB1E 2IMWP 5LL6b 1I7NA 5KFYA 5T14A 4MTDA 5EZYF 3RJ0A 2JA9A 2HVQA 4DR5H 2YZGA 1ZHSA 4ZI7F 2DWCA 1A9XA 4DL4A 2E2HA 2W6ZA 1B04A 2MJHA 4LFAH 1HNWH 1XRHA 1BGWA 4O4IF 3BJYA 4O2AF 3IN5A 2XCLA 2CWHA 4EBEA 3EZJA 4ED0A 2RDJA 1Y1WA 2PQUA 2JA6G 3HOVG 4RAZA 1BNCA 5FPRA 4RNOA 4M9UA 5KFDA 1Z2NX 4LSXA 4ECVA 4B8TA 1GSAA 1IOVA 2FFMA 3ETJA 4QIWE 5KFHA 2C2DA 2FPPB 3RAQA 4X66H 4OCHA 4EGJA 4JI8H 4IRDA 5C0XG 1XNQH 2HGSA 2V58A 3T5LA 2W6NA 4LF6H 1T94A 3GILA 3V6KA 3OUUA 4DV6H 2W9BB 1SCUB 4G3IA 3FMAA 3UQ8A 1ZHQA 3BQ0A 2OH2A 4KHPH 3T1YH 4LF7H 4APMA 3C0FB 4NXNH 4ED6A 1Z2OX 1ZQ7A 3HOZG 3Q8QB 2R8JA 1PX2A 4RZQA 4A2AA 2CPQA 4DV7H 4B3TH 1MSZA 2W70A 2V4RA 5JEAG 5CAEB 3M9OB 3GV8B 4QWEA 3G6YA 4EYIB 2ATLA 5LXTF 4EC5A 5IP7G 2F4VH 1ZZKA 2WAQA 3NGDA 3TQ1A 4A93G 2WB1A 3MJFA 4O3QA 4A3EG 4F4WA 5KT4A 1TWFA 4RZRA 3QZ7A 5LYJF 4EEYA 2V9WA 1RK6A 3RV4A 1RYSA 2ZDHA 2FB9A 3VPCA 2FMAA 1Y1VG 3BG5A 4ME6A 3U1KA 4O2BF 2UUAH 1EHIA 5KG1A 4UCRA 1P8LA 5EWFA 1DTJA 3RTXA 1Z2PX 4IR9A 2UXBH 5KG2A 2O03A 5KT3A 4FS2A 4RNMA 2Y0SA 3KAJA 1IBKH 4J9OA 2LTLA 1UC9A 5KFGA 3JAMW 5C3EG 2UXCH 2YZNA 4EEQA 3OSNA 5CB4F 1JX4A 4Q8FA 4MAMA 3RV3A 3MWEA 3GV7B 4ED2A 3M9NB 4ECQA 4ECXA 2E2IA 5FD5A 3QFFA 1C3OA 4O4HF 1JDEA 2NU9B 4JV0A 2WYOA 4JI0H 4RB2C 4I7HA 1E4EA 4HQ6A 5L9XA 5BPFA 1KJ9A 1KJJA 5KG5A 1E4GT 2W9AA 5KFOA 1TWAA 3H20A 5DLGA 4YR3A 2XIGA 1TWHA 3V69A 4A3MG 1S0OA 3OETA 4E9JA 2DGRA 5KFUA 4DL2A 2R8IA 1Y1WG 2ZQEA 2YZMA 5L1IA 1N36H 4AM3A 3K3PA 3GIIA 4GLXA 3PZPA 2HH3A 4FJUA 1KJQA 4MV4A 2W9CB 5DGAA 1VIGA 2P0AA 2NUAB 3SB1A 4RB0A 2UUCH 2BQRA 1WR2A 3H0GG 5KFPA 2DPIA 1W93A 3BQ1A 4MA0A 4JI6H 4BXXG 3GTLA 1BXRA 4NLGA 4JV5H 4DL3A 2AQ4A 5D1OA 5CA0F 4EFEA 2DZDA 2BQ3A 3GTOA 5JUMA 5BPHA 5LA6F 1PQXA 2M8WA 2GLTA 1FKAH 3WNZA 3OHBA 1WTJA 3HBLA 4CC6A 3OHAA 2B63A 4XZ3B 5IYCG 4J9RA 2CTLA 1RJRA 1I94H 4YB8B 5EWEA 3TQTA 3ORRA 3T1HH 5KKNB 5KFKA 4RAYA 2PMZA 2FPHX 2CTKA 3PR4A 4WD3A 2UUBH 1B6RA 1N48A 5JVDF 4IZOA 1FVIA 1K1QA 5KFXA 1HR0H 2CW8A 4HR7A 4F4ZA 5C5JA 3T5JA 3UFXB 4AQYH 4JYAH 5FPOA 1DT4A 1S20A 3KHRA 4ECRA 1R9TA 2C35B 4DL5A 5EDWA 2G8YA 3PW5A 2PN1A 4DR1H 3GIPA 3BA8A 3KTMA 2V5AA 3G8CA 4QW8A 1S9FA 2I87A 1K1SA 2R82A 4FM9A 5CA1F 3I4NG 3T5HA 1JDBB 4RUAA 2JEBI 4A3BG 1PK8A 4O3NA 3BABA 2W8KA 3E5NA 4J9NA 5JQWA 2VR1A 2M6QA 4ECTA 3EPIA 3AEVB 1CQIB 3RB0A 1L2ZA 4A3KG 3GABA 5KFCA 2Z0SA 2R86A 3KHGA 5IYDG 2AU0A 1N33H 3N6XA 4IWXA 3VMMA 1GO3E 4EBDA 5KFQA 2PBZA 3ETHA 3R5FA 3MR3A 4J9PA 4GC6A 1WSCA 4LH7A 5KT6A 1IOWA 2R7MA 1WH2A 3GIDA 2UU9H 4MV7A 3FKIG 4UFZA 1HNZH 5KG4A 3PVXA 4AYBE 1TA8A 2WE6A 3GR5A 2Y0SE 3V6JA 2JA6A 1DGSA 1S10A 4QWCA 4YQWA 3JSLA 3N43B 1BJTA 4RB3C 2D9IA 4B3MH 1TWCA 4Q43A 2SCUB 4DR7H 5LP6F 1X9ZA 2JE6I 3OUZA 2V4QA 2RGRA 2CTJA 3RUPA 5KG0A 5FLMG 4M7EA 2GPWA 4GKKH 1V9PA 4YJ2F 3KDKA 2CQYA 4LMYA 4I55F 4EFBA 4YY3H 3NCVA 4QIWA 2R6FA 4MV6A 4F4YA 2W6QA 2O4CA 3QD7X 3GLKA 4J0MA 4UCUA 2W7OA 5IYZF 5L1KA 3I12A 2FLPA 2VUMG 5IWAH 1CE8A 4A2BA 1HNXH 4UCSA 5KT2A 2IBKA 3GTGA 2YS7A 4A3CG 5DQIA 2WTFA 3UOEA 1Z2IA 1OWTA 4YJ3F 1WCMG 2CW7A 2UXDH 3G6VA 1C30A 5C1PA 3GIKA 3L2PA 5L1JA 3GTMA 1KJ8A 5K36G 4J9SA 4JV1A 5C4XG 3F8NA 2LF0A 4TUYF 4OO1G 3BAAA 5D1PA 4TQSA 4K0KH 1DV1A 3HXLA 4DV3H 5KG7A 4RUCA 3RB3A 4IRKA 4YR2A 3V6HA 1RJQA 2J6UA 2Q2UA 3JRXA 1M6VA 4B8CD 3RB4A 2VKCA 4ECYA 4DUZH 1M7JA 1TWGA 2FK3A 3K5HA 3MWMA 2C28A 4DV0H 4LF4H 2XD4A 2JA5G 1VIHA 5J2TF 3EYYA 4CC5A 3H4DA 1XMQH 2CPMA 2AXYA 3MFIA 5KFJA 3GIJA 4U7CA 2R7ZA 5KFNA 1N32H 1V4YA 1RYRA 2J6SA 5FD6A 4IHJF 1WHRA 5DT9A 4JVYA 3Q1KA 3PO2G 2C2EA 3WO1A 4AIMA 3J80W 1J5KA 3RF2A 1B33N 2J9GA 1NXUA 5BR8H 5KG6A 2HH2A 4A3IG 3R5XA 3VPBA 1DV2A 2VOBA 2FP4B 2R7ZG 2I8CA 2VA2A 2JA5A 4GC7A 3FKIA 4O3PA 2YU9A 3L4JA 3EPGA 3GKUA 3HKZE 4Q0YA 3ORQA 4YBZB 4QWDA 5KT5A 3RGXA 4JVHA 3CVZA 3DF7A 1JXLA 5HV6A 2DLNA 3N42B 2OLSA 3JSNA 1JIHA 1V51A 3KXYT 5KFWA 4DL6A 4I4TF 1E4EB 2PY9A 2FPIB 5J2UF 1ZZIA 5BMVF 4AYBA 2BQUA 2UVVA 2FMRA 4BWSC 1SEIA 5IT9W 1KEEA 1S0NA 1EC6A 2JEFA 3I4MG 4XYLB 1A0IA 5KFEA 1K1GA 5KFBA 1GYFA 3R5HA 2ASLA 1ULZA 4UCOA 4F50A 2NU6B 4I50F 1JLLB 2KSWA 3JRWA 4Y8VB 1VBIA 4A3DG 2QK4A 5DG9A 2R8GA 3H0GA 4JV2A 3J81W 3PW0A 4A3LG 4QWAA 4DV1H 2JVZA 3RAXA 2JEGA 2YRXA 5DGBA 2RGVA 3KHLA 1WE8A 4UCTA 2FLNA 2Y3MA 1RJPA 1F0XA 1SFOA 5KFSA 1M0TA 2B63G 4MA5A 3I0PA 2W71A 3N44B 4FU0A 1K83A 4ECWA 2JEJA 1AUVA 3OSPA 4NXMH 2YL2A 3IG0A 3LWBA 3LMLA 4LSAA 4R7RA 2UVWA 2RF4A 4MV9A 3JZIA 1CQJB 4YP3A 4OX9H 1I3QA 1X4NA 2K1HA 3L4KA 3RIZA 2R8HA 4MV8A 2M05A 1Y14B 5KFVA 1J5EH 1EUDB 3HOXG 3H40A 2HHHH 4J9KA 4Q8EA 3FDSA 2YYAA 2XCPA 5HBRB 2FK2A 2E5LH 2ZDQA 2WAQE 2X06A 2V59A 5LMUH 4ZOLF 1S0MA 4X64H 2I80A 3R23A 4EYHB 2BR0A 1I7LA 1VBGA 3V4ZA 5F9LA 5H80A 2IP4A 5KFRA 3TIGA 2JA7G 4B3SH 5C8YF 2CTEA 5KT7A 1KJIA 3BQ2A 2AGOA 4RB1A 2W8LA 1UG8A 1XDNA 4C5CA 5KFMA 5C44G 3GIMA 5D1OB 4DV5H 1S68A 4F4XA 5KFIA 2ZJTA 4NBQA 4DR6H 2WDTA 4TV8F 3T5KA 1TUAA 4DV4H 5JVLA 2CZGA 1T36A 2C22A 3L7ZC 1EYZA 4LFCH 1DIKA 4ED7A 4WALA 3J7AK 4WANA 4JI4H 1V8CA 3PN1A 4DR3H 1O75A 2AGPA 2YCHA 2JEIA 3N8DA 5IYBG 4FS1A 3M9MB 2J6TA 2OPVA 2CWFA 2UVUA 3OSSD 1VBHA 4QJFA 2NVXA 2R93G 2BL5A 2MCTA 3RFCA 3QZ8A 4DLKA 4LIJA 5KFLA 4NZTM 2C00A 5L1LA 4ED1A 3Q2OA 2R7KA 2Q2TA 5KFFA 2BA0A 2RDIA 2YRWA 2DPJA 4PWQA 4FJSA 4YR0A 4PDBA 2C2RA 3HB9A 4A3FG 4IR1A 5K2MA 4HNTA 2ANRA 4C2MA 2R93A 4B3RH 4QW9A 2OPUA 3MWDA 2W9CA 2JZXA 4C5AA 3GV5B 3K3VA 1ZZJA 2CKZB 5D8DA 4E4TA 4O4LF 3MFHA 3K5IA 4JUZA 4Q44A 2IA6A 2NN6G 4HNVA 1V9NA 4BY1G 2FK1A 2E3UA 1EUCB 1VKZA 5FLXW 1MZBA 5GONF 4LFBH 3WO0A 4MV1A 1IBLH 2FJZA 2GPSA 5EWGA 2FPGB 4BA1I 2W6PA 3LP8A 1ZETA 3GIQA 4ED3A 2A1SA 5KX5F 2HVSA 1KHMA 4DUYH 3VPDA 4J9LA 1E4FT 4ED8A 3GTPA 5KFTA 2R7NA 5FJ8G 5LMNH 4L1KA 1X9NA 3Q8RB 1ODHA 3U9SA 4IWYA 3MR6A 2YS6A 4XX0B 3N40P 5DQHA 4X65H 4IFDG 4R8UB 5C1OA 3V4SA 2FLLA 2W9BA 4O3OA 4ECZA 2VQFH 3U9TA 1CS0A 3CQZA 2VQDA 1GGOA 3RGZA 3PO3G 3TINA 1XMOH 3GTKA 1GSOA 4C5BA 1T3NA 2JA7A 1TAEA 2XCAA 4A3GG 5A2QW 2LRRA 4ECSA 3RBDA 4MV3A 1W96A 4XYMB 1S97A 1X0AA 1S03G 5DLFA 1N34H 2R92A 2VUMA 3G6XA 1N56A 4QWBA 2AGQA 4Q45A 3KDGA 1JKJB 5IP9G 4ZQIA 2JEAI 2VPSA 2W6MA 5KFAA 2VPQA 5DG8A 3MR2A 4ECUA 4RNNA 3HOUG 3KALA 2ZM6H 4BY7G 4WBNF 2X0SA 4DR4H 1WVNA 1I6UA 3N41B 1I50A 4J9MA 3FAUA 3VKEA 2DIKA 4DR2H 2ANNA 2W6OA 4DV2H 4R8UA 4EG0A 3PW4A 1ZTGA 1UC8A 4O3SA 2JA8G 4JI5H
chains in the Genus database with same CATH topology
4X64H 4J0MA 2O4CA 3QD7X 2UUAH 4LF8H 4UCUA 4UCRA 1P8LA 5IWAH 3RTXA 1HNXH 1Z2PX 4UCSA 4A2BA 2UXBH 2O03A 4JI1H 4YHHH 3KAJA 1IBKH 3OTOH 4B3SH 2CW7A 5EOYA 3JAMW 2UXDH 2UXCH 4EEQA 3L2PA 4IAJA 4RB1A 1XDNA 4OD6A 1M0WA 3F8NA 2LF0A 5D1OB 5FD5A 4X62H 4DV5H 2W57A 3BAAA 3BA9A 4UCVA 4LF9H 5D1PA 4K0KH 1S68A 3HXLA 4DV3H 2WYOA 2ZJTA 4JI0H 4RB2C 4I7HA 4DR6H 2WDTA 2Q2UA 4NZRM 4B8CD 1E4GT 2VKCA 1AN7A 2VUGA 4DUZH 4DV4H 3H20A 3MWMA 2FE3A 2XIGA 4DV0H 4LF4H 4LFCH 3OETA 4E9JA 3J7AK 2ZQEA 4JI4H 1N36H 3EYYA 4CC5A 1XMQH 3PN1A 1IBMH 4DR3H 4GKJH 4GLXA 1O75A 2VQEH 3M4IA 2YCHA 1FJGH 1N32H 2OWOA 4JI3H 3SB1A 4G08A 4RB0A 5FD6A 2UUCH 5DT9A 4JI7H 3OSSD 1VS0A 3J80W 4JI6H 3RF2A 4LF5H 2MCTA 4NZTM 5BR8H 3KAKA 4JV5H 4ETSA 2VOBA 5D1OA 4EFEA 2Q2TA 4MTEA 4JI2H 4LH6A 1FKAH 4PDBA 1XNRH 4CC6A 3L4JA 4Q0YA 1I94H 1SYXB 3RGXA 2PT7G 3CVZA 3DF7A 2HVRA 3T1HH 3N42B 4B3RH 4RAYA 2FPHX 5LL6b 3JSNA 4MTDA 3KXYT 3RJ0A 2UUBH 2HVQA 4DR5H 1FVIA 3K3VA 1HR0H 2CW8A 1ZHSA 4AQYH 4JYAH 5FPOA 4BWSC 1B04A 1SEIA 5FLXW 4LFAH 5IT9W 1HNWH 1BGWA 1MZBA 4LFBH 1IBLH 1A0IA 3EZJA 1GYFA 4DR1H 3BA8A 4RAZA 5FPRA 4UCOA 2HVSA 1Z2NX 4LSXA 4DUYH 2KSWA 4FM9A 1E4FT 1X9NA 5LMNH 4X66H 4OCHA 3BABA 1ODHA 4JI8H 1XNQH 2HGSA 3N40P 4LF6H 3J81W 4X65H 1L2ZA 4DV1H 3GABA 4DV6H 2RGVA 3FMAA 1ZHQA 2VQFH 3UQ8A 1N33H 4KHPH 3T1YH 2Y3MA 4LF7H 3N6XA 1F0XA 4NXNH 3C0FB 4UCTA 4APMA 1Z2OX 3RGZA 1XMOH 1M0TA 1TAEA 4LH7A 5A2QW 4RZQA 1WH2A 3N44B 2UU9H 4MV7A 4UFZA 4DV7H 1HNZH 4B3TH 4A2AA 1TA8A 1S03G 4NXMH 3IG0A 1N34H 3GR5A 2WE6A 3LMLA 4R7RA 4LSAA 4MV9A 1DGSA 3L4KA 3KDGA 4OX9H 4EC5A 2F4VH 2VPSA 3JSLA 1BJTA 3N43B 3RIZA 2D9IA 1J5EH 4B3MH 4RB3C 3KALA 2ZM6H 2HHHH 1X9ZA 4DR7H 4M7EA 4DR4H 1I6UA 3N41B 4GKKH 1V9PA 2RGRA 3FAUA 2E5LH 3KDKA 4DR2H 4LMYA 4DV2H 4EFBA 4YY3H 4JI5H 3NCVA 5LMUH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 H;  2UUA H;  4LF8 H;  5IWA H;  1HNX H;  2UXB H;  4JI1 H;  4YHH H;  1IBK H;  3OTO H;  4B3S H;  3JAM W;  2UXD H;  2UXC H;  4X62 H;  4DV5 H;  4LF9 H;  4K0K H;  4DV3 H;  4JI0 H;  4DR6 H;  1AN7 A;  4DUZ H;  4DV4 H;  4DV0 H;  4LF4 H;  4LFC H;  3J7A K;  4JI4 H;  1N36 H;  1XMQ H;  1IBM H;  4DR3 H;  4GKJ H;  2VQE H;  1FJG H;  1N32 H;  4JI3 H;  2UUC H;  4JI7 H;  3J80 W;  4JI6 H;  3RF2 A;  4LF5 H;  5BR8 H;  4JV5 H;  4JI2 H;  1FKA H;  4PDB A;  1XNR H;  1I94 H;  3T1H H;  4B3R H;  5LL6 b;  2UUB H;  4DR5 H;  1HR0 H;  4AQY H;  4JYA H;  1SEI A;  5FLX W;  4LFA H;  5IT9 W;  1HNW H;  4LFB H;  1IBL H;  4DR1 H;  4DUY H;  5LMN H;  4X66 H;  4JI8 H;  1XNQ H;  4LF6 H;  3J81 W;  4X65 H;  4DV1 H;  4DV6 H;  2VQF H;  1N33 H;  4KHP H;  3T1Y H;  4LF7 H;  4NXN H;  1XMO H;  5A2Q W;  2UU9 H;  4DV7 H;  1HNZ H;  4B3T H;  1S03 G;  4NXM H;  1N34 H;  4OX9 H;  2F4V H;  4B3M H;  1J5E H;  2ZM6 H;  2HHH H;  4DR7 H;  4DR4 H;  1I6U A;  4GKK H;  2E5L H;  4DR2 H;  4DV2 H;  4YY3 H;  4JI5 H;  5LMU H; 
#chains in the Genus database with same CATH topology
 5DG7 A;  2ALZ A;  4LF8 H;  2R87 A;  1B6S A;  3HOW G;  3H3V H;  4HNU A;  2VA3 A;  3H4B A;  4U6P A;  4FBT A;  4JI1 H;  2QYZ A;  2NU8 B;  4YHH H;  4BBS G;  3OTO H;  5EOY A;  5F9N A;  1Y1V A;  4ZHQ F;  5I47 A;  2R8K A;  4IAJ A;  3Q8S B;  4OD6 A;  1M0W A;  2YW2 A;  3SI8 A;  4A3J G;  4X62 H;  2W57 A;  4UCV A;  4RU9 A;  3BA9 A;  3MR5 A;  4LF9 H;  2CTM A;  4TV9 F;  4YAJ B;  2XC9 A;  2W7P A;  2UVR A;  2LTM A;  2P2R A;  3RBE A;  4NZR M;  1KBL A;  1VAJ A;  2R92 G;  5DQG A;  2VUG A;  1AN7 A;  4O3R A;  2ZDG A;  3GTQ A;  1GLV A;  1RK5 A;  2R7L A;  2FE3 A;  3RB6 A;  2QND A;  3AYH B;  5KG3 A;  3Q8P B;  3PW2 A;  5LOV F;  2NVY A;  1IBM H;  4GKJ H;  4EGQ A;  2VQE H;  3M4I A;  1FJG H;  4H8A A;  5JH7 F;  1KC7 A;  2OWO A;  4JI3 H;  2HJW A;  4G08 A;  4J9Q A;  4JI7 H;  2R84 A;  3HOY G;  1J4W A;  1VS0 A;  4EBC A;  1X4M A;  4QMF B;  4BBR G;  3GQC A;  4IRC A;  4LF5 H;  2XGP A;  3GTJ A;  2CTF A;  3PR5 B;  3KHH A;  2FKL A;  2PVP A;  3KAK A;  3PW7 A;  4FBU A;  2ASJ A;  4ETS A;  3HKZ A;  1WCM A;  4HYK A;  4MTE A;  2PMZ E;  4JI2 H;  4LH6 A;  1GSH A;  2YQR A;  1EZ1 A;  5KFZ A;  4BA2 I;  2XGQ A;  2ASD A;  1XNR H;  2R85 A;  4YAK B;  4TQR A;  3TII A;  2NU7 B;  1SYX B;  2PT7 G;  2HVR A;  1UNN C;  4DL7 A;  1AUX A;  3SE7 A;  2WB1 E;  2IMW P;  5LL6 b;  1I7N A;  5KFY A;  5T14 A;  4MTD A;  5EZY F;  3RJ0 A;  2JA9 A;  2HVQ A;  4DR5 H;  2YZG A;  1ZHS A;  4ZI7 F;  2DWC A;  1A9X A;  4DL4 A;  2E2H A;  2W6Z A;  1B04 A;  2MJH A;  4LFA H;  1HNW H;  1XRH A;  1BGW A;  4O4I F;  3BJY A;  4O2A F;  3IN5 A;  2XCL A;  2CWH A;  4EBE A;  3EZJ A;  4ED0 A;  2RDJ A;  1Y1W A;  2PQU A;  2JA6 G;  3HOV G;  4RAZ A;  1BNC A;  5FPR A;  4RNO A;  4M9U A;  5KFD A;  1Z2N X;  4LSX A;  4ECV A;  4B8T A;  1GSA A;  1IOV A;  2FFM A;  3ETJ A;  4QIW E;  5KFH A;  2C2D A;  2FPP B;  3RAQ A;  4X66 H;  4OCH A;  4EGJ A;  4JI8 H;  4IRD A;  5C0X G;  1XNQ H;  2HGS A;  2V58 A;  3T5L A;  2W6N A;  4LF6 H;  1T94 A;  3GIL A;  3V6K A;  3OUU A;  4DV6 H;  2W9B B;  1SCU B;  4G3I A;  3FMA A;  3UQ8 A;  1ZHQ A;  3BQ0 A;  2OH2 A;  4KHP H;  3T1Y H;  4LF7 H;  4APM A;  3C0F B;  4NXN H;  4ED6 A;  1Z2O X;  1ZQ7 A;  3HOZ G;  3Q8Q B;  2R8J A;  1PX2 A;  4RZQ A;  4A2A A;  2CPQ A;  4DV7 H;  4B3T H;  1MSZ A;  2W70 A;  2V4R A;  5JEA G;  5CAE B;  3M9O B;  3GV8 B;  4QWE A;  3G6Y A;  4EYI B;  2ATL A;  5LXT F;  4EC5 A;  5IP7 G;  2F4V H;  1ZZK A;  2WAQ A;  3NGD A;  3TQ1 A;  4A93 G;  2WB1 A;  3MJF A;  4O3Q A;  4A3E G;  4F4W A;  5KT4 A;  1TWF A;  4RZR A;  3QZ7 A;  5LYJ F;  4EEY A;  2V9W A;  1RK6 A;  3RV4 A;  1RYS A;  2ZDH A;  2FB9 A;  3VPC A;  2FMA A;  1Y1V G;  3BG5 A;  4ME6 A;  3U1K A;  4O2B F;  2UUA H;  1EHI A;  5KG1 A;  4UCR A;  1P8L A;  5EWF A;  1DTJ A;  3RTX A;  1Z2P X;  4IR9 A;  2UXB H;  5KG2 A;  2O03 A;  5KT3 A;  4FS2 A;  4RNM A;  2Y0S A;  3KAJ A;  1IBK H;  4J9O A;  2LTL A;  1UC9 A;  5KFG A;  3JAM W;  5C3E G;  2UXC H;  2YZN A;  4EEQ A;  3OSN A;  5CB4 F;  1JX4 A;  4Q8F A;  4MAM A;  3RV3 A;  3MWE A;  3GV7 B;  4ED2 A;  3M9N B;  4ECQ A;  4ECX A;  2E2I A;  5FD5 A;  3QFF A;  1C3O A;  4O4H F;  1JDE A;  2NU9 B;  4JV0 A;  2WYO A;  4JI0 H;  4RB2 C;  4I7H A;  1E4E A;  4HQ6 A;  5L9X A;  5BPF A;  1KJ9 A;  1KJJ A;  5KG5 A;  1E4G T;  2W9A A;  5KFO A;  1TWA A;  3H20 A;  5DLG A;  4YR3 A;  2XIG A;  1TWH A;  3V69 A;  4A3M G;  1S0O A;  3OET A;  4E9J A;  2DGR A;  5KFU A;  4DL2 A;  2R8I A;  1Y1W G;  2ZQE A;  2YZM A;  5L1I A;  1N36 H;  4AM3 A;  3K3P A;  3GII A;  4GLX A;  3PZP A;  2HH3 A;  4FJU A;  1KJQ A;  4MV4 A;  2W9C B;  5DGA A;  1VIG A;  2P0A A;  2NUA B;  3SB1 A;  4RB0 A;  2UUC H;  2BQR A;  1WR2 A;  3H0G G;  5KFP A;  2DPI A;  1W93 A;  3BQ1 A;  4MA0 A;  4JI6 H;  4BXX G;  3GTL A;  1BXR A;  4NLG A;  4JV5 H;  4DL3 A;  2AQ4 A;  5D1O A;  5CA0 F;  4EFE A;  2DZD A;  2BQ3 A;  3GTO A;  5JUM A;  5BPH A;  5LA6 F;  1PQX A;  2M8W A;  2GLT A;  1FKA H;  3WNZ A;  3OHB A;  1WTJ A;  3HBL A;  4CC6 A;  3OHA A;  2B63 A;  4XZ3 B;  5IYC G;  4J9R A;  2CTL A;  1RJR A;  1I94 H;  4YB8 B;  5EWE A;  3TQT A;  3ORR A;  3T1H H;  5KKN B;  5KFK A;  4RAY A;  2PMZ A;  2FPH X;  2CTK A;  3PR4 A;  4WD3 A;  2UUB H;  1B6R A;  1N48 A;  5JVD F;  4IZO A;  1FVI A;  1K1Q A;  5KFX A;  1HR0 H;  2CW8 A;  4HR7 A;  4F4Z A;  5C5J A;  3T5J A;  3UFX B;  4AQY H;  4JYA H;  5FPO A;  1DT4 A;  1S20 A;  3KHR A;  4ECR A;  1R9T A;  2C35 B;  4DL5 A;  5EDW A;  2G8Y A;  3PW5 A;  2PN1 A;  4DR1 H;  3GIP A;  3BA8 A;  3KTM A;  2V5A A;  3G8C A;  4QW8 A;  1S9F A;  2I87 A;  1K1S A;  2R82 A;  4FM9 A;  5CA1 F;  3I4N G;  3T5H A;  1JDB B;  4RUA A;  2JEB I;  4A3B G;  1PK8 A;  4O3N A;  3BAB A;  2W8K A;  3E5N A;  4J9N A;  5JQW A;  2VR1 A;  2M6Q A;  4ECT A;  3EPI A;  3AEV B;  1CQI B;  3RB0 A;  1L2Z A;  4A3K G;  3GAB A;  5KFC A;  2Z0S A;  2R86 A;  3KHG A;  5IYD G;  2AU0 A;  1N33 H;  3N6X A;  4IWX A;  3VMM A;  1GO3 E;  4EBD A;  5KFQ A;  2PBZ A;  3ETH A;  3R5F A;  3MR3 A;  4J9P A;  4GC6 A;  1WSC A;  4LH7 A;  5KT6 A;  1IOW A;  2R7M A;  1WH2 A;  3GID A;  2UU9 H;  4MV7 A;  3FKI G;  4UFZ A;  1HNZ H;  5KG4 A;  3PVX A;  4AYB E;  1TA8 A;  2WE6 A;  3GR5 A;  2Y0S E;  3V6J A;  2JA6 A;  1DGS A;  1S10 A;  4QWC A;  4YQW A;  3JSL A;  3N43 B;  1BJT A;  4RB3 C;  2D9I A;  4B3M H;  1TWC A;  4Q43 A;  2SCU B;  4DR7 H;  5LP6 F;  1X9Z A;  2JE6 I;  3OUZ A;  2V4Q A;  2RGR A;  2CTJ A;  3RUP A;  5KG0 A;  5FLM G;  4M7E A;  2GPW A;  4GKK H;  1V9P A;  4YJ2 F;  3KDK A;  2CQY A;  4LMY A;  4I55 F;  4EFB A;  4YY3 H;  3NCV A;  4QIW A;  2R6F A;  4MV6 A;  4F4Y A;  2W6Q A;  2O4C A;  3QD7 X;  3GLK A;  4J0M A;  4UCU A;  2W7O A;  5IYZ F;  5L1K A;  3I12 A;  2FLP A;  2VUM G;  5IWA H;  1CE8 A;  4A2B A;  1HNX H;  4UCS A;  5KT2 A;  2IBK A;  3GTG A;  2YS7 A;  4A3C G;  5DQI A;  2WTF A;  3UOE A;  1Z2I A;  1OWT A;  4YJ3 F;  1WCM G;  2CW7 A;  2UXD H;  3G6V A;  1C30 A;  5C1P A;  3GIK A;  3L2P A;  5L1J A;  3GTM A;  1KJ8 A;  5K36 G;  4J9S A;  4JV1 A;  5C4X G;  3F8N A;  2LF0 A;  4TUY F;  4OO1 G;  3BAA A;  5D1P A;  4TQS A;  4K0K H;  1DV1 A;  3HXL A;  4DV3 H;  5KG7 A;  4RUC A;  3RB3 A;  4IRK A;  4YR2 A;  3V6H A;  1RJQ A;  2J6U A;  2Q2U A;  3JRX A;  1M6V A;  4B8C D;  3RB4 A;  2VKC A;  4ECY A;  4DUZ H;  1M7J A;  1TWG A;  2FK3 A;  3K5H A;  3MWM A;  2C28 A;  4DV0 H;  4LF4 H;  2XD4 A;  2JA5 G;  1VIH A;  5J2T F;  3EYY A;  4CC5 A;  3H4D A;  1XMQ H;  2CPM A;  2AXY A;  3MFI A;  5KFJ A;  3GIJ A;  4U7C A;  2R7Z A;  5KFN A;  1N32 H;  1V4Y A;  1RYR A;  2J6S A;  5FD6 A;  4IHJ F;  1WHR A;  5DT9 A;  4JVY A;  3Q1K A;  3PO2 G;  2C2E A;  3WO1 A;  4AIM A;  3J80 W;  1J5K A;  3RF2 A;  1B33 N;  2J9G A;  1NXU A;  5BR8 H;  5KG6 A;  2HH2 A;  4A3I G;  3R5X A;  3VPB A;  1DV2 A;  2VOB A;  2FP4 B;  2R7Z G;  2I8C A;  2VA2 A;  2JA5 A;  4GC7 A;  3FKI A;  4O3P A;  2YU9 A;  3L4J A;  3EPG A;  3GKU A;  3HKZ E;  4Q0Y A;  3ORQ A;  4YBZ B;  4QWD A;  5KT5 A;  3RGX A;  4JVH A;  3CVZ A;  3DF7 A;  1JXL A;  5HV6 A;  2DLN A;  3N42 B;  2OLS A;  3JSN A;  1JIH A;  1V51 A;  3KXY T;  5KFW A;  4DL6 A;  4I4T F;  1E4E B;  2PY9 A;  2FPI B;  5J2U F;  1ZZI A;  5BMV F;  4AYB A;  2BQU A;  2UVV A;  2FMR A;  4BWS C;  1SEI A;  5IT9 W;  1KEE A;  1S0N A;  1EC6 A;  2JEF A;  3I4M G;  4XYL B;  1A0I A;  5KFE A;  1K1G A;  5KFB A;  1GYF A;  3R5H A;  2ASL A;  1ULZ A;  4UCO A;  4F50 A;  2NU6 B;  4I50 F;  1JLL B;  2KSW A;  3JRW A;  4Y8V B;  1VBI A;  4A3D G;  2QK4 A;  5DG9 A;  2R8G A;  3H0G A;  4JV2 A;  3J81 W;  3PW0 A;  4A3L G;  4QWA A;  4DV1 H;  2JVZ A;  3RAX A;  2JEG A;  2YRX A;  5DGB A;  2RGV A;  3KHL A;  1WE8 A;  4UCT A;  2FLN A;  2Y3M A;  1RJP A;  1F0X A;  1SFO A;  5KFS A;  1M0T A;  2B63 G;  4MA5 A;  3I0P A;  2W71 A;  3N44 B;  4FU0 A;  1K83 A;  4ECW A;  2JEJ A;  1AUV A;  3OSP A;  4NXM H;  2YL2 A;  3IG0 A;  3LWB A;  3LML A;  4LSA A;  4R7R A;  2UVW A;  2RF4 A;  4MV9 A;  3JZI A;  1CQJ B;  4YP3 A;  4OX9 H;  1I3Q A;  1X4N A;  2K1H A;  3L4K A;  3RIZ A;  2R8H A;  4MV8 A;  2M05 A;  1Y14 B;  5KFV A;  1J5E H;  1EUD B;  3HOX G;  3H40 A;  2HHH H;  4J9K A;  4Q8E A;  3FDS A;  2YYA A;  2XCP A;  5HBR B;  2FK2 A;  2E5L H;  2ZDQ A;  2WAQ E;  2X06 A;  2V59 A;  5LMU H;  4ZOL F;  1S0M A;  4X64 H;  2I80 A;  3R23 A;  4EYH B;  2BR0 A;  1I7L A;  1VBG A;  3V4Z A;  5F9L A;  5H80 A;  2IP4 A;  5KFR A;  3TIG A;  2JA7 G;  4B3S H;  5C8Y F;  2CTE A;  5KT7 A;  1KJI A;  3BQ2 A;  2AGO A;  4RB1 A;  2W8L A;  1UG8 A;  1XDN A;  4C5C A;  5KFM A;  5C44 G;  3GIM A;  5D1O B;  4DV5 H;  1S68 A;  4F4X A;  5KFI A;  2ZJT A;  4NBQ A;  4DR6 H;  2WDT A;  4TV8 F;  3T5K A;  1TUA A;  4DV4 H;  5JVL A;  2CZG A;  1T36 A;  2C22 A;  3L7Z C;  1EYZ A;  4LFC H;  1DIK A;  4ED7 A;  4WAL A;  3J7A K;  4WAN A;  4JI4 H;  1V8C A;  3PN1 A;  4DR3 H;  1O75 A;  2AGP A;  2YCH A;  2JEI A;  3N8D A;  5IYB G;  4FS1 A;  3M9M B;  2J6T A;  2OPV A;  2CWF A;  2UVU A;  3OSS D;  1VBH A;  4QJF A;  2NVX A;  2R93 G;  2BL5 A;  2MCT A;  3RFC A;  3QZ8 A;  4DLK A;  4LIJ A;  5KFL A;  4NZT M;  2C00 A;  5L1L A;  4ED1 A;  3Q2O A;  2R7K A;  2Q2T A;  5KFF A;  2BA0 A;  2RDI A;  2YRW A;  2DPJ A;  4PWQ A;  4FJS A;  4YR0 A;  4PDB A;  2C2R A;  3HB9 A;  4A3F G;  4IR1 A;  5K2M A;  4HNT A;  2ANR A;  4C2M A;  2R93 A;  4B3R H;  4QW9 A;  2OPU A;  3MWD A;  2W9C A;  2JZX A;  4C5A A;  3GV5 B;  3K3V A;  1ZZJ A;  2CKZ B;  5D8D A;  4E4T A;  4O4L F;  3MFH A;  3K5I A;  4JUZ A;  4Q44 A;  2IA6 A;  2NN6 G;  4HNV A;  1V9N A;  4BY1 G;  2FK1 A;  2E3U A;  1EUC B;  1VKZ A;  5FLX W;  1MZB A;  5GON F;  4LFB H;  3WO0 A;  4MV1 A;  1IBL H;  2FJZ A;  2GPS A;  5EWG A;  2FPG B;  4BA1 I;  2W6P A;  3LP8 A;  1ZET A;  3GIQ A;  4ED3 A;  2A1S A;  5KX5 F;  2HVS A;  1KHM A;  4DUY H;  3VPD A;  4J9L A;  1E4F T;  4ED8 A;  3GTP A;  5KFT A;  2R7N A;  5FJ8 G;  5LMN H;  4L1K A;  1X9N A;  3Q8R B;  1ODH A;  3U9S A;  4IWY A;  3MR6 A;  2YS6 A;  4XX0 B;  3N40 P;  5DQH A;  4X65 H;  4IFD G;  4R8U B;  5C1O A;  3V4S A;  2FLL A;  2W9B A;  4O3O A;  4ECZ A;  2VQF H;  3U9T A;  1CS0 A;  3CQZ A;  2VQD A;  1GGO A;  3RGZ A;  3PO3 G;  3TIN A;  1XMO H;  3GTK A;  1GSO A;  4C5B A;  1T3N A;  2JA7 A;  1TAE A;  2XCA A;  4A3G G;  5A2Q W;  2LRR A;  4ECS A;  3RBD A;  4MV3 A;  1W96 A;  4XYM B;  1S97 A;  1X0A A;  1S03 G;  5DLF A;  1N34 H;  2R92 A;  2VUM A;  3G6X A;  1N56 A;  4QWB A;  2AGQ A;  4Q45 A;  3KDG A;  1JKJ B;  5IP9 G;  4ZQI A;  2JEA I;  2VPS A;  2W6M A;  5KFA A;  2VPQ A;  5DG8 A;  3MR2 A;  4ECU A;  4RNN A;  3HOU G;  3KAL A;  2ZM6 H;  4BY7 G;  4WBN F;  2X0S A;  4DR4 H;  1WVN A;  1I6U A;  3N41 B;  1I50 A;  4J9M A;  3FAU A;  3VKE A;  2DIK A;  4DR2 H;  2ANN A;  2W6O A;  4DV2 H;  4R8U A;  4EG0 A;  3PW4 A;  1ZTG A;  1UC8 A;  4O3S A;  2JA8 G;  4JI5 H; 
#chains in the Genus database with same CATH homology
 4X64 H;  4J0M A;  2O4C A;  3QD7 X;  2UUA H;  4LF8 H;  4UCU A;  4UCR A;  1P8L A;  5IWA H;  3RTX A;  1HNX H;  1Z2P X;  4UCS A;  4A2B A;  2UXB H;  2O03 A;  4JI1 H;  4YHH H;  3KAJ A;  1IBK H;  3OTO H;  4B3S H;  2CW7 A;  5EOY A;  3JAM W;  2UXD H;  2UXC H;  4EEQ A;  3L2P A;  4IAJ A;  4RB1 A;  1XDN A;  4OD6 A;  1M0W A;  3F8N A;  2LF0 A;  5D1O B;  5FD5 A;  4X62 H;  4DV5 H;  2W57 A;  3BAA A;  3BA9 A;  4UCV A;  4LF9 H;  5D1P A;  4K0K H;  1S68 A;  3HXL A;  4DV3 H;  2WYO A;  2ZJT A;  4JI0 H;  4RB2 C;  4I7H A;  4DR6 H;  2WDT A;  2Q2U A;  4NZR M;  4B8C D;  1E4G T;  2VKC A;  1AN7 A;  2VUG A;  4DUZ H;  4DV4 H;  3H20 A;  3MWM A;  2FE3 A;  2XIG A;  4DV0 H;  4LF4 H;  4LFC H;  3OET A;  4E9J A;  3J7A K;  2ZQE A;  4JI4 H;  1N36 H;  3EYY A;  4CC5 A;  1XMQ H;  3PN1 A;  1IBM H;  4DR3 H;  4GKJ H;  4GLX A;  1O75 A;  2VQE H;  3M4I A;  2YCH A;  1FJG H;  1N32 H;  2OWO A;  4JI3 H;  3SB1 A;  4G08 A;  4RB0 A;  5FD6 A;  2UUC H;  5DT9 A;  4JI7 H;  3OSS D;  1VS0 A;  3J80 W;  4JI6 H;  3RF2 A;  4LF5 H;  2MCT A;  4NZT M;  5BR8 H;  3KAK A;  4JV5 H;  4ETS A;  2VOB A;  5D1O A;  4EFE A;  2Q2T A;  4MTE A;  4JI2 H;  4LH6 A;  1FKA H;  4PDB A;  1XNR H;  4CC6 A;  3L4J A;  4Q0Y A;  1I94 H;  1SYX B;  3RGX A;  2PT7 G;  3CVZ A;  3DF7 A;  2HVR A;  3T1H H;  3N42 B;  4B3R H;  4RAY A;  2FPH X;  5LL6 b;  3JSN A;  4MTD A;  3KXY T;  3RJ0 A;  2UUB H;  2HVQ A;  4DR5 H;  1FVI A;  3K3V A;  1HR0 H;  2CW8 A;  1ZHS A;  4AQY H;  4JYA H;  5FPO A;  4BWS C;  1B04 A;  1SEI A;  5FLX W;  4LFA H;  5IT9 W;  1HNW H;  1BGW A;  1MZB A;  4LFB H;  1IBL H;  1A0I A;  3EZJ A;  1GYF A;  4DR1 H;  3BA8 A;  4RAZ A;  5FPR A;  4UCO A;  2HVS A;  1Z2N X;  4LSX A;  4DUY H;  2KSW A;  4FM9 A;  1E4F T;  1X9N A;  5LMN H;  4X66 H;  4OCH A;  3BAB A;  1ODH A;  4JI8 H;  1XNQ H;  2HGS A;  3N40 P;  4LF6 H;  3J81 W;  4X65 H;  1L2Z A;  4DV1 H;  3GAB A;  4DV6 H;  2RGV A;  3FMA A;  1ZHQ A;  2VQF H;  3UQ8 A;  1N33 H;  4KHP H;  3T1Y H;  2Y3M A;  4LF7 H;  3N6X A;  1F0X A;  4NXN H;  3C0F B;  4UCT A;  4APM A;  1Z2O X;  3RGZ A;  1XMO H;  1M0T A;  1TAE A;  4LH7 A;  5A2Q W;  4RZQ A;  1WH2 A;  3N44 B;  2UU9 H;  4MV7 A;  4UFZ A;  4DV7 H;  1HNZ H;  4B3T H;  4A2A A;  1TA8 A;  1S03 G;  4NXM H;  3IG0 A;  1N34 H;  3GR5 A;  2WE6 A;  3LML A;  4R7R A;  4LSA A;  4MV9 A;  1DGS A;  3L4K A;  3KDG A;  4OX9 H;  4EC5 A;  2F4V H;  2VPS A;  3JSL A;  1BJT A;  3N43 B;  3RIZ A;  2D9I A;  1J5E H;  4B3M H;  4RB3 C;  3KAL A;  2ZM6 H;  2HHH H;  1X9Z A;  4DR7 H;  4M7E A;  4DR4 H;  1I6U A;  3N41 B;  4GKK H;  1V9P A;  2RGR A;  3FAU A;  2E5L H;  3KDK A;  4DR2 H;  4LMY A;  4DV2 H;  4EFB A;  4YY3 H;  4JI5 H;  3NCV A;  5LMU H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...