3J7AK

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
129
structure length
129
Chain Sequence
VRMSVLADCLKTINNAEKRGRRQVLIRPSSKVVIKFLQYMQKKGYIGSFEIVDDHRSGKIVVNLLGRINKCAVISPRYDVKLDEIEKIITSILPSRLFGHLILTTPYGIMDHEEARRKHTGGKVLGFFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
molecule keywords 18S ribosomal RNA
total genus 30
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3j7aK01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3j7aK02
4DV7H 4LF7H 1SEIA 1HR0H 1IBMH 1XNQH 4JYAH 2F4VH 2UXCH 4KHPH 4K0KH 3RF2A 1N32H 4GKKH 2UUBH 4DUYH 4DV5H 1XMOH 1N36H 4LF4H 5FLXW 4DV4H 5LMUH 4JI3H 4DR2H 4DUZH 4X66H 4YHHH 4PDBA 2VQEH 5A2QW 1HNXH 3T1YH 4B3TH 2UXDH 4DR3H 4JI0H 4GKJH 5BR8H 2HHHH 3JAMW 4DR5H 4DR6H 1XMQH 4X64H 4JI4H 4B3SH 1S03G 5LL6b 4JV5H 4DV3H 1J5EH 4DR1H 4NXMH 1FJGH 3J7AK 4X62H 2E5LH 4LFCH 4JI2H 4DV6H 5LMNH 1I94H 5IT9W 3OTOH 4DV1H 4B3RH 4DR7H 1N33H 5IWAH 4LF9H 4JI1H 1I6UA 4LFAH 3J81W 1HNWH 2ZM6H 2UXBH 2VQFH 2UU9H 4LF8H 4AQYH 4JI7H 4YY3H 3J80W 1XNRH 1IBKH 4JI6H 4DV2H 4DV0H 4X65H 1AN7A 3T1HH 4JI5H 4LF6H 4LF5H 1N34H 1HNZH 4JI8H 4DR4H 4NXNH 1IBLH 1FKAH 4OX9H 4LFBH 2UUCH 2UUAH 4B3MH
chains in the Genus database with same CATH superfamily
2G8YA 4DV7H 3BJYA 1SEIA 3FKIG 4NZRM 4MA0A 3RJ0A 5KFSA 3GLKA 3N40P 3RV4A 2W9CB 4EG0A 4FS1A 1XNQH 3MR3A 4ECZA 3Q1KA 4TV9F 2XCAA 5D1OB 2VKCA 5D8DA 5C3EG 4UCSA 5L1KA 5KFNA 1IOVA 4O3OA 4IRKA 4ECYA 3U1KA 3RTXA 5DLFA 4A3MG 1N32H 1RJPA 4BBRG 2CTMA 2W6NA 2UUBH 2W7PA 3PN1A 1GSAA 3PW4A 2ZJTA 3GIIA 4J9NA 3NCVA 1TWHA 4ED6A 1VIHA 4LF4H 1VAJA 3GV5B 2V4QA 1M0TA 4FU0A 3WO0A 5JVDF 2JEIA 2WYOA 3RGZA 3SB1A 5KFBA 2CTJA 2CW7A 3LWBA 4M7EA 4U7CA 2SCUB 1RJRA 2VA3A 2DPJA 1WE8A 2JA6A 3HOXG 2CTKA 4RU9A 2K1HA 2NVXA 4JI0H 1S0NA 1V4YA 1W93A 5BR8H 1F0XA 5C4XG 3R5XA 3JAMW 4DR5H 4O4IF 1S9FA 4DR6H 1KHMA 4O2BF 1DGSA 4EFEA 2R7ZG 3ETHA 1WVNA 5LA6F 2W6QA 2W57A 5HV6A 2VUMG 4G08A 5L1LA 5BPHA 5LL6b 3GKUA 3VPBA 3JZIA 2QNDA 4H8AA 1SCUB 4J9SA 2C2RA 1M7JA 1BGWA 1CS0A 2GPWA 2R8IA 5D1PA 3BQ2A 3HOVG 1XDNA 2JA7G 5JH7F 1V51A 4IR9A 2CZGA 3M9NB 4R7RA 3GTGA 3G8CA 3PO2G 1J5KA 1KEEA 4LH6A 4DV6H 3EYYA 2OPVA 4YB8B 4B3RH 3IG0A 1L2ZA 4RAYA 3HKZA 1ZHQA 1T36A 2XIGA 3JRXA 3H20A 2VOBA 4RZRA 2YQRA 4NLGA 4LMYA 2FPHX 3N43B 5H80A 1B04A 5IWAH 5C44G 5FD5A 3TQ1A 4Q8FA 2AGPA 2ASJA 1N56A 5IP9G 4F4ZA 2JA7A 4I4TF 5EWGA 5DGBA 4ED0A 5F9LA 3AYHB 1I7LA 4F4WA 2M6QA 1JDEA 1A9XA 1E4EB 1ZTGA 2O03A 4MTDA 2YU9A 4EC5A 3GTQA 2JA8G 1T94A 4HNVA 4F4YA 1E4FT 4J9MA 5CB4F 3RB6A 4LF8H 3HOZG 2ZDGA 5DG7A 3N44B 2W6PA 1S97A 3KAJA 1BXRA 2VA2A 4YY3H 2FK1A 1FVIA 2I80A 3BA9A 3HXLA 1K1QA 2V59A 1ULZA 4IWYA 3PW2A 2R92A 2YZMA 5KG2A 4IAJA 2VQDA 3OSPA 3OHBA 3N6XA 4APMA 4DV2H 2Y0SE 4FJSA 5KFTA 3WNZA 4X65H 1ZHSA 5KG6A 5J2TF 4A3FG 1X9NA 4EBDA 2FB9A 2YRXA 3HOUG 3JSLA 3GTPA 3KHHA 2ZDQA 2JA9A 4BWSC 4LF5H 1DIKA 1N34H 1HNZH 2DIKA 4ZQIA 2W8LA 3V6KA 3I4MG 2R6FA 3KAKA 4A3BG 5KFGA 1BJTA 2AU0A 1WSCA 2NN6G 4J9QA 1PQXA 3GIMA 1FKAH 1CQJB 3V4ZA 4JV0A 1TA8A 2UUAH 4WANA 1E4GT 3GABA 3H40A 4EYHB 4LF7H 5KFRA 3TINA 4YAKB 1HR0H 1IBMH 5KT4A 4DL6A 3MWMA 4JYAH 1MSZA 2BQUA 2UXCH 2JA5A 2W8KA 5KT6A 4TQSA 1T3NA 2YCHA 5KFQA 3K5HA 2C2EA 3L7ZC 5KG1A 5JQWA 5J2UF 2ASLA 1TUAA 1P8LA 2FPIB 4CC6A 2C00A 2XCPA 4J9OA 4GKKH 2W6OA 1TAEA 4EGJA 5C5JA 1GGOA 2HJWA 3RB4A 3GR5A 5BPFA 5FPOA 2RGVA 4DV5H 5EWEA 4F4XA 4QIWA 2JA5G 1UC9A 2IBKA 1KJJA 4O3PA 1N36H 4IFDG 1W96A 2RF4A 4A2BA 3KHLA 2UVWA 3GTLA 3BABA 5LMUH 3GQCA 2DPIA 1Y1WA 5C0XG 2MCTA 5KKNB 5LOVF 2FKLA 4JI3H 1CQIB 3KTMA 5CA1F 3OUZA 4DUZH 1GSOA 1VBGA 5EZYF 3TIIA 4PDBA 4Q44A 3GIDA 2BR0A 2BL5A 2UVRA 3T1YH 4UFZA 2HVRA 2OWOA 2CTFA 4DR3H 1X4MA 4E9JA 4BY1G 3PW0A 5C1PA 4GKJH 4XYLB 4BBSG 2HGSA 1RK5A 5KG7A 5DQHA 4J9LA 4R8UA 1V9NA 2R7MA 4O4LF 4EBEA 4C5AA 3SI8A 3MFIA 1XMQH 5KFEA 2HVSA 1JLLB 4O4HF 2XD4A 1EHIA 5IYBG 2JEAI 5IYDG 1S20A 1S03G 5D1OA 3EPGA 4DV3H 3M9OB 2J6TA 1J5EH 4YR0A 4NXMH 2VUMA 2CQYA 1CE8A 1DV1A 2V5AA 4A93G 2R7ZA 2FMRA 3T5HA 1B6RA 3J7AK 2JE6I 2J9GA 2VPQA 3R5FA 4I7HA 4X62H 1UC8A 2E5LH 1PX2A 2FLLA 1I94H 3H4BA 5L1IA 2IA6A 4QWEA 4JV2A 2HVQA 2CWHA 2YZGA 3T5KA 3G6VA 4EEQA 2B63G 1KJQA 3KALA 2LRRA 4A3EG 2ZQEA 2XGQA 4LF9H 4JI1H 2BQ3A 3VPCA 5KFUA 1SFOA 2R87A 4LFAH 4YR2A 4ZHQF 4LSXA 2V58A 5EWFA 2WB1E 5JVLA 2I87A 2W9BA 2UXBH 2R93G 4LSAA 5KG0A 3QD7X 3BA8A 2HH2A 2QK4A 5DQIA 5DQGA 1V8CA 4GLXA 1RYSA 1JX4A 2R8JA 1Y14B 1XRHA 4A2AA 2W6MA 3KDKA 4B8CD 3PW7A 4A3KG 1DTJA 3HBLA 3RB0A 2Y3MA 4JI6H 1WH2A 3KXYT 3MR2A 4F50A 1ZETA 1KJ9A 4XX0B 5KFDA 4UCTA 2WAQE 5KG4A 1N48A 1ZZKA 3JSNA 2UVUA 5KFWA 4HR7A 4RUCA 3RBEA 1S10A 4JVHA 2WDTA 2LF0A 2YS6A 2W9CA 2PMZE 4QWDA 2MJHA 1JDBB 5JUMA 4NXNH 2W9AA 4JUZA 1J4WA 2JEGA 2DGRA 4XZ3B 2V9WA 4OX9H 4LFBH 4MV4A 4PWQA 5K2MA 4O3QA 5KT5A 3L4JA 4IRCA 2X06A 3BQ1A 2JEBI 1GYFA 2J6SA 1WTJA 3GIPA 4MAMA 4DLKA 4QWCA 4AYBA 4ME6A 4JVYA 4MV3A 3PZPA 3VMMA 2R7KA 4EYIB 4U6PA 4KHPH 4UCRA 1TWCA 3R23A 1I50A 4K0KH 3I4NG 4JV1A 1S0OA 1RYRA 4M9UA 4QWBA 5KFPA 4TQRA 5F9NA 3RAQA 2ANRA 3RV3A 5KFMA 1AUVA 3C0FB 5KT7A 4ED1A 4HYKA 4J9KA 4Q0YA 3RAXA 2FPPB 1XMOH 4IWXA 1R9TA 1A0IA 5KFXA 3ORQA 4DV4H 2ANNA 4RB0A 5DG9A 5IYCG 4J0MA 4YR3A 3OHAA 2P2RA 2YL2A 2ASDA 1JXLA 4C2MA 3FMAA 3K3PA 3PR4A 3VPDA 4ECXA 4QW9A 4MV8A 5C1OA 3PO3G 1Y1WG 2KSWA 5KFKA 4O3RA 2VQEH 1ZZJA 1HNXH 2PN1A 3OSSD 1M0WA 1EC6A 4QW8A 4O3NA 2UXDH 1VKZA 3N8DA 4QWAA 3KHGA 5FD6A 2M8WA 4WALA 4IZOA 1BNCA 5JEAG 2X0SA 4HNTA 2I8CA 2VPSA 3WO1A 1WCMG 3H3VH 5EDWA 2YS7A 2R8KA 2HHHH 5KFJA 2C35B 3F8NA 3G6YA 1Z2PX 4NBQA 3HKZE 2OPUA 2W70A 2R7LA 3M9MB 4ECRA 4X64H 1O75A 5KFYA 4ED8A 2UVVA 4JI4H 5DLGA 3MJFA 1ZQ7A 1VIGA 4DL4A 3V4SA 4UCVA 4RNOA 4ECUA 1GO3E 4FM9A 4A3GG 4AIMA 3MR6A 1K1SA 2M05A 2AGQA 2JEFA 5KG5A 4B8TA 1X0AA 2NVYA 3PR5B 2GPSA 4ED7A 3FAUA 2R93A 2LTLA 2PY9A 4HQ6A 1PK8A 5LMNH 5IT9W 3U9SA 3RIZA 3RBDA 4A3LG 4BA1I 3OTOH 4DV1H 5KFFA 4UCOA 2WTFA 3BQ0A 4DL7A 5EOYA 2Q2UA 4EBCA 1N33H 3U9TA 3E5NA 2QYZA 2FMAA 2AGOA 4QIWE 2CWFA 1EUDB 2FK3A 4MA5A 5KFOA 3TQTA 4Q8EA 1KJ8A 3LP8A 1ZZIA 4TUYF 3J81W 3V6HA 2R8GA 3CQZA 4ED3A 2IMWP 2YW2A 2CKZB 3GILA 5K36G 4A3CG 3QFFA 3MFHA 3JRWA 2OH2A 2AQ4A 5IYZF 4O3SA 4MV7A 5FJ8G 3GIKA 3T5LA 4IR1A 4O2AF 4C5CA 2FPGB 4AQYH 3K5IA 4YQWA 1WCMA 4OCHA 2R7NA 2JEJA 3OSNA 1RJQA 2CTLA 1KC7A 2PT7G 1C3OA 3NGDA 3I12A 1I7NA 3OETA 5HBRB 4NZTM 1IBKH 4HNUA 2R85A 2W9BB 3KHRA 2JA6G 4FBTA 4BXXG 2VR1A 4DV0H 5KFAA 3GIJA 1AN7A 1VS0A 3GV7B 3T1HH 2Z0SA 2RDIA 5DG8A 4I55F 4RB3C 4JI8H 3LMLA 4AM3A 2WAQA 1K1GA 2RDJA 1X4NA 1WR2A 3DF7A 3OUUA 4J9PA 5LXTF 2Q2TA 1VBHA 1B6SA 5DT9A 2FFMA 4WD3A 5KX5F 2PMZA 3ORRA 3MR5A 4ECWA 3RGXA 3UOEA 2NU9B 5KFVA 3L4KA 2R84A 4GC7A 3MWDA 2F4VH 4LH7A 3T5JA 4ECVA 4YJ3F 2R92G 2FE3A 4EFBA 1K83A 3RB3A 2FJZA 1IOWA 1VBIA 3GTMA 3RF2A 2DZDA 3UFXB 5KFLA 4YAJB 4E4TA 4I50F 4OD6A 3AEVB 5C8YF 3Q2OA 2YZNA 3N41B 3G6XA 3UQ8A 2C2DA 1GLVA 1JKJB 3GIQA 5GONF 4DUYH 2FK2A 3ETJA 4WBNF 2VUGA 4YP3A 3FDSA 5FLXW 4IHJF 1S68A 2R82A 3RUPA 1S0MA 2CPQA 4YJ2F 5IP7G 3R5HA 3Q8SB 5CA0F 2HH3A 4DR2H 5BMVF 4FS2A 2W7OA 2RGRA 2E2IA 4X66H 2YRWA 4YHHH 5I47A 5KT3A 1EYZA 3Q8QB 5A2QW 4DL3A 2XGPA 4B3TH 3CVZA 5CAEB 4EGQA 4RZQA 4ZOLF 4RB2C 1C30A 1E4EA 4FBUA 5LYJF 3QZ8A 4ETSA 2WE6A 3QZ7A 4G3IA 3PVXA 2V4RA 5L9XA 1B33N 5FPRA 2C28A 5KT2A 2PBZA 2FLPA 2JVZA 3GTKA 4ECTA 2Y0SA 4C5BA 1Z2IA 4B3SH 5KFHA 4MV1A 3GTJA 3SE7A 4QJFA 4JV5H 1SYXB 3GTOA 1JIHA 2PVPA 2O4CA 4DR1H 1WHRA 1FJGH 3H0GG 2BQRA 1DV2A 2ZDHA 3FKIA 4GC6A 1DT4A 1M6VA 2P0AA 1Z2NX 1V9PA 3V6JA 5KFIA 5KFZA 4A3DG 1KJIA 4BA2I 4LFCH 2ATLA 4UCUA 4Q45A 2NU7B 4JI2H 2XC9A 1AUXA 1EUCB 1Z2OX 5LP6F 4ED2A 1TWGA 2B63A 3I0PA 4RNNA 1EZ1A 5T14A 3HOYG 3Q8PB 1RK6A 2XCLA 3V69A 4DR7H 3Q8RB 5DGAA 3GV8B 4A3IG 2LTMA 2NU6B 2DWCA 4R8UB 4MV9A 4CC5A 1Y1VG 1I6UA 3PW5A 4L1KA 3H0GA 3K3VA 1OWTA 4LIJA 3VKEA 1HNWH 4A3JG 2JZXA 4J9RA 2CW8A 3RFCA 1I3QA 4FJUA 2ZM6H 4MV6A 2VQFH 4XYMB 2UU9H 4ECQA 3EZJA 2FLNA 2CPMA 4RAZA 4OO1G 2R86A 1TWAA 3M4IA 2NU8B 4ZI7F 4RUAA 2J6UA 4JI7H 3J80W 4YBZB 4MTEA 4BY7G 2FP4B 3L2PA 4RNMA 1TWFA 3KDGA 2R8HA 3HOWG 4ECSA 2E3UA 2W6ZA 1XNRH 1X9ZA 1ODHA 2W71A 3EPIA 4QMFB 3H4DA 4DL5A 5KG3A 4RB1A 2A1SA 2BA0A 4AYBE 5KFCA 1GSHA 1Y1VA 2DLNA 2IP4A 2NUAB 4IRDA 1KBLA 3TIGA 4EEYA 4JI5H 2WB1A 3MWEA 5FLMG 3IN5A 4DL2A 2OLSA 2C22A 4LF6H 3BAAA 4Q43A 4Y8VB 2E2HA 4TV8F 4DR4H 2AXYA 3HB9A 1UG8A 2ALZA 2GLTA 2D9IA 3N42B 1UNNC 1IBLH 3BG5A 2CTEA 2YYAA 1NXUA 2PQUA 2UUCH 1MZBA 5L1JA 4B3MH
chains in the Genus database with same CATH topology
4DV7H 3RGXA 4LF7H 1SEIA 4NZRM 3RJ0A 3L4KA 3N40P 1HR0H 1IBMH 1XNQH 3MWMA 4JYAH 2F4VH 4LH7A 5D1OB 2UXCH 2VKCA 4KHPH 2FE3A 4UCRA 4EFBA 4K0KH 4UCSA 2YCHA 3RF2A 4OD6A 1P8LA 3RTXA 1GYFA 3N41B 4CC6A 3C0FB 1N32H 4GKKH 3UQ8A 1TAEA 2UUBH 3GR5A 4DUYH 3PN1A 2RGVA 4DV5H 2ZJTA 4Q0YA 2VUGA 5FPOA 1XMOH 3NCVA 1N36H 4LF4H 1A0IA 5FLXW 4A2BA 4DV4H 4RB0A 3BABA 5LMUH 1S68A 4J0MA 1M0TA 3FMAA 2MCTA 4JI3H 2WYOA 3RGZA 3SB1A 4DR2H 2RGRA 4DUZH 4X66H 2CW7A 4YHHH 4PDBA 2KSWA 4M7EA 2VQEH 5A2QW 1HNXH 3OSSD 1M0WA 3T1YH 4B3TH 2UXDH 3CVZA 4UFZA 2HVRA 4RZQA 5FD6A 2OWOA 4RB2C 4DR3H 4E9JA 4JI0H 4GKJH 2HGSA 5BR8H 1F0XA 4B3MH 2VPSA 4ETSA 2HHHH 2WE6A 3JAMW 3F8NA 1Z2PX 4DR5H 4DR6H 1XMQH 4EFEA 1DGSA 5FPRA 2HVSA 4X64H 1O75A 4JI4H 2W57A 4B3SH 4G08A 1S03G 5D1OA 5LL6b 4JV5H 4DV3H 1SYXB 2O4CA 1J5EH 4DR1H 4NXMH 4UCVA 1FJGH 4FM9A 1BGWA 5D1PA 1Z2NX 1V9PA 1XDNA 3J7AK 4I7HA 4R7RA 4X62H 2E5LH 3FAUA 4LFCH 4UCUA 4JI2H 4DV6H 5LMNH 1I94H 5IT9W 3EYYA 4LH6A 3RIZA 1Z2OX 3OTOH 4DV1H 4B3RH 2HVQA 3IG0A 4RAYA 4UCOA 2Q2UA 1ZHQA 2XIGA 5EOYA 1L2ZA 3H20A 2VOBA 4EEQA 4DR7H 1N33H 4LMYA 2FPHX 3N43B 1B04A 5IWAH 3KALA 5FD5A 2ZQEA 4LF9H 4JI1H 4MV9A 4CC5A 1I6UA 4LFAH 4LSXA 3K3VA 3J81W 1HNWH 2O03A 4MTDA 4EC5A 2CW8A 1E4FT 2ZM6H 2UXBH 2VQFH 2UU9H 4LSAA 3EZJA 4LF8H 3QD7X 3BA8A 3N44B 4MV7A 3M4IA 4RAZA 4GLXA 4AQYH 3KAJA 4JI7H 4YY3H 3J80W 4OCHA 1FVIA 4MTEA 3BA9A 3HXLA 4A2AA 3L2PA 3KDGA 3KDKA 2PT7G 4B8CD 1XNRH 1X9ZA 1ODHA 3OETA 4IAJA 4NZTM 1IBKH 2Y3MA 4JI6H 1WH2A 3KXYT 3N6XA 4RB1A 4APMA 4DV2H 4DV0H 4UCTA 4X65H 1ZHSA 3JSNA 1AN7A 1VS0A 1X9NA 3T1HH 4JI5H 3JSLA 4LF6H 2WDTA 2LF0A 4LF5H 1N34H 1HNZH 4JI8H 3BAAA 3LMLA 4BWSC 4DR4H 4RB3C 3KAKA 4NXNH 2D9IA 1BJTA 3DF7A 1IBLH 3N42B 2Q2TA 1FKAH 5DT9A 4OX9H 4LFBH 1TA8A 3L4JA 2UUCH 1MZBA 2UUAH 1E4GT 3GABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 H;  4LF7 H;  1SEI A;  1HR0 H;  1IBM H;  1XNQ H;  4JYA H;  2F4V H;  2UXC H;  4KHP H;  4K0K H;  3RF2 A;  1N32 H;  4GKK H;  2UUB H;  4DUY H;  4DV5 H;  1XMO H;  1N36 H;  4LF4 H;  5FLX W;  4DV4 H;  5LMU H;  4JI3 H;  4DR2 H;  4DUZ H;  4X66 H;  4YHH H;  4PDB A;  2VQE H;  5A2Q W;  1HNX H;  3T1Y H;  4B3T H;  2UXD H;  4DR3 H;  4JI0 H;  4GKJ H;  5BR8 H;  2HHH H;  3JAM W;  4DR5 H;  4DR6 H;  1XMQ H;  4X64 H;  4JI4 H;  4B3S H;  1S03 G;  5LL6 b;  4JV5 H;  4DV3 H;  1J5E H;  4DR1 H;  4NXM H;  1FJG H;  3J7A K;  4X62 H;  2E5L H;  4LFC H;  4JI2 H;  4DV6 H;  5LMN H;  1I94 H;  5IT9 W;  3OTO H;  4DV1 H;  4B3R H;  4DR7 H;  1N33 H;  5IWA H;  4LF9 H;  4JI1 H;  1I6U A;  4LFA H;  3J81 W;  1HNW H;  2ZM6 H;  2UXB H;  2VQF H;  2UU9 H;  4LF8 H;  4AQY H;  4JI7 H;  4YY3 H;  3J80 W;  1XNR H;  1IBK H;  4JI6 H;  4DV2 H;  4DV0 H;  4X65 H;  1AN7 A;  3T1H H;  4JI5 H;  4LF6 H;  4LF5 H;  1N34 H;  1HNZ H;  4JI8 H;  4DR4 H;  4NXN H;  1IBL H;  1FKA H;  4OX9 H;  4LFB H;  2UUC H;  2UUA H;  4B3M H; 
#chains in the Genus database with same CATH topology
 2G8Y A;  4DV7 H;  3BJY A;  1SEI A;  3FKI G;  4NZR M;  4MA0 A;  3RJ0 A;  5KFS A;  3GLK A;  3N40 P;  3RV4 A;  2W9C B;  4EG0 A;  4FS1 A;  1XNQ H;  3MR3 A;  4ECZ A;  3Q1K A;  4TV9 F;  2XCA A;  5D1O B;  2VKC A;  5D8D A;  5C3E G;  4UCS A;  5L1K A;  5KFN A;  1IOV A;  4O3O A;  4IRK A;  4ECY A;  3U1K A;  3RTX A;  5DLF A;  4A3M G;  1N32 H;  1RJP A;  4BBR G;  2CTM A;  2W6N A;  2UUB H;  2W7P A;  3PN1 A;  1GSA A;  3PW4 A;  2ZJT A;  3GII A;  4J9N A;  3NCV A;  1TWH A;  4ED6 A;  1VIH A;  4LF4 H;  1VAJ A;  3GV5 B;  2V4Q A;  1M0T A;  4FU0 A;  3WO0 A;  5JVD F;  2JEI A;  2WYO A;  3RGZ A;  3SB1 A;  5KFB A;  2CTJ A;  2CW7 A;  3LWB A;  4M7E A;  4U7C A;  2SCU B;  1RJR A;  2VA3 A;  2DPJ A;  1WE8 A;  2JA6 A;  3HOX G;  2CTK A;  4RU9 A;  2K1H A;  2NVX A;  4JI0 H;  1S0N A;  1V4Y A;  1W93 A;  5BR8 H;  1F0X A;  5C4X G;  3R5X A;  3JAM W;  4DR5 H;  4O4I F;  1S9F A;  4DR6 H;  1KHM A;  4O2B F;  1DGS A;  4EFE A;  2R7Z G;  3ETH A;  1WVN A;  5LA6 F;  2W6Q A;  2W57 A;  5HV6 A;  2VUM G;  4G08 A;  5L1L A;  5BPH A;  5LL6 b;  3GKU A;  3VPB A;  3JZI A;  2QND A;  4H8A A;  1SCU B;  4J9S A;  2C2R A;  1M7J A;  1BGW A;  1CS0 A;  2GPW A;  2R8I A;  5D1P A;  3BQ2 A;  3HOV G;  1XDN A;  2JA7 G;  5JH7 F;  1V51 A;  4IR9 A;  2CZG A;  3M9N B;  4R7R A;  3GTG A;  3G8C A;  3PO2 G;  1J5K A;  1KEE A;  4LH6 A;  4DV6 H;  3EYY A;  2OPV A;  4YB8 B;  4B3R H;  3IG0 A;  1L2Z A;  4RAY A;  3HKZ A;  1ZHQ A;  1T36 A;  2XIG A;  3JRX A;  3H20 A;  2VOB A;  4RZR A;  2YQR A;  4NLG A;  4LMY A;  2FPH X;  3N43 B;  5H80 A;  1B04 A;  5IWA H;  5C44 G;  5FD5 A;  3TQ1 A;  4Q8F A;  2AGP A;  2ASJ A;  1N56 A;  5IP9 G;  4F4Z A;  2JA7 A;  4I4T F;  5EWG A;  5DGB A;  4ED0 A;  5F9L A;  3AYH B;  1I7L A;  4F4W A;  2M6Q A;  1JDE A;  1A9X A;  1E4E B;  1ZTG A;  2O03 A;  4MTD A;  2YU9 A;  4EC5 A;  3GTQ A;  2JA8 G;  1T94 A;  4HNV A;  4F4Y A;  1E4F T;  4J9M A;  5CB4 F;  3RB6 A;  4LF8 H;  3HOZ G;  2ZDG A;  5DG7 A;  3N44 B;  2W6P A;  1S97 A;  3KAJ A;  1BXR A;  2VA2 A;  4YY3 H;  2FK1 A;  1FVI A;  2I80 A;  3BA9 A;  3HXL A;  1K1Q A;  2V59 A;  1ULZ A;  4IWY A;  3PW2 A;  2R92 A;  2YZM A;  5KG2 A;  4IAJ A;  2VQD A;  3OSP A;  3OHB A;  3N6X A;  4APM A;  4DV2 H;  2Y0S E;  4FJS A;  5KFT A;  3WNZ A;  4X65 H;  1ZHS A;  5KG6 A;  5J2T F;  4A3F G;  1X9N A;  4EBD A;  2FB9 A;  2YRX A;  3HOU G;  3JSL A;  3GTP A;  3KHH A;  2ZDQ A;  2JA9 A;  4BWS C;  4LF5 H;  1DIK A;  1N34 H;  1HNZ H;  2DIK A;  4ZQI A;  2W8L A;  3V6K A;  3I4M G;  2R6F A;  3KAK A;  4A3B G;  5KFG A;  1BJT A;  2AU0 A;  1WSC A;  2NN6 G;  4J9Q A;  1PQX A;  3GIM A;  1FKA H;  1CQJ B;  3V4Z A;  4JV0 A;  1TA8 A;  2UUA H;  4WAN A;  1E4G T;  3GAB A;  3H40 A;  4EYH B;  4LF7 H;  5KFR A;  3TIN A;  4YAK B;  1HR0 H;  1IBM H;  5KT4 A;  4DL6 A;  3MWM A;  4JYA H;  1MSZ A;  2BQU A;  2UXC H;  2JA5 A;  2W8K A;  5KT6 A;  4TQS A;  1T3N A;  2YCH A;  5KFQ A;  3K5H A;  2C2E A;  3L7Z C;  5KG1 A;  5JQW A;  5J2U F;  2ASL A;  1TUA A;  1P8L A;  2FPI B;  4CC6 A;  2C00 A;  2XCP A;  4J9O A;  4GKK H;  2W6O A;  1TAE A;  4EGJ A;  5C5J A;  1GGO A;  2HJW A;  3RB4 A;  3GR5 A;  5BPF A;  5FPO A;  2RGV A;  4DV5 H;  5EWE A;  4F4X A;  4QIW A;  2JA5 G;  1UC9 A;  2IBK A;  1KJJ A;  4O3P A;  1N36 H;  4IFD G;  1W96 A;  2RF4 A;  4A2B A;  3KHL A;  2UVW A;  3GTL A;  3BAB A;  5LMU H;  3GQC A;  2DPI A;  1Y1W A;  5C0X G;  2MCT A;  5KKN B;  5LOV F;  2FKL A;  4JI3 H;  1CQI B;  3KTM A;  5CA1 F;  3OUZ A;  4DUZ H;  1GSO A;  1VBG A;  5EZY F;  3TII A;  4PDB A;  4Q44 A;  3GID A;  2BR0 A;  2BL5 A;  2UVR A;  3T1Y H;  4UFZ A;  2HVR A;  2OWO A;  2CTF A;  4DR3 H;  1X4M A;  4E9J A;  4BY1 G;  3PW0 A;  5C1P A;  4GKJ H;  4XYL B;  4BBS G;  2HGS A;  1RK5 A;  5KG7 A;  5DQH A;  4J9L A;  4R8U A;  1V9N A;  2R7M A;  4O4L F;  4EBE A;  4C5A A;  3SI8 A;  3MFI A;  1XMQ H;  5KFE A;  2HVS A;  1JLL B;  4O4H F;  2XD4 A;  1EHI A;  5IYB G;  2JEA I;  5IYD G;  1S20 A;  1S03 G;  5D1O A;  3EPG A;  4DV3 H;  3M9O B;  2J6T A;  1J5E H;  4YR0 A;  4NXM H;  2VUM A;  2CQY A;  1CE8 A;  1DV1 A;  2V5A A;  4A93 G;  2R7Z A;  2FMR A;  3T5H A;  1B6R A;  3J7A K;  2JE6 I;  2J9G A;  2VPQ A;  3R5F A;  4I7H A;  4X62 H;  1UC8 A;  2E5L H;  1PX2 A;  2FLL A;  1I94 H;  3H4B A;  5L1I A;  2IA6 A;  4QWE A;  4JV2 A;  2HVQ A;  2CWH A;  2YZG A;  3T5K A;  3G6V A;  4EEQ A;  2B63 G;  1KJQ A;  3KAL A;  2LRR A;  4A3E G;  2ZQE A;  2XGQ A;  4LF9 H;  4JI1 H;  2BQ3 A;  3VPC A;  5KFU A;  1SFO A;  2R87 A;  4LFA H;  4YR2 A;  4ZHQ F;  4LSX A;  2V58 A;  5EWF A;  2WB1 E;  5JVL A;  2I87 A;  2W9B A;  2UXB H;  2R93 G;  4LSA A;  5KG0 A;  3QD7 X;  3BA8 A;  2HH2 A;  2QK4 A;  5DQI A;  5DQG A;  1V8C A;  4GLX A;  1RYS A;  1JX4 A;  2R8J A;  1Y14 B;  1XRH A;  4A2A A;  2W6M A;  3KDK A;  4B8C D;  3PW7 A;  4A3K G;  1DTJ A;  3HBL A;  3RB0 A;  2Y3M A;  4JI6 H;  1WH2 A;  3KXY T;  3MR2 A;  4F50 A;  1ZET A;  1KJ9 A;  4XX0 B;  5KFD A;  4UCT A;  2WAQ E;  5KG4 A;  1N48 A;  1ZZK A;  3JSN A;  2UVU A;  5KFW A;  4HR7 A;  4RUC A;  3RBE A;  1S10 A;  4JVH A;  2WDT A;  2LF0 A;  2YS6 A;  2W9C A;  2PMZ E;  4QWD A;  2MJH A;  1JDB B;  5JUM A;  4NXN H;  2W9A A;  4JUZ A;  1J4W A;  2JEG A;  2DGR A;  4XZ3 B;  2V9W A;  4OX9 H;  4LFB H;  4MV4 A;  4PWQ A;  5K2M A;  4O3Q A;  5KT5 A;  3L4J A;  4IRC A;  2X06 A;  3BQ1 A;  2JEB I;  1GYF A;  2J6S A;  1WTJ A;  3GIP A;  4MAM A;  4DLK A;  4QWC A;  4AYB A;  4ME6 A;  4JVY A;  4MV3 A;  3PZP A;  3VMM A;  2R7K A;  4EYI B;  4U6P A;  4KHP H;  4UCR A;  1TWC A;  3R23 A;  1I50 A;  4K0K H;  3I4N G;  4JV1 A;  1S0O A;  1RYR A;  4M9U A;  4QWB A;  5KFP A;  4TQR A;  5F9N A;  3RAQ A;  2ANR A;  3RV3 A;  5KFM A;  1AUV A;  3C0F B;  5KT7 A;  4ED1 A;  4HYK A;  4J9K A;  4Q0Y A;  3RAX A;  2FPP B;  1XMO H;  4IWX A;  1R9T A;  1A0I A;  5KFX A;  3ORQ A;  4DV4 H;  2ANN A;  4RB0 A;  5DG9 A;  5IYC G;  4J0M A;  4YR3 A;  3OHA A;  2P2R A;  2YL2 A;  2ASD A;  1JXL A;  4C2M A;  3FMA A;  3K3P A;  3PR4 A;  3VPD A;  4ECX A;  4QW9 A;  4MV8 A;  5C1O A;  3PO3 G;  1Y1W G;  2KSW A;  5KFK A;  4O3R A;  2VQE H;  1ZZJ A;  1HNX H;  2PN1 A;  3OSS D;  1M0W A;  1EC6 A;  4QW8 A;  4O3N A;  2UXD H;  1VKZ A;  3N8D A;  4QWA A;  3KHG A;  5FD6 A;  2M8W A;  4WAL A;  4IZO A;  1BNC A;  5JEA G;  2X0S A;  4HNT A;  2I8C A;  2VPS A;  3WO1 A;  1WCM G;  3H3V H;  5EDW A;  2YS7 A;  2R8K A;  2HHH H;  5KFJ A;  2C35 B;  3F8N A;  3G6Y A;  1Z2P X;  4NBQ A;  3HKZ E;  2OPU A;  2W70 A;  2R7L A;  3M9M B;  4ECR A;  4X64 H;  1O75 A;  5KFY A;  4ED8 A;  2UVV A;  4JI4 H;  5DLG A;  3MJF A;  1ZQ7 A;  1VIG A;  4DL4 A;  3V4S A;  4UCV A;  4RNO A;  4ECU A;  1GO3 E;  4FM9 A;  4A3G G;  4AIM A;  3MR6 A;  1K1S A;  2M05 A;  2AGQ A;  2JEF A;  5KG5 A;  4B8T A;  1X0A A;  2NVY A;  3PR5 B;  2GPS A;  4ED7 A;  3FAU A;  2R93 A;  2LTL A;  2PY9 A;  4HQ6 A;  1PK8 A;  5LMN H;  5IT9 W;  3U9S A;  3RIZ A;  3RBD A;  4A3L G;  4BA1 I;  3OTO H;  4DV1 H;  5KFF A;  4UCO A;  2WTF A;  3BQ0 A;  4DL7 A;  5EOY A;  2Q2U A;  4EBC A;  1N33 H;  3U9T A;  3E5N A;  2QYZ A;  2FMA A;  2AGO A;  4QIW E;  2CWF A;  1EUD B;  2FK3 A;  4MA5 A;  5KFO A;  3TQT A;  4Q8E A;  1KJ8 A;  3LP8 A;  1ZZI A;  4TUY F;  3J81 W;  3V6H A;  2R8G A;  3CQZ A;  4ED3 A;  2IMW P;  2YW2 A;  2CKZ B;  3GIL A;  5K36 G;  4A3C G;  3QFF A;  3MFH A;  3JRW A;  2OH2 A;  2AQ4 A;  5IYZ F;  4O3S A;  4MV7 A;  5FJ8 G;  3GIK A;  3T5L A;  4IR1 A;  4O2A F;  4C5C A;  2FPG B;  4AQY H;  3K5I A;  4YQW A;  1WCM A;  4OCH A;  2R7N A;  2JEJ A;  3OSN A;  1RJQ A;  2CTL A;  1KC7 A;  2PT7 G;  1C3O A;  3NGD A;  3I12 A;  1I7N A;  3OET A;  5HBR B;  4NZT M;  1IBK H;  4HNU A;  2R85 A;  2W9B B;  3KHR A;  2JA6 G;  4FBT A;  4BXX G;  2VR1 A;  4DV0 H;  5KFA A;  3GIJ A;  1AN7 A;  1VS0 A;  3GV7 B;  3T1H H;  2Z0S A;  2RDI A;  5DG8 A;  4I55 F;  4RB3 C;  4JI8 H;  3LML A;  4AM3 A;  2WAQ A;  1K1G A;  2RDJ A;  1X4N A;  1WR2 A;  3DF7 A;  3OUU A;  4J9P A;  5LXT F;  2Q2T A;  1VBH A;  1B6S A;  5DT9 A;  2FFM A;  4WD3 A;  5KX5 F;  2PMZ A;  3ORR A;  3MR5 A;  4ECW A;  3RGX A;  3UOE A;  2NU9 B;  5KFV A;  3L4K A;  2R84 A;  4GC7 A;  3MWD A;  2F4V H;  4LH7 A;  3T5J A;  4ECV A;  4YJ3 F;  2R92 G;  2FE3 A;  4EFB A;  1K83 A;  3RB3 A;  2FJZ A;  1IOW A;  1VBI A;  3GTM A;  3RF2 A;  2DZD A;  3UFX B;  5KFL A;  4YAJ B;  4E4T A;  4I50 F;  4OD6 A;  3AEV B;  5C8Y F;  3Q2O A;  2YZN A;  3N41 B;  3G6X A;  3UQ8 A;  2C2D A;  1GLV A;  1JKJ B;  3GIQ A;  5GON F;  4DUY H;  2FK2 A;  3ETJ A;  4WBN F;  2VUG A;  4YP3 A;  3FDS A;  5FLX W;  4IHJ F;  1S68 A;  2R82 A;  3RUP A;  1S0M A;  2CPQ A;  4YJ2 F;  5IP7 G;  3R5H A;  3Q8S B;  5CA0 F;  2HH3 A;  4DR2 H;  5BMV F;  4FS2 A;  2W7O A;  2RGR A;  2E2I A;  4X66 H;  2YRW A;  4YHH H;  5I47 A;  5KT3 A;  1EYZ A;  3Q8Q B;  5A2Q W;  4DL3 A;  2XGP A;  4B3T H;  3CVZ A;  5CAE B;  4EGQ A;  4RZQ A;  4ZOL F;  4RB2 C;  1C30 A;  1E4E A;  4FBU A;  5LYJ F;  3QZ8 A;  4ETS A;  2WE6 A;  3QZ7 A;  4G3I A;  3PVX A;  2V4R A;  5L9X A;  1B33 N;  5FPR A;  2C28 A;  5KT2 A;  2PBZ A;  2FLP A;  2JVZ A;  3GTK A;  4ECT A;  2Y0S A;  4C5B A;  1Z2I A;  4B3S H;  5KFH A;  4MV1 A;  3GTJ A;  3SE7 A;  4QJF A;  4JV5 H;  1SYX B;  3GTO A;  1JIH A;  2PVP A;  2O4C A;  4DR1 H;  1WHR A;  1FJG H;  3H0G G;  2BQR A;  1DV2 A;  2ZDH A;  3FKI A;  4GC6 A;  1DT4 A;  1M6V A;  2P0A A;  1Z2N X;  1V9P A;  3V6J A;  5KFI A;  5KFZ A;  4A3D G;  1KJI A;  4BA2 I;  4LFC H;  2ATL A;  4UCU A;  4Q45 A;  2NU7 B;  4JI2 H;  2XC9 A;  1AUX A;  1EUC B;  1Z2O X;  5LP6 F;  4ED2 A;  1TWG A;  2B63 A;  3I0P A;  4RNN A;  1EZ1 A;  5T14 A;  3HOY G;  3Q8P B;  1RK6 A;  2XCL A;  3V69 A;  4DR7 H;  3Q8R B;  5DGA A;  3GV8 B;  4A3I G;  2LTM A;  2NU6 B;  2DWC A;  4R8U B;  4MV9 A;  4CC5 A;  1Y1V G;  1I6U A;  3PW5 A;  4L1K A;  3H0G A;  3K3V A;  1OWT A;  4LIJ A;  3VKE A;  1HNW H;  4A3J G;  2JZX A;  4J9R A;  2CW8 A;  3RFC A;  1I3Q A;  4FJU A;  2ZM6 H;  4MV6 A;  2VQF H;  4XYM B;  2UU9 H;  4ECQ A;  3EZJ A;  2FLN A;  2CPM A;  4RAZ A;  4OO1 G;  2R86 A;  1TWA A;  3M4I A;  2NU8 B;  4ZI7 F;  4RUA A;  2J6U A;  4JI7 H;  3J80 W;  4YBZ B;  4MTE A;  4BY7 G;  2FP4 B;  3L2P A;  4RNM A;  1TWF A;  3KDG A;  2R8H A;  3HOW G;  4ECS A;  2E3U A;  2W6Z A;  1XNR H;  1X9Z A;  1ODH A;  2W71 A;  3EPI A;  4QMF B;  3H4D A;  4DL5 A;  5KG3 A;  4RB1 A;  2A1S A;  2BA0 A;  4AYB E;  5KFC A;  1GSH A;  1Y1V A;  2DLN A;  2IP4 A;  2NUA B;  4IRD A;  1KBL A;  3TIG A;  4EEY A;  4JI5 H;  2WB1 A;  3MWE A;  5FLM G;  3IN5 A;  4DL2 A;  2OLS A;  2C22 A;  4LF6 H;  3BAA A;  4Q43 A;  4Y8V B;  2E2H A;  4TV8 F;  4DR4 H;  2AXY A;  3HB9 A;  1UG8 A;  2ALZ A;  2GLT A;  2D9I A;  3N42 B;  1UNN C;  1IBL H;  3BG5 A;  2CTE A;  2YYA A;  1NXU A;  2PQU A;  2UUC H;  1MZB A;  5L1J A;  4B3M H; 
#chains in the Genus database with same CATH homology
 4DV7 H;  3RGX A;  4LF7 H;  1SEI A;  4NZR M;  3RJ0 A;  3L4K A;  3N40 P;  1HR0 H;  1IBM H;  1XNQ H;  3MWM A;  4JYA H;  2F4V H;  4LH7 A;  5D1O B;  2UXC H;  2VKC A;  4KHP H;  2FE3 A;  4UCR A;  4EFB A;  4K0K H;  4UCS A;  2YCH A;  3RF2 A;  4OD6 A;  1P8L A;  3RTX A;  1GYF A;  3N41 B;  4CC6 A;  3C0F B;  1N32 H;  4GKK H;  3UQ8 A;  1TAE A;  2UUB H;  3GR5 A;  4DUY H;  3PN1 A;  2RGV A;  4DV5 H;  2ZJT A;  4Q0Y A;  2VUG A;  5FPO A;  1XMO H;  3NCV A;  1N36 H;  4LF4 H;  1A0I A;  5FLX W;  4A2B A;  4DV4 H;  4RB0 A;  3BAB A;  5LMU H;  1S68 A;  4J0M A;  1M0T A;  3FMA A;  2MCT A;  4JI3 H;  2WYO A;  3RGZ A;  3SB1 A;  4DR2 H;  2RGR A;  4DUZ H;  4X66 H;  2CW7 A;  4YHH H;  4PDB A;  2KSW A;  4M7E A;  2VQE H;  5A2Q W;  1HNX H;  3OSS D;  1M0W A;  3T1Y H;  4B3T H;  2UXD H;  3CVZ A;  4UFZ A;  2HVR A;  4RZQ A;  5FD6 A;  2OWO A;  4RB2 C;  4DR3 H;  4E9J A;  4JI0 H;  4GKJ H;  2HGS A;  5BR8 H;  1F0X A;  4B3M H;  2VPS A;  4ETS A;  2HHH H;  2WE6 A;  3JAM W;  3F8N A;  1Z2P X;  4DR5 H;  4DR6 H;  1XMQ H;  4EFE A;  1DGS A;  5FPR A;  2HVS A;  4X64 H;  1O75 A;  4JI4 H;  2W57 A;  4B3S H;  4G08 A;  1S03 G;  5D1O A;  5LL6 b;  4JV5 H;  4DV3 H;  1SYX B;  2O4C A;  1J5E H;  4DR1 H;  4NXM H;  4UCV A;  1FJG H;  4FM9 A;  1BGW A;  5D1P A;  1Z2N X;  1V9P A;  1XDN A;  3J7A K;  4I7H A;  4R7R A;  4X62 H;  2E5L H;  3FAU A;  4LFC H;  4UCU A;  4JI2 H;  4DV6 H;  5LMN H;  1I94 H;  5IT9 W;  3EYY A;  4LH6 A;  3RIZ A;  1Z2O X;  3OTO H;  4DV1 H;  4B3R H;  2HVQ A;  3IG0 A;  4RAY A;  4UCO A;  2Q2U A;  1ZHQ A;  2XIG A;  5EOY A;  1L2Z A;  3H20 A;  2VOB A;  4EEQ A;  4DR7 H;  1N33 H;  4LMY A;  2FPH X;  3N43 B;  1B04 A;  5IWA H;  3KAL A;  5FD5 A;  2ZQE A;  4LF9 H;  4JI1 H;  4MV9 A;  4CC5 A;  1I6U A;  4LFA H;  4LSX A;  3K3V A;  3J81 W;  1HNW H;  2O03 A;  4MTD A;  4EC5 A;  2CW8 A;  1E4F T;  2ZM6 H;  2UXB H;  2VQF H;  2UU9 H;  4LSA A;  3EZJ A;  4LF8 H;  3QD7 X;  3BA8 A;  3N44 B;  4MV7 A;  3M4I A;  4RAZ A;  4GLX A;  4AQY H;  3KAJ A;  4JI7 H;  4YY3 H;  3J80 W;  4OCH A;  1FVI A;  4MTE A;  3BA9 A;  3HXL A;  4A2A A;  3L2P A;  3KDG A;  3KDK A;  2PT7 G;  4B8C D;  1XNR H;  1X9Z A;  1ODH A;  3OET A;  4IAJ A;  4NZT M;  1IBK H;  2Y3M A;  4JI6 H;  1WH2 A;  3KXY T;  3N6X A;  4RB1 A;  4APM A;  4DV2 H;  4DV0 H;  4UCT A;  4X65 H;  1ZHS A;  3JSN A;  1AN7 A;  1VS0 A;  1X9N A;  3T1H H;  4JI5 H;  3JSL A;  4LF6 H;  2WDT A;  2LF0 A;  4LF5 H;  1N34 H;  1HNZ H;  4JI8 H;  3BAA A;  3LML A;  4BWS C;  4DR4 H;  4RB3 C;  3KAK A;  4NXN H;  2D9I A;  1BJT A;  3DF7 A;  1IBL H;  3N42 B;  2Q2T A;  1FKA H;  5DT9 A;  4OX9 H;  4LFB H;  1TA8 A;  3L4J A;  2UUC H;  1MZB A;  2UUA H;  1E4G T;  3GAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...