3J7AK

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
129
structure length
129
Chain Sequence
VRMSVLADCLKTINNAEKRGRRQVLIRPSSKVVIKFLQYMQKKGYIGSFEIVDDHRSGKIVVNLLGRINKCAVISPRYDVKLDEIEKIITSILPSRLFGHLILTTPYGIMDHEEARRKHTGGKVLGFFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
molecule keywords 18S ribosomal RNA
total genus 30
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3j7aK01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3j7aK02
4K0KH 1HNXH 1HNWH 1XMOH 4JI7H 4NXNH 4DR4H 1XMQH 5A2QW 4JI8H 4LF8H 4DV4H 4B3SH 4DR1H 3OTOH 5IT9W 4LFCH 1I94H 4LF4H 1XNRH 2UUAH 2UXBH 4PDBA 4JYAH 1IBKH 4DV6H 1AN7A 4LFBH 2VQFH 3JAMW 4LFAH 1IBLH 4B3MH 2E5LH 4GKKH 5LMUH 2VQEH 4LF6H 4OX9H 4DR6H 5BR8H 5LL6b 1I6UA 4X66H 4X65H 2F4VH 4B3RH 4DUZH 3J80W 4DV5H 3RF2A 5IWAH 4JI2H 1N36H 4X62H 1SEIA 2ZM6H 5FLXW 3T1HH 4GKJH 2UXCH 3J81W 4LF9H 4JI4H 1S03G 1IBMH 1J5EH 2HHHH 4JI0H 2UUCH 4DR3H 4B3TH 4JI1H 4DV2H 4DUYH 1N32H 4X64H 4DR7H 4DV3H 4LF7H 4AQYH 4NXMH 1FKAH 4DV0H 2UUBH 1N33H 4DV7H 4YHHH 4DR2H 4DV1H 1N34H 1HR0H 2UU9H 4JI6H 1FJGH 3J7AK 4DR5H 3T1YH 1HNZH 1XNQH 4LF5H 4YY3H 4KHPH 2UXDH 5LMNH 4JI3H 4JI5H 4JV5H
chains in the Genus database with same CATH superfamily
2XD4A 4HQ6A 2ZQEA 4RAZA 4CC6A 3EPGA 2IA6A 3KAKA 2A1SA 1CS0A 4IRDA 3M4IA 4DLKA 1XMQH 2AQ4A 5C3EG 1I3QA 2IMWP 5A2QW 2M8WA 4ZOLF 5J2TF 1VIHA 1V51A 2MJHA 1EUDB 4ED1A 3RGXA 4UCRA 5HBRB 1VBHA 4DL6A 3OTOH 1DV1A 3PW7A 4LFCH 3TINA 1GLVA 1XNRH 1ODHA 4MV6A 2UXBH 1ZZJA 2RGVA 4O3QA 3MR3A 5KFGA 1KBLA 3GTLA 4OD6A 3Q2OA 4QWBA 4DL7A 5KT7A 1IBKH 2KSWA 5F9LA 5IP9G 1K1GA 4LFBH 5JUMA 2OPUA 5D1OA 2W6QA 2FB9A 5CA1F 3GIDA 4LMYA 2JA8G 4LFAH 4MA0A 3UOEA 3PW5A 4Q43A 4NZRM 2YZMA 4A3GG 1WCMA 3KALA 2JA6A 2PMZE 5KG7A 5EWFA 4GC6A 2FLNA 3KHRA 4LF6H 3N8DA 2CTKA 2BQRA 2NU7B 2CTMA 4NLGA 3OSNA 2M05A 2W9BA 2C28A 2ZDQA 1T3NA 4LSAA 1A9XA 1F0XA 2VQDA 5KKNB 4IFDG 4B3RH 4QWCA 2XCAA 2Q2TA 3FKIA 3J80W 4DV5H 2Y0SE 3OSSD 3RV4A 1GYFA 1TWAA 5IYDG 4JI2H 2G8YA 3KDGA 3HKZA 4GLXA 2R8KA 3RV3A 1RK6A 2DIKA 4RB3C 5IYZF 4YP3A 5BMVF 3HOYG 5KFHA 3JRXA 4QIWE 1ZHQA 4LIJA 3RTXA 2RDJA 5FLXW 2W57A 2DGRA 4GKJH 5EZYF 2VUMG 3H0GG 4ETSA 2C00A 4JVHA 2E2HA 3GIKA 5C44G 2JZXA 2C2EA 3N44B 4A3IG 2PN1A 4R8UB 2UUCH 3RB0A 3VPDA 2FFMA 2JVZA 4Q45A 1S68A 5JVDF 3N43B 2W6MA 2YRWA 4UCTA 2J6UA 2RF4A 4RUCA 1O75A 1Y14B 4FS1A 2AGQA 4DUYH 4YQWA 1S10A 4O3OA 3PO2G 3T5LA 3N42B 4XYLB 2FK2A 5KT3A 4FBTA 1X4MA 4MA5A 2NVXA 2FP4B 5KFXA 2W71A 2XIGA 5DQIA 5KT4A 2W9CB 2Y3MA 2YL2A 1ZZKA 4EBCA 5KFOA 3I4MG 1RJQA 3HXLA 2QYZA 5D1PA 4EFBA 4ZQIA 3RAQA 4EGQA 2R8GA 4C2MA 3GQCA 4ED0A 3BA8A 4HNUA 3WNZA 1UC8A 3R5HA 4DR2H 3G6YA 2HGSA 1DIKA 5FJ8G 2W7OA 3BAAA 1W93A 1ULZA 2HVQA 4YBZB 2FMRA 2UU9H 2QK4A 2V58A 1UG8A 1E4GT 3K3VA 3FMAA 4EFEA 1EC6A 1J5KA 2W6PA 5IYBG 1AUXA 4YR2A 5BPHA 4ECUA 4E4TA 4RU9A 3QFFA 2R8HA 2R93G 3T5KA 2LTMA 1VKZA 4WD3A 1V9PA 2R92A 5KFKA 4EG0A 2WTFA 5KT6A 3LWBA 4DL4A 1XNQH 3R5FA 4YY3H 3K5IA 4KHPH 2M6QA 3SB1A 2R8IA 5CA0F 5FD5A 1GO3E 3OUZA 3H40A 3HB9A 2JA7A 2YS7A 4MV4A 4BBRG 5KFQA 1PX2A 2W70A 4JUZA 4A3CG 3K3PA 3DF7A 1WSCA 4Q44A 5J2UF 1ZZIA 4BA2I 1X4NA 5FPRA 3SE7A 2XCPA 2X06A 4A2BA 3WO1A 4M7EA 5L1JA 2PQUA 1HNWH 5LYJF 4Q0YA 2HVRA 1CQJB 4JI7H 5KFYA 1IOVA 3GIIA 1B04A 4UCOA 1KHMA 4DV4H 5LP6F 4J9LA 2Z0SA 4QWAA 4J9MA 5L9XA 2ASJA 2W9BB 4PDBA 3K5HA 3KHHA 4J9OA 4BXXG 2JEGA 4RAYA 1BNCA 5K2MA 5C1PA 1UNNC 1AN7A 1TWGA 2AGPA 2CPMA 1Y1VG 1T94A 3GV5B 4A3LG 2O4CA 2OH2A 1KJ9A 2JA7G 2PY9A 2YYAA 1KJIA 3N40P 3GABA 2E5LH 4HR7A 5KFWA 1MSZA 1TWCA 4FJUA 1Z2NX 5LMUH 5IP7G 1RK5A 5FPOA 2WB1A 4C5AA 4J9NA 5BR8H 4ME6A 5LL6b 4MV9A 1I6UA 5FLMG 4FS2A 4IWXA 3BG5A 3FKIG 2ASDA 2BL5A 2PT7G 5DGAA 2WAQE 3RB3A 2VA2A 2R7ZG 2UVVA 4LH6A 3PW4A 2QNDA 3V4ZA 3LP8A 3Q1KA 5C5JA 2GLTA 4MV3A 3V69A 1M0WA 2WDTA 1FVIA 1AUVA 2VKCA 4E9JA 2V59A 1GGOA 1XRHA 4G08A 2XGQA 2JEBI 1N36H 3VPBA 2BQ3A 3RIZA 2ZM6H 4UFZA 4MTEA 4TQRA 4OCHA 3T1HH 5T14A 5KFZA 3MR2A 3V6JA 1RJRA 4EGJA 3GTMA 3J81W 4L1KA 4Y8VB 4BY7G 3GTPA 4JI4H 1IOWA 4U7CA 1Y1WA 3GIPA 5KFJA 1S0NA 1DV2A 5CB4F 1S03G 3NGDA 1M0TA 2YU9A 4YJ3F 1S0MA 2V9WA 4GC7A 4JI1H 4DV2H 2R7MA 3OHBA 2ZJTA 2NVYA 1K1SA 1N32H 1VAJA 4DR7H 4A3KG 5KFCA 1JLLB 2W6ZA 4RZQA 3RBDA 1RYSA 1VBIA 1GSAA 2X0SA 3KTMA 4AQYH 5C8YF 3U9TA 3CQZA 5KT5A 1BGWA 4DV0H 1TA8A 2WYOA 5EWGA 4TQSA 3KHGA 1X9NA 3OHAA 1EYZA 1I7NA 3IG0A 4YHHH 4ECVA 4LH7A 4A3DG 1KJJA 1DT4A 2D9IA 2DWCA 5KG6A 5KFNA 1N34H 4YR0A 1KC7A 3FAUA 4WANA 4QMFB 2VPQA 4AYBA 3HKZE 2ANNA 3H4BA 4CC5A 4TUYF 4MTDA 1GSOA 2R7NA 4J9PA 4F4YA 4A3MG 5KFPA 5KG2A 3TQTA 2ZDHA 3Q8SB 2W9AA 4DR5H 3RGZA 3G6VA 2FPIB 2W8LA 2OPVA 2HVSA 5FD6A 4HYKA 2MCTA 2JEIA 4ZI7F 1E4FT 4UCUA 4A2AA 5DQHA 2FMAA 3H3VH 3ETHA 5LMNH 5EOYA 4JI3H 2NU9B 1VBGA 2FPHX 5I47A 4XX0B 1EZ1A 3RAXA 1Y1VA 3AEVB 4EBDA 3EPIA 4F4WA 5K36G 2YRXA 4U6PA 1X9ZA 3GIQA 4ECXA 2CWFA 5DT9A 4RB0A 2C2DA 3H20A 2W6OA 4K0KH 3VMMA 4J9SA 1KJQA 2LF0A 1SYXB 4BA1I 1SCUB 4F4ZA 3F8NA 3H0GA 3HOUG 3MJFA 1XMOH 4DR4H 5KFAA 2PVPA 5KFTA 4XYMB 2V5AA 1UC9A 4EYIB 4AIMA 3EZJA 4LF8H 4IWYA 4OO1G 1OWTA 4DR1H 3Q8PB 5IT9W 3Q8QB 3GR5A 2JA5G 4LF4H 2UVWA 3ORQA 2I87A 1WH2A 3V6KA 1KJ8A 4JYAH 4C5BA 2W7PA 4DV6H 1C3OA 2LTLA 1C30A 2E3UA 4R8UA 2VQFH 2YZGA 5F9NA 2CQYA 2VPSA 3PR5B 4J9KA 1ZTGA 3KHLA 1DGSA 2ATLA 4FBUA 2W8KA 4F50A 1E4EA 3SI8A 2VUMA 3OETA 4GKKH 5KFFA 4RNMA 2CZGA 5KFRA 4RNOA 4A93G 2HH2A 2VQEH 1KEEA 4OX9H 4MV7A 1EUCB 2C22A 3HOXG 2CPQA 4X66H 4ECTA 4X65H 2Q2UA 1I7LA 2W6NA 3CVZA 4DUZH 3RF2A 4B8TA 5LA6F 4PWQA 4A3EG 4YR3A 5KG5A 1RYRA 1J4WA 4AM3A 4BBSG 4ECZA 2JA6G 3C0FB 5KFBA 3PZPA 1Z2IA 1WR2A 1P8LA 5DG9A 1TUAA 5D1OB 2AU0A 1Z2OX 5KFSA 3M9NB 1PQXA 2XC9A 5L1KA 2FK3A 5H80A 3BQ2A 3BQ0A 4IR1A 3PR4A 4QWEA 2K1HA 3MFIA 4C5CA 2UXCH 2I8CA 2ALZA 4DL2A 4LF9H 1TWFA 3WO0A 3TIIA 1S0OA 2LRRA 2V4RA 4O3SA 2IBKA 4IRKA 1IBMH 2WB1E 3L4KA 4R7RA 2YCHA 2HH3A 4QW8A 3PO3G 5BPFA 2CKZB 2WE6A 1Y1WG 3GV7B 2FLPA 3AYHB 4RNNA 3N6XA 3VKEA 4O2BF 4EYHB 3RUPA 3TQ1A 1B6SA 3MR6A 3NCVA 3V4SA 4O2AF 2V4QA 2CWHA 2JE6I 1A0IA 4O3RA 4NZTM 2YW2A 3UFXB 5C0XG 4DV3H 3KDKA 4H8AA 4ZHQF 3QD7X 4MV8A 4LF7H 2B63G 3MFHA 4A3BG 3V6HA 3N41B 4I50F 5KX5F 5DLGA 1FKAH 5KFDA 2UUBH 2FE3A 2R84A 4RB2C 2VOBA 2JEJA 5KFMA 1N33H 5KFIA 1BJTA 4JV1A 4DV7H 3LMLA 3GTJA 4O4HF 3QZ7A 4YAKB 3MWDA 3GIJA 4YB8B 3R5XA 2CW8A 3L4JA 3E5NA 2R92G 2C35B 3KXYT 1ZQ7A 4JV0A 2IP4A 3HBLA 3GILA 3H4DA 1SFOA 4JV2A 5JH7F 4IHJF 2PMZA 5LXTF 2HJWA 3TIGA 4ECQA 2CTLA 2FK1A 2DLNA 1X0AA 1M6VA 3RJ0A 4EBEA 4WALA 3RBEA 3IN5A 4IZOA 2RDIA 1HNZH 5JVLA 3ETJA 4LF5H 2BQUA 3GTQA 4F4XA 1WCMG 2CTJA 4RB1A 3GIMA 2AXYA 1Z2PX 4YJ2F 1I50A 4IAJA 4WBNF 3PN1A 2JEAI 2VR1A 4J0MA 5JEAG 4B8CD 4EEYA 1L2ZA 4O3PA 2PBZA 3U1KA 1V8CA 3HOVG 1HNXH 2YZNA 2JA9A 2NN6G 4NXNH 4FJSA 3M9MB 4G3IA 1B33N 1VIGA 1E4EB 5DG7A 2NUAB 2CTEA 4J9QA 4Q8EA 3GKUA 2B63A 1JXLA 4JI8H 5KFLA 4A3JG 4JVYA 3BABA 3JSNA 4QJFA 3GV8B 1ZHSA 2R82A 2W9CA 4ECSA 3PW0A 1R9TA 3BJYA 1BXRA 5L1IA 4B3SH 4ECYA 1S97A 3GTKA 1I94H 4ED3A 4IRCA 2UUAH 3BQ1A 4I55F 5EDWA 3UQ8A 4BY1G 3GTOA 3MWEA 4I4TF 4QWDA 2OWOA 5EWEA 3GLKA 5LOVF 1CQIB 1PK8A 5DQGA 2SCUB 3JRWA 3JAMW 2NU8B 4YAJB 1IBLH 4B3MH 3FDSA 3JSLA 4MV1A 4O3NA 2FPPB 5C4XG 3BA9A 4TV9F 2DZDA 4ED8A 4DR6H 2R6FA 1VS0A 4O4LF 1TWHA 2ANRA 3G8CA 2FKLA 2GPWA 4NBQA 1B6RA 5C1OA 3I0PA 4ED7A 2F4VH 1WTJA 2CTFA 4EEQA 4M9UA 4QIWA 1V9NA 4TV8F 5KFVA 4DL3A 5IWAH 4LSXA 2ASLA 2VA3A 4BWSC 2UVUA 2R8JA 4A3FG 2R7KA 5GONF 1GSHA 2I80A 3ORRA 2R86A 4UCSA 5JQWA 2FLLA 2J6TA 4AYBE 2E2IA 1K83A 2XCLA 1JIHA 4X62H 2P0AA 3QZ8A 3I4NG 1SEIA 1NXUA 4FU0A 3HOZG 3GTGA 1WE8A 1WHRA 2Y0SA 2DPIA 4ED2A 2VUGA 5KFEA 1JKJB 3MR5A 4XZ3B 4RUAA 1DTJA 2WAQA 5HV6A 2JA5A 4IR9A 3L7ZC 1MZBA 3OUUA 3RFCA 1J5EH 2HHHH 4JI0H 2FPGB 2YS6A 2ZDGA 1ZETA 4FM9A 4QW9A 2YQRA 1N56A 5L1LA 1N48A 4MAMA 2FJZA 4DR3H 2CW7A 4B3TH 1T36A 2J6SA 2BA0A 2GPSA 2O03A 1JDEA 3I12A 4X64H 3M9OB 2BR0A 5D8DA 3EYYA 4HNTA 3PVXA 5KG1A 2DPJA 2UVRA 1K1QA 3RB6A 2R87A 4NXMH 5KT2A 1WVNA 4APMA 3T5JA 3R23A 1M7JA 2OLSA 5KG0A 3PW2A 1EHIA 5KG3A 3G6XA 2J9GA 5IYCG 4ED6A 1S20A 1JDBB 2NU6B 4O4IF 3Q8RB 2XGPA 2P2RA 4ECWA 4DV1H 4DL5A 3OSPA 2C2RA 1HR0H 5KFUA 4JI6H 3RB4A 2R7LA 1JX4A 1W96A 5KG4A 2R7ZA 5DGBA 3KAJA 1FJGH 1TAEA 3JZIA 3J7AK 4RZRA 1V4YA 3MWMA 3VPCA 3T1YH 3L2PA 3HOWG 2R93A 1XDNA 1S9FA 2R85A 2UXDH 4UCVA 1CE8A 5CAEB 4JI5H 5DG8A 4ECRA 3T5HA 2RGRA 4HNVA 4Q8FA 4J9RA 4I7HA 2JEFA 4EC5A 1RJPA 5DLFA 2AGOA 3U9SA 4JV5H
chains in the Genus database with same CATH topology
4B8CD 4K0KH 1L2ZA 4CC6A 2LF0A 2ZQEA 1SYXB 4RAZA 5FPRA 1HNXH 3KAKA 4A2BA 1HNWH 4M7EA 3F8NA 4Q0YA 2HVRA 1XMOH 4JI7H 4NXNH 4DR4H 3M4IA 1XMQH 1B04A 5A2QW 3DF7A 4UCOA 4JI8H 3BABA 3JSNA 3EZJA 4LF8H 1ZHSA 3RGXA 4UCRA 4DV4H 4B3SH 4DR1H 3OTOH 5IT9W 3GR5A 4LFCH 1I94H 4LF4H 1XNRH 1ODHA 2UUAH 2UXBH 4PDBA 1WH2A 2RGVA 4JYAH 4OD6A 1IBKH 4RAYA 3UQ8A 4DV6H 2KSWA 1AN7A 4LFBH 2OWOA 2VQFH 2VPSA 5D1OA 2O4CA 4LMYA 1DGSA 3JAMW 1IBLH 4B3MH 4LFAH 3JSLA 3GABA 2E5LH 3N40P 3OETA 4NZRM 4GKKH 3BA9A 3KALA 1Z2NX 5LMUH 5FPOA 2VQEH 4LF6H 4OX9H 4DR6H 5BR8H 1VS0A 4MV7A 4MV9A 5LL6b 1I6UA 4X66H 2PT7G 4X65H 4LSAA 2Q2UA 2F4VH 1F0XA 4EEQA 4LH6A 4B3RH 3CVZA 4DUZH 2Q2TA 3J80W 4DV5H 3RF2A 5IWAH 4LSXA 3OSSD 1M0WA 4BWSC 2WDTA 1GYFA 1FVIA 4JI2H 2VKCA 3KDGA 4GLXA 4E9JA 4UCSA 3C0FB 4G08A 4RB3C 1N36H 4X62H 1P8LA 5D1OB 1Z2OX 1SEIA 3RIZA 2ZM6H 1ZHQA 4UFZA 3RTXA 2VUGA 4MTEA 5FLXW 4OCHA 3T1HH 2W57A 4GKJH 2UXCH 3J81W 4ETSA 4LF9H 4JI4H 1MZBA 1S03G 1IBMH 1J5EH 2HHHH 4JI0H 1M0TA 3N44B 2UUCH 4R7RA 3L4KA 4FM9A 2YCHA 4RB1A 2WE6A 4DR3H 1S68A 2CW7A 4B3TH 4JI1H 3N43B 4DV2H 4UCTA 3N6XA 2O03A 1O75A 2ZJTA 4DUYH 1N32H 3NCVA 4X64H 4DR7H 1A0IA 3N42B 4NZTM 4RZQA 3EYYA 4DV3H 3KDKA 3QD7X 4LF7H 2XIGA 4AQYH 4NXMH 2Y3MA 3N41B 1BGWA 4APMA 1FKAH 4DV0H 1TA8A 2UUBH 2FE3A 2WYOA 3HXLA 5D1PA 4EFBA 1X9NA 4RB2C 2VOBA 1N33H 1BJTA 3BA8A 4DV7H 3IG0A 4YHHH 3LMLA 4DR2H 4LH7A 2HGSA 2CW8A 2D9IA 3BAAA 3L4JA 4DV1H 1N34H 2HVQA 3FAUA 3KXYT 1HR0H 2UU9H 4JI6H 3K3VA 1E4GT 3FMAA 4CC5A 4EFEA 4MTDA 3KAJA 1FJGH 1TAEA 3J7AK 4DR5H 3RGZA 3MWMA 1V9PA 3RJ0A 2HVSA 5FD6A 3T1YH 2MCTA 3L2PA 1HNZH 1E4FT 1XNQH 4UCUA 4LF5H 4A2AA 4YY3H 1XDNA 4KHPH 2UXDH 5LMNH 3SB1A 4JI3H 4JI5H 1Z2PX 4UCVA 2FPHX 5EOYA 4IAJA 5FD5A 2RGRA 3PN1A 4I7HA 1X9ZA 4EC5A 4RB0A 5DT9A 4J0MA 3H20A 4JV5H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K H;  1HNX H;  1HNW H;  1XMO H;  4JI7 H;  4NXN H;  4DR4 H;  1XMQ H;  5A2Q W;  4JI8 H;  4LF8 H;  4DV4 H;  4B3S H;  4DR1 H;  3OTO H;  5IT9 W;  4LFC H;  1I94 H;  4LF4 H;  1XNR H;  2UUA H;  2UXB H;  4PDB A;  4JYA H;  1IBK H;  4DV6 H;  1AN7 A;  4LFB H;  2VQF H;  3JAM W;  4LFA H;  1IBL H;  4B3M H;  2E5L H;  4GKK H;  5LMU H;  2VQE H;  4LF6 H;  4OX9 H;  4DR6 H;  5BR8 H;  5LL6 b;  1I6U A;  4X66 H;  4X65 H;  2F4V H;  4B3R H;  4DUZ H;  3J80 W;  4DV5 H;  3RF2 A;  5IWA H;  4JI2 H;  1N36 H;  4X62 H;  1SEI A;  2ZM6 H;  5FLX W;  3T1H H;  4GKJ H;  2UXC H;  3J81 W;  4LF9 H;  4JI4 H;  1S03 G;  1IBM H;  1J5E H;  2HHH H;  4JI0 H;  2UUC H;  4DR3 H;  4B3T H;  4JI1 H;  4DV2 H;  4DUY H;  1N32 H;  4X64 H;  4DR7 H;  4DV3 H;  4LF7 H;  4AQY H;  4NXM H;  1FKA H;  4DV0 H;  2UUB H;  1N33 H;  4DV7 H;  4YHH H;  4DR2 H;  4DV1 H;  1N34 H;  1HR0 H;  2UU9 H;  4JI6 H;  1FJG H;  3J7A K;  4DR5 H;  3T1Y H;  1HNZ H;  1XNQ H;  4LF5 H;  4YY3 H;  4KHP H;  2UXD H;  5LMN H;  4JI3 H;  4JI5 H;  4JV5 H; 
#chains in the Genus database with same CATH topology
 2XD4 A;  4HQ6 A;  2ZQE A;  4RAZ A;  4CC6 A;  3EPG A;  2IA6 A;  3KAK A;  2A1S A;  1CS0 A;  4IRD A;  3M4I A;  4DLK A;  1XMQ H;  2AQ4 A;  5C3E G;  1I3Q A;  2IMW P;  5A2Q W;  2M8W A;  4ZOL F;  5J2T F;  1VIH A;  1V51 A;  2MJH A;  1EUD B;  4ED1 A;  3RGX A;  4UCR A;  5HBR B;  1VBH A;  4DL6 A;  3OTO H;  1DV1 A;  3PW7 A;  4LFC H;  3TIN A;  1GLV A;  1XNR H;  1ODH A;  4MV6 A;  2UXB H;  1ZZJ A;  2RGV A;  4O3Q A;  3MR3 A;  5KFG A;  1KBL A;  3GTL A;  4OD6 A;  3Q2O A;  4QWB A;  4DL7 A;  5KT7 A;  1IBK H;  2KSW A;  5F9L A;  5IP9 G;  1K1G A;  4LFB H;  5JUM A;  2OPU A;  5D1O A;  2W6Q A;  2FB9 A;  5CA1 F;  3GID A;  4LMY A;  2JA8 G;  4LFA H;  4MA0 A;  3UOE A;  3PW5 A;  4Q43 A;  4NZR M;  2YZM A;  4A3G G;  1WCM A;  3KAL A;  2JA6 A;  2PMZ E;  5KG7 A;  5EWF A;  4GC6 A;  2FLN A;  3KHR A;  4LF6 H;  3N8D A;  2CTK A;  2BQR A;  2NU7 B;  2CTM A;  4NLG A;  3OSN A;  2M05 A;  2W9B A;  2C28 A;  2ZDQ A;  1T3N A;  4LSA A;  1A9X A;  1F0X A;  2VQD A;  5KKN B;  4IFD G;  4B3R H;  4QWC A;  2XCA A;  2Q2T A;  3FKI A;  3J80 W;  4DV5 H;  2Y0S E;  3OSS D;  3RV4 A;  1GYF A;  1TWA A;  5IYD G;  4JI2 H;  2G8Y A;  3KDG A;  3HKZ A;  4GLX A;  2R8K A;  3RV3 A;  1RK6 A;  2DIK A;  4RB3 C;  5IYZ F;  4YP3 A;  5BMV F;  3HOY G;  5KFH A;  3JRX A;  4QIW E;  1ZHQ A;  4LIJ A;  3RTX A;  2RDJ A;  5FLX W;  2W57 A;  2DGR A;  4GKJ H;  5EZY F;  2VUM G;  3H0G G;  4ETS A;  2C00 A;  4JVH A;  2E2H A;  3GIK A;  5C44 G;  2JZX A;  2C2E A;  3N44 B;  4A3I G;  2PN1 A;  4R8U B;  2UUC H;  3RB0 A;  3VPD A;  2FFM A;  2JVZ A;  4Q45 A;  1S68 A;  5JVD F;  3N43 B;  2W6M A;  2YRW A;  4UCT A;  2J6U A;  2RF4 A;  4RUC A;  1O75 A;  1Y14 B;  4FS1 A;  2AGQ A;  4DUY H;  4YQW A;  1S10 A;  4O3O A;  3PO2 G;  3T5L A;  3N42 B;  4XYL B;  2FK2 A;  5KT3 A;  4FBT A;  1X4M A;  4MA5 A;  2NVX A;  2FP4 B;  5KFX A;  2W71 A;  2XIG A;  5DQI A;  5KT4 A;  2W9C B;  2Y3M A;  2YL2 A;  1ZZK A;  4EBC A;  5KFO A;  3I4M G;  1RJQ A;  3HXL A;  2QYZ A;  5D1P A;  4EFB A;  4ZQI A;  3RAQ A;  4EGQ A;  2R8G A;  4C2M A;  3GQC A;  4ED0 A;  3BA8 A;  4HNU A;  3WNZ A;  1UC8 A;  3R5H A;  4DR2 H;  3G6Y A;  2HGS A;  1DIK A;  5FJ8 G;  2W7O A;  3BAA A;  1W93 A;  1ULZ A;  2HVQ A;  4YBZ B;  2FMR A;  2UU9 H;  2QK4 A;  2V58 A;  1UG8 A;  1E4G T;  3K3V A;  3FMA A;  4EFE A;  1EC6 A;  1J5K A;  2W6P A;  5IYB G;  1AUX A;  4YR2 A;  5BPH A;  4ECU A;  4E4T A;  4RU9 A;  3QFF A;  2R8H A;  2R93 G;  3T5K A;  2LTM A;  1VKZ A;  4WD3 A;  1V9P A;  2R92 A;  5KFK A;  4EG0 A;  2WTF A;  5KT6 A;  3LWB A;  4DL4 A;  1XNQ H;  3R5F A;  4YY3 H;  3K5I A;  4KHP H;  2M6Q A;  3SB1 A;  2R8I A;  5CA0 F;  5FD5 A;  1GO3 E;  3OUZ A;  3H40 A;  3HB9 A;  2JA7 A;  2YS7 A;  4MV4 A;  4BBR G;  5KFQ A;  1PX2 A;  2W70 A;  4JUZ A;  4A3C G;  3K3P A;  3DF7 A;  1WSC A;  4Q44 A;  5J2U F;  1ZZI A;  4BA2 I;  1X4N A;  5FPR A;  3SE7 A;  2XCP A;  2X06 A;  4A2B A;  3WO1 A;  4M7E A;  5L1J A;  2PQU A;  1HNW H;  5LYJ F;  4Q0Y A;  2HVR A;  1CQJ B;  4JI7 H;  5KFY A;  1IOV A;  3GII A;  1B04 A;  4UCO A;  1KHM A;  4DV4 H;  5LP6 F;  4J9L A;  2Z0S A;  4QWA A;  4J9M A;  5L9X A;  2ASJ A;  2W9B B;  4PDB A;  3K5H A;  3KHH A;  4J9O A;  4BXX G;  2JEG A;  4RAY A;  1BNC A;  5K2M A;  5C1P A;  1UNN C;  1AN7 A;  1TWG A;  2AGP A;  2CPM A;  1Y1V G;  1T94 A;  3GV5 B;  4A3L G;  2O4C A;  2OH2 A;  1KJ9 A;  2JA7 G;  2PY9 A;  2YYA A;  1KJI A;  3N40 P;  3GAB A;  2E5L H;  4HR7 A;  5KFW A;  1MSZ A;  1TWC A;  4FJU A;  1Z2N X;  5LMU H;  5IP7 G;  1RK5 A;  5FPO A;  2WB1 A;  4C5A A;  4J9N A;  5BR8 H;  4ME6 A;  5LL6 b;  4MV9 A;  1I6U A;  5FLM G;  4FS2 A;  4IWX A;  3BG5 A;  3FKI G;  2ASD A;  2BL5 A;  2PT7 G;  5DGA A;  2WAQ E;  3RB3 A;  2VA2 A;  2R7Z G;  2UVV A;  4LH6 A;  3PW4 A;  2QND A;  3V4Z A;  3LP8 A;  3Q1K A;  5C5J A;  2GLT A;  4MV3 A;  3V69 A;  1M0W A;  2WDT A;  1FVI A;  1AUV A;  2VKC A;  4E9J A;  2V59 A;  1GGO A;  1XRH A;  4G08 A;  2XGQ A;  2JEB I;  1N36 H;  3VPB A;  2BQ3 A;  3RIZ A;  2ZM6 H;  4UFZ A;  4MTE A;  4TQR A;  4OCH A;  3T1H H;  5T14 A;  5KFZ A;  3MR2 A;  3V6J A;  1RJR A;  4EGJ A;  3GTM A;  3J81 W;  4L1K A;  4Y8V B;  4BY7 G;  3GTP A;  4JI4 H;  1IOW A;  4U7C A;  1Y1W A;  3GIP A;  5KFJ A;  1S0N A;  1DV2 A;  5CB4 F;  1S03 G;  3NGD A;  1M0T A;  2YU9 A;  4YJ3 F;  1S0M A;  2V9W A;  4GC7 A;  4JI1 H;  4DV2 H;  2R7M A;  3OHB A;  2ZJT A;  2NVY A;  1K1S A;  1N32 H;  1VAJ A;  4DR7 H;  4A3K G;  5KFC A;  1JLL B;  2W6Z A;  4RZQ A;  3RBD A;  1RYS A;  1VBI A;  1GSA A;  2X0S A;  3KTM A;  4AQY H;  5C8Y F;  3U9T A;  3CQZ A;  5KT5 A;  1BGW A;  4DV0 H;  1TA8 A;  2WYO A;  5EWG A;  4TQS A;  3KHG A;  1X9N A;  3OHA A;  1EYZ A;  1I7N A;  3IG0 A;  4YHH H;  4ECV A;  4LH7 A;  4A3D G;  1KJJ A;  1DT4 A;  2D9I A;  2DWC A;  5KG6 A;  5KFN A;  1N34 H;  4YR0 A;  1KC7 A;  3FAU A;  4WAN A;  4QMF B;  2VPQ A;  4AYB A;  3HKZ E;  2ANN A;  3H4B A;  4CC5 A;  4TUY F;  4MTD A;  1GSO A;  2R7N A;  4J9P A;  4F4Y A;  4A3M G;  5KFP A;  5KG2 A;  3TQT A;  2ZDH A;  3Q8S B;  2W9A A;  4DR5 H;  3RGZ A;  3G6V A;  2FPI B;  2W8L A;  2OPV A;  2HVS A;  5FD6 A;  4HYK A;  2MCT A;  2JEI A;  4ZI7 F;  1E4F T;  4UCU A;  4A2A A;  5DQH A;  2FMA A;  3H3V H;  3ETH A;  5LMN H;  5EOY A;  4JI3 H;  2NU9 B;  1VBG A;  2FPH X;  5I47 A;  4XX0 B;  1EZ1 A;  3RAX A;  1Y1V A;  3AEV B;  4EBD A;  3EPI A;  4F4W A;  5K36 G;  2YRX A;  4U6P A;  1X9Z A;  3GIQ A;  4ECX A;  2CWF A;  5DT9 A;  4RB0 A;  2C2D A;  3H20 A;  2W6O A;  4K0K H;  3VMM A;  4J9S A;  1KJQ A;  2LF0 A;  1SYX B;  4BA1 I;  1SCU B;  4F4Z A;  3F8N A;  3H0G A;  3HOU G;  3MJF A;  1XMO H;  4DR4 H;  5KFA A;  2PVP A;  5KFT A;  4XYM B;  2V5A A;  1UC9 A;  4EYI B;  4AIM A;  3EZJ A;  4LF8 H;  4IWY A;  4OO1 G;  1OWT A;  4DR1 H;  3Q8P B;  5IT9 W;  3Q8Q B;  3GR5 A;  2JA5 G;  4LF4 H;  2UVW A;  3ORQ A;  2I87 A;  1WH2 A;  3V6K A;  1KJ8 A;  4JYA H;  4C5B A;  2W7P A;  4DV6 H;  1C3O A;  2LTL A;  1C30 A;  2E3U A;  4R8U A;  2VQF H;  2YZG A;  5F9N A;  2CQY A;  2VPS A;  3PR5 B;  4J9K A;  1ZTG A;  3KHL A;  1DGS A;  2ATL A;  4FBU A;  2W8K A;  4F50 A;  1E4E A;  3SI8 A;  2VUM A;  3OET A;  4GKK H;  5KFF A;  4RNM A;  2CZG A;  5KFR A;  4RNO A;  4A93 G;  2HH2 A;  2VQE H;  1KEE A;  4OX9 H;  4MV7 A;  1EUC B;  2C22 A;  3HOX G;  2CPQ A;  4X66 H;  4ECT A;  4X65 H;  2Q2U A;  1I7L A;  2W6N A;  3CVZ A;  4DUZ H;  3RF2 A;  4B8T A;  5LA6 F;  4PWQ A;  4A3E G;  4YR3 A;  5KG5 A;  1RYR A;  1J4W A;  4AM3 A;  4BBS G;  4ECZ A;  2JA6 G;  3C0F B;  5KFB A;  3PZP A;  1Z2I A;  1WR2 A;  1P8L A;  5DG9 A;  1TUA A;  5D1O B;  2AU0 A;  1Z2O X;  5KFS A;  3M9N B;  1PQX A;  2XC9 A;  5L1K A;  2FK3 A;  5H80 A;  3BQ2 A;  3BQ0 A;  4IR1 A;  3PR4 A;  4QWE A;  2K1H A;  3MFI A;  4C5C A;  2UXC H;  2I8C A;  2ALZ A;  4DL2 A;  4LF9 H;  1TWF A;  3WO0 A;  3TII A;  1S0O A;  2LRR A;  2V4R A;  4O3S A;  2IBK A;  4IRK A;  1IBM H;  2WB1 E;  3L4K A;  4R7R A;  2YCH A;  2HH3 A;  4QW8 A;  3PO3 G;  5BPF A;  2CKZ B;  2WE6 A;  1Y1W G;  3GV7 B;  2FLP A;  3AYH B;  4RNN A;  3N6X A;  3VKE A;  4O2B F;  4EYH B;  3RUP A;  3TQ1 A;  1B6S A;  3MR6 A;  3NCV A;  3V4S A;  4O2A F;  2V4Q A;  2CWH A;  2JE6 I;  1A0I A;  4O3R A;  4NZT M;  2YW2 A;  3UFX B;  5C0X G;  4DV3 H;  3KDK A;  4H8A A;  4ZHQ F;  3QD7 X;  4MV8 A;  4LF7 H;  2B63 G;  3MFH A;  4A3B G;  3V6H A;  3N41 B;  4I50 F;  5KX5 F;  5DLG A;  1FKA H;  5KFD A;  2UUB H;  2FE3 A;  2R84 A;  4RB2 C;  2VOB A;  2JEJ A;  5KFM A;  1N33 H;  5KFI A;  1BJT A;  4JV1 A;  4DV7 H;  3LML A;  3GTJ A;  4O4H F;  3QZ7 A;  4YAK B;  3MWD A;  3GIJ A;  4YB8 B;  3R5X A;  2CW8 A;  3L4J A;  3E5N A;  2R92 G;  2C35 B;  3KXY T;  1ZQ7 A;  4JV0 A;  2IP4 A;  3HBL A;  3GIL A;  3H4D A;  1SFO A;  4JV2 A;  5JH7 F;  4IHJ F;  2PMZ A;  5LXT F;  2HJW A;  3TIG A;  4ECQ A;  2CTL A;  2FK1 A;  2DLN A;  1X0A A;  1M6V A;  3RJ0 A;  4EBE A;  4WAL A;  3RBE A;  3IN5 A;  4IZO A;  2RDI A;  1HNZ H;  5JVL A;  3ETJ A;  4LF5 H;  2BQU A;  3GTQ A;  4F4X A;  1WCM G;  2CTJ A;  4RB1 A;  3GIM A;  2AXY A;  1Z2P X;  4YJ2 F;  1I50 A;  4IAJ A;  4WBN F;  3PN1 A;  2JEA I;  2VR1 A;  4J0M A;  5JEA G;  4B8C D;  4EEY A;  1L2Z A;  4O3P A;  2PBZ A;  3U1K A;  1V8C A;  3HOV G;  1HNX H;  2YZN A;  2JA9 A;  2NN6 G;  4NXN H;  4FJS A;  3M9M B;  4G3I A;  1B33 N;  1VIG A;  1E4E B;  5DG7 A;  2NUA B;  2CTE A;  4J9Q A;  4Q8E A;  3GKU A;  2B63 A;  1JXL A;  4JI8 H;  5KFL A;  4A3J G;  4JVY A;  3BAB A;  3JSN A;  4QJF A;  3GV8 B;  1ZHS A;  2R82 A;  2W9C A;  4ECS A;  3PW0 A;  1R9T A;  3BJY A;  1BXR A;  5L1I A;  4B3S H;  4ECY A;  1S97 A;  3GTK A;  1I94 H;  4ED3 A;  4IRC A;  2UUA H;  3BQ1 A;  4I55 F;  5EDW A;  3UQ8 A;  4BY1 G;  3GTO A;  3MWE A;  4I4T F;  4QWD A;  2OWO A;  5EWE A;  3GLK A;  5LOV F;  1CQI B;  1PK8 A;  5DQG A;  2SCU B;  3JRW A;  3JAM W;  2NU8 B;  4YAJ B;  1IBL H;  4B3M H;  3FDS A;  3JSL A;  4MV1 A;  4O3N A;  2FPP B;  5C4X G;  3BA9 A;  4TV9 F;  2DZD A;  4ED8 A;  4DR6 H;  2R6F A;  1VS0 A;  4O4L F;  1TWH A;  2ANR A;  3G8C A;  2FKL A;  2GPW A;  4NBQ A;  1B6R A;  5C1O A;  3I0P A;  4ED7 A;  2F4V H;  1WTJ A;  2CTF A;  4EEQ A;  4M9U A;  4QIW A;  1V9N A;  4TV8 F;  5KFV A;  4DL3 A;  5IWA H;  4LSX A;  2ASL A;  2VA3 A;  4BWS C;  2UVU A;  2R8J A;  4A3F G;  2R7K A;  5GON F;  1GSH A;  2I80 A;  3ORR A;  2R86 A;  4UCS A;  5JQW A;  2FLL A;  2J6T A;  4AYB E;  2E2I A;  1K83 A;  2XCL A;  1JIH A;  4X62 H;  2P0A A;  3QZ8 A;  3I4N G;  1SEI A;  1NXU A;  4FU0 A;  3HOZ G;  3GTG A;  1WE8 A;  1WHR A;  2Y0S A;  2DPI A;  4ED2 A;  2VUG A;  5KFE A;  1JKJ B;  3MR5 A;  4XZ3 B;  4RUA A;  1DTJ A;  2WAQ A;  5HV6 A;  2JA5 A;  4IR9 A;  3L7Z C;  1MZB A;  3OUU A;  3RFC A;  1J5E H;  2HHH H;  4JI0 H;  2FPG B;  2YS6 A;  2ZDG A;  1ZET A;  4FM9 A;  4QW9 A;  2YQR A;  1N56 A;  5L1L A;  1N48 A;  4MAM A;  2FJZ A;  4DR3 H;  2CW7 A;  4B3T H;  1T36 A;  2J6S A;  2BA0 A;  2GPS A;  2O03 A;  1JDE A;  3I12 A;  4X64 H;  3M9O B;  2BR0 A;  5D8D A;  3EYY A;  4HNT A;  3PVX A;  5KG1 A;  2DPJ A;  2UVR A;  1K1Q A;  3RB6 A;  2R87 A;  4NXM H;  5KT2 A;  1WVN A;  4APM A;  3T5J A;  3R23 A;  1M7J A;  2OLS A;  5KG0 A;  3PW2 A;  1EHI A;  5KG3 A;  3G6X A;  2J9G A;  5IYC G;  4ED6 A;  1S20 A;  1JDB B;  2NU6 B;  4O4I F;  3Q8R B;  2XGP A;  2P2R A;  4ECW A;  4DV1 H;  4DL5 A;  3OSP A;  2C2R A;  1HR0 H;  5KFU A;  4JI6 H;  3RB4 A;  2R7L A;  1JX4 A;  1W96 A;  5KG4 A;  2R7Z A;  5DGB A;  3KAJ A;  1FJG H;  1TAE A;  3JZI A;  3J7A K;  4RZR A;  1V4Y A;  3MWM A;  3VPC A;  3T1Y H;  3L2P A;  3HOW G;  2R93 A;  1XDN A;  1S9F A;  2R85 A;  2UXD H;  4UCV A;  1CE8 A;  5CAE B;  4JI5 H;  5DG8 A;  4ECR A;  3T5H A;  2RGR A;  4HNV A;  4Q8F A;  4J9R A;  4I7H A;  2JEF A;  4EC5 A;  1RJP A;  5DLF A;  2AGO A;  3U9S A;  4JV5 H; 
#chains in the Genus database with same CATH homology
 4B8C D;  4K0K H;  1L2Z A;  4CC6 A;  2LF0 A;  2ZQE A;  1SYX B;  4RAZ A;  5FPR A;  1HNX H;  3KAK A;  4A2B A;  1HNW H;  4M7E A;  3F8N A;  4Q0Y A;  2HVR A;  1XMO H;  4JI7 H;  4NXN H;  4DR4 H;  3M4I A;  1XMQ H;  1B04 A;  5A2Q W;  3DF7 A;  4UCO A;  4JI8 H;  3BAB A;  3JSN A;  3EZJ A;  4LF8 H;  1ZHS A;  3RGX A;  4UCR A;  4DV4 H;  4B3S H;  4DR1 H;  3OTO H;  5IT9 W;  3GR5 A;  4LFC H;  1I94 H;  4LF4 H;  1XNR H;  1ODH A;  2UUA H;  2UXB H;  4PDB A;  1WH2 A;  2RGV A;  4JYA H;  4OD6 A;  1IBK H;  4RAY A;  3UQ8 A;  4DV6 H;  2KSW A;  1AN7 A;  4LFB H;  2OWO A;  2VQF H;  2VPS A;  5D1O A;  2O4C A;  4LMY A;  1DGS A;  3JAM W;  1IBL H;  4B3M H;  4LFA H;  3JSL A;  3GAB A;  2E5L H;  3N40 P;  3OET A;  4NZR M;  4GKK H;  3BA9 A;  3KAL A;  1Z2N X;  5LMU H;  5FPO A;  2VQE H;  4LF6 H;  4OX9 H;  4DR6 H;  5BR8 H;  1VS0 A;  4MV7 A;  4MV9 A;  5LL6 b;  1I6U A;  4X66 H;  2PT7 G;  4X65 H;  4LSA A;  2Q2U A;  2F4V H;  1F0X A;  4EEQ A;  4LH6 A;  4B3R H;  3CVZ A;  4DUZ H;  2Q2T A;  3J80 W;  4DV5 H;  3RF2 A;  5IWA H;  4LSX A;  3OSS D;  1M0W A;  4BWS C;  2WDT A;  1GYF A;  1FVI A;  4JI2 H;  2VKC A;  3KDG A;  4GLX A;  4E9J A;  4UCS A;  3C0F B;  4G08 A;  4RB3 C;  1N36 H;  4X62 H;  1P8L A;  5D1O B;  1Z2O X;  1SEI A;  3RIZ A;  2ZM6 H;  1ZHQ A;  4UFZ A;  3RTX A;  2VUG A;  4MTE A;  5FLX W;  4OCH A;  3T1H H;  2W57 A;  4GKJ H;  2UXC H;  3J81 W;  4ETS A;  4LF9 H;  4JI4 H;  1MZB A;  1S03 G;  1IBM H;  1J5E H;  2HHH H;  4JI0 H;  1M0T A;  3N44 B;  2UUC H;  4R7R A;  3L4K A;  4FM9 A;  2YCH A;  4RB1 A;  2WE6 A;  4DR3 H;  1S68 A;  2CW7 A;  4B3T H;  4JI1 H;  3N43 B;  4DV2 H;  4UCT A;  3N6X A;  2O03 A;  1O75 A;  2ZJT A;  4DUY H;  1N32 H;  3NCV A;  4X64 H;  4DR7 H;  1A0I A;  3N42 B;  4NZT M;  4RZQ A;  3EYY A;  4DV3 H;  3KDK A;  3QD7 X;  4LF7 H;  2XIG A;  4AQY H;  4NXM H;  2Y3M A;  3N41 B;  1BGW A;  4APM A;  1FKA H;  4DV0 H;  1TA8 A;  2UUB H;  2FE3 A;  2WYO A;  3HXL A;  5D1P A;  4EFB A;  1X9N A;  4RB2 C;  2VOB A;  1N33 H;  1BJT A;  3BA8 A;  4DV7 H;  3IG0 A;  4YHH H;  3LML A;  4DR2 H;  4LH7 A;  2HGS A;  2CW8 A;  2D9I A;  3BAA A;  3L4J A;  4DV1 H;  1N34 H;  2HVQ A;  3FAU A;  3KXY T;  1HR0 H;  2UU9 H;  4JI6 H;  3K3V A;  1E4G T;  3FMA A;  4CC5 A;  4EFE A;  4MTD A;  3KAJ A;  1FJG H;  1TAE A;  3J7A K;  4DR5 H;  3RGZ A;  3MWM A;  1V9P A;  3RJ0 A;  2HVS A;  5FD6 A;  3T1Y H;  2MCT A;  3L2P A;  1HNZ H;  1E4F T;  1XNQ H;  4UCU A;  4LF5 H;  4A2A A;  4YY3 H;  1XDN A;  4KHP H;  2UXD H;  5LMN H;  3SB1 A;  4JI3 H;  4JI5 H;  1Z2P X;  4UCV A;  2FPH X;  5EOY A;  4IAJ A;  5FD5 A;  2RGR A;  3PN1 A;  4I7H A;  1X9Z A;  4EC5 A;  4RB0 A;  5DT9 A;  4J0M A;  3H20 A;  4JV5 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...