3J7AK

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
129
structure length
129
Chain Sequence
VRMSVLADCLKTINNAEKRGRRQVLIRPSSKVVIKFLQYMQKKGYIGSFEIVDDHRSGKIVVNLLGRINKCAVISPRYDVKLDEIEKIITSILPSRLFGHLILTTPYGIMDHEEARRKHTGGKVLGFFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 30
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3j7aK01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3j7aK02
5FLXW 5LL6b 5IT9W 4DR1H 2UXBH 4DR7H 4DV1H 1I94H 2UXDH 2E5LH 4DR4H 1FKAH 4DV2H 4JI1H 4DUYH 4LF9H 4DR3H 4JI4H 4JI6H 4DUZH 1HNXH 4B3MH 1AN7A 4YY3H 1HNWH 1XNRH 1IBKH 3RF2A 4X65H 4LF6H 1SEIA 4JI8H 4GKJH 4LF7H 3J80W 4GKKH 4JI2H 4LF5H 4DV5H 1N36H 4JYAH 1IBMH 4JV5H 1IBLH 1J5EH 1S03G 4X64H 1HR0H 2ZM6H 3T1HH 2VQEH 5LMUH 2VQFH 4DR5H 1N34H 4PDBA 4LF4H 1FJGH 4LF8H 5LMNH 5IWAH 1XMOH 2UUBH 2UXCH 4DR6H 3OTOH 4B3SH 2HHHH 4B3RH 1XNQH 4DR2H 1N33H 4X62H 3J7AK 4LFAH 4NXNH 4DV0H 1I6UA 4NXMH 4AQYH 3J81W 4X66H 4JI3H 5BR8H 3JAMW 2UUCH 4OX9H 4DV6H 4JI5H 4YHHH 4LFBH 4LFCH 4DV4H 3T1YH 1XMQH 4B3TH 4JI7H 2UUAH 5A2QW 4DV7H 2UU9H 1HNZH 1N32H 2F4VH 4K0KH 4DV3H 4KHPH 4JI0H
chains in the Genus database with same CATH superfamily
5FLXW 2NU6B 2Q2UA 2C22A 2FLNA 4MV7A 4O3SA 4NBQA 5LL6b 3VPBA 5BPFA 3Q8SB 2E2HA 2WB1E 2R7KA 3U1KA 2R86A 3HOUG 3Q8RB 2UVRA 3R5FA 4JV1A 5DT9A 4YR0A 4DL7A 1VKZA 3QZ8A 4AIMA 4UCOA 4JV2A 1I94H 4J9NA 4NLGA 3I4NG 3GTOA 3PW7A 3KHLA 1B04A 3PW5A 3FMAA 1GSAA 4IRDA 2XCLA 1WSCA 4MV8A 2V4RA 2NVXA 1KC7A 2AQ4A 1MZBA 4DR3H 1JLLB 4FU0A 1PQXA 3NCVA 4DUZH 3F8NA 4LSAA 2R84A 4EGJA 1AN7A 1VAJA 5KT2A 2W6QA 3SB1A 4ZQIA 1M0TA 3N44B 1DV1A 5LP6F 1IBKH 1W93A 4ECQA 3V6HA 3OSSD 1V8CA 5KFXA 2CZGA 3UFXB 2JVZA 5JVLA 3GIQA 4EBDA 1SYXB 2RGVA 5IP9G 1RK6A 3OHBA 3J80W 3RB6A 5KT6A 2W7OA 1E4EB 2V9WA 4FS2A 4A3DG 3GIPA 5DQIA 2FMRA 1PX2A 4YJ2F 4YAKB 5KFJA 2VKCA 3PO3G 4RZQA 2JA6A 5L1IA 2FJZA 1ZZIA 1DGSA 1J5KA 2K1HA 1J5EH 1IBLH 4EYIB 2M8WA 5KFDA 4LMYA 5KFGA 4Q43A 5KFCA 4X64H 4AYBE 2FPHX 2J6UA 1B6RA 1VIGA 1K1QA 2V5AA 2W70A 3HB9A 1O75A 5KFOA 2V58A 2YU9A 4FM9A 2AU0A 2VOBA 2XIGA 4MV9A 5KG5A 3BAAA 5F9LA 5J2UF 3G8CA 3GTLA 2YZMA 4LF4H 3M9MB 1FJGH 5IWAH 1XMOH 2UUBH 3GQCA 2B63G 3VMMA 2LF0A 2W71A 1TA8A 4RAYA 4AM3A 3PR4A 4ZI7F 5IYBG 3JSLA 3H4DA 1T94A 2CW7A 3FDSA 1RJRA 1TAEA 2PVPA 2JEJA 2CTKA 4FJSA 4ME6A 3OTOH 4ETSA 5C1OA 3HOVG 3V4ZA 4IRKA 2CPQA 4IZOA 3RB0A 3I12A 3VPDA 1N33H 3CVZA 3ETHA 4YAJB 3SI8A 3Q1KA 5KFTA 5LA6F 3GTMA 2ALZA 2YW2A 3K5HA 1I6UA 3U9SA 1UNNC 4MA0A 3Q8QB 3M9NB 3KTMA 2CPMA 2P2RA 3EZJA 3GV7B 4BY7G 2OLSA 2R93G 2HGSA 2KSWA 3KHHA 1KJIA 3AYHB 1V51A 3HBLA 2CTMA 4UCUA 2XCAA 4EC5A 4JV0A 4I7HA 4U7CA 4MTDA 2W8KA 3V6KA 2JA9A 1NXUA 3HKZA 3TINA 4XYMB 2RDIA 5D8DA 2R7ZA 4J9PA 4DV6H 1WCMG 2QNDA 4G08A 2R85A 3GTKA 2YCHA 1JX4A 1P8LA 2UVUA 4FJUA 5D1PA 5KG4A 3IN5A 4QWDA 2VPQA 4ECWA 5D1OA 4A3JG 4DV4H 1EHIA 1XMQH 4I4TF 4APMA 1X0AA 2ATLA 3N8DA 5KG6A 2VUMA 1W96A 4F4YA 2ASLA 4DV7H 5KG2A 3PW2A 3MWDA 4C5AA 1DIKA 1RJPA 2R7LA 4B8CD 1GO3E 4CC6A 4NZRM 1WE8A 2BR0A 2ASDA 2F4VH 4K0KH 4KHPH 5KFSA 3SE7A 3PW4A 2DGRA 3RAQA 2B63A 2HJWA 4IR9A 4UCSA 3L2PA 2MCTA 4H8AA 4I55F 5C0XG 2WAQE 3H0GG 4HR7A 2VPSA 2WTFA 2NU7B 1V9PA 2VA2A 4A3FG 4DV1H 2YS7A 3GLKA 3TQTA 2E3UA 2R8GA 4M9UA 1Y1VG 3Q2OA 4O3QA 2NUAB 3BJYA 1BXRA 1RYRA 5K2MA 5F9NA 2IBKA 1FKAH 2R93A 4JI1H 4MV4A 1Z2OX 2DLNA 2W57A 5KFFA 5JVDF 4O4IF 2LRRA 4JI4H 4JI6H 3MR2A 4A3KG 3ETJA 1I3QA 3GIKA 1V4YA 1EC6A 1AUXA 1EYZA 5EWGA 2J6TA 1WCMA 2FFMA 4TQRA 4IWYA 4ZHQF 1V9NA 4RUCA 3GV8B 2FK3A 2Y3MA 4A2AA 4X65H 3PO2G 1F0XA 5C4XG 4LF6H 4J9OA 2VQDA 4JI8H 2RF4A 3GIMA 1TWGA 1WHRA 2OWOA 4TV8F 5DLFA 4O3PA 2IA6A 1S20A 4GKKH 1I7NA 4YR3A 1XDNA 3QD7X 4R8UA 2V4QA 1DV2A 3L4KA 2CTJA 2M6QA 4WALA 3M9OB 3GR5A 1IBMH 3RB4A 4JV5H 1ZETA 2WYOA 3H3VH 3LMLA 2CQYA 3KAKA 1S03G 4MAMA 1S10A 2JA8G 5KFIA 2CTFA 3G6VA 4ED3A 5DQHA 2W6OA 4A3IG 2FLLA 4QW8A 4YP3A 1GYFA 4ECVA 4DR5H 3RAXA 5L1KA 2FB9A 2V59A 3N40P 2HVSA 3H0GA 3RUPA 4RB2C 1N34H 5DGAA 2CTEA 4PDBA 1T36A 3N6XA 2PQUA 3EPIA 2W9BA 1Y1VA 4NZTM 4BBRG 4EFEA 2MJHA 4J9MA 1JKJB 3HKZE 4HNVA 4F50A 4LIJA 4LF8H 1OWTA 5LMNH 2YRXA 4ED6A 2C2RA 1ZZKA 2C28A 5FJ8G 5KT5A 4E4TA 1N48A 3RTXA 4QIWA 1WH2A 2WDTA 3RV4A 1IOVA 2ZQEA 4E9JA 2DIKA 4MA5A 5BMVF 2OPUA 5KFKA 5IYCG 2DPIA 2BL5A 4B3SH 2R82A 4TUYF 4Q44A 1Y1WG 4B3RH 4QWEA 3K5IA 1XNQH 3QFFA 5IYDG 3RV3A 1JDBB 5C5JA 1CQIB 4MV3A 4QWAA 3MFIA 2JEIA 1R9TA 4A3EG 4ED0A 4C5CA 4UFZA 2FK2A 3I0PA 2C00A 4I50F 2DPJA 5KT3A 1ZQ7A 3KHGA 1EUCB 5FD5A 1XRHA 4RB3C 4XZ3B 1X4NA 3PZPA 5EDWA 2QK4A 4JI3H 2LTLA 5BPHA 4ED8A 1UG8A 4ED2A 4HNUA 3PR5B 2R8JA 2R8KA 2O03A 5JQWA 3EPGA 2VA3A 2A1SA 4OX9H 2CTLA 5FD6A 4XYLB 2X0SA 4JI5H 4O2AF 4TQSA 2JEAI 2W6NA 3T5LA 4ZOLF 4LFBH 2FKLA 1S9FA 3GIDA 4ED1A 2O4CA 1ODHA 3T1YH 4JI7H 2JEFA 2JE6I 2UUAH 2Y0SA 5FPOA 4J0MA 3PVXA 3T5KA 4DL2A 1ZHSA 3MFHA 1KJQA 3BA8A 1TUAA 1GSOA 3IG0A 3N42B 5I47A 4YR2A 2W9CA 3H20A 1A0IA 5KFUA 4OD6A 4YBZB 3V69A 4DV3H 3OUZA 3ORRA 4HYKA 1S0OA 4B8TA 2BQ3A 4Y8VB 5KKNB 3TQ1A 2R7ZG 2R8IA 2WB1A 4J9QA 1PK8A 4R7RA 2W6PA 2UXBH 1C3OA 1KJ8A 3BQ0A 4FS1A 4C5BA 5DG7A 4ECZA 2IMWP 1TWAA 5C8YF 4RNOA 2XGPA 2ANNA 1S0NA 5DG8A 5KFNA 2UXDH 4HQ6A 3GTGA 4LSXA 4J9RA 4A3BG 4F4WA 4DL5A 2NU8B 5KFVA 2NU9B 5FLMG 4DV2H 4A3GG 3WNZA 3BQ1A 1KEEA 5IP7G 5L9XA 5CA1F 2ANRA 2I8CA 4LF9H 4FBUA 1EUDB 3PW0A 3L7ZC 4Q8EA 1HNWH 1XNRH 3MWEA 5KFYA 1GSHA 1RYSA 4Q0YA 2FPPB 3BA9A 2CWHA 2JA5G 1SFOA 2HH3A 2YRWA 4WD3A 5LXTF 3HOZG 3M4IA 3RIZA 4EGQA 3KXYT 3GABA 3KALA 4A93G 4LF7H 5EZYF 2C2EA 5KFZA 2VUGA 4DL4A 4O3RA 2GPSA 3VPCA 5JUMA 4RUAA 2W6ZA 4F4ZA 4DV5H 3N41B 2FP4B 2JZXA 2C35B 4DL3A 4JYAH 5IYZF 3HOWG 3BQ2A 4M7EA 2YZNA 5D1OB 4QJFA 3HOXG 2PMZA 3OUUA 4UCVA 3EYYA 4AYBA 2YS6A 3MR6A 4EBEA 4ECTA 2AGQA 2D9IA 2VQFH 3HOYG 1B6SA 4DLKA 5KFPA 5KG0A 2NVYA 4O2BF 5L1JA 2GLTA 4BA2I 5JEAG 1ZTGA 5L1LA 4MV6A 4GC7A 4IAJA 2R92G 2AGPA 4JVHA 1N56A 4LH7A 4EYHB 1TWHA 4XX0B 5KFBA 4RU9A 2UXCH 1GGOA 3Q8PB 4DR6H 1Z2PX 3DF7A 1KJJA 2CKZB 1WTJA 2FE3A 2ZDGA 5KX5F 3C0FB 3OHAA 2HHHH 3G6XA 2NN6G 3FAUA 5HV6A 4QW9A 2FLPA 4DR2H 1E4GT 2Y0SE 3LWBA 4A3CG 4ECRA 2JA5A 3N43B 1EZ1A 1CS0A 4Q8FA 2JA6G 3PN1A 4A3LG 1Y14B 1CE8A 4X62H 1B33N 4J9SA 4EBCA 2BQUA 1UC8A 5EOYA 4CC5A 2IP4A 4ECXA 1ULZA 4BBSG 3CQZA 4AQYH 3GTPA 1VBGA 3L4JA 3E5NA 4X66H 5T14A 2LTMA 2DZDA 4O3NA 4IHJF 4RZRA 5JH7F 4QMFB 2WE6A 3RFCA 2BQRA 1VS0A 1E4EA 2UUCH 2R87A 4IFDG 4PWQA 3UQ8A 5C3EG 4JVYA 2XGQA 4DL6A 3KAJA 5CA0F 4UCTA 3GILA 1TWFA 2DWCA 4L1KA 4YHHH 4R8UB 4UCRA 4LFCH 4OCHA 2AXYA 1JDEA 4MV1A 3R5XA 4B3TH 2FK1A 4ECUA 1JXLA 4GLXA 5A2QW 2W6MA 4ECSA 4ECYA 5KFQA 4EEQA 1X9NA 2UU9H 1HNZH 5KG7A 1K1SA 3RBEA 3MJFA 3TIIA 4O4HF 2I87A 5DG9A 1X4MA 3GTJA 4RB0A 1BNCA 4WANA 2UVWA 2R92A 4JI0H 2YYAA 4YJ3F 5KT7A 3QZ7A 1MSZA 1ZHQA 5J2TF 1RJQA 4JUZA 5C1PA 5DGBA 1VBIA 1WVNA 4U6PA 5IT9W 5KFEA 2XC9A 4DR1H 2WAQA 2E2IA 3U9TA 2X06A 4DR7H 4BWSC 2W9BB 3V6JA 3OSPA 2JEGA 3JZIA 4IR1A 3GKUA 1BJTA 1E4FT 5KG1A 1I50A 2FPIB 2PT7G 2PBZA 5GONF 5KFHA 2I80A 2Z0SA 5KT4A 2E5LH 4DR4H 3GIJA 2RGRA 1AUVA 3OETA 2FMAA 3LP8A 4O4LF 1Z2IA 3WO1A 1VBHA 3HXLA 1J4WA 4DUYH 2PMZE 3R23A 5FPRA 5EWFA 1HNXH 2PY9A 4RNNA 4B3MH 5CAEB 4YY3H 4YQWA 4EEYA 2XCPA 3MR5A 1S0MA 2OH2A 4RNMA 2JA7G 2VUMG 4QWCA 3RF2A 3RBDA 3FKIG 3WO0A 5EWEA 2G8YA 1JIHA 1UC9A 4GKJH 3VKEA 2SCUB 2R8HA 3ORQA 1I7LA 5DQGA 1BGWA 3KDGA 1Y1WA 1KJ9A 3MWMA 4JI2H 2W7PA 2W9AA 4LF5H 1DT4A 3BG5A 5KFAA 4IRCA 3UOEA 1N36H 4RB1A 3AEVB 3TIGA 4LH6A 2ASJA 1S68A 1ZZJA 1FVIA 2CW8A 4EFBA 2M05A 2JEBI 2BA0A 1KBLA 1HR0H 2ZM6H 3T1HH 2VQEH 5LMUH 4IWXA 2R7MA 1C30A 2VR1A 2W9CB 4TV9F 2P0AA 3NGDA 3K3VA 2FPGB 4EG0A 4ED7A 2PN1A 3GV5B 1A9XA 4FBTA 1DTJA 2W8LA 4O3OA 4QWBA 4HNTA 4RAZA 3H4BA 1S97A 1KHMA 5K36G 2HH2A 4C2MA 2J6SA 5LOVF 5KFRA 1K83A 4OO1G 1M0WA 2JA7A 4QIWE 4WBNF 3MR3A 1VIHA 1TWCA 3I4MG 2YQRA 5KFLA 4A3MG 3G6YA 3H40A 4J9LA 2HVRA 2AGOA 1RK5A 4BY1G 3FKIA 3JRXA 2QYZA 1T3NA 3J7AK 3RJ0A 4LFAH 1L2ZA 4NXNH 4DV0H 4NXMH 1SCUB 1Z2NX 2CWFA 3T5HA 3J81W 5CB4F 2HVQA 2ZJTA 3V4SA 3KHRA 5C44G 5BR8H 2R6FA 3R5HA 4J9KA 4GC6A 3K3PA 4BXXG 3JAMW 3JRWA 2UVVA 1M7JA 2OPVA 1K1GA 3JSNA 4F4XA 4YB8B 4A2BA 1IOWA 3GIIA 2GPWA 1X9ZA 2RDJA 5KG3A 1GLVA 2Q2TA 5HBRB 3KDKA 5DLGA 2YZGA 1M6VA 1WR2A 5LYJF 3OSNA 2YL2A 3RB3A 5H80A 1CQJB 5KFMA 4MTEA 2ZDHA 4G3IA 3BABA 3RGZA 3GTQA 2J9GA 3RGXA 4BA1I 5KFWA 2XD4A 3T5JA 2R7NA 4Q45A 1N32H 1SEIA 2C2DA 2ZDQA
chains in the Genus database with same CATH topology
5FLXW 2Q2UA 1ZHQA 4MV7A 4UCSA 5LL6b 3L2PA 2MCTA 5IT9W 4R7RA 4DR1H 2UXBH 4DR7H 4BWSC 5DT9A 1BJTA 2VPSA 1E4FT 1V9PA 4UCOA 2PT7G 4DV1H 1I94H 2UXDH 4LSXA 2E5LH 1B04A 4DR4H 3FMAA 2RGRA 3OETA 1FKAH 4DV2H 4JI1H 1Z2OX 2W57A 3HXLA 4DUYH 4LF9H 4DR3H 1MZBA 4JI4H 4DUZH 3NCVA 1HNXH 4JI6H 3F8NA 4B3MH 1AN7A 4YY3H 1HNWH 1XNRH 3SB1A 1M0TA 3N44B 4Q0YA 3BA9A 1IBKH 3RF2A 2Y3MA 4A2AA 3OSSD 4X65H 1F0XA 3M4IA 3RIZA 4LF6H 1SEIA 3KXYT 3GABA 4JI8H 4GKJH 3KALA 2OWOA 1SYXB 2RGVA 4LF7H 3J80W 2VUGA 4GKKH 3KDGA 1BGWA 3MWMA 4JI2H 1XDNA 3QD7X 4LF5H 3L4KA 4DV5H 3N41B 5FPRA 2VKCA 1N36H 4RZQA 4JYAH 4RB1A 3GR5A 1IBMH 4LH6A 1S68A 4JV5H 1FVIA 2CW8A 2WYOA 4M7EA 3LMLA 5D1OB 4EFBA 1DGSA 1IBLH 1J5EH 3KAKA 1S03G 4UCVA 3EYYA 4LMYA 4X64H 1HR0H 2ZM6H 3T1HH 2VQEH 2D9IA 1GYFA 5LMUH 2FPHX 2VQFH 4DR5H 3N40P 2HVSA 1O75A 3K3VA 4FM9A 2VOBA 4RB2C 1N34H 2XIGA 4MV9A 4PDBA 3BAAA 3N6XA 4NZTM 4RAZA 4LF4H 4EFEA 4IAJA 1FJGH 4LF8H 4LH7A 5LMNH 5IWAH 1XMOH 2UUBH 2LF0A 1TA8A 4RAYA 3RTXA 1WH2A 2WDTA 3JSLA 2UXCH 2ZQEA 4E9JA 4DR6H 1TAEA 1M0WA 1Z2PX 2CW7A 3DF7A 2FE3A 3OTOH 4B3SH 4ETSA 3C0FB 2HHHH 3FAUA 4B3RH 1XNQH 4DR2H 1E4GT 2HVRA 1N33H 3CVZA 3N43B 3PN1A 4X62H 3J7AK 4LFAH 4UFZA 3RJ0A 1L2ZA 4NXNH 4DV0H 1I6UA 4NXMH 5EOYA 4CC5A 1Z2NX 3EZJA 4AQYH 5FD5A 4RB3C 2HGSA 3J81W 2KSWA 3L4JA 4UCUA 2HVQA 2ZJTA 4EC5A 4X66H 4JI3H 5BR8H 4I7HA 4MTDA 3JAMW 2WE6A 1VS0A 2O03A 2UUCH 3UQ8A 4OX9H 4DV6H 3JSNA 3KAJA 4A2BA 5FD6A 4UCTA 1X9ZA 4G08A 4JI5H 2Q2TA 4YHHH 2YCHA 1P8LA 4LFBH 3KDKA 4OCHA 4LFCH 4UCRA 5D1PA 5D1OA 2O4CA 4DV4H 3T1YH 1XMQH 1ODHA 4B3TH 4JI7H 2UUAH 5FPOA 4MTEA 4APMA 4J0MA 5A2QW 3BABA 4LSAA 3RGZA 4GLXA 1ZHSA 4EEQA 4DV7H 2UU9H 3RGXA 1X9NA 1HNZH 3BA8A 3IG0A 3N42B 4B8CD 4CC6A 4NZRM 4RB0A 3H20A 1N32H 1A0IA 4OD6A 2F4VH 4DV3H 4K0KH 4KHPH 4JI0H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX W;  5LL6 b;  5IT9 W;  4DR1 H;  2UXB H;  4DR7 H;  4DV1 H;  1I94 H;  2UXD H;  2E5L H;  4DR4 H;  1FKA H;  4DV2 H;  4JI1 H;  4DUY H;  4LF9 H;  4DR3 H;  4JI4 H;  4JI6 H;  4DUZ H;  1HNX H;  4B3M H;  1AN7 A;  4YY3 H;  1HNW H;  1XNR H;  1IBK H;  3RF2 A;  4X65 H;  4LF6 H;  1SEI A;  4JI8 H;  4GKJ H;  4LF7 H;  3J80 W;  4GKK H;  4JI2 H;  4LF5 H;  4DV5 H;  1N36 H;  4JYA H;  1IBM H;  4JV5 H;  1IBL H;  1J5E H;  1S03 G;  4X64 H;  1HR0 H;  2ZM6 H;  3T1H H;  2VQE H;  5LMU H;  2VQF H;  4DR5 H;  1N34 H;  4PDB A;  4LF4 H;  1FJG H;  4LF8 H;  5LMN H;  5IWA H;  1XMO H;  2UUB H;  2UXC H;  4DR6 H;  3OTO H;  4B3S H;  2HHH H;  4B3R H;  1XNQ H;  4DR2 H;  1N33 H;  4X62 H;  3J7A K;  4LFA H;  4NXN H;  4DV0 H;  1I6U A;  4NXM H;  4AQY H;  3J81 W;  4X66 H;  4JI3 H;  5BR8 H;  3JAM W;  2UUC H;  4OX9 H;  4DV6 H;  4JI5 H;  4YHH H;  4LFB H;  4LFC H;  4DV4 H;  3T1Y H;  1XMQ H;  4B3T H;  4JI7 H;  2UUA H;  5A2Q W;  4DV7 H;  2UU9 H;  1HNZ H;  1N32 H;  2F4V H;  4K0K H;  4DV3 H;  4KHP H;  4JI0 H; 
#chains in the Genus database with same CATH topology
 5FLX W;  2NU6 B;  2Q2U A;  2C22 A;  2FLN A;  4MV7 A;  4O3S A;  4NBQ A;  5LL6 b;  3VPB A;  5BPF A;  3Q8S B;  2E2H A;  2WB1 E;  2R7K A;  3U1K A;  2R86 A;  3HOU G;  3Q8R B;  2UVR A;  3R5F A;  4JV1 A;  5DT9 A;  4YR0 A;  4DL7 A;  1VKZ A;  3QZ8 A;  4AIM A;  4UCO A;  4JV2 A;  1I94 H;  4J9N A;  4NLG A;  3I4N G;  3GTO A;  3PW7 A;  3KHL A;  1B04 A;  3PW5 A;  3FMA A;  1GSA A;  4IRD A;  2XCL A;  1WSC A;  4MV8 A;  2V4R A;  2NVX A;  1KC7 A;  2AQ4 A;  1MZB A;  4DR3 H;  1JLL B;  4FU0 A;  1PQX A;  3NCV A;  4DUZ H;  3F8N A;  4LSA A;  2R84 A;  4EGJ A;  1AN7 A;  1VAJ A;  5KT2 A;  2W6Q A;  3SB1 A;  4ZQI A;  1M0T A;  3N44 B;  1DV1 A;  5LP6 F;  1IBK H;  1W93 A;  4ECQ A;  3V6H A;  3OSS D;  1V8C A;  5KFX A;  2CZG A;  3UFX B;  2JVZ A;  5JVL A;  3GIQ A;  4EBD A;  1SYX B;  2RGV A;  5IP9 G;  1RK6 A;  3OHB A;  3J80 W;  3RB6 A;  5KT6 A;  2W7O A;  1E4E B;  2V9W A;  4FS2 A;  4A3D G;  3GIP A;  5DQI A;  2FMR A;  1PX2 A;  4YJ2 F;  4YAK B;  5KFJ A;  2VKC A;  3PO3 G;  4RZQ A;  2JA6 A;  5L1I A;  2FJZ A;  1ZZI A;  1DGS A;  1J5K A;  2K1H A;  1J5E H;  1IBL H;  4EYI B;  2M8W A;  5KFD A;  4LMY A;  5KFG A;  4Q43 A;  5KFC A;  4X64 H;  4AYB E;  2FPH X;  2J6U A;  1B6R A;  1VIG A;  1K1Q A;  2V5A A;  2W70 A;  3HB9 A;  1O75 A;  5KFO A;  2V58 A;  2YU9 A;  4FM9 A;  2AU0 A;  2VOB A;  2XIG A;  4MV9 A;  5KG5 A;  3BAA A;  5F9L A;  5J2U F;  3G8C A;  3GTL A;  2YZM A;  4LF4 H;  3M9M B;  1FJG H;  5IWA H;  1XMO H;  2UUB H;  3GQC A;  2B63 G;  3VMM A;  2LF0 A;  2W71 A;  1TA8 A;  4RAY A;  4AM3 A;  3PR4 A;  4ZI7 F;  5IYB G;  3JSL A;  3H4D A;  1T94 A;  2CW7 A;  3FDS A;  1RJR A;  1TAE A;  2PVP A;  2JEJ A;  2CTK A;  4FJS A;  4ME6 A;  3OTO H;  4ETS A;  5C1O A;  3HOV G;  3V4Z A;  4IRK A;  2CPQ A;  4IZO A;  3RB0 A;  3I12 A;  3VPD A;  1N33 H;  3CVZ A;  3ETH A;  4YAJ B;  3SI8 A;  3Q1K A;  5KFT A;  5LA6 F;  3GTM A;  2ALZ A;  2YW2 A;  3K5H A;  1I6U A;  3U9S A;  1UNN C;  4MA0 A;  3Q8Q B;  3M9N B;  3KTM A;  2CPM A;  2P2R A;  3EZJ A;  3GV7 B;  4BY7 G;  2OLS A;  2R93 G;  2HGS A;  2KSW A;  3KHH A;  1KJI A;  3AYH B;  1V51 A;  3HBL A;  2CTM A;  4UCU A;  2XCA A;  4EC5 A;  4JV0 A;  4I7H A;  4U7C A;  4MTD A;  2W8K A;  3V6K A;  2JA9 A;  1NXU A;  3HKZ A;  3TIN A;  4XYM B;  2RDI A;  5D8D A;  2R7Z A;  4J9P A;  4DV6 H;  1WCM G;  2QND A;  4G08 A;  2R85 A;  3GTK A;  2YCH A;  1JX4 A;  1P8L A;  2UVU A;  4FJU A;  5D1P A;  5KG4 A;  3IN5 A;  4QWD A;  2VPQ A;  4ECW A;  5D1O A;  4A3J G;  4DV4 H;  1EHI A;  1XMQ H;  4I4T F;  4APM A;  1X0A A;  2ATL A;  3N8D A;  5KG6 A;  2VUM A;  1W96 A;  4F4Y A;  2ASL A;  4DV7 H;  5KG2 A;  3PW2 A;  3MWD A;  4C5A A;  1DIK A;  1RJP A;  2R7L A;  4B8C D;  1GO3 E;  4CC6 A;  4NZR M;  1WE8 A;  2BR0 A;  2ASD A;  2F4V H;  4K0K H;  4KHP H;  5KFS A;  3SE7 A;  3PW4 A;  2DGR A;  3RAQ A;  2B63 A;  2HJW A;  4IR9 A;  4UCS A;  3L2P A;  2MCT A;  4H8A A;  4I55 F;  5C0X G;  2WAQ E;  3H0G G;  4HR7 A;  2VPS A;  2WTF A;  2NU7 B;  1V9P A;  2VA2 A;  4A3F G;  4DV1 H;  2YS7 A;  3GLK A;  3TQT A;  2E3U A;  2R8G A;  4M9U A;  1Y1V G;  3Q2O A;  4O3Q A;  2NUA B;  3BJY A;  1BXR A;  1RYR A;  5K2M A;  5F9N A;  2IBK A;  1FKA H;  2R93 A;  4JI1 H;  4MV4 A;  1Z2O X;  2DLN A;  2W57 A;  5KFF A;  5JVD F;  4O4I F;  2LRR A;  4JI4 H;  4JI6 H;  3MR2 A;  4A3K G;  3ETJ A;  1I3Q A;  3GIK A;  1V4Y A;  1EC6 A;  1AUX A;  1EYZ A;  5EWG A;  2J6T A;  1WCM A;  2FFM A;  4TQR A;  4IWY A;  4ZHQ F;  1V9N A;  4RUC A;  3GV8 B;  2FK3 A;  2Y3M A;  4A2A A;  4X65 H;  3PO2 G;  1F0X A;  5C4X G;  4LF6 H;  4J9O A;  2VQD A;  4JI8 H;  2RF4 A;  3GIM A;  1TWG A;  1WHR A;  2OWO A;  4TV8 F;  5DLF A;  4O3P A;  2IA6 A;  1S20 A;  4GKK H;  1I7N A;  4YR3 A;  1XDN A;  3QD7 X;  4R8U A;  2V4Q A;  1DV2 A;  3L4K A;  2CTJ A;  2M6Q A;  4WAL A;  3M9O B;  3GR5 A;  1IBM H;  3RB4 A;  4JV5 H;  1ZET A;  2WYO A;  3H3V H;  3LML A;  2CQY A;  3KAK A;  1S03 G;  4MAM A;  1S10 A;  2JA8 G;  5KFI A;  2CTF A;  3G6V A;  4ED3 A;  5DQH A;  2W6O A;  4A3I G;  2FLL A;  4QW8 A;  4YP3 A;  1GYF A;  4ECV A;  4DR5 H;  3RAX A;  5L1K A;  2FB9 A;  2V59 A;  3N40 P;  2HVS A;  3H0G A;  3RUP A;  4RB2 C;  1N34 H;  5DGA A;  2CTE A;  4PDB A;  1T36 A;  3N6X A;  2PQU A;  3EPI A;  2W9B A;  1Y1V A;  4NZT M;  4BBR G;  4EFE A;  2MJH A;  4J9M A;  1JKJ B;  3HKZ E;  4HNV A;  4F50 A;  4LIJ A;  4LF8 H;  1OWT A;  5LMN H;  2YRX A;  4ED6 A;  2C2R A;  1ZZK A;  2C28 A;  5FJ8 G;  5KT5 A;  4E4T A;  1N48 A;  3RTX A;  4QIW A;  1WH2 A;  2WDT A;  3RV4 A;  1IOV A;  2ZQE A;  4E9J A;  2DIK A;  4MA5 A;  5BMV F;  2OPU A;  5KFK A;  5IYC G;  2DPI A;  2BL5 A;  4B3S H;  2R82 A;  4TUY F;  4Q44 A;  1Y1W G;  4B3R H;  4QWE A;  3K5I A;  1XNQ H;  3QFF A;  5IYD G;  3RV3 A;  1JDB B;  5C5J A;  1CQI B;  4MV3 A;  4QWA A;  3MFI A;  2JEI A;  1R9T A;  4A3E G;  4ED0 A;  4C5C A;  4UFZ A;  2FK2 A;  3I0P A;  2C00 A;  4I50 F;  2DPJ A;  5KT3 A;  1ZQ7 A;  3KHG A;  1EUC B;  5FD5 A;  1XRH A;  4RB3 C;  4XZ3 B;  1X4N A;  3PZP A;  5EDW A;  2QK4 A;  4JI3 H;  2LTL A;  5BPH A;  4ED8 A;  1UG8 A;  4ED2 A;  4HNU A;  3PR5 B;  2R8J A;  2R8K A;  2O03 A;  5JQW A;  3EPG A;  2VA3 A;  2A1S A;  4OX9 H;  2CTL A;  5FD6 A;  4XYL B;  2X0S A;  4JI5 H;  4O2A F;  4TQS A;  2JEA I;  2W6N A;  3T5L A;  4ZOL F;  4LFB H;  2FKL A;  1S9F A;  3GID A;  4ED1 A;  2O4C A;  1ODH A;  3T1Y H;  4JI7 H;  2JEF A;  2JE6 I;  2UUA H;  2Y0S A;  5FPO A;  4J0M A;  3PVX A;  3T5K A;  4DL2 A;  1ZHS A;  3MFH A;  1KJQ A;  3BA8 A;  1TUA A;  1GSO A;  3IG0 A;  3N42 B;  5I47 A;  4YR2 A;  2W9C A;  3H20 A;  1A0I A;  5KFU A;  4OD6 A;  4YBZ B;  3V69 A;  4DV3 H;  3OUZ A;  3ORR A;  4HYK A;  1S0O A;  4B8T A;  2BQ3 A;  4Y8V B;  5KKN B;  3TQ1 A;  2R7Z G;  2R8I A;  2WB1 A;  4J9Q A;  1PK8 A;  4R7R A;  2W6P A;  2UXB H;  1C3O A;  1KJ8 A;  3BQ0 A;  4FS1 A;  4C5B A;  5DG7 A;  4ECZ A;  2IMW P;  1TWA A;  5C8Y F;  4RNO A;  2XGP A;  2ANN A;  1S0N A;  5DG8 A;  5KFN A;  2UXD H;  4HQ6 A;  3GTG A;  4LSX A;  4J9R A;  4A3B G;  4F4W A;  4DL5 A;  2NU8 B;  5KFV A;  2NU9 B;  5FLM G;  4DV2 H;  4A3G G;  3WNZ A;  3BQ1 A;  1KEE A;  5IP7 G;  5L9X A;  5CA1 F;  2ANR A;  2I8C A;  4LF9 H;  4FBU A;  1EUD B;  3PW0 A;  3L7Z C;  4Q8E A;  1HNW H;  1XNR H;  3MWE A;  5KFY A;  1GSH A;  1RYS A;  4Q0Y A;  2FPP B;  3BA9 A;  2CWH A;  2JA5 G;  1SFO A;  2HH3 A;  2YRW A;  4WD3 A;  5LXT F;  3HOZ G;  3M4I A;  3RIZ A;  4EGQ A;  3KXY T;  3GAB A;  3KAL A;  4A93 G;  4LF7 H;  5EZY F;  2C2E A;  5KFZ A;  2VUG A;  4DL4 A;  4O3R A;  2GPS A;  3VPC A;  5JUM A;  4RUA A;  2W6Z A;  4F4Z A;  4DV5 H;  3N41 B;  2FP4 B;  2JZX A;  2C35 B;  4DL3 A;  4JYA H;  5IYZ F;  3HOW G;  3BQ2 A;  4M7E A;  2YZN A;  5D1O B;  4QJF A;  3HOX G;  2PMZ A;  3OUU A;  4UCV A;  3EYY A;  4AYB A;  2YS6 A;  3MR6 A;  4EBE A;  4ECT A;  2AGQ A;  2D9I A;  2VQF H;  3HOY G;  1B6S A;  4DLK A;  5KFP A;  5KG0 A;  2NVY A;  4O2B F;  5L1J A;  2GLT A;  4BA2 I;  5JEA G;  1ZTG A;  5L1L A;  4MV6 A;  4GC7 A;  4IAJ A;  2R92 G;  2AGP A;  4JVH A;  1N56 A;  4LH7 A;  4EYH B;  1TWH A;  4XX0 B;  5KFB A;  4RU9 A;  2UXC H;  1GGO A;  3Q8P B;  4DR6 H;  1Z2P X;  3DF7 A;  1KJJ A;  2CKZ B;  1WTJ A;  2FE3 A;  2ZDG A;  5KX5 F;  3C0F B;  3OHA A;  2HHH H;  3G6X A;  2NN6 G;  3FAU A;  5HV6 A;  4QW9 A;  2FLP A;  4DR2 H;  1E4G T;  2Y0S E;  3LWB A;  4A3C G;  4ECR A;  2JA5 A;  3N43 B;  1EZ1 A;  1CS0 A;  4Q8F A;  2JA6 G;  3PN1 A;  4A3L G;  1Y14 B;  1CE8 A;  4X62 H;  1B33 N;  4J9S A;  4EBC A;  2BQU A;  1UC8 A;  5EOY A;  4CC5 A;  2IP4 A;  4ECX A;  1ULZ A;  4BBS G;  3CQZ A;  4AQY H;  3GTP A;  1VBG A;  3L4J A;  3E5N A;  4X66 H;  5T14 A;  2LTM A;  2DZD A;  4O3N A;  4IHJ F;  4RZR A;  5JH7 F;  4QMF B;  2WE6 A;  3RFC A;  2BQR A;  1VS0 A;  1E4E A;  2UUC H;  2R87 A;  4IFD G;  4PWQ A;  3UQ8 A;  5C3E G;  4JVY A;  2XGQ A;  4DL6 A;  3KAJ A;  5CA0 F;  4UCT A;  3GIL A;  1TWF A;  2DWC A;  4L1K A;  4YHH H;  4R8U B;  4UCR A;  4LFC H;  4OCH A;  2AXY A;  1JDE A;  4MV1 A;  3R5X A;  4B3T H;  2FK1 A;  4ECU A;  1JXL A;  4GLX A;  5A2Q W;  2W6M A;  4ECS A;  4ECY A;  5KFQ A;  4EEQ A;  1X9N A;  2UU9 H;  1HNZ H;  5KG7 A;  1K1S A;  3RBE A;  3MJF A;  3TII A;  4O4H F;  2I87 A;  5DG9 A;  1X4M A;  3GTJ A;  4RB0 A;  1BNC A;  4WAN A;  2UVW A;  2R92 A;  4JI0 H;  2YYA A;  4YJ3 F;  5KT7 A;  3QZ7 A;  1MSZ A;  1ZHQ A;  5J2T F;  1RJQ A;  4JUZ A;  5C1P A;  5DGB A;  1VBI A;  1WVN A;  4U6P A;  5IT9 W;  5KFE A;  2XC9 A;  4DR1 H;  2WAQ A;  2E2I A;  3U9T A;  2X06 A;  4DR7 H;  4BWS C;  2W9B B;  3V6J A;  3OSP A;  2JEG A;  3JZI A;  4IR1 A;  3GKU A;  1BJT A;  1E4F T;  5KG1 A;  1I50 A;  2FPI B;  2PT7 G;  2PBZ A;  5GON F;  5KFH A;  2I80 A;  2Z0S A;  5KT4 A;  2E5L H;  4DR4 H;  3GIJ A;  2RGR A;  1AUV A;  3OET A;  2FMA A;  3LP8 A;  4O4L F;  1Z2I A;  3WO1 A;  1VBH A;  3HXL A;  1J4W A;  4DUY H;  2PMZ E;  3R23 A;  5FPR A;  5EWF A;  1HNX H;  2PY9 A;  4RNN A;  4B3M H;  5CAE B;  4YY3 H;  4YQW A;  4EEY A;  2XCP A;  3MR5 A;  1S0M A;  2OH2 A;  4RNM A;  2JA7 G;  2VUM G;  4QWC A;  3RF2 A;  3RBD A;  3FKI G;  3WO0 A;  5EWE A;  2G8Y A;  1JIH A;  1UC9 A;  4GKJ H;  3VKE A;  2SCU B;  2R8H A;  3ORQ A;  1I7L A;  5DQG A;  1BGW A;  3KDG A;  1Y1W A;  1KJ9 A;  3MWM A;  4JI2 H;  2W7P A;  2W9A A;  4LF5 H;  1DT4 A;  3BG5 A;  5KFA A;  4IRC A;  3UOE A;  1N36 H;  4RB1 A;  3AEV B;  3TIG A;  4LH6 A;  2ASJ A;  1S68 A;  1ZZJ A;  1FVI A;  2CW8 A;  4EFB A;  2M05 A;  2JEB I;  2BA0 A;  1KBL A;  1HR0 H;  2ZM6 H;  3T1H H;  2VQE H;  5LMU H;  4IWX A;  2R7M A;  1C30 A;  2VR1 A;  2W9C B;  4TV9 F;  2P0A A;  3NGD A;  3K3V A;  2FPG B;  4EG0 A;  4ED7 A;  2PN1 A;  3GV5 B;  1A9X A;  4FBT A;  1DTJ A;  2W8L A;  4O3O A;  4QWB A;  4HNT A;  4RAZ A;  3H4B A;  1S97 A;  1KHM A;  5K36 G;  2HH2 A;  4C2M A;  2J6S A;  5LOV F;  5KFR A;  1K83 A;  4OO1 G;  1M0W A;  2JA7 A;  4QIW E;  4WBN F;  3MR3 A;  1VIH A;  1TWC A;  3I4M G;  2YQR A;  5KFL A;  4A3M G;  3G6Y A;  3H40 A;  4J9L A;  2HVR A;  2AGO A;  1RK5 A;  4BY1 G;  3FKI A;  3JRX A;  2QYZ A;  1T3N A;  3J7A K;  3RJ0 A;  4LFA H;  1L2Z A;  4NXN H;  4DV0 H;  4NXM H;  1SCU B;  1Z2N X;  2CWF A;  3T5H A;  3J81 W;  5CB4 F;  2HVQ A;  2ZJT A;  3V4S A;  3KHR A;  5C44 G;  5BR8 H;  2R6F A;  3R5H A;  4J9K A;  4GC6 A;  3K3P A;  4BXX G;  3JAM W;  3JRW A;  2UVV A;  1M7J A;  2OPV A;  1K1G A;  3JSN A;  4F4X A;  4YB8 B;  4A2B A;  1IOW A;  3GII A;  2GPW A;  1X9Z A;  2RDJ A;  5KG3 A;  1GLV A;  2Q2T A;  5HBR B;  3KDK A;  5DLG A;  2YZG A;  1M6V A;  1WR2 A;  5LYJ F;  3OSN A;  2YL2 A;  3RB3 A;  5H80 A;  1CQJ B;  5KFM A;  4MTE A;  2ZDH A;  4G3I A;  3BAB A;  3RGZ A;  3GTQ A;  2J9G A;  3RGX A;  4BA1 I;  5KFW A;  2XD4 A;  3T5J A;  2R7N A;  4Q45 A;  1N32 H;  1SEI A;  2C2D A;  2ZDQ A; 
#chains in the Genus database with same CATH homology
 5FLX W;  2Q2U A;  1ZHQ A;  4MV7 A;  4UCS A;  5LL6 b;  3L2P A;  2MCT A;  5IT9 W;  4R7R A;  4DR1 H;  2UXB H;  4DR7 H;  4BWS C;  5DT9 A;  1BJT A;  2VPS A;  1E4F T;  1V9P A;  4UCO A;  2PT7 G;  4DV1 H;  1I94 H;  2UXD H;  4LSX A;  2E5L H;  1B04 A;  4DR4 H;  3FMA A;  2RGR A;  3OET A;  1FKA H;  4DV2 H;  4JI1 H;  1Z2O X;  2W57 A;  3HXL A;  4DUY H;  4LF9 H;  4DR3 H;  1MZB A;  4JI4 H;  4DUZ H;  3NCV A;  1HNX H;  4JI6 H;  3F8N A;  4B3M H;  1AN7 A;  4YY3 H;  1HNW H;  1XNR H;  3SB1 A;  1M0T A;  3N44 B;  4Q0Y A;  3BA9 A;  1IBK H;  3RF2 A;  2Y3M A;  4A2A A;  3OSS D;  4X65 H;  1F0X A;  3M4I A;  3RIZ A;  4LF6 H;  1SEI A;  3KXY T;  3GAB A;  4JI8 H;  4GKJ H;  3KAL A;  2OWO A;  1SYX B;  2RGV A;  4LF7 H;  3J80 W;  2VUG A;  4GKK H;  3KDG A;  1BGW A;  3MWM A;  4JI2 H;  1XDN A;  3QD7 X;  4LF5 H;  3L4K A;  4DV5 H;  3N41 B;  5FPR A;  2VKC A;  1N36 H;  4RZQ A;  4JYA H;  4RB1 A;  3GR5 A;  1IBM H;  4LH6 A;  1S68 A;  4JV5 H;  1FVI A;  2CW8 A;  2WYO A;  4M7E A;  3LML A;  5D1O B;  4EFB A;  1DGS A;  1IBL H;  1J5E H;  3KAK A;  1S03 G;  4UCV A;  3EYY A;  4LMY A;  4X64 H;  1HR0 H;  2ZM6 H;  3T1H H;  2VQE H;  2D9I A;  1GYF A;  5LMU H;  2FPH X;  2VQF H;  4DR5 H;  3N40 P;  2HVS A;  1O75 A;  3K3V A;  4FM9 A;  2VOB A;  4RB2 C;  1N34 H;  2XIG A;  4MV9 A;  4PDB A;  3BAA A;  3N6X A;  4NZT M;  4RAZ A;  4LF4 H;  4EFE A;  4IAJ A;  1FJG H;  4LF8 H;  4LH7 A;  5LMN H;  5IWA H;  1XMO H;  2UUB H;  2LF0 A;  1TA8 A;  4RAY A;  3RTX A;  1WH2 A;  2WDT A;  3JSL A;  2UXC H;  2ZQE A;  4E9J A;  4DR6 H;  1TAE A;  1M0W A;  1Z2P X;  2CW7 A;  3DF7 A;  2FE3 A;  3OTO H;  4B3S H;  4ETS A;  3C0F B;  2HHH H;  3FAU A;  4B3R H;  1XNQ H;  4DR2 H;  1E4G T;  2HVR A;  1N33 H;  3CVZ A;  3N43 B;  3PN1 A;  4X62 H;  3J7A K;  4LFA H;  4UFZ A;  3RJ0 A;  1L2Z A;  4NXN H;  4DV0 H;  1I6U A;  4NXM H;  5EOY A;  4CC5 A;  1Z2N X;  3EZJ A;  4AQY H;  5FD5 A;  4RB3 C;  2HGS A;  3J81 W;  2KSW A;  3L4J A;  4UCU A;  2HVQ A;  2ZJT A;  4EC5 A;  4X66 H;  4JI3 H;  5BR8 H;  4I7H A;  4MTD A;  3JAM W;  2WE6 A;  1VS0 A;  2O03 A;  2UUC H;  3UQ8 A;  4OX9 H;  4DV6 H;  3JSN A;  3KAJ A;  4A2B A;  5FD6 A;  4UCT A;  1X9Z A;  4G08 A;  4JI5 H;  2Q2T A;  4YHH H;  2YCH A;  1P8L A;  4LFB H;  3KDK A;  4OCH A;  4LFC H;  4UCR A;  5D1P A;  5D1O A;  2O4C A;  4DV4 H;  3T1Y H;  1XMQ H;  1ODH A;  4B3T H;  4JI7 H;  2UUA H;  5FPO A;  4MTE A;  4APM A;  4J0M A;  5A2Q W;  3BAB A;  4LSA A;  3RGZ A;  4GLX A;  1ZHS A;  4EEQ A;  4DV7 H;  2UU9 H;  3RGX A;  1X9N A;  1HNZ H;  3BA8 A;  3IG0 A;  3N42 B;  4B8C D;  4CC6 A;  4NZR M;  4RB0 A;  3H20 A;  1N32 H;  1A0I A;  4OD6 A;  2F4V H;  4DV3 H;  4K0K H;  4KHP H;  4JI0 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...