3J7AK

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
129
structure length
129
Chain Sequence
VRMSVLADCLKTINNAEKRGRRQVLIRPSSKVVIKFLQYMQKKGYIGSFEIVDDHRSGKIVVNLLGRINKCAVISPRYDVKLDEIEKIITSILPSRLFGHLILTTPYGIMDHEEARRKHTGGKVLGFFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/inhibitor
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
total genus 30
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3j7aK01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3j7aK02
4DR5H 4DUYH 3T1HH 2UXDH 1N32H 4JI6H 2UUBH 4JI0H 2VQEH 3J80W 4DR4H 4LF6H 1FJGH 1HNXH 4LFBH 1XNRH 4LFAH 4JI2H 3T1YH 4NXNH 4DV5H 2E5LH 4JI3H 2UUAH 4JV5H 4DR1H 4K0KH 4X65H 4DV6H 4KHPH 1I94H 3J7AK 4B3TH 2F4VH 4OX9H 5LMUH 3JAMW 3J81W 3OTOH 1J5EH 4B3RH 1AN7A 5LMNH 1IBKH 2ZM6H 1XNQH 4DR3H 4DR7H 4LF8H 4JI5H 1HNZH 2UUCH 1SEIA 5BR8H 4X62H 1XMOH 1N33H 4YY3H 1IBLH 4GKKH 4DV4H 4X66H 4DR2H 5LL6b 4JYAH 4JI7H 4DR6H 4B3MH 4DV0H 5IWAH 5A2QW 4LF4H 4X64H 4JI1H 1S03G 4PDBA 5FLXW 4AQYH 1N34H 2UXCH 4YHHH 1N36H 2HHHH 4JI4H 4DV3H 4DUZH 5IT9W 4LF9H 2UU9H 4NXMH 4DV1H 1HNWH 1HR0H 1XMQH 4DV2H 4DV7H 1I6UA 2UXBH 4LF7H 1IBMH 1FKAH 4GKJH 4LF5H 4LFCH 3RF2A 4JI8H 2VQFH 4B3SH
chains in the Genus database with same CATH superfamily
2CTKA 1JKJB 4DR5H 2VQDA 1L2ZA 3SE7A 3T1HH 4HNTA 2UXDH 3HXLA 2UVWA 1N32H 4ED1A 1VIHA 3KHRA 4IRCA 3HOVG 5KG6A 4YP3A 4O3SA 2PY9A 2VA2A 1EUCB 2Q2UA 4A3FG 4YBZB 4DR4H 3OSNA 1O75A 2J6SA 4ECXA 3R5FA 2C35B 3VPCA 2E2IA 3GKUA 3RB6A 1GSAA 1I3QA 5T14A 2R8HA 2XIGA 2R8KA 2WYOA 1BGWA 4LFBH 5CB4F 2JEIA 1XNRH 5KFGA 5KFOA 4LFAH 2C2EA 5DGBA 2W6ZA 3RGZA 4BWSC 3HOWG 4NXNH 1ZZKA 4ECWA 1S10A 5KFLA 3RJ0A 2CTJA 1S9FA 1UG8A 2O4CA 5IYZF 3RFCA 1JDEA 3H40A 2VKCA 5BMVF 4RUCA 4WD3A 5D1PA 5HBRB 1M0TA 5L1LA 2BA0A 2CW7A 3FAUA 4X65H 5KFRA 4JV1A 4QWBA 4IHJF 3J7AK 4B3TH 2XCAA 4OX9H 5CAEB 5LMUH 1S68A 4JVHA 4LMYA 1I50A 3OTOH 2YU9A 1V4YA 4FS2A 4C2MA 4RUAA 2I80A 2NU9B 2ZM6H 4RB1A 4DR3H 3GQCA 2VUMG 3PO3G 5KT3A 4LSXA 3EPGA 5C1OA 4ED2A 2R7ZA 2OWOA 1A0IA 2Q2TA 3F8NA 4BY1G 2DLNA 2JE6I 1SEIA 4F4YA 5BR8H 2E3UA 2DPIA 2PMZE 5KFUA 2R6FA 5EDWA 3QD7X 3WO1A 1N33H 4MV3A 3N8DA 3RTXA 3M9OB 5EWGA 3L7ZC 1P8LA 2BQRA 4LH6A 4FM9A 1ZZJA 4UCOA 4O3OA 2QYZA 5KFNA 3GV7B 4QWEA 4YR2A 5DG7A 1MZBA 4JYAH 2GPSA 4MV9A 4DR6H 5KFSA 3V69A 4QIWA 4EGJA 4DV0H 4RAZA 4ECTA 3G6YA 5CA0F 4FJSA 3KXYT 1UNNC 3U1KA 4ZQIA 4DL7A 3TIGA 3ORRA 5LXTF 3I0PA 4G3IA 2C00A 3MFIA 1WVNA 1ODHA 2W6QA 3RUPA 5FLXW 3GILA 4IRDA 3I12A 3E5NA 3H4DA 1ZHSA 3N6XA 4QWCA 2R8GA 3MR3A 1N34H 1A9XA 2V4QA 4I4TF 1N56A 1DV1A 4GC6A 1X0AA 5KG1A 3V4SA 2Z0SA 2HHHH 5FJ8G 4ED3A 3T5LA 3PW5A 4IRKA 4DUZH 1UC8A 3Q8RB 3UOEA 2OH2A 4NBQA 1E4EB 3FDSA 4ZHQF 4EG0A 2ATLA 1KJIA 2FK1A 3ETHA 5KFCA 3JSLA 3QZ7A 3Q2OA 5L1IA 4EBCA 4A3MG 2ALZA 4AYBA 4HNUA 4J9KA 5DQHA 1I6UA 3M4IA 4Q43A 5KT5A 3GIIA 1E4GT 4WBNF 4FS1A 4J9RA 4LF5H 1KC7A 4ED8A 4ECYA 2R93A 4JI8H 3BA8A 1ZHQA 3K5HA 3HBLA 3MWDA 1OWTA 4YQWA 4J9PA 4MV4A 1KJQA 3H4BA 3GTPA 5J2TF 1K1SA 2PT7G 2C22A 2CTLA 4ME6A 2O03A 5KT7A 3RAQA 3ETJA 4UCVA 1K1GA 4J0MA 2JA7G 2BQUA 1KHMA 4ECRA 3RB0A 2DZDA 2NN6G 3PW4A 3PR4A 1DT4A 5DQIA 2UUBH 2Y0SA 3TINA 1RYRA 4UCTA 4IR9A 2FPHX 1I7NA 4JI0H 4Q45A 3HKZA 1CE8A 5L9XA 3JRWA 4YAJB 4EFEA 1SFOA 2VA3A 2XGQA 2JA8G 2X06A 1GO3E 1NXUA 2ZDGA 1WE8A 5KFYA 1FJGH 2FLPA 2B63A 5KFVA 4F4XA 1EHIA 3GTKA 1B6SA 2JEFA 2YRXA 2FK2A 1V9PA 2NU7B 2V58A 4UCRA 2IP4A 2WB1A 4J9SA 4DL5A 4ED6A 1TA8A 3BQ0A 4U7CA 4XX0B 4YB8B 1VBGA 3OUUA 1T36A 1VS0A 4EGQA 2JEJA 2AGPA 1V9NA 4BA1I 4JV5H 3I4MG 2K1HA 2CTFA 1KJ8A 2D9IA 4MV6A 2W9CB 1W96A 3KALA 1TWAA 4KHPH 2YZMA 4IFDG 3PVXA 1I94H 2FPIB 1XRHA 4HYKA 5KFPA 2CW8A 1V8CA 3HB9A 4CC5A 2W9BB 2CPMA 3RB4A 2KSWA 3J81W 2R7ZG 2BL5A 1B04A 3MFHA 3KDKA 2ZDHA 2XGPA 3FKIA 3MR2A 1EC6A 2W9CA 3MWEA 4ED0A 4R8UB 2LTMA 4DR7H 1PQXA 2W70A 1E4EA 2PBZA 3EZJA 1B33N 3FMAA 4Y8VB 1X9ZA 4JI5H 4J9LA 4UCUA 2JA6A 2YZNA 4IAJA 3Q1KA 4EFBA 5KFDA 1M0WA 1GYFA 4EBEA 2FPPB 3OHBA 3OETA 3MR5A 4QW8A 5K36G 4XYLB 2AQ4A 4YY3H 1T94A 5KFJA 1CQIB 2YYAA 2LTLA 2AXYA 4MA5A 4RZRA 4GKKH 3HOXG 3RB3A 1RJPA 5FPOA 2W7OA 3UQ8A 2QNDA 3RV4A 2Y0SE 5C4XG 4FU0A 4OD6A 4ZI7F 4Q8EA 3OSSD 2J6TA 5FD5A 4JI7H 1JXLA 2R7NA 1M6VA 2HVSA 4B3MH 2FJZA 1CS0A 2PN1A 2IA6A 2Y3MA 3BABA 4O3PA 3NCVA 5A2QW 1Y1VG 4X64H 3LMLA 2JZXA 3RV3A 5KFMA 4U6PA 2XCPA 5IYDG 4O3RA 2I87A 5C1PA 4AM3A 2HH3A 4PDBA 2YZGA 3H0GA 4NZRM 3BAAA 1IOVA 3K5IA 4HQ6A 2DIKA 3WO0A 4GLXA 4EEYA 3GIQA 2W6OA 2HH2A 2JA5G 3BG5A 3LP8A 2C2RA 4YJ2F 2R92A 4F50A 2UXCH 1TWFA 2OPUA 4IWXA 3T5JA 2YRWA 2R7LA 1S97A 5K2MA 2W7PA 2YQRA 3Q8PB 4JI4H 3VPDA 5IP9G 3BQ1A 1Y14B 5KFBA 3Q8SB 4DL2A 1KJ9A 3G8CA 3G6VA 5IT9W 4TV9F 4FBTA 5DG8A 2CQYA 1R9TA 2YCHA 5KFAA 1WCMA 2YW2A 4EC5A 3N43B 1K83A 1TWCA 3KAJA 5C0XG 1XMQH 3EYYA 4DV2H 5LYJF 4A93G 2ZDQA 4J9NA 4M9UA 4E4TA 4A3DG 2LRRA 4DV7H 4ZOLF 4PWQA 2A1SA 4ED7A 4I50F 4LF7H 4APMA 1X9NA 2R86A 2XD4A 3NGDA 4LIJA 2FFMA 1PX2A 2RGVA 4TV8F 3CVZA 3Q8QB 4LFCH 3RF2A 5FLMG 1AUXA 1GGOA 3T5HA 2ANRA 5H80A 5KFTA 2G8YA 3C0FB 1DGSA 5JUMA 5I47A 1PK8A 4RB0A 4DUYH 2NU8B 2WTFA 2W9BA 2BQ3A 2UVRA 3KTMA 1Y1WG 1KEEA 5KFIA 5KG5A 1X4NA 5DT9A 4DL3A 4RU9A 4R8UA 4YR0A 4MTDA 4JI6H 4O2AF 2ASLA 3RAXA 4RAYA 2HJWA 2NU6B 4O4IF 4EYHB 3HOZG 4TQRA 2VR1A 3VKEA 4O4LF 3GIKA 2R87A 3H3VH 3J80W 2ANNA 1EUDB 2HGSA 3UFXB 4XZ3B 5L1JA 4OCHA 5EZYF 3GIMA 1GSHA 1VBIA 3OUZA 2FP4B 4BXXG 2NVXA 4I55F 4O3QA 2NVYA 4IR1A 3T1YH 4ECVA 3T5KA 4R7RA 2VUMA 3PN1A 4DV5H 2CKZB 4UCSA 3GTJA 5KG7A 4NLGA 2E5LH 4WANA 1JLLB 4JI3H 1W93A 1KJJA 3TIIA 3GIJA 1DV2A 1WH2A 5IP7G 2W9AA 2W8KA 2R82A 4TQSA 3M9MB 4MA0A 1ZQ7A 5DLFA 3I4NG 5JVDF 3FKIG 3SB1A 5LA6F 1K1QA 4QIWE 1TAEA 5EOYA 3WNZA 3GTMA 3JAMW 3OSPA 1J5EH 4B3RH 2JA6G 1ZETA 2CWHA 3GTOA 2AGOA 2W6NA 1IBKH 2MJHA 1C30A 3PW2A 4YAKB 3BA9A 2GPWA 1UC9A 1GLVA 4LH7A 2VPSA 5DGAA 4C5AA 2YL2A 4RB2C 2PQUA 1HNZH 2UUCH 5KFXA 1E4FT 3L4JA 2M6QA 1N48A 2UVVA 3N40P 2CZGA 5KFEA 2CTEA 3GLKA 1S20A 1IBLH 5KFZA 1KBLA 1WR2A 4QJFA 5KG3A 4DV4H 4B8CD 3GIPA 3JZIA 2DPJA 3GIDA 2AU0A 2P0AA 1DTJA 2IBKA 4RNMA 1AUVA 5D8DA 1Z2NX 4JUZA 1ZZIA 5HV6A 4J9QA 4Q44A 4E9JA 2XC9A 2JA9A 4AYBE 2V9WA 1BJTA 1TUAA 2VPQA 4LF4H 1S03G 4MAMA 1S0OA 5JH7F 5KKNB 2V59A 4B8TA 1XDNA 1TWHA 3HOUG 3R5XA 1RYSA 4EEQA 1WTJA 4WALA 2SCUB 1M7JA 4L1KA 4MV1A 4TUYF 3K3VA 2PMZA 2JA5A 1JDBB 4BA2I 3N44B 1BXRA 1JX4A 5DG9A 2RGRA 1WCMG 4M7EA 4ECSA 2WE6A 4YHHH 1N36H 3RIZA 1RK6A 5FPRA 5D1OB 1HNWH 2UU9H 4NXMH 3AYHB 3N41B 4YJ3F 4A3KG 2OLSA 1GSOA 3KAKA 2JA7A 5C5JA 3DF7A 5EWEA 4A3CG 3HKZE 1IOWA 2MCTA 1VIGA 2X0SA 5F9LA 3PO2G 4A3LG 3G6XA 3GR5A 4J9MA 2V5AA 4F4ZA 2R7MA 2FLNA 2HVRA 1FKAH 2M05A 2FKLA 4HNVA 4Q8FA 3H20A 4A3BG 2R8JA 4DL4A 5C44G 2WB1E 2VQFH 4B3SH 3MWMA 3V6JA 1EZ1A 3L2PA 4BBSG 3VPBA 5KG0A 5KX5F 5IYBG 3IG0A 2FMRA 4JV0A 5KFFA 2IMWP 2JEBI 5KT2A 3PW0A 4A3IG 3R23A 1ZTGA 3SI8A 4C5BA 4QWAA 3GABA 2RDJA 4O3NA 2QK4A 4RB3C 3GTQA 2HVQA 4QMFB 5L1KA 1MSZA 4EBDA 2VQEH 3BQ2A 2VUGA 2W8LA 2FPGB 2NUAB 5DLGA 1B6RA 3MR6A 4LF6H 5CA1F 2R93G 1V51A 5JQWA 1HNXH 4OO1G 3KHHA 1SCUB 4A3GG 1X4MA 2I8CA 2JVZA 1J5KA 2XCLA 2GLTA 4JI2H 1BNCA 2VOBA 4HR7A 3GV5B 4CC6A 2CPQA 3TQTA 1VAJA 4IWYA 3OHAA 2W71A 4ECUA 3V4ZA 2JEAI 3GTGA 2FLLA 1Z2PX 4GC7A 4A3JG 2W57A 1CQJB 3M9NB 3K3PA 2UUAH 4DR1H 2FE3A 2CTMA 1EYZA 5KG2A 4K0KH 4LSAA 3GV8B 4DV6H 4O4HF 3KHLA 1RK5A 3CQZA 1I7LA 4F4WA 2F4VH 3QFFA 2B63G 2DGRA 4MV7A 2AGQA 2FK3A 1AN7A 2OPVA 4J9OA 4IZOA 5KT4A 4UFZA 4A2AA 5LMNH 1XNQH 5FD6A 5F9NA 4NZTM 3EPIA 2RDIA 2WDTA 5D1OA 2WAQA 4LF8H 2ZJTA 3HOYG 1Y1VA 2E2HA 5GONF 1J4WA 4O2BF 5KFHA 5JVLA 4H8AA 3ORQA 3JSNA 4C5CA 4X62H 2R7KA 2R85A 1XMOH 5KFQA 2W6PA 4A2BA 1RJRA 2FB9A 2FMAA 4BBRG 2DWCA 3RBEA 4YR3A 1Z2OX 4DLKA 1S0MA 4AIMA 4X66H 2R8IA 4DL6A 2J9GA 3V6KA 5KT6A 4DR2H 5LL6b 2J6UA 4RZQA 2ZQEA 2LF0A 5KFWA 2ASJA 1VKZA 5IWAH 2RF4A 5C3EG 3GTLA 1T3NA 4JI1H 1WSCA 3IN5A 4EYIB 4JVYA 4JV2A 3U9SA 1S0NA 4XYMB 1DIKA 5JEAG 1F0XA 3RGXA 5KFKA 4AQYH 4RNNA 3V6HA 5EWFA 3PW7A 2YS7A 5BPFA 2ASDA 2YS6A 5LP6F 3MJFA 4QWDA 1ULZA 1JIHA 1FVIA 3VMMA 3AEVB 4ECZA 4A3EG 3R5HA 5IYCG 3PZPA 2BR0A 4ETSA 5BPHA 5DQGA 2UVUA 4QW9A 2P2RA 1RJQA 3N42B 3PR5B 2PVPA 4DV3H 3L4KA 4BY7G 3JRXA 1Y1WA 4LF9H 3LWBA 1TWGA 4DV1H 4ECQA 1C3OA 2JEGA 4FBUA 4Q0YA 2C28A 4MTEA 1SYXB 1HR0H 1VBHA 3QZ8A 3BJYA 2W6MA 4I7HA 3KDGA 3H0GG 2UXBH 5KG4A 2M8WA 4G08A 1IBMH 2WAQE 2C2DA 4MV8A 3RBDA 4GKJH 2R84A 3KHGA 2CWFA 3TQ1A 5LOVF 2R92G 5C8YF 1Z2IA 5J2UF 3U9TA 1WHRA 4FJUA 2V4RA 4RNOA
chains in the Genus database with same CATH topology
4RB0A 4DR5H 4DUYH 2PT7G 1L2ZA 3IG0A 2O03A 3T1HH 2UXDH 3HXLA 4UCVA 1N32H 5DT9A 4J0MA 4MTDA 4JI6H 3GABA 4RB3C 2UUBH 4RAYA 2HVQA 4UCTA 2FPHX 5FD5A 2Q2UA 4JI0H 2VQEH 3J80W 4DR4H 1O75A 2HGSA 4EFEA 2VUGA 4LF6H 4OCHA 1FJGH 2XIGA 1HNXH 2WYOA 1BGWA 4LFBH 1XNRH 3L2PA 4LFAH 4JI2H 3T1YH 3RGZA 1V9PA 2VOBA 4UCRA 4R7RA 4BWSC 4NXNH 4CC6A 3PN1A 1TA8A 4DV5H 3RJ0A 2O4CA 4UCSA 1Z2PX 2VKCA 1VS0A 2E5LH 2W57A 5D1PA 4JI3H 2UUAH 4JV5H 1M0TA 4DR1H 1WH2A 2FE3A 2CW7A 4K0KH 3FAUA 2D9IA 4LSAA 4X65H 4DV6H 3KALA 4KHPH 3SB1A 1I94H 3J7AK 4B3TH 1TAEA 2F4VH 5EOYA 2CW8A 4OX9H 4MV7A 4CC5A 5LMUH 1S68A 4LMYA 3JAMW 3J81W 2KSWA 3OTOH 1J5EH 4B3RH 1B04A 1AN7A 3KDKA 4UFZA 4A2AA 5LMNH 1IBKH 2ZM6H 1XNQH 4DR3H 4NZTM 4DR7H 3BA9A 5FD6A 4LH7A 2WDTA 5D1OA 4LSXA 2VPSA 3EZJA 4LF8H 2ZJTA 3FMAA 4RB2C 1X9ZA 4JI5H 1HNZH 1A0IA 2UUCH 4UCUA 3F8NA 1E4FT 4IAJA 1SEIA 4EFBA 3L4JA 1M0WA 5BR8H 1GYFA 3JSNA 4X62H 3OETA 3N40P 3QD7X 1XMOH 1N33H 3RTXA 4YY3H 4A2BA 1P8LA 2Q2TA 1IBLH 4LH6A 4FM9A 4GKKH 4DV4H 4UCOA 4B8CD 1Z2OX 5FPOA 3UQ8A 4X66H 4OD6A 3OSSD 5LL6b 4DR2H 1Z2NX 1MZBA 4JYAH 4JI7H 2ZQEA 4MV9A 2LF0A 4DR6H 4RZQA 4E9JA 4B3MH 2HVSA 4DV0H 4RAZA 1BJTA 5IWAH 2Y3MA 3BABA 3KXYT 3NCVA 5A2QW 4LF4H 4X64H 4JI1H 1S03G 3LMLA 1XDNA 3RGXA 4PDBA 1F0XA 1ODHA 5FLXW 4AQYH 4NZRM 3BAAA 4EEQA 1ZHSA 3N6XA 4GLXA 1FVIA 1N34H 3K3VA 2UXCH 3N44B 2RGRA 4ETSA 4M7EA 2WE6A 4YHHH 1N36H 2HHHH 4JI4H 4DV3H 3N42B 4DUZH 3RIZA 3L4KA 5FPRA 5D1OB 5IT9W 4LF9H 2UU9H 4NXMH 4DV1H 1HNWH 3N41B 2YCHA 3KAKA 4Q0YA 4EC5A 3DF7A 3N43B 4MTEA 2OWOA 1SYXB 1HR0H 3KAJA 3EYYA 1XMQH 2MCTA 3JSLA 4DV2H 4DV7H 4I7HA 3KDGA 3GR5A 1I6UA 2UXBH 2HVRA 4G08A 4LF7H 1IBMH 3M4IA 1FKAH 4APMA 1X9NA 1E4GT 4GKJH 4LF5H 2RGVA 3CVZA 3H20A 4LFCH 3RF2A 4RB1A 4JI8H 3BA8A 1ZHQA 2VQFH 4B3SH 3MWMA 3C0FB 1DGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 H;  4DUY H;  3T1H H;  2UXD H;  1N32 H;  4JI6 H;  2UUB H;  4JI0 H;  2VQE H;  3J80 W;  4DR4 H;  4LF6 H;  1FJG H;  1HNX H;  4LFB H;  1XNR H;  4LFA H;  4JI2 H;  3T1Y H;  4NXN H;  4DV5 H;  2E5L H;  4JI3 H;  2UUA H;  4JV5 H;  4DR1 H;  4K0K H;  4X65 H;  4DV6 H;  4KHP H;  1I94 H;  3J7A K;  4B3T H;  2F4V H;  4OX9 H;  5LMU H;  3JAM W;  3J81 W;  3OTO H;  1J5E H;  4B3R H;  1AN7 A;  5LMN H;  1IBK H;  2ZM6 H;  1XNQ H;  4DR3 H;  4DR7 H;  4LF8 H;  4JI5 H;  1HNZ H;  2UUC H;  1SEI A;  5BR8 H;  4X62 H;  1XMO H;  1N33 H;  4YY3 H;  1IBL H;  4GKK H;  4DV4 H;  4X66 H;  4DR2 H;  5LL6 b;  4JYA H;  4JI7 H;  4DR6 H;  4B3M H;  4DV0 H;  5IWA H;  5A2Q W;  4LF4 H;  4X64 H;  4JI1 H;  1S03 G;  4PDB A;  5FLX W;  4AQY H;  1N34 H;  2UXC H;  4YHH H;  1N36 H;  2HHH H;  4JI4 H;  4DV3 H;  4DUZ H;  5IT9 W;  4LF9 H;  2UU9 H;  4NXM H;  4DV1 H;  1HNW H;  1HR0 H;  1XMQ H;  4DV2 H;  4DV7 H;  1I6U A;  2UXB H;  4LF7 H;  1IBM H;  1FKA H;  4GKJ H;  4LF5 H;  4LFC H;  3RF2 A;  4JI8 H;  2VQF H;  4B3S H; 
#chains in the Genus database with same CATH topology
 2CTK A;  1JKJ B;  4DR5 H;  2VQD A;  1L2Z A;  3SE7 A;  3T1H H;  4HNT A;  2UXD H;  3HXL A;  2UVW A;  1N32 H;  4ED1 A;  1VIH A;  3KHR A;  4IRC A;  3HOV G;  5KG6 A;  4YP3 A;  4O3S A;  2PY9 A;  2VA2 A;  1EUC B;  2Q2U A;  4A3F G;  4YBZ B;  4DR4 H;  3OSN A;  1O75 A;  2J6S A;  4ECX A;  3R5F A;  2C35 B;  3VPC A;  2E2I A;  3GKU A;  3RB6 A;  1GSA A;  1I3Q A;  5T14 A;  2R8H A;  2XIG A;  2R8K A;  2WYO A;  1BGW A;  4LFB H;  5CB4 F;  2JEI A;  1XNR H;  5KFG A;  5KFO A;  4LFA H;  2C2E A;  5DGB A;  2W6Z A;  3RGZ A;  4BWS C;  3HOW G;  4NXN H;  1ZZK A;  4ECW A;  1S10 A;  5KFL A;  3RJ0 A;  2CTJ A;  1S9F A;  1UG8 A;  2O4C A;  5IYZ F;  3RFC A;  1JDE A;  3H40 A;  2VKC A;  5BMV F;  4RUC A;  4WD3 A;  5D1P A;  5HBR B;  1M0T A;  5L1L A;  2BA0 A;  2CW7 A;  3FAU A;  4X65 H;  5KFR A;  4JV1 A;  4QWB A;  4IHJ F;  3J7A K;  4B3T H;  2XCA A;  4OX9 H;  5CAE B;  5LMU H;  1S68 A;  4JVH A;  4LMY A;  1I50 A;  3OTO H;  2YU9 A;  1V4Y A;  4FS2 A;  4C2M A;  4RUA A;  2I80 A;  2NU9 B;  2ZM6 H;  4RB1 A;  4DR3 H;  3GQC A;  2VUM G;  3PO3 G;  5KT3 A;  4LSX A;  3EPG A;  5C1O A;  4ED2 A;  2R7Z A;  2OWO A;  1A0I A;  2Q2T A;  3F8N A;  4BY1 G;  2DLN A;  2JE6 I;  1SEI A;  4F4Y A;  5BR8 H;  2E3U A;  2DPI A;  2PMZ E;  5KFU A;  2R6F A;  5EDW A;  3QD7 X;  3WO1 A;  1N33 H;  4MV3 A;  3N8D A;  3RTX A;  3M9O B;  5EWG A;  3L7Z C;  1P8L A;  2BQR A;  4LH6 A;  4FM9 A;  1ZZJ A;  4UCO A;  4O3O A;  2QYZ A;  5KFN A;  3GV7 B;  4QWE A;  4YR2 A;  5DG7 A;  1MZB A;  4JYA H;  2GPS A;  4MV9 A;  4DR6 H;  5KFS A;  3V69 A;  4QIW A;  4EGJ A;  4DV0 H;  4RAZ A;  4ECT A;  3G6Y A;  5CA0 F;  4FJS A;  3KXY T;  1UNN C;  3U1K A;  4ZQI A;  4DL7 A;  3TIG A;  3ORR A;  5LXT F;  3I0P A;  4G3I A;  2C00 A;  3MFI A;  1WVN A;  1ODH A;  2W6Q A;  3RUP A;  5FLX W;  3GIL A;  4IRD A;  3I12 A;  3E5N A;  3H4D A;  1ZHS A;  3N6X A;  4QWC A;  2R8G A;  3MR3 A;  1N34 H;  1A9X A;  2V4Q A;  4I4T F;  1N56 A;  1DV1 A;  4GC6 A;  1X0A A;  5KG1 A;  3V4S A;  2Z0S A;  2HHH H;  5FJ8 G;  4ED3 A;  3T5L A;  3PW5 A;  4IRK A;  4DUZ H;  1UC8 A;  3Q8R B;  3UOE A;  2OH2 A;  4NBQ A;  1E4E B;  3FDS A;  4ZHQ F;  4EG0 A;  2ATL A;  1KJI A;  2FK1 A;  3ETH A;  5KFC A;  3JSL A;  3QZ7 A;  3Q2O A;  5L1I A;  4EBC A;  4A3M G;  2ALZ A;  4AYB A;  4HNU A;  4J9K A;  5DQH A;  1I6U A;  3M4I A;  4Q43 A;  5KT5 A;  3GII A;  1E4G T;  4WBN F;  4FS1 A;  4J9R A;  4LF5 H;  1KC7 A;  4ED8 A;  4ECY A;  2R93 A;  4JI8 H;  3BA8 A;  1ZHQ A;  3K5H A;  3HBL A;  3MWD A;  1OWT A;  4YQW A;  4J9P A;  4MV4 A;  1KJQ A;  3H4B A;  3GTP A;  5J2T F;  1K1S A;  2PT7 G;  2C22 A;  2CTL A;  4ME6 A;  2O03 A;  5KT7 A;  3RAQ A;  3ETJ A;  4UCV A;  1K1G A;  4J0M A;  2JA7 G;  2BQU A;  1KHM A;  4ECR A;  3RB0 A;  2DZD A;  2NN6 G;  3PW4 A;  3PR4 A;  1DT4 A;  5DQI A;  2UUB H;  2Y0S A;  3TIN A;  1RYR A;  4UCT A;  4IR9 A;  2FPH X;  1I7N A;  4JI0 H;  4Q45 A;  3HKZ A;  1CE8 A;  5L9X A;  3JRW A;  4YAJ B;  4EFE A;  1SFO A;  2VA3 A;  2XGQ A;  2JA8 G;  2X06 A;  1GO3 E;  1NXU A;  2ZDG A;  1WE8 A;  5KFY A;  1FJG H;  2FLP A;  2B63 A;  5KFV A;  4F4X A;  1EHI A;  3GTK A;  1B6S A;  2JEF A;  2YRX A;  2FK2 A;  1V9P A;  2NU7 B;  2V58 A;  4UCR A;  2IP4 A;  2WB1 A;  4J9S A;  4DL5 A;  4ED6 A;  1TA8 A;  3BQ0 A;  4U7C A;  4XX0 B;  4YB8 B;  1VBG A;  3OUU A;  1T36 A;  1VS0 A;  4EGQ A;  2JEJ A;  2AGP A;  1V9N A;  4BA1 I;  4JV5 H;  3I4M G;  2K1H A;  2CTF A;  1KJ8 A;  2D9I A;  4MV6 A;  2W9C B;  1W96 A;  3KAL A;  1TWA A;  4KHP H;  2YZM A;  4IFD G;  3PVX A;  1I94 H;  2FPI B;  1XRH A;  4HYK A;  5KFP A;  2CW8 A;  1V8C A;  3HB9 A;  4CC5 A;  2W9B B;  2CPM A;  3RB4 A;  2KSW A;  3J81 W;  2R7Z G;  2BL5 A;  1B04 A;  3MFH A;  3KDK A;  2ZDH A;  2XGP A;  3FKI A;  3MR2 A;  1EC6 A;  2W9C A;  3MWE A;  4ED0 A;  4R8U B;  2LTM A;  4DR7 H;  1PQX A;  2W70 A;  1E4E A;  2PBZ A;  3EZJ A;  1B33 N;  3FMA A;  4Y8V B;  1X9Z A;  4JI5 H;  4J9L A;  4UCU A;  2JA6 A;  2YZN A;  4IAJ A;  3Q1K A;  4EFB A;  5KFD A;  1M0W A;  1GYF A;  4EBE A;  2FPP B;  3OHB A;  3OET A;  3MR5 A;  4QW8 A;  5K36 G;  4XYL B;  2AQ4 A;  4YY3 H;  1T94 A;  5KFJ A;  1CQI B;  2YYA A;  2LTL A;  2AXY A;  4MA5 A;  4RZR A;  4GKK H;  3HOX G;  3RB3 A;  1RJP A;  5FPO A;  2W7O A;  3UQ8 A;  2QND A;  3RV4 A;  2Y0S E;  5C4X G;  4FU0 A;  4OD6 A;  4ZI7 F;  4Q8E A;  3OSS D;  2J6T A;  5FD5 A;  4JI7 H;  1JXL A;  2R7N A;  1M6V A;  2HVS A;  4B3M H;  2FJZ A;  1CS0 A;  2PN1 A;  2IA6 A;  2Y3M A;  3BAB A;  4O3P A;  3NCV A;  5A2Q W;  1Y1V G;  4X64 H;  3LML A;  2JZX A;  3RV3 A;  5KFM A;  4U6P A;  2XCP A;  5IYD G;  4O3R A;  2I87 A;  5C1P A;  4AM3 A;  2HH3 A;  4PDB A;  2YZG A;  3H0G A;  4NZR M;  3BAA A;  1IOV A;  3K5I A;  4HQ6 A;  2DIK A;  3WO0 A;  4GLX A;  4EEY A;  3GIQ A;  2W6O A;  2HH2 A;  2JA5 G;  3BG5 A;  3LP8 A;  2C2R A;  4YJ2 F;  2R92 A;  4F50 A;  2UXC H;  1TWF A;  2OPU A;  4IWX A;  3T5J A;  2YRW A;  2R7L A;  1S97 A;  5K2M A;  2W7P A;  2YQR A;  3Q8P B;  4JI4 H;  3VPD A;  5IP9 G;  3BQ1 A;  1Y14 B;  5KFB A;  3Q8S B;  4DL2 A;  1KJ9 A;  3G8C A;  3G6V A;  5IT9 W;  4TV9 F;  4FBT A;  5DG8 A;  2CQY A;  1R9T A;  2YCH A;  5KFA A;  1WCM A;  2YW2 A;  4EC5 A;  3N43 B;  1K83 A;  1TWC A;  3KAJ A;  5C0X G;  1XMQ H;  3EYY A;  4DV2 H;  5LYJ F;  4A93 G;  2ZDQ A;  4J9N A;  4M9U A;  4E4T A;  4A3D G;  2LRR A;  4DV7 H;  4ZOL F;  4PWQ A;  2A1S A;  4ED7 A;  4I50 F;  4LF7 H;  4APM A;  1X9N A;  2R86 A;  2XD4 A;  3NGD A;  4LIJ A;  2FFM A;  1PX2 A;  2RGV A;  4TV8 F;  3CVZ A;  3Q8Q B;  4LFC H;  3RF2 A;  5FLM G;  1AUX A;  1GGO A;  3T5H A;  2ANR A;  5H80 A;  5KFT A;  2G8Y A;  3C0F B;  1DGS A;  5JUM A;  5I47 A;  1PK8 A;  4RB0 A;  4DUY H;  2NU8 B;  2WTF A;  2W9B A;  2BQ3 A;  2UVR A;  3KTM A;  1Y1W G;  1KEE A;  5KFI A;  5KG5 A;  1X4N A;  5DT9 A;  4DL3 A;  4RU9 A;  4R8U A;  4YR0 A;  4MTD A;  4JI6 H;  4O2A F;  2ASL A;  3RAX A;  4RAY A;  2HJW A;  2NU6 B;  4O4I F;  4EYH B;  3HOZ G;  4TQR A;  2VR1 A;  3VKE A;  4O4L F;  3GIK A;  2R87 A;  3H3V H;  3J80 W;  2ANN A;  1EUD B;  2HGS A;  3UFX B;  4XZ3 B;  5L1J A;  4OCH A;  5EZY F;  3GIM A;  1GSH A;  1VBI A;  3OUZ A;  2FP4 B;  4BXX G;  2NVX A;  4I55 F;  4O3Q A;  2NVY A;  4IR1 A;  3T1Y H;  4ECV A;  3T5K A;  4R7R A;  2VUM A;  3PN1 A;  4DV5 H;  2CKZ B;  4UCS A;  3GTJ A;  5KG7 A;  4NLG A;  2E5L H;  4WAN A;  1JLL B;  4JI3 H;  1W93 A;  1KJJ A;  3TII A;  3GIJ A;  1DV2 A;  1WH2 A;  5IP7 G;  2W9A A;  2W8K A;  2R82 A;  4TQS A;  3M9M B;  4MA0 A;  1ZQ7 A;  5DLF A;  3I4N G;  5JVD F;  3FKI G;  3SB1 A;  5LA6 F;  1K1Q A;  4QIW E;  1TAE A;  5EOY A;  3WNZ A;  3GTM A;  3JAM W;  3OSP A;  1J5E H;  4B3R H;  2JA6 G;  1ZET A;  2CWH A;  3GTO A;  2AGO A;  2W6N A;  1IBK H;  2MJH A;  1C30 A;  3PW2 A;  4YAK B;  3BA9 A;  2GPW A;  1UC9 A;  1GLV A;  4LH7 A;  2VPS A;  5DGA A;  4C5A A;  2YL2 A;  4RB2 C;  2PQU A;  1HNZ H;  2UUC H;  5KFX A;  1E4F T;  3L4J A;  2M6Q A;  1N48 A;  2UVV A;  3N40 P;  2CZG A;  5KFE A;  2CTE A;  3GLK A;  1S20 A;  1IBL H;  5KFZ A;  1KBL A;  1WR2 A;  4QJF A;  5KG3 A;  4DV4 H;  4B8C D;  3GIP A;  3JZI A;  2DPJ A;  3GID A;  2AU0 A;  2P0A A;  1DTJ A;  2IBK A;  4RNM A;  1AUV A;  5D8D A;  1Z2N X;  4JUZ A;  1ZZI A;  5HV6 A;  4J9Q A;  4Q44 A;  4E9J A;  2XC9 A;  2JA9 A;  4AYB E;  2V9W A;  1BJT A;  1TUA A;  2VPQ A;  4LF4 H;  1S03 G;  4MAM A;  1S0O A;  5JH7 F;  5KKN B;  2V59 A;  4B8T A;  1XDN A;  1TWH A;  3HOU G;  3R5X A;  1RYS A;  4EEQ A;  1WTJ A;  4WAL A;  2SCU B;  1M7J A;  4L1K A;  4MV1 A;  4TUY F;  3K3V A;  2PMZ A;  2JA5 A;  1JDB B;  4BA2 I;  3N44 B;  1BXR A;  1JX4 A;  5DG9 A;  2RGR A;  1WCM G;  4M7E A;  4ECS A;  2WE6 A;  4YHH H;  1N36 H;  3RIZ A;  1RK6 A;  5FPR A;  5D1O B;  1HNW H;  2UU9 H;  4NXM H;  3AYH B;  3N41 B;  4YJ3 F;  4A3K G;  2OLS A;  1GSO A;  3KAK A;  2JA7 A;  5C5J A;  3DF7 A;  5EWE A;  4A3C G;  3HKZ E;  1IOW A;  2MCT A;  1VIG A;  2X0S A;  5F9L A;  3PO2 G;  4A3L G;  3G6X A;  3GR5 A;  4J9M A;  2V5A A;  4F4Z A;  2R7M A;  2FLN A;  2HVR A;  1FKA H;  2M05 A;  2FKL A;  4HNV A;  4Q8F A;  3H20 A;  4A3B G;  2R8J A;  4DL4 A;  5C44 G;  2WB1 E;  2VQF H;  4B3S H;  3MWM A;  3V6J A;  1EZ1 A;  3L2P A;  4BBS G;  3VPB A;  5KG0 A;  5KX5 F;  5IYB G;  3IG0 A;  2FMR A;  4JV0 A;  5KFF A;  2IMW P;  2JEB I;  5KT2 A;  3PW0 A;  4A3I G;  3R23 A;  1ZTG A;  3SI8 A;  4C5B A;  4QWA A;  3GAB A;  2RDJ A;  4O3N A;  2QK4 A;  4RB3 C;  3GTQ A;  2HVQ A;  4QMF B;  5L1K A;  1MSZ A;  4EBD A;  2VQE H;  3BQ2 A;  2VUG A;  2W8L A;  2FPG B;  2NUA B;  5DLG A;  1B6R A;  3MR6 A;  4LF6 H;  5CA1 F;  2R93 G;  1V51 A;  5JQW A;  1HNX H;  4OO1 G;  3KHH A;  1SCU B;  4A3G G;  1X4M A;  2I8C A;  2JVZ A;  1J5K A;  2XCL A;  2GLT A;  4JI2 H;  1BNC A;  2VOB A;  4HR7 A;  3GV5 B;  4CC6 A;  2CPQ A;  3TQT A;  1VAJ A;  4IWY A;  3OHA A;  2W71 A;  4ECU A;  3V4Z A;  2JEA I;  3GTG A;  2FLL A;  1Z2P X;  4GC7 A;  4A3J G;  2W57 A;  1CQJ B;  3M9N B;  3K3P A;  2UUA H;  4DR1 H;  2FE3 A;  2CTM A;  1EYZ A;  5KG2 A;  4K0K H;  4LSA A;  3GV8 B;  4DV6 H;  4O4H F;  3KHL A;  1RK5 A;  3CQZ A;  1I7L A;  4F4W A;  2F4V H;  3QFF A;  2B63 G;  2DGR A;  4MV7 A;  2AGQ A;  2FK3 A;  1AN7 A;  2OPV A;  4J9O A;  4IZO A;  5KT4 A;  4UFZ A;  4A2A A;  5LMN H;  1XNQ H;  5FD6 A;  5F9N A;  4NZT M;  3EPI A;  2RDI A;  2WDT A;  5D1O A;  2WAQ A;  4LF8 H;  2ZJT A;  3HOY G;  1Y1V A;  2E2H A;  5GON F;  1J4W A;  4O2B F;  5KFH A;  5JVL A;  4H8A A;  3ORQ A;  3JSN A;  4C5C A;  4X62 H;  2R7K A;  2R85 A;  1XMO H;  5KFQ A;  2W6P A;  4A2B A;  1RJR A;  2FB9 A;  2FMA A;  4BBR G;  2DWC A;  3RBE A;  4YR3 A;  1Z2O X;  4DLK A;  1S0M A;  4AIM A;  4X66 H;  2R8I A;  4DL6 A;  2J9G A;  3V6K A;  5KT6 A;  4DR2 H;  5LL6 b;  2J6U A;  4RZQ A;  2ZQE A;  2LF0 A;  5KFW A;  2ASJ A;  1VKZ A;  5IWA H;  2RF4 A;  5C3E G;  3GTL A;  1T3N A;  4JI1 H;  1WSC A;  3IN5 A;  4EYI B;  4JVY A;  4JV2 A;  3U9S A;  1S0N A;  4XYM B;  1DIK A;  5JEA G;  1F0X A;  3RGX A;  5KFK A;  4AQY H;  4RNN A;  3V6H A;  5EWF A;  3PW7 A;  2YS7 A;  5BPF A;  2ASD A;  2YS6 A;  5LP6 F;  3MJF A;  4QWD A;  1ULZ A;  1JIH A;  1FVI A;  3VMM A;  3AEV B;  4ECZ A;  4A3E G;  3R5H A;  5IYC G;  3PZP A;  2BR0 A;  4ETS A;  5BPH A;  5DQG A;  2UVU A;  4QW9 A;  2P2R A;  1RJQ A;  3N42 B;  3PR5 B;  2PVP A;  4DV3 H;  3L4K A;  4BY7 G;  3JRX A;  1Y1W A;  4LF9 H;  3LWB A;  1TWG A;  4DV1 H;  4ECQ A;  1C3O A;  2JEG A;  4FBU A;  4Q0Y A;  2C28 A;  4MTE A;  1SYX B;  1HR0 H;  1VBH A;  3QZ8 A;  3BJY A;  2W6M A;  4I7H A;  3KDG A;  3H0G G;  2UXB H;  5KG4 A;  2M8W A;  4G08 A;  1IBM H;  2WAQ E;  2C2D A;  4MV8 A;  3RBD A;  4GKJ H;  2R84 A;  3KHG A;  2CWF A;  3TQ1 A;  5LOV F;  2R92 G;  5C8Y F;  1Z2I A;  5J2U F;  3U9T A;  1WHR A;  4FJU A;  2V4R A;  4RNO A; 
#chains in the Genus database with same CATH homology
 4RB0 A;  4DR5 H;  4DUY H;  2PT7 G;  1L2Z A;  3IG0 A;  2O03 A;  3T1H H;  2UXD H;  3HXL A;  4UCV A;  1N32 H;  5DT9 A;  4J0M A;  4MTD A;  4JI6 H;  3GAB A;  4RB3 C;  2UUB H;  4RAY A;  2HVQ A;  4UCT A;  2FPH X;  5FD5 A;  2Q2U A;  4JI0 H;  2VQE H;  3J80 W;  4DR4 H;  1O75 A;  2HGS A;  4EFE A;  2VUG A;  4LF6 H;  4OCH A;  1FJG H;  2XIG A;  1HNX H;  2WYO A;  1BGW A;  4LFB H;  1XNR H;  3L2P A;  4LFA H;  4JI2 H;  3T1Y H;  3RGZ A;  1V9P A;  2VOB A;  4UCR A;  4R7R A;  4BWS C;  4NXN H;  4CC6 A;  3PN1 A;  1TA8 A;  4DV5 H;  3RJ0 A;  2O4C A;  4UCS A;  1Z2P X;  2VKC A;  1VS0 A;  2E5L H;  2W57 A;  5D1P A;  4JI3 H;  2UUA H;  4JV5 H;  1M0T A;  4DR1 H;  1WH2 A;  2FE3 A;  2CW7 A;  4K0K H;  3FAU A;  2D9I A;  4LSA A;  4X65 H;  4DV6 H;  3KAL A;  4KHP H;  3SB1 A;  1I94 H;  3J7A K;  4B3T H;  1TAE A;  2F4V H;  5EOY A;  2CW8 A;  4OX9 H;  4MV7 A;  4CC5 A;  5LMU H;  1S68 A;  4LMY A;  3JAM W;  3J81 W;  2KSW A;  3OTO H;  1J5E H;  4B3R H;  1B04 A;  1AN7 A;  3KDK A;  4UFZ A;  4A2A A;  5LMN H;  1IBK H;  2ZM6 H;  1XNQ H;  4DR3 H;  4NZT M;  4DR7 H;  3BA9 A;  5FD6 A;  4LH7 A;  2WDT A;  5D1O A;  4LSX A;  2VPS A;  3EZJ A;  4LF8 H;  2ZJT A;  3FMA A;  4RB2 C;  1X9Z A;  4JI5 H;  1HNZ H;  1A0I A;  2UUC H;  4UCU A;  3F8N A;  1E4F T;  4IAJ A;  1SEI A;  4EFB A;  3L4J A;  1M0W A;  5BR8 H;  1GYF A;  3JSN A;  4X62 H;  3OET A;  3N40 P;  3QD7 X;  1XMO H;  1N33 H;  3RTX A;  4YY3 H;  4A2B A;  1P8L A;  2Q2T A;  1IBL H;  4LH6 A;  4FM9 A;  4GKK H;  4DV4 H;  4UCO A;  4B8C D;  1Z2O X;  5FPO A;  3UQ8 A;  4X66 H;  4OD6 A;  3OSS D;  5LL6 b;  4DR2 H;  1Z2N X;  1MZB A;  4JYA H;  4JI7 H;  2ZQE A;  4MV9 A;  2LF0 A;  4DR6 H;  4RZQ A;  4E9J A;  4B3M H;  2HVS A;  4DV0 H;  4RAZ A;  1BJT A;  5IWA H;  2Y3M A;  3BAB A;  3KXY T;  3NCV A;  5A2Q W;  4LF4 H;  4X64 H;  4JI1 H;  1S03 G;  3LML A;  1XDN A;  3RGX A;  4PDB A;  1F0X A;  1ODH A;  5FLX W;  4AQY H;  4NZR M;  3BAA A;  4EEQ A;  1ZHS A;  3N6X A;  4GLX A;  1FVI A;  1N34 H;  3K3V A;  2UXC H;  3N44 B;  2RGR A;  4ETS A;  4M7E A;  2WE6 A;  4YHH H;  1N36 H;  2HHH H;  4JI4 H;  4DV3 H;  3N42 B;  4DUZ H;  3RIZ A;  3L4K A;  5FPR A;  5D1O B;  5IT9 W;  4LF9 H;  2UU9 H;  4NXM H;  4DV1 H;  1HNW H;  3N41 B;  2YCH A;  3KAK A;  4Q0Y A;  4EC5 A;  3DF7 A;  3N43 B;  4MTE A;  2OWO A;  1SYX B;  1HR0 H;  3KAJ A;  3EYY A;  1XMQ H;  2MCT A;  3JSL A;  4DV2 H;  4DV7 H;  4I7H A;  3KDG A;  3GR5 A;  1I6U A;  2UXB H;  2HVR A;  4G08 A;  4LF7 H;  1IBM H;  3M4I A;  1FKA H;  4APM A;  1X9N A;  1E4G T;  4GKJ H;  4LF5 H;  2RGV A;  3CVZ A;  3H20 A;  4LFC H;  3RF2 A;  4RB1 A;  4JI8 H;  3BA8 A;  1ZHQ A;  2VQF H;  4B3S H;  3MWM A;  3C0F B;  1DGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...