3J7AK

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
129
structure length
129
Chain Sequence
VRMSVLADCLKTINNAEKRGRRQVLIRPSSKVVIKFLQYMQKKGYIGSFEIVDDHRSGKIVVNLLGRINKCAVISPRYDVKLDEIEKIITSILPSRLFGHLILTTPYGIMDHEEARRKHTGGKVLGFFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 30
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3j7aK01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3j7aK02
4YHHH 1HNWH 4KHPH 3JAMW 4AQYH 5IWAH 3J81W 4LF7H 5LL6b 2UXBH 5A2QW 5IT9W 2ZM6H 4DV7H 4JI1H 4JI5H 4NXNH 4B3SH 1XNQH 4X66H 4JV5H 4LF8H 2F4VH 4JI4H 1AN7A 4B3MH 4JYAH 1FJGH 4JI7H 1XMOH 2VQEH 1HNXH 4LF9H 4DV1H 3OTOH 4DV5H 4NXMH 4B3RH 2UUCH 3T1HH 1N34H 1IBLH 4LFCH 1HR0H 5LMNH 4K0KH 2UU9H 3T1YH 4DV6H 2HHHH 1N32H 4OX9H 4LF5H 1XMQH 1N36H 1FKAH 1HNZH 4LF4H 4GKJH 2UXDH 4DR2H 4LFAH 4JI8H 3RF2A 5BR8H 2UXCH 1I94H 4DR1H 1I6UA 2VQFH 4X65H 4DV3H 4DR7H 4DV2H 1IBMH 4JI0H 4DR3H 4X62H 4X64H 4LF6H 4JI6H 2UUAH 4DV4H 1SEIA 4YY3H 2E5LH 4LFBH 1J5EH 1S03G 3J80W 4DUZH 4JI3H 1XNRH 4DR6H 4PDBA 4DUYH 4B3TH 1IBKH 4GKKH 3J7AK 4DV0H 2UUBH 4JI2H 4DR4H 5FLXW 4DR5H 1N33H 5LMUH
chains in the Genus database with same CATH superfamily
2W7PA 4EC5A 3RGZA 2LF0A 5KG7A 3M9MB 3OHAA 2W9BB 2AU0A 1B04A 1OWTA 5IYCG 4IR1A 3MWEA 2R85A 4MV1A 3M4IA 3OETA 2NN6G 2I8CA 1JDBB 3OSPA 4ECTA 2UXBH 4J9OA 1K1GA 1E4GT 5H80A 2NUAB 5A2QW 1DT4A 4A3LG 3UFXB 3I4NG 2YZMA 2ZM6H 2FLLA 2ATLA 2FFMA 4EFBA 5BPFA 1GLVA 1EC6A 1SCUB 3HOXG 5KFJA 1UC8A 4B3SH 4MV6A 4X66H 2CTMA 5C0XG 2DZDA 2GLTA 5KFQA 4O3SA 1AN7A 3KHLA 2VOBA 3GIDA 3GIJA 1SYXB 2X06A 1F0XA 4XYMB 3K3VA 5KG3A 4B3MH 3JSNA 4TV8F 4EYHB 1T36A 4DL3A 4R8UB 2OPUA 3G8CA 2JA7A 4JUZA 1I50A 2O03A 2ANRA 1WVNA 4UCVA 2Y3MA 5FD5A 3MWDA 3PVXA 3Q1KA 4QW8A 2VKCA 5KT7A 2JA9A 3Q8PB 1N34H 3C0FB 3G6VA 1SFOA 3L4KA 2XC9A 1HR0H 3L4JA 5LMNH 4K0KH 3VPDA 3VPBA 1DV2A 4RNMA 2XCPA 3TQ1A 3GTLA 4EEQA 2CTEA 3HB9A 3PN1A 2NVXA 2Y0SE 3ETHA 2RGVA 4O3QA 1N32H 4OX9H 5EWGA 2J6UA 4LF5H 2LTMA 2ZDQA 3RB6A 4O3OA 4NBQA 4ZOLF 5DQHA 1EYZA 1EHIA 4M7EA 1DV1A 5KX5F 1K83A 2JA5G 2FMAA 5T14A 5L9XA 5CAEB 4ECVA 3BA9A 5D8DA 1I94H 1RYSA 3RV3A 3V6KA 2J6TA 3Q8QB 5DQGA 4BA2I 5KG1A 1KEEA 4A3BG 4RZQA 5L1JA 2AGQA 1I6UA 5LP6F 4YQWA 4TQSA 4O3RA 1KJQA 4XX0B 3RJ0A 4RUAA 3HOUG 1KJIA 1TWHA 4X65H 1RJPA 2YS7A 3HKZA 4J9QA 4QIWA 3KDGA 4DR7H 1RK5A 2WAQA 4EG0A 2HVSA 4NLGA 2HVRA 2JA6G 2J9GA 1UNNC 4BBRG 1E4EA 5LOVF 4A3KG 3KDKA 2SCUB 5KG6A 4C5BA 2Y0SA 5JQWA 1VBIA 5LYJF 3H0GA 4F50A 2VA2A 4GC6A 4TQRA 2OLSA 4I7HA 4UCRA 4QWAA 4IAJA 3KAKA 3BQ2A 4MV8A 3U9TA 5L1LA 3GLKA 3V69A 5FJ8G 2ASJA 1ZTGA 1Z2NX 5LA6F 2FP4B 3HOZG 2VR1A 2W6QA 2W8LA 2E5LH 4MA0A 5DQIA 2FK3A 2YZNA 5EDWA 2JEBI 1S03G 1XNRH 4DUYH 5KG5A 3BQ0A 5BPHA 4B3TH 2R87A 4ED7A 3T5LA 1Y1WG 1VS0A 1IBKH 1I7LA 3BABA 4LMYA 3Q8SB 4J9SA 4A3GG 1M0WA 3RBDA 5KFIA 4ZHQF 4F4WA 4EBEA 1GO3E 1VAJA 3KALA 4IRCA 1L2ZA 4U7CA 1A9XA 3N8DA 4NZTM 2C35B 2W7OA 5FLXW 3IN5A 4Q44A 4I55F 4OO1G 3JRWA 5DLFA 5K36G 4C2MA 4YHHH 1V51A 4ZQIA 2VQDA 5KFPA 1JLLB 4O3NA 4YAKB 4J9KA 2E2HA 4KHPH 3RB4A 4IWXA 1V9PA 1W96A 4IZOA 3BQ1A 3TIIA 1UG8A 2CW8A 4CC6A 2RF4A 3PW2A 1O75A 4E4TA 2CQYA 1TA8A 4ED8A 3I0PA 2BL5A 2XIGA 2NU8B 3WO1A 4JI1H 4UFZA 5DLGA 1RK6A 1WSCA 4HQ6A 1EUDB 2C00A 3MFIA 3HOWG 1XNQH 2FMRA 3R5HA 5KFBA 2V9WA 5C4XG 4JI4H 2FK2A 3M9OB 1Y1VA 4MV4A 2R92G 2BQUA 1GSHA 5JEAG 3GIIA 3DF7A 3RV4A 4BA1I 1FJGH 2FPHX 3K5IA 4ECYA 3VKEA 3VPCA 4JV1A 4A3DG 2JEIA 2HJWA 5DG7A 4RB1A 2MJHA 4DV1H 4FU0A 2BR0A 3CQZA 2RGRA 4DV5H 4IWYA 3MWMA 2UUCH 2JE6I 2WDTA 2RDJA 4EYIB 2R82A 1WR2A 4AYBA 4J0MA 3GTPA 2WYOA 5KFAA 3RBEA 1X4MA 1UC9A 3N41B 5KFRA 4LFCH 1N48A 4LSAA 1DGSA 4A3CG 2CWFA 5C8YF 5IYDG 4DV6H 1PX2A 2BA0A 2HH2A 3EPIA 4YJ3F 4FS1A 3RAXA 2YRXA 1WTJA 2YU9A 4ECXA 2C2EA 2WE6A 4MV7A 5KG4A 2JZXA 4APMA 3BG5A 1AUVA 4LF4H 4HNVA 3T5JA 2UXDH 4LFAH 3OSSD 2JVZA 3TINA 3HOYG 4JI8H 2QNDA 3RF2A 5GONF 4DLKA 3FAUA 4YR3A 3TQTA 2ZQEA 5DT9A 1ZZJA 2UXCH 3KHRA 2R7ZA 2FLNA 2R6FA 5KT2A 4DL2A 4UCUA 2DLNA 3G6YA 4Y8VB 3RIZA 4Q45A 1S97A 4ZI7F 4IRDA 5KT4A 1DTJA 3HKZE 1K1SA 4LH7A 3AEVB 1KJJA 4QIWE 5EOYA 5IYZF 2Q2TA 2V58A 5D1OA 4RNNA 4DV3H 2WAQE 4BY1G 4EGQA 4ED0A 2UVRA 2B63G 1E4EB 1TWAA 5C44G 4DR3H 4X62H 2R8JA 2VUMA 3MJFA 1V9NA 1ZZIA 4JV2A 1Z2OX 2FE3A 4L1KA 5DG8A 4GLXA 2V5AA 4ED6A 1WHRA 4AIMA 3GR5A 2W6NA 2WB1A 2HGSA 1VBGA 5F9NA 3R5XA 4JI6H 1T94A 1X4NA 4DV4H 4LH6A 3LMLA 4YY3H 1PK8A 3MFHA 2G8YA 5J2TF 5JUMA 2W9BA 3RB0A 4A2BA 4QWCA 1J5EH 5C5JA 4QJFA 3Q2OA 3KXYT 1KJ8A 2FPPB 5KFDA 4DR6H 4PDBA 4ECRA 3GTGA 1WCMA 2C28A 1TUAA 1A0IA 4J9PA 5KT6A 3J7AK 2NVYA 5KFHA 2UUBH 4RB2C 4ECSA 4B8TA 4ETSA 2R7LA 2R93A 1GSOA 1S10A 4DR4H 1T3NA 2JA7G 2R7KA 3TIGA 3FKIA 4Q43A 4BXXG 5JVLA 4Q0YA 3UQ8A 2IMWP 4JVHA 4DR5H 3H4BA 1S68A 3E5NA 2ZDGA 3EYYA 4ECQA 3MR3A 4OD6A 1AUXA 1NXUA 2R8KA 3FMAA 3JAMW 4MTEA 1ODHA 2R8GA 5IWAH 4OCHA 3J81W 3FDSA 5KT3A 3NCVA 2O4CA 1B33N 5LL6b 4YJ2F 5KFFA 1E4FT 5D1PA 4ED3A 3LWBA 5FPRA 4M9UA 2FKLA 4MV9A 4DV7H 4G3IA 2FJZA 4RB0A 4JI5H 1WE8A 2M8WA 3LP8A 2ZDHA 5C1OA 4EEYA 4A3EG 2CTLA 2YCHA 4DL4A 3HBLA 5EZYF 5EWEA 2F4VH 3GILA 4O2AF 3PW7A 4HR7A 4HYKA 2DWCA 4G08A 4O4HF 4XYLB 4AM3A 2R8HA 2AXYA 1JDEA 1TWGA 3GTKA 3CVZA 3GQCA 1VBHA 1XMOH 5F9LA 2VQEH 1HNXH 4YR2A 5K2MA 1B6RA 5BMVF 2W8KA 4UCOA 3V6JA 1S9FA 3OTOH 4B3RH 4R7RA 1XDNA 1S20A 2D9IA 3T1HH 4AYBE 1C3OA 4NZRM 1IBLH 3N43B 3QFFA 3WNZA 5KFMA 1R9TA 4FBTA 1FVIA 1K1QA 2PMZA 5KFUA 4EGJA 2UU9H 2PBZA 2DPIA 3T1YH 1C30A 3KHGA 3GIMA 3T5HA 3I4MG 4BBSG 2DIKA 2BQ3A 1X9NA 3N42B 2W9CA 3SI8A 3HXLA 3H0GG 2WTFA 1BGWA 4FS2A 4RU9A 2LRRA 1XMQH 1N36H 2PY9A 5IP9G 1TWFA 2OWOA 4DL5A 4GKJH 2MCTA 1KJ9A 1KC7A 4MV3A 2CPMA 4EBDA 5I47A 1S0MA 2FLPA 3BAAA 1I3QA 4IHJF 2QK4A 3QZ7A 4YBZB 4WALA 1MZBA 3GIQA 4O2BF 5KFNA 3OHBA 3MR6A 4H8AA 2CTFA 5KFZA 2VQFH 3ORRA 3ORQA 5D1OB 3BJYA 4YB8B 4FM9A 1IOVA 5KG2A 2JA8G 3JSLA 1VIHA 5JVDF 3N40P 2YZGA 4QWBA 4RNOA 4MTDA 2W9AA 4Q8EA 3HOVG 1V8CA 3EZJA 1ULZA 5FPOA 2E2IA 5CB4F 2YL2A 4F4ZA 1J4WA 4J9RA 2UVWA 4TUYF 4ME6A 2R7MA 2WB1E 4WBNF 5LXTF 4WD3A 1RJRA 5KFSA 1TAEA 4B8CD 2VPSA 5IP7G 3PR4A 3GIKA 5DGAA 3GTMA 4QW9A 4RZRA 4XZ3B 4J9MA 3JZIA 2CZGA 2R7NA 2JA5A 2AGPA 2A1SA 3GV8B 3AYHB 2NU6B 2YRWA 4FJSA 1PQXA 4JI3H 3RUPA 5C3EG 3PW5A 2BQRA 3N44B 5DG9A 2XGQA 1VIGA 1CE8A 5FLMG 3GTQA 4RAYA 2M6QA 4YR0A 4GKKH 4UCSA 1GGOA 4JV0A 1Y1VG 2DPJA 2P2RA 2AGOA 3H3VH 4JI2H 5FD6A 2I80A 2K1HA 4E9JA 1P8LA 4TV9F 3RTXA 4O3PA 3M9NB 2Z0SA 5KT5A 1S0NA 3U9SA 5JH7F 2OH2A 3N6XA 3H20A 5EWFA 1RYRA 2FPGB 3V4ZA 2PQUA 2FB9A 1ZZKA 4QMFB 4J9LA 1JXLA 2E3UA 1ZETA 3SB1A 3T5KA 1HNWH 1W93A 2W6MA 4ED2A 4AQYH 1EZ1A 3VMMA 3QZ8A 3PW4A 4C5CA 2YW2A 2YS6A 3GIPA 2PT7G 4LF7H 4O4IF 5CA1F 2R8IA 4A3IG 2XCLA 3KTMA 5KFWA 3NGDA 3L7ZC 3H40A 5IT9W 3U1KA 2GPSA 5KFVA 3GV5B 2OPVA 3RB3A 1GSAA 1Y1WA 1VKZA 2UVUA 2FK1A 3BA8A 2XCAA 4NXNH 4IFDG 1Z2PX 1ZHQA 4JV5H 3OUUA 4HNUA 4LF8H 1XRHA 2NU7B 4C5AA 3GABA 1JX4A 2JA6A 1MSZA 5KG0A 1Z2IA 3H4DA 4I50F 5KFGA 2JEGA 1KBLA 1KHMA 2YYAA 1BXRA 3IG0A 2R7ZG 4JYAH 4J9NA 4WANA 4QWEA 4JI7H 1EUCB 4R8UA 4A2AA 3Q8RB 2JEJA 5KFKA 4IR9A 4ECWA 3PZPA 4LF9H 4FBUA 3PW0A 2ANNA 2V4RA 1BJTA 4LIJA 4JVYA 4NXMH 2R86A 2C22A 3QD7X 1ZQ7A 1Y14B 2ZJTA 5L1IA 4IRKA 4EBCA 4ED1A 1V4YA 1B6SA 2PMZE 2UVVA 2KSWA 3L2PA 2CTJA 2VUMG 1J5KA 2W9CB 2PVPA 4GC7A 2HHHH 2R84A 5KKNB 3SE7A 2VUGA 2VPQA 2PN1A 3MR2A 2LTLA 3WO0A 4ECUA 2CKZB 3K3PA 4BWSC 4Q8FA 2IA6A 2I87A 1JKJB 4U6PA 1ZHSA 4PWQA 4A93G 5KFLA 3RAQA 1X0AA 1FKAH 1HNZH 4I4TF 2W70A 2ASLA 1JIHA 4MA5A 4DR2H 4F4YA 2R92A 3K5HA 4CC5A 4DL7A 1CQIB 1X9ZA 3ETJA 5BR8H 3KHHA 2VA3A 4DR1H 3RGXA 2XGPA 4A3JG 4A3MG 5KFCA 3EPGA 3GTJA 1WCMG 4RUCA 3MR5A 2YQRA 2QYZA 3GKUA 5C1PA 3GV7B 3PR5B 3R5FA 3OUZA 4ECZA 2AQ4A 2IBKA 2R93G 5IYBG 2ASDA 4DV2H 1IBMH 3I12A 4LSXA 4JI0H 3KAJA 4F4XA 3FKIG 4RB3C 4A3FG 1M6VA 2CTKA 2Q2UA 4X64H 3R23A 1RJQA 4LF6H 2XD4A 2CPQA 5KFYA 5KFEA 4YP3A 5KFXA 2W6ZA 5KFOA 3PO2G 2M05A 1CQJB 2CW7A 3GTOA 2UUAH 1CS0A 4O4LF 2W6OA 4QWDA 2V4QA 1SEIA 3RFCA 5HBRB 4YAJB 2C2DA 2JEFA 2RDIA 2GPWA 1S0OA 1BNCA 4LFBH 2HH3A 3OSNA 5J2UF 3J80W 4DUZH 1WH2A 3UOEA 2JEAI 2HVQA 4RAZA 2V59A 2W71A 2C2RA 4BY7G 1GYFA 2ALZA 5HV6A 4MAMA 4HNTA 3V4SA 2J6SA 4DV0H 2DGRA 3V6HA 5CA0F 1I7NA 2IP4A 3G6XA 2P0AA 5DGBA 5L1KA 2B63A 5KFTA 2X0SA 3F8NA 2NU9B 1TWCA 2CWHA 4UCTA 1M7JA 1DIKA 2W6PA 4DL6A 1IOWA 2FPIB 1N56A 3JRXA 1N33H 2W57A 4FJUA 5LMUH 3PO3G 1M0TA 4EFEA
chains in the Genus database with same CATH topology
3SB1A 4YHHH 4EC5A 3RGZA 2LF0A 1HNWH 4OD6A 1B04A 4KHPH 3FMAA 3JAMW 4MTEA 1ODHA 4AQYH 5IWAH 4OCHA 1V9PA 3J81W 3M4IA 3NCVA 3OETA 2O4CA 2PT7G 5LL6b 4LF7H 2CW8A 2UXBH 4CC6A 1E4FT 1E4GT 1O75A 5D1PA 5A2QW 5FPRA 5IT9W 1TA8A 4MV9A 2ZM6H 4DV7H 2XIGA 4RB0A 4JI1H 4JI5H 4UFZA 4EFBA 3BA8A 4NXNH 1Z2PX 1ZHQA 4B3SH 1XNQH 4X66H 4JV5H 2YCHA 4LF8H 2F4VH 3GABA 4JI4H 1AN7A 2VOBA 1SYXB 4G08A 1F0XA 3K3VA 4B3MH 3JSNA 3DF7A 3IG0A 4JYAH 1FJGH 2RGRA 2FPHX 3CVZA 4JI7H 4A2AA 2O03A 1XMOH 4UCVA 2VQEH 2Y3MA 1HNXH 5FD5A 4RB1A 4LF9H 4DV1H 4UCOA 3OTOH 4DV5H 2VKCA 4NXMH 4B3RH 2UUCH 1BJTA 3QD7X 1XDNA 3MWMA 2D9IA 3T1HH 2WDTA 2ZJTA 4R7RA 1N34H 4NZRM 1IBLH 3C0FB 3N43B 4J0MA 2WYOA 3L4KA 1FVIA 3N41B 4LFCH 1HR0H 3L4JA 4LSAA 1DGSA 5LMNH 4K0KH 2UU9H 2KSWA 3L2PA 3T1YH 4DV6H 4EEQA 3PN1A 1X9NA 3N42B 2HHHH 3HXLA 1BGWA 2VUGA 2RGVA 1N32H 4OX9H 4BWSC 4LF5H 1XMQH 1N36H 1ZHSA 2WE6A 4MV7A 4APMA 2OWOA 1FKAH 1HNZH 4LF4H 4GKJH 2MCTA 4M7EA 2UXDH 4DR2H 3OSSD 4LFAH 4CC5A 4JI8H 3RF2A 1X9ZA 3FAUA 2ZQEA 5DT9A 5BR8H 2UXCH 3BA9A 3BAAA 1I94H 4DR1H 3RGXA 4UCUA 1MZBA 3RIZA 4RZQA 1I6UA 3RJ0A 2VQFH 4LH7A 5D1OB 4X65H 5EOYA 2Q2TA 5D1OA 4FM9A 4DV3H 3JSLA 3KDGA 4DR7H 4DV2H 2HVSA 1IBMH 4LSXA 3N40P 4JI0H 2HVRA 4MTDA 3KAJA 4DR3H 3EZJA 4X62H 3KDKA 5FPOA 4RB3C 4X64H 2Q2UA 4LF6H 1Z2OX 2FE3A 4GLXA 4I7HA 4UCRA 4IAJA 3GR5A 3KAKA 2HGSA 1TAEA 4B8CD 2CW7A 2VPSA 2UUAH 4JI6H 4DV4H 1SEIA 1Z2NX 3LMLA 4YY3H 4LH6A 2E5LH 4A2BA 4LFBH 1J5EH 1S03G 3J80W 4DUZH 3KXYT 4JI3H 1XNRH 1WH2A 4DR6H 4PDBA 3N44B 2HVQA 4DUYH 4RAZA 4B3TH 1GYFA 1VS0A 1A0IA 4RAYA 1IBKH 3BABA 4GKKH 3J7AK 4DV0H 4LMYA 4UCSA 2UUBH 4RB2C 4ETSA 1M0WA 4JI2H 4DR4H 3F8NA 3KALA 5FD6A 1L2ZA 3RTXA 4E9JA 1P8LA 4UCTA 4Q0YA 4NZTM 3UQ8A 3N6XA 5FLXW 4DR5H 3H20A 1S68A 1N33H 2W57A 3EYYA 5LMUH 1M0TA 4EFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH H;  1HNW H;  4KHP H;  3JAM W;  4AQY H;  5IWA H;  3J81 W;  4LF7 H;  5LL6 b;  2UXB H;  5A2Q W;  5IT9 W;  2ZM6 H;  4DV7 H;  4JI1 H;  4JI5 H;  4NXN H;  4B3S H;  1XNQ H;  4X66 H;  4JV5 H;  4LF8 H;  2F4V H;  4JI4 H;  1AN7 A;  4B3M H;  4JYA H;  1FJG H;  4JI7 H;  1XMO H;  2VQE H;  1HNX H;  4LF9 H;  4DV1 H;  3OTO H;  4DV5 H;  4NXM H;  4B3R H;  2UUC H;  3T1H H;  1N34 H;  1IBL H;  4LFC H;  1HR0 H;  5LMN H;  4K0K H;  2UU9 H;  3T1Y H;  4DV6 H;  2HHH H;  1N32 H;  4OX9 H;  4LF5 H;  1XMQ H;  1N36 H;  1FKA H;  1HNZ H;  4LF4 H;  4GKJ H;  2UXD H;  4DR2 H;  4LFA H;  4JI8 H;  3RF2 A;  5BR8 H;  2UXC H;  1I94 H;  4DR1 H;  1I6U A;  2VQF H;  4X65 H;  4DV3 H;  4DR7 H;  4DV2 H;  1IBM H;  4JI0 H;  4DR3 H;  4X62 H;  4X64 H;  4LF6 H;  4JI6 H;  2UUA H;  4DV4 H;  1SEI A;  4YY3 H;  2E5L H;  4LFB H;  1J5E H;  1S03 G;  3J80 W;  4DUZ H;  4JI3 H;  1XNR H;  4DR6 H;  4PDB A;  4DUY H;  4B3T H;  1IBK H;  4GKK H;  3J7A K;  4DV0 H;  2UUB H;  4JI2 H;  4DR4 H;  5FLX W;  4DR5 H;  1N33 H;  5LMU H; 
#chains in the Genus database with same CATH topology
 2W7P A;  4EC5 A;  3RGZ A;  2LF0 A;  5KG7 A;  3M9M B;  3OHA A;  2W9B B;  2AU0 A;  1B04 A;  1OWT A;  5IYC G;  4IR1 A;  3MWE A;  2R85 A;  4MV1 A;  3M4I A;  3OET A;  2NN6 G;  2I8C A;  1JDB B;  3OSP A;  4ECT A;  2UXB H;  4J9O A;  1K1G A;  1E4G T;  5H80 A;  2NUA B;  5A2Q W;  1DT4 A;  4A3L G;  3UFX B;  3I4N G;  2YZM A;  2ZM6 H;  2FLL A;  2ATL A;  2FFM A;  4EFB A;  5BPF A;  1GLV A;  1EC6 A;  1SCU B;  3HOX G;  5KFJ A;  1UC8 A;  4B3S H;  4MV6 A;  4X66 H;  2CTM A;  5C0X G;  2DZD A;  2GLT A;  5KFQ A;  4O3S A;  1AN7 A;  3KHL A;  2VOB A;  3GID A;  3GIJ A;  1SYX B;  2X06 A;  1F0X A;  4XYM B;  3K3V A;  5KG3 A;  4B3M H;  3JSN A;  4TV8 F;  4EYH B;  1T36 A;  4DL3 A;  4R8U B;  2OPU A;  3G8C A;  2JA7 A;  4JUZ A;  1I50 A;  2O03 A;  2ANR A;  1WVN A;  4UCV A;  2Y3M A;  5FD5 A;  3MWD A;  3PVX A;  3Q1K A;  4QW8 A;  2VKC A;  5KT7 A;  2JA9 A;  3Q8P B;  1N34 H;  3C0F B;  3G6V A;  1SFO A;  3L4K A;  2XC9 A;  1HR0 H;  3L4J A;  5LMN H;  4K0K H;  3VPD A;  3VPB A;  1DV2 A;  4RNM A;  2XCP A;  3TQ1 A;  3GTL A;  4EEQ A;  2CTE A;  3HB9 A;  3PN1 A;  2NVX A;  2Y0S E;  3ETH A;  2RGV A;  4O3Q A;  1N32 H;  4OX9 H;  5EWG A;  2J6U A;  4LF5 H;  2LTM A;  2ZDQ A;  3RB6 A;  4O3O A;  4NBQ A;  4ZOL F;  5DQH A;  1EYZ A;  1EHI A;  4M7E A;  1DV1 A;  5KX5 F;  1K83 A;  2JA5 G;  2FMA A;  5T14 A;  5L9X A;  5CAE B;  4ECV A;  3BA9 A;  5D8D A;  1I94 H;  1RYS A;  3RV3 A;  3V6K A;  2J6T A;  3Q8Q B;  5DQG A;  4BA2 I;  5KG1 A;  1KEE A;  4A3B G;  4RZQ A;  5L1J A;  2AGQ A;  1I6U A;  5LP6 F;  4YQW A;  4TQS A;  4O3R A;  1KJQ A;  4XX0 B;  3RJ0 A;  4RUA A;  3HOU G;  1KJI A;  1TWH A;  4X65 H;  1RJP A;  2YS7 A;  3HKZ A;  4J9Q A;  4QIW A;  3KDG A;  4DR7 H;  1RK5 A;  2WAQ A;  4EG0 A;  2HVS A;  4NLG A;  2HVR A;  2JA6 G;  2J9G A;  1UNN C;  4BBR G;  1E4E A;  5LOV F;  4A3K G;  3KDK A;  2SCU B;  5KG6 A;  4C5B A;  2Y0S A;  5JQW A;  1VBI A;  5LYJ F;  3H0G A;  4F50 A;  2VA2 A;  4GC6 A;  4TQR A;  2OLS A;  4I7H A;  4UCR A;  4QWA A;  4IAJ A;  3KAK A;  3BQ2 A;  4MV8 A;  3U9T A;  5L1L A;  3GLK A;  3V69 A;  5FJ8 G;  2ASJ A;  1ZTG A;  1Z2N X;  5LA6 F;  2FP4 B;  3HOZ G;  2VR1 A;  2W6Q A;  2W8L A;  2E5L H;  4MA0 A;  5DQI A;  2FK3 A;  2YZN A;  5EDW A;  2JEB I;  1S03 G;  1XNR H;  4DUY H;  5KG5 A;  3BQ0 A;  5BPH A;  4B3T H;  2R87 A;  4ED7 A;  3T5L A;  1Y1W G;  1VS0 A;  1IBK H;  1I7L A;  3BAB A;  4LMY A;  3Q8S B;  4J9S A;  4A3G G;  1M0W A;  3RBD A;  5KFI A;  4ZHQ F;  4F4W A;  4EBE A;  1GO3 E;  1VAJ A;  3KAL A;  4IRC A;  1L2Z A;  4U7C A;  1A9X A;  3N8D A;  4NZT M;  2C35 B;  2W7O A;  5FLX W;  3IN5 A;  4Q44 A;  4I55 F;  4OO1 G;  3JRW A;  5DLF A;  5K36 G;  4C2M A;  4YHH H;  1V51 A;  4ZQI A;  2VQD A;  5KFP A;  1JLL B;  4O3N A;  4YAK B;  4J9K A;  2E2H A;  4KHP H;  3RB4 A;  4IWX A;  1V9P A;  1W96 A;  4IZO A;  3BQ1 A;  3TII A;  1UG8 A;  2CW8 A;  4CC6 A;  2RF4 A;  3PW2 A;  1O75 A;  4E4T A;  2CQY A;  1TA8 A;  4ED8 A;  3I0P A;  2BL5 A;  2XIG A;  2NU8 B;  3WO1 A;  4JI1 H;  4UFZ A;  5DLG A;  1RK6 A;  1WSC A;  4HQ6 A;  1EUD B;  2C00 A;  3MFI A;  3HOW G;  1XNQ H;  2FMR A;  3R5H A;  5KFB A;  2V9W A;  5C4X G;  4JI4 H;  2FK2 A;  3M9O B;  1Y1V A;  4MV4 A;  2R92 G;  2BQU A;  1GSH A;  5JEA G;  3GII A;  3DF7 A;  3RV4 A;  4BA1 I;  1FJG H;  2FPH X;  3K5I A;  4ECY A;  3VKE A;  3VPC A;  4JV1 A;  4A3D G;  2JEI A;  2HJW A;  5DG7 A;  4RB1 A;  2MJH A;  4DV1 H;  4FU0 A;  2BR0 A;  3CQZ A;  2RGR A;  4DV5 H;  4IWY A;  3MWM A;  2UUC H;  2JE6 I;  2WDT A;  2RDJ A;  4EYI B;  2R82 A;  1WR2 A;  4AYB A;  4J0M A;  3GTP A;  2WYO A;  5KFA A;  3RBE A;  1X4M A;  1UC9 A;  3N41 B;  5KFR A;  4LFC H;  1N48 A;  4LSA A;  1DGS A;  4A3C G;  2CWF A;  5C8Y F;  5IYD G;  4DV6 H;  1PX2 A;  2BA0 A;  2HH2 A;  3EPI A;  4YJ3 F;  4FS1 A;  3RAX A;  2YRX A;  1WTJ A;  2YU9 A;  4ECX A;  2C2E A;  2WE6 A;  4MV7 A;  5KG4 A;  2JZX A;  4APM A;  3BG5 A;  1AUV A;  4LF4 H;  4HNV A;  3T5J A;  2UXD H;  4LFA H;  3OSS D;  2JVZ A;  3TIN A;  3HOY G;  4JI8 H;  2QND A;  3RF2 A;  5GON F;  4DLK A;  3FAU A;  4YR3 A;  3TQT A;  2ZQE A;  5DT9 A;  1ZZJ A;  2UXC H;  3KHR A;  2R7Z A;  2FLN A;  2R6F A;  5KT2 A;  4DL2 A;  4UCU A;  2DLN A;  3G6Y A;  4Y8V B;  3RIZ A;  4Q45 A;  1S97 A;  4ZI7 F;  4IRD A;  5KT4 A;  1DTJ A;  3HKZ E;  1K1S A;  4LH7 A;  3AEV B;  1KJJ A;  4QIW E;  5EOY A;  5IYZ F;  2Q2T A;  2V58 A;  5D1O A;  4RNN A;  4DV3 H;  2WAQ E;  4BY1 G;  4EGQ A;  4ED0 A;  2UVR A;  2B63 G;  1E4E B;  1TWA A;  5C44 G;  4DR3 H;  4X62 H;  2R8J A;  2VUM A;  3MJF A;  1V9N A;  1ZZI A;  4JV2 A;  1Z2O X;  2FE3 A;  4L1K A;  5DG8 A;  4GLX A;  2V5A A;  4ED6 A;  1WHR A;  4AIM A;  3GR5 A;  2W6N A;  2WB1 A;  2HGS A;  1VBG A;  5F9N A;  3R5X A;  4JI6 H;  1T94 A;  1X4N A;  4DV4 H;  4LH6 A;  3LML A;  4YY3 H;  1PK8 A;  3MFH A;  2G8Y A;  5J2T F;  5JUM A;  2W9B A;  3RB0 A;  4A2B A;  4QWC A;  1J5E H;  5C5J A;  4QJF A;  3Q2O A;  3KXY T;  1KJ8 A;  2FPP B;  5KFD A;  4DR6 H;  4PDB A;  4ECR A;  3GTG A;  1WCM A;  2C28 A;  1TUA A;  1A0I A;  4J9P A;  5KT6 A;  3J7A K;  2NVY A;  5KFH A;  2UUB H;  4RB2 C;  4ECS A;  4B8T A;  4ETS A;  2R7L A;  2R93 A;  1GSO A;  1S10 A;  4DR4 H;  1T3N A;  2JA7 G;  2R7K A;  3TIG A;  3FKI A;  4Q43 A;  4BXX G;  5JVL A;  4Q0Y A;  3UQ8 A;  2IMW P;  4JVH A;  4DR5 H;  3H4B A;  1S68 A;  3E5N A;  2ZDG A;  3EYY A;  4ECQ A;  3MR3 A;  4OD6 A;  1AUX A;  1NXU A;  2R8K A;  3FMA A;  3JAM W;  4MTE A;  1ODH A;  2R8G A;  5IWA H;  4OCH A;  3J81 W;  3FDS A;  5KT3 A;  3NCV A;  2O4C A;  1B33 N;  5LL6 b;  4YJ2 F;  5KFF A;  1E4F T;  5D1P A;  4ED3 A;  3LWB A;  5FPR A;  4M9U A;  2FKL A;  4MV9 A;  4DV7 H;  4G3I A;  2FJZ A;  4RB0 A;  4JI5 H;  1WE8 A;  2M8W A;  3LP8 A;  2ZDH A;  5C1O A;  4EEY A;  4A3E G;  2CTL A;  2YCH A;  4DL4 A;  3HBL A;  5EZY F;  5EWE A;  2F4V H;  3GIL A;  4O2A F;  3PW7 A;  4HR7 A;  4HYK A;  2DWC A;  4G08 A;  4O4H F;  4XYL B;  4AM3 A;  2R8H A;  2AXY A;  1JDE A;  1TWG A;  3GTK A;  3CVZ A;  3GQC A;  1VBH A;  1XMO H;  5F9L A;  2VQE H;  1HNX H;  4YR2 A;  5K2M A;  1B6R A;  5BMV F;  2W8K A;  4UCO A;  3V6J A;  1S9F A;  3OTO H;  4B3R H;  4R7R A;  1XDN A;  1S20 A;  2D9I A;  3T1H H;  4AYB E;  1C3O A;  4NZR M;  1IBL H;  3N43 B;  3QFF A;  3WNZ A;  5KFM A;  1R9T A;  4FBT A;  1FVI A;  1K1Q A;  2PMZ A;  5KFU A;  4EGJ A;  2UU9 H;  2PBZ A;  2DPI A;  3T1Y H;  1C30 A;  3KHG A;  3GIM A;  3T5H A;  3I4M G;  4BBS G;  2DIK A;  2BQ3 A;  1X9N A;  3N42 B;  2W9C A;  3SI8 A;  3HXL A;  3H0G G;  2WTF A;  1BGW A;  4FS2 A;  4RU9 A;  2LRR A;  1XMQ H;  1N36 H;  2PY9 A;  5IP9 G;  1TWF A;  2OWO A;  4DL5 A;  4GKJ H;  2MCT A;  1KJ9 A;  1KC7 A;  4MV3 A;  2CPM A;  4EBD A;  5I47 A;  1S0M A;  2FLP A;  3BAA A;  1I3Q A;  4IHJ F;  2QK4 A;  3QZ7 A;  4YBZ B;  4WAL A;  1MZB A;  3GIQ A;  4O2B F;  5KFN A;  3OHB A;  3MR6 A;  4H8A A;  2CTF A;  5KFZ A;  2VQF H;  3ORR A;  3ORQ A;  5D1O B;  3BJY A;  4YB8 B;  4FM9 A;  1IOV A;  5KG2 A;  2JA8 G;  3JSL A;  1VIH A;  5JVD F;  3N40 P;  2YZG A;  4QWB A;  4RNO A;  4MTD A;  2W9A A;  4Q8E A;  3HOV G;  1V8C A;  3EZJ A;  1ULZ A;  5FPO A;  2E2I A;  5CB4 F;  2YL2 A;  4F4Z A;  1J4W A;  4J9R A;  2UVW A;  4TUY F;  4ME6 A;  2R7M A;  2WB1 E;  4WBN F;  5LXT F;  4WD3 A;  1RJR A;  5KFS A;  1TAE A;  4B8C D;  2VPS A;  5IP7 G;  3PR4 A;  3GIK A;  5DGA A;  3GTM A;  4QW9 A;  4RZR A;  4XZ3 B;  4J9M A;  3JZI A;  2CZG A;  2R7N A;  2JA5 A;  2AGP A;  2A1S A;  3GV8 B;  3AYH B;  2NU6 B;  2YRW A;  4FJS A;  1PQX A;  4JI3 H;  3RUP A;  5C3E G;  3PW5 A;  2BQR A;  3N44 B;  5DG9 A;  2XGQ A;  1VIG A;  1CE8 A;  5FLM G;  3GTQ A;  4RAY A;  2M6Q A;  4YR0 A;  4GKK H;  4UCS A;  1GGO A;  4JV0 A;  1Y1V G;  2DPJ A;  2P2R A;  2AGO A;  3H3V H;  4JI2 H;  5FD6 A;  2I80 A;  2K1H A;  4E9J A;  1P8L A;  4TV9 F;  3RTX A;  4O3P A;  3M9N B;  2Z0S A;  5KT5 A;  1S0N A;  3U9S A;  5JH7 F;  2OH2 A;  3N6X A;  3H20 A;  5EWF A;  1RYR A;  2FPG B;  3V4Z A;  2PQU A;  2FB9 A;  1ZZK A;  4QMF B;  4J9L A;  1JXL A;  2E3U A;  1ZET A;  3SB1 A;  3T5K A;  1HNW H;  1W93 A;  2W6M A;  4ED2 A;  4AQY H;  1EZ1 A;  3VMM A;  3QZ8 A;  3PW4 A;  4C5C A;  2YW2 A;  2YS6 A;  3GIP A;  2PT7 G;  4LF7 H;  4O4I F;  5CA1 F;  2R8I A;  4A3I G;  2XCL A;  3KTM A;  5KFW A;  3NGD A;  3L7Z C;  3H40 A;  5IT9 W;  3U1K A;  2GPS A;  5KFV A;  3GV5 B;  2OPV A;  3RB3 A;  1GSA A;  1Y1W A;  1VKZ A;  2UVU A;  2FK1 A;  3BA8 A;  2XCA A;  4NXN H;  4IFD G;  1Z2P X;  1ZHQ A;  4JV5 H;  3OUU A;  4HNU A;  4LF8 H;  1XRH A;  2NU7 B;  4C5A A;  3GAB A;  1JX4 A;  2JA6 A;  1MSZ A;  5KG0 A;  1Z2I A;  3H4D A;  4I50 F;  5KFG A;  2JEG A;  1KBL A;  1KHM A;  2YYA A;  1BXR A;  3IG0 A;  2R7Z G;  4JYA H;  4J9N A;  4WAN A;  4QWE A;  4JI7 H;  1EUC B;  4R8U A;  4A2A A;  3Q8R B;  2JEJ A;  5KFK A;  4IR9 A;  4ECW A;  3PZP A;  4LF9 H;  4FBU A;  3PW0 A;  2ANN A;  2V4R A;  1BJT A;  4LIJ A;  4JVY A;  4NXM H;  2R86 A;  2C22 A;  3QD7 X;  1ZQ7 A;  1Y14 B;  2ZJT A;  5L1I A;  4IRK A;  4EBC A;  4ED1 A;  1V4Y A;  1B6S A;  2PMZ E;  2UVV A;  2KSW A;  3L2P A;  2CTJ A;  2VUM G;  1J5K A;  2W9C B;  2PVP A;  4GC7 A;  2HHH H;  2R84 A;  5KKN B;  3SE7 A;  2VUG A;  2VPQ A;  2PN1 A;  3MR2 A;  2LTL A;  3WO0 A;  4ECU A;  2CKZ B;  3K3P A;  4BWS C;  4Q8F A;  2IA6 A;  2I87 A;  1JKJ B;  4U6P A;  1ZHS A;  4PWQ A;  4A93 G;  5KFL A;  3RAQ A;  1X0A A;  1FKA H;  1HNZ H;  4I4T F;  2W70 A;  2ASL A;  1JIH A;  4MA5 A;  4DR2 H;  4F4Y A;  2R92 A;  3K5H A;  4CC5 A;  4DL7 A;  1CQI B;  1X9Z A;  3ETJ A;  5BR8 H;  3KHH A;  2VA3 A;  4DR1 H;  3RGX A;  2XGP A;  4A3J G;  4A3M G;  5KFC A;  3EPG A;  3GTJ A;  1WCM G;  4RUC A;  3MR5 A;  2YQR A;  2QYZ A;  3GKU A;  5C1P A;  3GV7 B;  3PR5 B;  3R5F A;  3OUZ A;  4ECZ A;  2AQ4 A;  2IBK A;  2R93 G;  5IYB G;  2ASD A;  4DV2 H;  1IBM H;  3I12 A;  4LSX A;  4JI0 H;  3KAJ A;  4F4X A;  3FKI G;  4RB3 C;  4A3F G;  1M6V A;  2CTK A;  2Q2U A;  4X64 H;  3R23 A;  1RJQ A;  4LF6 H;  2XD4 A;  2CPQ A;  5KFY A;  5KFE A;  4YP3 A;  5KFX A;  2W6Z A;  5KFO A;  3PO2 G;  2M05 A;  1CQJ B;  2CW7 A;  3GTO A;  2UUA H;  1CS0 A;  4O4L F;  2W6O A;  4QWD A;  2V4Q A;  1SEI A;  3RFC A;  5HBR B;  4YAJ B;  2C2D A;  2JEF A;  2RDI A;  2GPW A;  1S0O A;  1BNC A;  4LFB H;  2HH3 A;  3OSN A;  5J2U F;  3J80 W;  4DUZ H;  1WH2 A;  3UOE A;  2JEA I;  2HVQ A;  4RAZ A;  2V59 A;  2W71 A;  2C2R A;  4BY7 G;  1GYF A;  2ALZ A;  5HV6 A;  4MAM A;  4HNT A;  3V4S A;  2J6S A;  4DV0 H;  2DGR A;  3V6H A;  5CA0 F;  1I7N A;  2IP4 A;  3G6X A;  2P0A A;  5DGB A;  5L1K A;  2B63 A;  5KFT A;  2X0S A;  3F8N A;  2NU9 B;  1TWC A;  2CWH A;  4UCT A;  1M7J A;  1DIK A;  2W6P A;  4DL6 A;  1IOW A;  2FPI B;  1N56 A;  3JRX A;  1N33 H;  2W57 A;  4FJU A;  5LMU H;  3PO3 G;  1M0T A;  4EFE A; 
#chains in the Genus database with same CATH homology
 3SB1 A;  4YHH H;  4EC5 A;  3RGZ A;  2LF0 A;  1HNW H;  4OD6 A;  1B04 A;  4KHP H;  3FMA A;  3JAM W;  4MTE A;  1ODH A;  4AQY H;  5IWA H;  4OCH A;  1V9P A;  3J81 W;  3M4I A;  3NCV A;  3OET A;  2O4C A;  2PT7 G;  5LL6 b;  4LF7 H;  2CW8 A;  2UXB H;  4CC6 A;  1E4F T;  1E4G T;  1O75 A;  5D1P A;  5A2Q W;  5FPR A;  5IT9 W;  1TA8 A;  4MV9 A;  2ZM6 H;  4DV7 H;  2XIG A;  4RB0 A;  4JI1 H;  4JI5 H;  4UFZ A;  4EFB A;  3BA8 A;  4NXN H;  1Z2P X;  1ZHQ A;  4B3S H;  1XNQ H;  4X66 H;  4JV5 H;  2YCH A;  4LF8 H;  2F4V H;  3GAB A;  4JI4 H;  1AN7 A;  2VOB A;  1SYX B;  4G08 A;  1F0X A;  3K3V A;  4B3M H;  3JSN A;  3DF7 A;  3IG0 A;  4JYA H;  1FJG H;  2RGR A;  2FPH X;  3CVZ A;  4JI7 H;  4A2A A;  2O03 A;  1XMO H;  4UCV A;  2VQE H;  2Y3M A;  1HNX H;  5FD5 A;  4RB1 A;  4LF9 H;  4DV1 H;  4UCO A;  3OTO H;  4DV5 H;  2VKC A;  4NXM H;  4B3R H;  2UUC H;  1BJT A;  3QD7 X;  1XDN A;  3MWM A;  2D9I A;  3T1H H;  2WDT A;  2ZJT A;  4R7R A;  1N34 H;  4NZR M;  1IBL H;  3C0F B;  3N43 B;  4J0M A;  2WYO A;  3L4K A;  1FVI A;  3N41 B;  4LFC H;  1HR0 H;  3L4J A;  4LSA A;  1DGS A;  5LMN H;  4K0K H;  2UU9 H;  2KSW A;  3L2P A;  3T1Y H;  4DV6 H;  4EEQ A;  3PN1 A;  1X9N A;  3N42 B;  2HHH H;  3HXL A;  1BGW A;  2VUG A;  2RGV A;  1N32 H;  4OX9 H;  4BWS C;  4LF5 H;  1XMQ H;  1N36 H;  1ZHS A;  2WE6 A;  4MV7 A;  4APM A;  2OWO A;  1FKA H;  1HNZ H;  4LF4 H;  4GKJ H;  2MCT A;  4M7E A;  2UXD H;  4DR2 H;  3OSS D;  4LFA H;  4CC5 A;  4JI8 H;  3RF2 A;  1X9Z A;  3FAU A;  2ZQE A;  5DT9 A;  5BR8 H;  2UXC H;  3BA9 A;  3BAA A;  1I94 H;  4DR1 H;  3RGX A;  4UCU A;  1MZB A;  3RIZ A;  4RZQ A;  1I6U A;  3RJ0 A;  2VQF H;  4LH7 A;  5D1O B;  4X65 H;  5EOY A;  2Q2T A;  5D1O A;  4FM9 A;  4DV3 H;  3JSL A;  3KDG A;  4DR7 H;  4DV2 H;  2HVS A;  1IBM H;  4LSX A;  3N40 P;  4JI0 H;  2HVR A;  4MTD A;  3KAJ A;  4DR3 H;  3EZJ A;  4X62 H;  3KDK A;  5FPO A;  4RB3 C;  4X64 H;  2Q2U A;  4LF6 H;  1Z2O X;  2FE3 A;  4GLX A;  4I7H A;  4UCR A;  4IAJ A;  3GR5 A;  3KAK A;  2HGS A;  1TAE A;  4B8C D;  2CW7 A;  2VPS A;  2UUA H;  4JI6 H;  4DV4 H;  1SEI A;  1Z2N X;  3LML A;  4YY3 H;  4LH6 A;  2E5L H;  4A2B A;  4LFB H;  1J5E H;  1S03 G;  3J80 W;  4DUZ H;  3KXY T;  4JI3 H;  1XNR H;  1WH2 A;  4DR6 H;  4PDB A;  3N44 B;  2HVQ A;  4DUY H;  4RAZ A;  4B3T H;  1GYF A;  1VS0 A;  1A0I A;  4RAY A;  1IBK H;  3BAB A;  4GKK H;  3J7A K;  4DV0 H;  4LMY A;  4UCS A;  2UUB H;  4RB2 C;  4ETS A;  1M0W A;  4JI2 H;  4DR4 H;  3F8N A;  3KAL A;  5FD6 A;  1L2Z A;  3RTX A;  4E9J A;  1P8L A;  4UCT A;  4Q0Y A;  4NZT M;  3UQ8 A;  3N6X A;  5FLX W;  4DR5 H;  3H20 A;  1S68 A;  1N33 H;  2W57 A;  3EYY A;  5LMU H;  1M0T A;  4EFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...