4AM3A

Crystal structure of c. crescentus pnpase bound to rna
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
622
structure length
622
Chain Sequence
GSMFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAVFAKSQKPGQDFFPLTVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVKGFKNEVQVVVTVLQHDLENDPDILGMVAASAALCLSGAPFMGPIGAARVGWVDGAYVLNPTLDEMKESKMDLVVAGTADAVMMVESEIQELSEEIVLGGVNFAHQQMQAVIDAIIDLAEHAAKEPFAFEPEDTDAIKAKMKDLVGADIAAAYKIQKKQDRYEAVGAAKKKAIAALGLSDENPTGYDPLKLGAIFKELEADVVRRGILDTGLRIDGRDVKTVRPILGEVGILPRTHGSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKESFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLAMMDAGVPLVRPVSGIAMGLILEQDGFAVLSDILGDEDHLGDMDFKVAGTSEGLTSLQMDIKIAGITPAIMEQALAQAKEGRAHILGEMNKAMDAPRADVGDFAPKIETINIPTDKIREVIGSGGKVIREIVATTGAKVDINDDGVVKVSASDGAKIKAAIDWIKSITDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Caulobacter Crescentus Polynucleotide Phosphorylase Reveals a Mechanism of RNA Substrate Channelling and RNA Degradosome Assembly.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase/rna
molecule keywords POLYRIBONUCLEOTIDE NUCLEOTIDYLTRANSFERASE
total genus 175
structure length 622
sequence length 622
chains with identical sequence B, C
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2012-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF00575 S1 S1 RNA binding domain
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 4am3A02
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4am3A03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4am3A01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4am3A04
3L7ZB 4AIMA 4AIDA 2JE6A 2ANRA 4JVYA 5JEAC 1R6LA 2JEAB 2BL5A 1ZTGA 2JEAI 1VIGA 2BR2B 5JEAF 2NN6G 2JE6B 4B8TA 3M7ND 2PY9A 5K36F 2OPVA 4BA1B 2JE6I 2C39B 5K36G 2C38B 5JEAE 2NN6F 2PO2B 4IFDD 4OO1F 5JEAA 5JEAG 4AM3A 2BA0G 2AXYA 1DTJA 2WNRB 1OYRA 4JVHA 2BA1D 1ZZKA 1VIHA 5C0XD 1WVNA 4LIJA 4BA2A 2WP8A 1X4MA 2ANNA 3GCMA 5K36C 2CTEA 1UDNA 2QNDA 3CDJA 2JEBB 2PNZA 3HKMA 1J5KA 1OYSA 2JVZA 2NN6C 1J4WA 4IFDF 2NN6E 4OO1E 4BA2I 2PO2A 5C0XA 3U1KA 2PNZB 2PO0B 5K36E 2E3UA 5K36A 1WE8A 1ZZIA 2BR2A 3KRNA 1DT4A 2C37B 2NN6A 4BA1A 1K1GA 4QMFB 2WNRA 2FMRA 1UDQA 2HH3A 2JEBA 1ZZJA 2CTKA 2C37A 3GLLA 4IFDE 3AEVB 4IFDG 2PO1B 2CTMA 2Z0SA 1UDOA 5C0XG 2PO0A 4IFDB 3GMEA 4NBQA 4OO1C 3H36A 3M85G 2PO1A 5C0XF 2YQRA 2CTJA 2BA1G 2CTLA 4IFDA 2JEBI 1OYPA 1EC6A 4WANA 3M7NG 5C0XB 4BA2B 2NN6D 2P2RA 4OO1D 5K36B 2BA0D 2DGRA 2JZXA 5K36D 2NN6B 3VKEA 5JEAD 4BA1I 3V69A 5C0XC 1KHMA 1TUAA 1UDSA 3DD6A 2HH2A 2CTFA 1E3HA 2C39A 3M85D 1R6MA 4OO1A 3H1CA 1E3PA 5C0XE 2BA0A 2CPQA 2JA9A 3L7ZC 4IFDC 4OO1B 2OPUA 2PQUA 2MJHA 2WP8B 1X4NA 3L7ZA 4OO1G 5JEAB 4WALA 3B4TA 2C38A 3CDIA 1WHUA 2JEAA
chains in the Genus database with same CATH superfamily
2PX9A 2BOLA 1SC7A 3ZXSA 3JRHA 2QSGX 4G6DA 2DO7A 4NC6A 1IBKH 2LNBA 1GXQA 3RSNA 4OZEA 4BH9A 3JR9A 3IL2A 4BGDA 2PY9A 5GADJ 3GUDA 3N97A 1ZLKA 1FWKA 4E9JA 3MD2A 2MG4A 4HW0A 4LG0B 2C39B 3G6EI 1ZH5A 2NVYJ 2KRCA 4OO1F 3NRVA 3S2WA 4E7JA 1XGNA 3JREA 2VL8A 3V42A 1YJWI 3T1BA 3KZZA 1J2XA 1FMWA 3DBHB 2UUAI 2CRGA 5DM6F 1ZK8A 4BBRJ 1RC9A 2WP8A 2DT7B 5ERIA 1JTYA 4Y15A 2EV5A 3WTZA 2JA5J 3CMYA 1VQ6I 1Z3YA 4EVIA 3GTPJ 3ABTA 1QPMA 4FE4A 2R7RA 5IT9Q 4F92B 2EQRA 2E2JJ 4KISA 1D3YA 4A0XA 1Z7UA 2OTLI 4DV5I 1J75A 4XBFA 4AQYH 1JKQC 1UJ8A 1G8XA 5B3SH 5DM7F 1HNZI 4S0HB 2GWRA 2VKHA 5LMNE 4DZPA 2H6CA 1S16A 2K9SA 2VKDA 1U5TB 4V2FA 3CCRI 3ZZTA 5IP9J 1ZRDA 3VOEA 2E7XA 2L9SA 1F43A 4P5OA 3LA3A 4LFUA 2WB1N 3S8PA 5J47A 1L3LA 2LR8A 2O03A 2R7TA 1FOWA 4HNVA 3P3CA 4HX8A 4EJOA 4DR7E 2Y2ZA 3PL8A 5GTHC 1ETVA 1MMAA 1GV2A 3O8HA 1VQMI 3CO6C 1TLHB 4IRIA 4LF6H 1ZARA 5H2FC 3SEZA 1A36A 4O3MA 2ZB9A 3T8TA 4DV4I 1RREA 2BA1G 1QHGA 2VC1A 2IP2A 4XKVA 3FF5A 3TGNA 6PAXA 4DPYA 1EC6A 3WG9A 1BL0A 1O4XA 3KE2A 3IH3A 2UUZA 5LMUH 3ZM7A 2VBWA 1U2WA 4A0YA 2RNJA 4BHBA 5LEJA 4B3AA 3E5XA 4BJ6C 1VQ7I 4HACA 2WY8Q 2FX0A 3K2AA 3K4BA 2IRFG 2Z16A 4LPFA 2HI3A 2GXGA 3ABUA 4JX6A 2CTFA 1ZTRA 2C39A 4DJAA 3W2VA 5IWAE 1OCRH 4KMFA 2IGOA 3K9TA 3KP5A 4RM3A 2HFSA 1EV7A 5B1BH 3QU3A 1TQMA 1XMQE 4NXNE 3LSJA 2KPMA 2IS2A 3PSFA 2HQNA 4ZJZA 1Z67A 2PQ8A 1XMKA 2ELJA 2MC4A 4AVPA 5GMEA 4DV0I 4HYEA 4K0KE 1ZN2A 5A2QC 2PQUA 2DOAA 4WALA 4XQFA 3B4TA 2XB5A 3HHGA 3SZGA 3NZKA 1FWZA 3SHFA 3JRDA 2CQQA 4X66E 3OIPA 1OYYA 3JRGA 3BROA 1FTZA 3KYCB 4A93J 2G0EA 3QODA 3ROUA 3FHZA 4QNJA 2HKXA 1PP8F 5FKLA 1NG7A 1W7PA 2HPMA 2GM4A 2M8GX 3I59A 1VQOI 5JEAF 2NN6G 4PJMA 1IRZA 1EJ9A 1HDPA 4GXOA 4N9IA 3OYIA 3FKIJ 1D0YA 1N33E 4JI1H 3VEPA 1W7PB 2CMPA 2F5CA 1SFXA 2VLAA 2CQKA 4USKA 3IWZA 2BA1D 4XKBA 4JI0H 2ZC2A 4BE0A 4LFAE 1YLFA 2M2EA 1MBEA 2PNMA 4YY3I 5M5YJ 4X64E 2HR3A 4L5IA 1B6AA 1NHAA 2O3FA 3BR0A 3E0JB 4CYCA 3P9KA 4TV7A 3A03A 2QNDA 3M6AA 3CCVI 2XRLA 1W1WE 2JVZA 5GPAA 3DXJF 4G08A 1FP2A 2EFOA 2OZUA 4G7OF 3KP3A 2O7OA 2AXLA 3H0GJ 3L7WA 4LJZF 3V8LA 5DNLA 1TNSA 3I0TA 3LNUA 4X64I 3DF8A 4IXAA 3E5QA 1YX5A 3L9FA 3GFLA 4DV7H 5CLSA 1DARA 5M5XJ 5TGTA 3CF5F 3RKYA 5HODA 4GFBA 2G7UA 4UVAA 4PFOA 1ZZJA 3H92A 2E5NA 2X6YA 3H9JA 2G8YA 1YO5C 2NS0A 3F21A 2C37A 2A2DA 4PGHA 2BW3B 4DV4H 3S1RJ 3BJ6A 3SYTA 1U5TC 3OWTA 2BW3A 2L4MA 3FHNA 3K70D 3K1JA 5C0XF 2CTJA 4CCJA 5K5RA 1NK3P 2STTA 1SMYF 1OYPA 5F64A 4UUTA 1JUMA 2HXIA 4YFKF 4B4CA 2DOFA 4E7IA 4KIBA 4DV6E 4X65E 5J1UA 2XAGA 3PQJA 2F6CA 2Q1ZB 2A05A 4DUZH 4F55A 2DGRA 2VQFH 3FXLA 2D1HA 5ED4A 1DDNA 4PJLA 1U8RA 1IBME 3D4JA 1N25A 4BUPA 4BXXJ 4RS8A 4N3OA 2Y9YA 3SQNA 4OO1A 3LSKA 3K7AJ 1QBJA 1HXDA 3CCSI 3LL7A 1WGXA 3IH4A 2GBYA 1MNEA 4II2A 5LHGA 3JAMZ 4I98B 5AONA 1USUA 2XGCA 1ZM4A 5E8IA 5L3JA 4IZJA 5CKTA 5K5QA 1DP3A 2CJJA 4N4OB 4ZZLA 3TO6A 4PRXA 3E6DA 3HKZN 4BXFA 1VQKI 3LSMA 3LAJA 4FN5A 1FZPB 2KL4A 2VASA 4BXUA 5FFXA 4BYYA 2HEOA 4A5MA 4G9YA 2GO3A 1MH3A 4LF9H 3GXOA 2JEAB 3HUGA 1HDDC 3H3VK 2KDOA 3IAM2 1AWCA 4FW5A 3EUKL 2XSJC 2KIMA 4FW7A 4JI1I 1ZG3A 3QOPA 4RGXA 4DR3H 2BXYA 1RI7A 3BPXA 1K83J 3M7ND 5K36F 4PK4A 2R7XA 3SDGA 4FWGA 2HHHE 4LF8H 2EZLA 5FO5A 5LMUE 5K36G 4AC0A 3V4GA 2XHKA 2RN7A 3CJTB 3PO2J 2WNRB 1R4MB 4JI3H 2P5KA 2RDPA 4RA2A 4C3JJ 3KLOA 3IV5A 1OISA 1CF7A 2HWVA 4HZFA 1ZRFA 3OL4A 2QWWA 5EJCA 2Q0OA 1AKHB 2K9NA 4XN0A 3OY9A 3FXKA 3HC7A 3ECOA 2L9NA 4DR6E 4DV0H 1PYVA 1H7UA 4OX9I 4C2MJ 3ERED 3M8EA 2FRHA 1R1UA 1U9OA 2F5FA 1H88C 2X1DA 3I53A 3PO3J 1TWFJ 3HOYJ 5C0XA 3GR5A 1MMNA 1SFOJ 2O4CA 1WJFA 2ZFWA 3HZJA 4IQ4A 4DUYE 2UUAE 2PT7G 2PG4A 3DKXA 4JI2I 2LFBA 3ABMH 1OCOH 2VJ5A 2WADA 3HOUJ 4B3RI 3E97A 3L2CA 3ERMA 5JHFA 4BE1A 2UXDE 2HH3A 3GFIA 3T1HI 1NHIA 2IGNA 4IFDE 1FKAE 2LYCA 1H9TA 1I1GA 4PCQA 1S3JA 2L5QA 4DZJA 2Z9OA 2GIVA 2XGDA 3H36A 3M85G 2Q8KA 2FBHA 3L00A 4A3EJ 3QRFF 2PO1A 4IZKA 4BNCA 2K4JA 3CQZJ 3WTTC 1WJCA 2NNYA 4UT4A 1YOVB 1FIPA 1F1ZA 1XPXA 3J7ZI 1H89C 2R92J 1Y0UA 2DEJA 1Z3XA 3KFWX 3RZOJ 2XAUA 5J8FA 3ZQLA 5LGUA 1I6HJ 2JUGA 4Q48A 4ASNA 3LPSA 1IRFA 3JW4A 2JVGA 2R5ZA 1Y39A 2HK2A 1E17A 3GZ5A 3Q6NA 1FC3A 3HKZA 2COBA 4C3IJ 4EATA 5E17F 2J7KA 3WU6A 4DR2I 3NQOA 1PVGA 4JP0A 2JJ7A 1KU2A 4LK1F 4OAYA 2NNNA 3F6VA 4AIHA 2A3SA 4KICA 4S04A 4CGZA 2HDCA 5JR3A 1R6MA 2I10A 5BQTA 3GLXA 5LBQA 1HKQA 1N32I 1JHFA 2DA3A 1WJBA 4BL0B 2HKOA 3B78A 3ASNH 1PUFB 4OX9H 2JZYA 1LFPA 3PM1A 5L3EA 1CGPA 4L0ZB 2UXCI 1O3RA 4FJUA 4RLFA 3W6VA 2WAEA 3OYJA 2CGEA 1VTNC 1K61A 5LHHA 4PJNA 2ANRA 4A0ZA 1O57A 2Y75A 5FKMA 3I4MJ 3H4LA 5FLXQ 3OMYA 3G1OA 4AUXA 2DA6A 3FKJA 2UUBE 4XRFA 2LJPA 1WH7A 5B5EC 2IA2A 4UXNA 4EMSA 4JYAI 1R5HA 1N0VC 4EM1A 4DV6H 4B3TH 3SFZA 2NN6F 5JEAG 3T1HH 1RHYA 2VBYA 4YIFA 5J4YA 2XGXA 1H9GA 1X19A 2P0WA 3F3XA 1IN7A 2JA8J 2OC6A 3BC8A 2HOSA 2HKJA 3U9GA 1OPCA 1ZGWA 1WI3A 4IHXA 3H0DA 1G6NA 3WU2C 3TKYA 3HKMA 3FISA 2ZCWA 2L9VA 1LPQA 2AHQA 1MBKA 3L2UA 1IRXA 1UB9A 3GFJA 5ILSA 3OS1A 1N77A 3ESWB 2JN6A 2K3PA 3NWSA 2Z5CB 2E5ZA 1XNQI 2Z2SB 2A5WA 4Z7YA 2XF7A 2X1EA 1LQ1A 3N4MA 2EB7A 1MNMC 3A02A 4X0GA 1ZXNA 5KK1A 3J7AY 1P2FA 2K3FA 3PUFA 2ZKZA 4IQJA 4ZDOA 4A3GJ 3J80Z 4G94A 1E3OC 4URLA 2HNHA 3HGGA 2RVCA 1Y8QB 2DQLA 4DR3E 3AEVB 2WW4A 2UUCI 4NHJA 1AN7A 4D5FA 2Z0SA 2FNPA 5C0XG 4LF5I 4EC5A 1HK7A 1J09A 1XB4A 2FOKA 2H1LA 2JSPA 4ZTFA 5IT9K 3OS0A 3GX4X 3DU6A 4RGSA 3R6SA 3GZ6A 3LQQA 3P9CA 2AS5F 2CPMA 2W1OA 3LSHA 4GKKI 4LF5H 1ZREA 4PSWA 3SFIA 2NVTJ 2M1BA 1GUUA 4B3RH 3HYIA 2UXBI 1QVTA 4HQMA 3K17A 4Y7NJ 1LB2A 4C3HJ 3ZZ0A 4WXCA 4CDGA 3FK6A 4F7ZA 3A2KA 3DPUA 2BE5F 2KT0A 2VIXA 4Y17A 2EA2A 5F0CA 3ZN1A 1K6OA 2LC2A 1N32E 4XKCA 1MBGA 4I7HA 4AU7A 1BR4A 1YW7A 3FXQA 5A2QK 4HDVA 4ENMA 1XNQH 2OU2A 4NC7A 5EEGA 5F04A 1WKMA 3F0CA 2HK3A 3G3ZA 4QSHA 1RKWA 3FIWA 5KAFC 1RNLA 1YQAA 3L7ZC 1RZ4A 2JRTA 4DR4H 4B44A 1S29A 1KKHA 4U7BA 1LFUP 2QYOA 2MJHA 4KDPA 3WE2A 2MD5A 2DW4A 4N4NB 4X66H 2FMYA 3WE3A 1EH8A 5E3NA 1NHJA 3L7ZA 3GABA 3ZRGA 1DPRA 1EKEA 3K4JA 3RTRA 2M4GA 5KHDA 3IRQA 3GYHX 3F0NA 4EJTA 5JHUA 1Z1DA 3IUOA 2A6TA 1BM9A 5D8LB 3CMAI 2A68F 3PFYA 2V6CA 5E3MA 1W5SA 4Z7CA 2HVSA 1FYKA 3OETA 1GV5A 3QOEA 5EKWA 1MBHA 1SFUA 2ZMEB 2CGPA 4DYRA 2NVQJ 4HXZA 2DK5A 4RAGA 2OBPA 1XSDA 1TP4A 4P55A 5JEAE 4HQEA 2E2HJ 2AXYA 3L1PA 2EV6A 4LFAH 3G71I 4WWCA 4M73A 4OMYA 4E7HA 1D5VA 1BOBA 1R5GA 1TWGJ 2R7ZJ 1XMQI 1FEXA 1DUXC 1VIHA 2K86A 4DUYI 4IHSA 4A5NA 4RB1A 1Z0VA 4RMNA 1YIJI 5D6FA 1OQYA 2F5VA 2E1MC 2QEXI 3C7JA 1BC7C 2DJNA 4EJVA 2KRHA 1LVKA 4X62H 1ZGAA 2XAQA 2QKLB 1J59A 4ZYDA 1WZ2A 2WAQA 3J7AM 1ERDA 1LDKB 1MDMB 2CQXA 4CHUA 4OD6A 1K47A 2WTEA 1MU5A 1DP7P 1IUFA 2VQFI 1MJ9A 5K36A 4W1UA 1USVA 5CVIA 4B09A 1YW9A 2R5ZB 3VFZA 3TMOA 1KTVA 4HLXA 3MWMA 5FLVA 3P3EA 1MG7A 3DEEA 2H27A 3HHHA 4YY3H 4JI4I 3C18A 4JI8H 1H8AC 2LKXA 2BY1A 3T8RA 1BI0A 4RB3C 4YFNF 1A35A 1FNNA 2KHMA 1K4TA 1IDZA 2K7LA 3BCAA 3TOBA 3WG7H 1B72A 2PO1B 1IBLI 2Z99A 1OJLA 1G3TA 5GMDA 5GP9A 2XROA 3TO7A 4LFCI 3JRCA 5BR8H 3FK7A 2X48A 4JI5I 4MLOA 3TBIA 5EF6A 2IT0A 5FD6A 3S32A 4IFDA 3J80W 3ECHA 4D7MA 3FX3A 1M1EB 1FPQA 1OMIA 2OV7A 3GTGJ 4KQVA 1XCVA 1IF1A 2RQPA 4LB5A 4AVZA 1EF4A 4XLCA 3WTUC 4FETA 4FQGA 4A6EA 4XLHA 3J7AO 4MYTA 1S72I 2R93J 1P6RA 1PP7U 3F23A 3RPQA 1B9MA 3OIOA 3OYEA 4CH7A 1ITYA 3CJRB 4C9YA 3RQ4A 2DPDA 1TUAA 3DBLB 3IC7A 2FPHX 3MVPA 1TTYA 3BR1A 1QZZA 4LIUA 2OJED 1X58A 4I09A 1MGTA 2L2OA 3JSPA 3MKYB 3BJAA 1IUYA 3E3VA 4DV5H 1B4AA 5IT9C 1GVJA 1QZEA 4A3MJ 2JWTA 4OIOF 4KN7X 3CDLA 2VPRA 3K85A 4IFDC 2BV6A 5BPDA 4CCKA 5FLXC 2ZSHB 5DV5A 3OOPA 2LG4A 1N34H 5K5OA 3KX2A 3VSKA 5F27A 3SZTA 5JEAB 3BOQA 2ESHA 1NG6A 1DGWY 5A2QW 1T98A 2QA4I 4OIPF 3E6BA 1H72C 2HDWA 2UXBE 1S20A 4JOMA 1FJGI 4YEJA 1R6LA 1IGNA 2HHHH 3CDHA 2BR2B 2EFGA 2VESA 4JI6I 4M9SA 4I01A 5TRDA 3F8NA 1OR7C 2CQ7A 5E3LA 1P92A 3QWLA 4AM3A 1IBLH 1HQCA 1DTJA 4E70A 2DTRA 2K85A 2V1NA 1I3QJ 3CO7C 3PJRA 2OQGA 5F6FA 5HLTA 2IAIA 2KJCA 2STWA 1OYRA 4L5JA 4FWDA 5K1YA 1B59A 3FDYA 5FRNA 2H8RA 1B63A 1V5FA 1VQ9I 4IOAF 1XNQE 4H4KC 1Q1HA 4D5CA 4BJTA 2DU9A 3BZCA 4BA2A 2F48A 4IHVA 3I4PA 2ZXJA 2EIKH 5LGTA 2AE8A 1LDDA 5CYVA 5K36C 1FY7A 2A2CA 1ZG1A 3S1QJ 1Z2IA 1Y1VJ 4HLYA 1P9QC 4FHTA 2X6WA 4BAYA 3TEDA 3V5RA 1D1AA 2XKPA 4I3HA 3Q0WA 4I76A 2ZQEA 4JG4A 3HJEA 4FWHA 3A1YA 2DA7A 1SAXA 2CV1A 5CVRA 3V7CA 2NN6A 4AQYE 4P96A 2GXBA 5FROA 2NRAC 4GKKE 3N05A 4KITB 4WUDA 1IW7F 1SD6A 3ZZUA 1KU9A 2RV8A 4KT5C 4A12A 3JTGA 1FSEA 1XDSA 4JYAE 4ZDLA 2HFHA 2KRFA 4LF8I 4LF7H 4L9VA 1H7SA 1VQPI 3DEUA 3DLAA 3SZPA 3ZQFA 4M6VA 1I5ZA 4DGWB 4CYCB 3GMEA 1TBXA 1OCTC 2COMA 1HBXG 3C1DA 3KZYA 3QYFA 3QPLA 2VODA 4LLLA 2QQAA 1VQ4I 1HR0H 1XSXA 5H6RA 4EGYA 2DCEA 3WODF 1OJ4A 3J80C 4M1KA 1EI1A 4XLPF 5D5VB 2UXCE 2GOXB 4X1EA 1VQ8I 2H1KA 2NN6D 3ZQ7A 1O3QA 2DTZA 2R7UA 1IXRC 2KKOA 3SEQA 2A5YB 1J9IA 1V8CA 4HG2A 4CCMA 2B9SA 1BR2A 1WJEA 4UB8C 3WGHA 5J6XA 4IZJD 2YR2A 1E3HA 5H6QA 4HDUA 1T33A 1XRHA 2Y30A 3GONA 1TZLA 4EMDA 4ON0A 4XK4A 5K7FA 4DR1I 1E3PA 3HM5A 4HEA2 4LF4I 4G12A 3I55I 4HRIA 5EL9A 1USSA 3WTYC 1JE8A 5J1RA 2TRTA 2VQHA 4KYWA 5DYMA 3I58A 1ON1A 1Z5CA 4M9ZA 1G2HA 2EZHA 2RNGA 3PS3A 3BWGA 1XMOE 1R23A 2ID3A 2VI6A 3GF2A 3PRYA 1S7EA 2D2WA 2C38A 4IHTA 4JQFA 1R36A 2IJLA 2J5PA 2LTPA 3OL3A 4HA8A 4CCOA 1RR9A 4JI6E 1HA8A 3JCUC 1ZELA 4L9NA 1XC5A 2M5WA 3HG9A 1QRYA 4Y3OA 1I39A 4BU2A 1VQ5I 3GZNB 4NDLA 2QBYB 1KU3A 2FQ3A 1GDTA 1PDNC 1OCZH 4XTJA 2MLKA 1S7OA 4GRIA 4G7ZF 2H09A 3DP7A 2DDBA 5A2QZ 5IYDJ 5DRRA 1IG7A 4IFDD 2MH2A 3PNVA 1D8KA 3TQNA 2BVLA 2UUCH 3E5UA 2VJJA 4PSXA 3PIOF 2PJPA 3PS1A 1HW5A 2DN0A 2BYVE 3S2HJ 5EGOA 2V34A 3I54A 4XLEA 4EM2A 1HLVA 5DROA 1ZAOA 1GVDA 3LA2A 4E6KG 3ZOBA 4B3SE 3B6CA 3DBRB 2JEBB 2PNZA 1KVKA 1ULYA 2YSRA 3OTOI 1IN5A 2JT2A 1RIOH 4KNYA 3U21A 4M3EA 4IFDF 4M3BA 2QQ9A 3HOTA 4XN3A 4DPTA 1SEIA 4S05A 2W82A 1BI2A 4UV8A 1W5TA 2M7BA 4BS9A 4U3DA 4MQYA 2GO4A 1LVAA 3QAHA 2LLKA 2E2IJ 3PFIA 1HNWE 1KYWA 2UXBH 1SFKA 2X06A 5AIPA 4DV7E 1AOYA 3K4LA 2LDUA 3PNTA 4ESJA 1VNDA 1X1AA 3PYGA 1B9NA 5ILVA 3U1YA 2O1VA 3G2BA 4XIDA 5DT9A 2V9PA 3ASOH 3JTHA 2GZWA 5E1XA 3HRUA 2XAHA 4J01A 2VKVA 2A61A 2DA2A 4BKXA 1PJRA 1JJ8C 2UWMA 5BPIA 4PJ0C 1IC8A 5HS7A 4I6ZA 1HSTA 3LSRA 4JI4H 4HNTA 4M6XA 4FE7A 5K36D 2ETHA 3WHBA 4LF4E 5IOZA 1I6UA 2ZITA 1KA8A 1MKMA 1T56A 2E60A 1Z7LA 4DUZE 4FASD 1HNZH 3OOUA 4LOCA 1IRGA 1F36A 3SJMA 4F52A 2HYJA 3V8KA 3Q1QA 2R42A 1G59A 5IYCJ 1R7JA 3P3GA 1ETXA 5JI6A 2KZGA 2DMNA 1S7AA 2V4JC 3DPLC 2JA7J 5C4XJ 1ON2A 4MU4A 2TDXA 3K10A 4D1QA 3HSEA 4MQ9F 3WGIA 2DFIA 4DR2H 4HF2A 2FBIA 5LMUI 1Y6ZA 1Y1WJ 2BXZA 2VT3A 3NEUA 1FYMA 4AIMA 2F5EA 2E5LI 2JE6A 2H8WA 1U8BA 2ZM6E 2FFMA 4ENKA 3A4CA 3I0PA 2RREA 4E7KA 1FT9A 1QNTA 2BZTA 5F0FA 1R9TJ 2CW8A 2JEAI 2BHZA 3RKXA 3M1CA 2CWHA 5FLXZ 2OPVA 2R4GA 3OYCA 2UXNA 3KYLA 1R4NB 2HGCA 4HF1A 2KIUA 2P7VB 3Q9SA 5AIQA 4CXFA 3O8GA 3MZYA 2PO2B 5CVUA 1Z0TA 4JV5H 3OR1C 4ENJA 4B1RA 2UUBI 2Y0MA 4ISAA 4DV3I 4LF8E 4ZVIA 2W48A 3L2VA 1Z6TA 2ZXHA 2HDDA 2W7NA 1N34I 1D1BA 1BIAA 1UMQA 1R1VA 3OR2C 4HBLA 3LOCA 1B72B 4QWQA 1Z0EA 1XGMA 1REPC 5BOXA 2CG9A 2CWEA 3PYEA 4A3CJ 5C0XD 4AQYI 3AG3H 4QPOA 2XASA 2OZ6A 4ABZA 4DR4I 3QD7X 1A6IA 3UNGC 4H0EA 2LMDA 3UKGA 1W0TA 2QVOA 4BQNA 4DV1H 2PO2A 2M8WA 4IZJB 3U1KA 4WF2A 1Z9CA 1B8IB 3I64A 4OAZA 1FBSA 4Y4RA 1P4AA 3AL0B 4YY3E 4RGRA 1BBYA 1MDMA 1OFCX 3KP4A 5E79C 4ZYGA 4K2EA 3WTSC 1KIJA 1N36E 3HB9A 1USTA 3H5NA 1HNXH 5E1ZB 3MQ0A 1NH3A 4Y52J 4BA1A 3T1YE 2NXNB 4CCLA 4DUYH 2L7ZA 2CUZA 1VI0A 2UUAH 4CA0A 2QSHX 1FTTA 4XR6A 4EJUA 3FMSA 3CD6I 1J0RA 4XOTA 4MO7A 5BR8E 3FMQA 1XTAA 1AHDP 3O3KA 2L3DA 2V8PA 1IZ1A 1R71A 3LSTA 1T39A 2EPFA 3P9IA 4XOPA 2DYSH 2M7AA 2CW0F 4RAFA 4ZYHA 4M72A 1NTCA 2KMUA 3MAJA 3CLOA 3S1MJ 4A3JJ 2B0LA 2VOOA 2R5YB 2CFOA 5KCMA 1S9HA 4N0BA 3HXLA 5HDKA 1LKXA 2UV1A 2XUBA 2Z33A 5EEHA 5FJ8J 1IJWC 1T8IA 1YHQI 4MFDA 5ICEA 2E5LE 1A6FA 2EFPA 2OD5A 1QA6A 2DDAA 2P81A 4B3SH 4MU0A 4KHPI 4IHYA 1WSUA 4XLAA 1WCMJ 2LY2A 5JEAD 2FA5A 1OYIA 2VE9A 4HNUA 4F91B 2AJ4A 4AWXB 4X64H 2VBXA 1S4EA 2LF0A 1P4WA 4JI2E 1ONVA 2BY0A 4RB0A 3QT6A 1S5LC 1Y0NA 5LGNA 1MD0A 2DMTA 2IS6A 3H1CA 1MSEC 2Z5BB 3FXUA 1HNWH 3QPTA 3U2RA 5E20A 2D5VA 2ISYA 4WUCA 4IL6C 4FCYA 1QPIA 2DA5A 4OU0A 3MCZA 2EA4A 2Z5BA 2F4VI 2LVSA 3GTQJ 1K78B 3TDZC 2IBDA 2XDVA 4XLFA 5DEQA 4AYBA 4OX9E 1BI3A 4LCFA 1ZZKA 5HLHA 3FMRA 3HEFA 1D8JA 2KIQA 2PJRB 4BDZA 5LL6R 4A2UA 2IS1A 1FBQA 1IDYA 4OOIA 1PUEE 2DPUA 1POGA 1ORKA 3W3CA 3JAMQ 4OMZA 4DR7I 2LRRA 1X3WB 1HCRA 1HOMA 2BEOA 2QZ8A 4DV4E 2VQEI 2W57A 5TJJA 2E35A 1GXPA 4P9FA 2CWFA 2JE6I 1N75A 4JI5E 3GTMJ 1YW8A 4LMYA 3R61A 1P4XA 3H9GA 2HPIA 5K7HA 2VQEE 4JI4E 2LTMA 2PLYA 4IFDB 1LE8B 1XDUA 1TQPA 4L9JA 3I56I 3OS2A 1Y6IA 5IWAI 3EQLF 1HNZE 2F4IA 3HJCA 4G7HF 4LIJA 3VSLA 5EG0A 1YH8A 3S3NA 1HNWI 1X1DA 2CTEA 1YHCA 1ZR4A 3FAUA 4O5VA 2VQFE 3BG7A 2NYXA 3BG3A 4KT6A 3FXOA 4BA2I 1WQ2A 1YS6A 2MGQA 5LLQA 3M4OJ 1QHHD 3S16J 2PO0B 3I3LA 1ZM3A 1MMDA 4XSXF 2R3SA 4M71A 4IPAA 2XPVA 1FWLA 3R4KA 3HRTA 3MKWB 2L7KA 3FXRA 3V8JA 3EZJA 3OYDA 2H6BA 2LF7A 1K79A 3L2WA 1VQNI 2GQQA 2CV0A 5JLWA 1MZBA 4A3LJ 2IGKA 1QU3A 1HF0A 4MU1A 1U78A 4NXME 2DA1A 4DYQA 3ZQGA 1YFHA 1JT6A 3WU1B 1B1BA 1T38A 4CYDA 4OWRB 3J81Q 4B3XA 2DBBA 3DU5A 2PO0A 1TT5B 1O7LA 2P5LC 4YHHE 3K4CA 4RB2C 3HTSB 1MX0A 2VC0A 4WXDA 3ZQCA 4XKWA 2ID6A 2M4KA 4GDFA 1W5CC 2BV3A 4BY1J 3CCQI 3M9AA 1XGOA 2DOEA 2V9KA 5B1AH 5F1RA 5E18F 1RUOA 5FWKA 2IGMA 2L02A 4ZDPA 4LF5E 1T95A 3NARA 3SXYA 4OO1D 2HVQA 4HV6A 2ECCA 2ZJPF 3HOXJ 1RPWA 3OYFA 2VT2A 5EYRA 1W36C 2KP6A 2NN6B 5GAGJ 3E1SA 3TW6A 4DPUA 1ODDA 4QPQA 3OTOE 1Y56A 3DD6A 3ZMVA 3DPTA 3WHCA 1VISA 4RPFA 4OIQF 3T1YI 2HH2A 4PJJA 2VKCA 1SVLA 2UZKA 1JUPA 2G9WA 2HOAA 3BQYA 4D0PA 5F1JA 1TWCJ 2JRMA 3W6JB 4V2GA 4UUVA 2JA9A 3LNQA 3T1YH 2JPBA 1T6SA 2P4WA 4M3GA 3DTKA 2Y48A 2OPUA 3MZHA 1YRNA 4XNFA 3BR2A 2L54A 4DR4E 4XICA 1ZRCA 4B3MH 4HV5A 4A3BJ 3ZKBA 1F5TA 1WHRA 4QIWN 4ESFA 3QU6A 1HW1A 5HLIA 1S03G 1J5EE 2VBZA 4C2TA 1UFMA 3I4NJ 4A3FJ 4UUSA 2EZIA 3CC4I 2CYYA 4XLNF 2UUCE 3K1PA 3Q0VA 1JXSA 4GQUA 4A3KJ 1FIAA 2CG4A 1N0UA 1I94I 4I02A 1A04A 1UAAA 3ZQIA 2MBFA 1F9NA 2B63J 1IN6A 5E8GA 1WVNA 3J7AG 2ANNA 4JI2H 2LRDA 4IJAA 2QLZA 3GCMA 4ETSA 2F4VH 3LSGA 2XAFA 1B8IA 4C2UA 5M3MJ 3DV8A 2F1DA 4BACA 2HQRA 3RQIA 4DW6A 3L2RA 2LF8A 1EA6A 1PQXA 1LEAA 1P7IA 2NN6E 4OCHA 3G1LA 4QTRA 1SFEA 3I71A 4KUMA 3EUAA 4NQWB 3MKLA 5LRRA 3WGGA 4D9JA 4YG2F 2EJRA 2QKMB 4Y33A 1HKTA 3OSSD 2DJIA 3J81Z 5DCMB 2ELKA 1W0UA 2BR2A 3FBIB 4RAYA 3KRNA 4DXLA 1L0OC 2QQBA 3GVAA 1IXSB 4I99C 4JI3I 4YIIA 3PUBA 4R1FA 4DU7A 2FMRA 1EH6A 2JEBA 2NAZA 2E1CA 3WTXC 2XSDC 4BQQA 2OQRA 1BJAA 3F22A 4IFDG 5LHIA 3EUHC 2V79A 1KU7A 2E1NA 2HZTA 4EGZA 1CF7B 2EWNA 3BDDA 1DPUA 3ML6A 3CESA 5EGOB 2ADUA 4JI5H 3BZKA 3M8FA 3VPRA 4HF0A 1AA7A 1T0FA 2NS7A 2VUMJ 4XMYA 4G8XA 4NBQA 1J5EI 1RETA 4OINF 2O3ZA 2D9IA 2VQEH 3K4KA 4B43A 2XRNA 2LD5A 2Y9ZA 3G1MA 3CUQA 1Z21A 3I9V2 4KJZA 2X1CA 4CCNA 2OCCH 4MEXF 5L3GA 4D7NA 4HYMA 3K0LA 5C0XB 2Y31A 2N8GA 5DDGA 5LEKA 2ICWG 3C2HA 5HNFA 2D1VA 2O1UA 1MSZA 1I1SA 5D5UB 3NAUA 3A0HC 2BY2A 3T5XA 3RZDJ 2YPRA 3H3UA 4JYKA 5LD2C 1WFXA 4BA1I 3HTUA 4J3DA 4AIKA 2X51A 5C0XC 1ZQ3P 4A69C 1IV6A 2G7HA 2Q2EA 2WWYA 1JUSA 5C44J 1DU0A 4DR1H 4A3DJ 3O6BB 2K9QA 2AO9A 3M1EA 1WTJA 3ZQHA 2CPQA 1OCCH 1LDJA 4OO1B 5IT9W 4DV5E 2V2VA 4U88A 4E7ZA 1FYLA 3PSIA 1N33I 2JPCA 4OO1G 3COAC 2ZM6H 2FXAA 2OTJI 2R3VA 1BI1A 2V2QA 1J7KA 4B3SI 2ISZA 2JEAA 1IXCA 2E1RA 2JT1A 4UUSB 1Z0CA 4LF6E 1WVRA 2E1OA 3ZGKA 5BMZA 2F4OB 1YYVA 1BW5A 1ZTGA 1QVUA 4LLGF 3R0AA 2O1WA 4UVCA 2ZBKA 4YIRX 4IVNA 4E4HA 1ZYRF 4RGUA 2UU9I 4ENNA 3A0BC 1ZGJA 3ZP5A 1KZHA 3QT5A 4K0KI 3MKZA 5CQGA 4B8CD 2VE8A 2V1DA 4B3RE 4LFBE 2BGCA 2FF4A 2HFUA 3RI4A 2ELHA 1HC8A 4MU3A 4GYGA 1TW2A 5IY5H 5LFAA 1VBIA 4FJSA 1N32H 3PIPF 3JRIA 1MSFC 1P42A 1PIEA 2CUJA 3Q3SA 1X4PA 2WC2A 1UEKA 1Z59A 4XL9A 5JFRA 2DI3A 3K6GA 2PNZB 3V2UC 5HOOA 5K36E 2LH9A 2VJIA 2WAQN 2ZMEA 3F6OA 2HTSA 3LFKA 1ZM9A 3VYTB 1OLTA 1OR7A 3KZIC 5HVQC 2KDZA 5DRPA 1XMAA 4DR5E 3WU4A 3BR5A 3KYDB 4R1HA 1FJLA 3C2GA 3OYAA 2R7VA 1QZRA 4ZYAA 2P7CB 1I94H 1SVMA 2W84A 1MMGA 4GKKH 4LFCE 4IRGA 2CTMA 2BBYA 3CLQA 3E7LA 4F3QA 5J40A 1UDOA 3HOVJ 4JI7I 3AG2H 3ZQQA 2J65A 1S8NA 4JI1E 3PQKA 4JYAH 4RBOA 1XX5A 3CCJI 2CH0A 5EZGA 3CZ6A 2GA1A 3TP3A 1VFCA 1Y60A 1ELOA 4JI7H 2E5LH 2FQ4A 5CPRB 4WUBA 2ZMEC 2O9LA 4HX7A 5IPAA 3M7NG 3LSPA 3HULA 3AL0C 2QUFA 3D5RC 3LMMA 2F4VE 4Q4ZF 1X3UA 2HOEA 2HZDA 2W24A 2BM0A 4JI8I 5FRMA 2ZNYA 4DQ2A 2UXCH 1XMXA 3PNYA 3J7YJ 1I50J 5CQEA 1D0ZA 4FISA 1EA3A 1V55H 2ZXIA 5BNGA 4IRHA 1SANA 1ENHA 1V9NA 2HQ5A 2A69F 4FW3A 3L09A 4L18B 4GKJE 5C0XE 3BTCA 3K1MA 2A6EF 3RIRA 4L0YB 2BA0A 3NCVA 4FW6A 3AKZA 1QGPA 3BTIA 3HPGA 2BM1A 2A6HF 2NS8A 5K7ZA 3J80K 2DT5A 3H35A 1SD5A 1ZKGA 4GGGA 4DNCA 2ZNZA 3KCCA 5GTIC 2CUEA 2IERA 1U9NA 2ZFUA 1YE9A 3CDIA 1UELB 2E19A 3LWFA 1XMOH 4B3TI 1U0JA 4AIDA 4DIQA 3ZMUA 2OF7A 1U2RA 1NZ0A 4LOMA 4JVYA 4LFAI 5L3BA 3DFGA 4NC8A 2BY3A 5IT9Z 2JTVA 2HU9A 2EINH 2CZ9A 5C3EJ 3HRSA 2QM3A 4P7AA 3JAMC 5BS6A 2KJBA 4M3DA 3LA7A 2V26A 5BR8I 2MFZA 5L3CA 1X0AA 4X65H 1Z5AA 2W85A 4BDYA 3A01B 4LF9I 3P06A 1FSHA 1YITI 5M5WJ 2LREA 4R79A 3C3WA 2V7FA 3ISPA 3JRAA 2MW8A 2WB1A 3F8FA 1FJGE 2NPFA 3BJOA 3B6AA 1IBMH 2K02A 3G4SI 5J3LA 4NZTM 2AQFA 2LY9A 5EEAA 2X4HA 5TISC 2EFQA 3ZN0A 4MDTA 2D45A 1KQ0A 3E6MA 3WTVC 4L5EA 4USMA 2IVMA 4G6TB 1YJ9I 4U0VA 2GIZA 2DQRA 5JVGF 3MN2A 3GTJJ 4ZTJA 1TT0A 2Z5UA 2KFDA 1X4OA 4GKJI 3ZKDA 3C2BA 1QZYA 3UHMA 1ETWA 1NHHA 5FD5A 4X6AJ 2V2ZA 1Q1VA 4PZJA 1O3SA 4Q5SF 4LF9E 2R0QC 4KIFA 1R5ID 3HL2A 3GTKJ 1N34E 2DAOA 3H5AA 3FXJA 1FLIA 1MNDA 4P9UA 4OIRF 2DXIA 3PS2A 1TL8A 4DV3E 3L2QA 2MA3A 2JMWA 2XF5A 2GS8A 1I3AA 4LCHA 4CICA 1XHKA 4RAZA 1WWXA 1PUFA 3P76A 3BTJA 3R60A 4PDBA 3HSFA 2IPQX 3F8CA 3J81C 3F8MA 3GFMA 5DD4A 4RDUA 2IS4A 3BQZA 3UR3C 5L3DA 2FSWA 1K7AA 2W00A 4MEYF 4CZCA 5J8CA 3RCOA 1UHMA 3BCBA 3M7GA 1WI9A 2PMHA 3OIQA 1TC3C 4BA2B 2VKEA 2XEXA 2JA2A 5KVRA 4DV0E 4DR6H 1F4KA 4LLNA 2Y0SA 1MJAA 1SD7A 1IBLE 2CU7A 2IA1A 2CO5A 2M87A 1YRNB 4NXNI 3I5UA 2HVRA 1TW3A 2V6EA 3VKEA 3HOZJ 3V69A 1G3SA 3B8HA 3IH2A 3PYFA 2CFXA 1WJAA 4LG3A 3M85D 4ZZDA 1X1PA 4DU8A 1D5YA 1IN8A 2K5CA 3DLLF 4MIMA 1WH5A 3U1DA 3KP2A 4IX7A 4B3ME 2VN2A 4DUZI 2A1SA 2CVEA 4LG0A 3CP8A 3CUQB 1TWHJ 2IESA 1H74A 3S1NJ 1I94E 3OSFA 1JGSA 4NB5A 2DK8A 1FKAH 1VI7A 1X1BA 4KHPH 4IO9F 2F5DA 3OV8A 4HAMA 3A01A 4AIJA 4Z6YA 2PMZN 3P5JA 1VZ0A 4M74A 5FB2A 3HDDA 2LSOA 5FKNA 2LKPA 1PKPA 5D6EA 2H94A 1FBUA 3CP2A 2EFNA 2P6TA 3ELKA 3B73A 3BZ6A 1KGSA 3LFUA 4CO8A 2JE6B 3GO5A 3D0SA 4LF7I 4EM0B 3QP6A 5FKKA 2DEIA 1JTXA 4DBQA 3PYDA 1XG1A 2XKOA 2AQEA 1Y4SA 2E7WA 2XVCA 3CMEI 1ETQA 3E6CC 4PRVA 2R7FA 2KIFA 3IKTA 4I0BA 2VONA 2HOTA 2VXZA 4DV2I 4JV5E 3HBLA 1A6QA 2HXOA 2UXDI 4ZYEA 2GOMA 1HNXI 2ZJQF 3EUHA 1H0MA 1V5EA 4A3IJ 1W36D 2CSOA 4II3A 3CC7I 1J5KA 5DTDA 4BQOA 1V5GA 1Z77A 1OYSA 1FI4A 3WU3A 4FX4A 4GKJH 3DCFA 3GTOJ 1TWAJ 4NNJA 4DBRA 4OO1E 3GBGA 1KQ8A 3KDGA 5D8KB 2BHYA 4LFBI 3AG1H 2M0CA 3BG6A 1IO2A 1X1CA 1V3FA 2CQNA 2LK2A 2XB0X 3ABLH 4U0WA 3KETA 1DT4A 1JGGA 3P7NA 2RQQA 4ANJA 1YG2A 2I8DA 2WV0A 3LSIA 2GLOA 1K1GA 3DTIA 1N36H 2FJ1A 4WX9A 4U7DA 3CMMA 2NVUB 3FM3A 1O3TA 1NK2P 4PU9A 4YHHI 1JT0A 2VXDA 3IRRA 5FGMA 4ED4A 2F4MB 1Z0WA 1WJ5A 1ZR2A 2QF7A 3RJPA 4JI6H 3RDIA 3GWZA 3ONQA 2R7SA 3B82A 4NXMI 3VDXA 5CVVA 4BEHA 3T1HE 1MIJA 4A6DA 2HHHI 2YX4A 3ZCOA 4LF6I 3HOSA 1X9ZA 2EBIA 3HRMA 3IAS2 4PGGA 2K40A 3RKWA 2VQGA 1YX3A 2KISA 2VQLA 1XGSA 2E71A 2IOPA 1IN4A 3J80Q 1XMOI 1SAUA 2FU4A 3UOEA 3BR3A 2B7EA 2FEZA 2R7DA 2R7QA 4UNOA 4UTGA 5IP7J 1B62A 3BP8A 2LOOA 4UB6C 1C0WA 2KLOA 4PUSA 4AD9A 3QYEA 4BJ5C 2P5VA 3J7AK 1HW2A 5FLXK 1BA5A 1ACIA 4DR1E 1NXUA 2K27A 1KHMA 1UDSA 4XSZF 3CCUI 3DKYA 1TNTA 3HGYA 3OSGA 4KN4X 2OPTA 1T08B 1T0FC 3KLNA 4NZRM 4M9XA 1I27A 1RUNA 1AU7A 5CJ9A 5DUIA 2RGVA 2IW5A 1R6RA 3FM5A 2L4AA 2JSCA 1Z91A 4G6QA 2PFBA 4X62I 4MHGA 4I2OA 3H9QA 1DGRM 3D1NI 3RKQA 5DD8A 3MEXA 2CW7A 5DS9A 2MD0A 3NWTA 2XC7A 3Q9VA 4DV3H 3CCLI 2M45A 4FW4A 3FZVA 3W6KB 2EZKA 2IOQA 2MABA 1Z0XA 2FNAA 3L7ZB 3GKUA 4BEHB 3Q5FA 4DV6I 2Q2EB 2CUFA 3R0JA 4IS9A 2MC3A 2ZBKB 4XM3A 1ETKA 2Z1DA 3HPHA 2VF3A 2UU9H 2R7WA 2R5YA 2EK5A 3Q6MA 3F8BA 4XRSG 4FT8A 2JK3A 4HPQA 4IF4A 5CVJA 1MBFA 3GTLJ 3KDKA 2MSYA 1IBKE 3CC2I 4PFPA 4MFEA 3VYSB 2OI2A 2C38B 1SVOA 1ZHFA 2E34A 3DKWA 1O7FA 2ZXWH 3BTLA 4RM2A 3V7SA 3QP5A 2M9HA 3CCEI 3S2DJ 2HKEA 3QPSA 4B3MI 3S93A 2GXAA 1RKTA 1K4SA 3BPVA 4IOCF 1SEUA 3OYLA 2FUG2 1X4MA 4I0AA 4LK0F 1UDNA 1SMTA 1YS7A 2DMUA 4GYIA 4E7SA 4XRMA 5E3OA 3MZ8A 2CS3A 1J4WA 2DT6A 2MLGA 1OYWA 4DPXA 4LF4H 2NOJB 3ZMDA 1WUUA 1FX7A 3DEWA 1GHCA 3OYNA 1LE8A 1R58A 2AXTC 3RYPA 1UHSA 2WBMA 3EETA 3KEYA 1BN5A 2VQCA 1H73A 3I59B 3FBNB 2UXDH 3WU0A 1XNRE 1D6TA 4Q47A 1ODHA 1JHHA 5LMNH 2I5UA 3H5RA 4KIGA 5D4RA 3SB1A 5FLMJ 1HKSA 3KEOA 3RF2A 2ECBA 2LBFA 3CJQB 4XONA 2FOWA 4DR2E 1U6GA 2EIJH 2DA4A 3S17J 3IHUA 5J1YA 1HR0I 3ZR8X 4BQAA 4WK8F 4NXMH 2Z5CA 1G3YA 5F08A 1XN7A 2E1MB 2WA0A 1R49A 3K4NA 3JRBA 4MQVA 2QGUA 5LRSA 2YQRA 2CTLA 3CJNA 2PNLA 2PMZA 1K78A 2JEBI 5DUKA 4DR7H 3J81W 1A31A 3M8JA 2ACJA 3QQAA 3QT8A 5DNXA 3VYRB 4WANA 1N36I 2YUSA 2YS9A 5HDGA 3KIOA 4HX4A 2IXSA 3AG4H 4U87A 2JUCA 1FOYA 3BG5A 1OKRA 3HUGB 5DCMA 4EQQA 4XRSA 1ZG5A 4FW9A 5B66C 4LGWA 2XGEA 2OAZA 5GPCA 2IEKA 4V19K 1Y8RB 4LD5A 4ZH4F 2XF6A 4JK1X 2L7FP 2HYFA 3X2QH 2OA4A 2FBKA 3K69A 1JJ6C 3OTOH 2M34A 4BBSJ 1Z0GA 2O5RA 3QPHA 3F9KA 5D4SA 1TQIA 5KNLA 2DODA 2V1UA 1F0XA 2DYRH 2Y0SN 2XIGA 4Z2YA 5J4VA 4JI8E 4DV1E 5JVTA 1IV8A 4DYCA 2XPWA 3ZPLA 2O1TA 3RPUD 2X9DA 2KQRA 3BY6A 2PMUA 2C6YA 3BT9A 3S3MA 2WP8B 4E7LA 1XMQH 2PBIA 5FLXW 2YX7A 4CUGA 4DR6I 4ESBA 5LL6b 1WHUA 3S14J 1HNXE 2NOGA 5EZHA 2ME0A 3W2WA 2UUBH 3HOWJ 1LUJB 4DV2E 4IZKB 2K9MA 3K2ZA 4JV5I 2X85A 1D1CA 4B3TE 1XD7A 4L9TA 1VIGA 1JI8A 4X62E 1UG2A 2W4SA 3TOAA 2LKSA 1J5EH 2EILH 4BA1B 3RYRA 2DFHA 4ITVA 3JAMW 3EDPA 5JEAA 1FJGH 2BA0G 4DR5I 4N9HA 3IP4B 2XPUA 1U3EM 1Y5YA 3ULQB 2L0KA 1ZXMA 3H3ZA 1N33H 3K1NA 3SDBA 3EYYA 1BIBA 1YTYA 2Y3MA 3JRFA 5HDNA 3QYBA 1V4RA 1Z05A 3LQRA 1ETOA 4UVBA 1R00A 4JI0E 3S15J 1DU6A 2L01A 1WRJA 3FWEA 2XV4S 4PDKA 4QLCU 2JQ7A 1GLNA 4CZZA 4EV0A 2LP0A 2NVXJ 1XS9A 3DQVC 3WU5A 5EDNA 4C30A 4UY8I 1FOXA 3IWFA 2O8KA 2QCOA 3B02A 4M6YA 2E3UA 2LY1A 3BLYA 1KQ9A 3CUOA 3KEQA 2EFWA 4IKFA 1ZZIA 4W97A 1KYZA 1E2XA 2W25A 4JI0I 2XAJA 1WPKA 3DTEA 2GA2A 5HS9A 5HLGA 1MMSA 1IBMI 4QMFB 2L9RA 2WNRA 1UDQA 2GQ0A 2UU9E 2CTKA 3T0YA 1R1TA 1HSJA 1W4MA 3OYBA 3JSOA 4HOBA 4IZZA 2ME6A 3GLLA 3REOA 1X3ZB 2Y69H 3ZMTA 1ZLJA 3VB2A 2LBFB 4X65I 4P52A 4RLQA 3M3YJ 5H20A 5EG0B 3CF2A 4B8XA 3OYGA 4OO1C 3DWLE 3V7RA 2K4BA 2R7OA 1X2NA 4P1WA 1Z5BA 2QBYA 3EYIA 2HS5A 4QNKA 1XSVA 2FMLA 3TW7A 1LNWA 4H8AA 4AYBN 3F72A 5LMNI 1RESA 1FOKA 2X6XA 1AKHA 2EV0A 2M0MA 1Z0BA 1W7PD 2P2RA 5K36B 5E1WA 1BC8C 1G3WA 2UXXA 1DQUA 2M3AA 2JA6J 2BA0D 4J00A 2JZXA 1EH7A 2JVHA 1PVEA 4UV9A 3WTWC 2PI0A 4IEJA 1V54H 1BW6A 4LIVA 4DV1I 1XNRI 4M3FA 2DFEA 2PJRA 1K6YA 3J81K 5M3FJ 4YELA 1YIOA 2ZSIB 3TL4X 4OKGA 1XNRH 3HIFA 4ZC3A 4KHPE 2X36A 4U0YA 4FTHA 3O2PE 1CQTA 2EH3A 3K70C 1X4NA 4O6JA 5HS8A 3G73A 2PEXA 2RC4A 4LF7E 1SD4A 4KA4A 2VOPA 2O6GE 1FP1D 1XXEA 5C4JJ 4IHWA 1E0EA 2O0YA 4HACB 5JEAC 1P7JA 2BL5A 2ZJRF 5FKOA 5A2QQ 1UCRA 2YU3A 4FX0A 1D0XA 4F93B 4HY1A 3VWBA 4B8TA 1HR0E 2VJ4A 2DFFA 2EIMH 4DR3I 3OYKA 2O61A 3TP0A 4MGRA 1IBKI 4YHHH 4WCGA 1MH4A 4B48A 5ILUA 4JVHA 5GAEJ 2CV2A 1WJDA 3CCYA 3HSRA 2A07F 1BOAA 2HYGD 2ZM6I 5DCFA 2WY7Q 3EPZA 5L3FA 1JKOC 4X66I 1T2KA 2HQAA 4JI3E 3KP6A 3VODA 3CDJA 3K4MA 4LB6B 2WAFA 3ABKH 5ICCA 4JBAA 1LEBA 4LFBH 1S6LA 2J5OA 1ETYA 5D5XB 4BE2A 2RAEA 4XORA 3JAMK 3CCMI 2NN6C 3AFHA 4MYUA 2O8XA 1U5TA 5D5WB 3AAFA 2Z3YA 1APLC 3IKVA 3MMYB 1G4DA 2DLLA 3TDUC 4UHTA 3OYMA 1YJNI 1MW7A 1WE8A 2M6QA 3RPUA 4LITA 1IAWA 2QSFX 4BHPA 4Y13A 5IWAH 2FD5A 2QQ8A 5ICFA 1VQLI 3MFKA 2C37B 5GAHJ 4NXNH 2OCEA 2X7IA 4DV2H 4JX5A 1MBJA 4B47A 4K0KH 2M8EA 2ZJ2A 1Z6RA 2P8TA 3VYUB 4U3BA 4MTDA 2X0LA 1ZM2A 1JKRC 4NUBA 4DR5H 5DRQA 2VB6A 3BG9A 2HTJA 1J5YA 2WV1A 1LFBA 4EEFG 3CUQC 3W2AA 2K1HA 3CWVA 3OYHA 2MH9A 2RKHA 3D5LA 1XCBA 2ZO4A 4LFCH 1FMVA 5JLXA 2PN6A 3GEZA 2ESNA 3D5SC 3ZMSA 5IT3A 2F2EA 4WXHA 1UZCA 2VPLA 2MYSA 5IYBJ 1KONA 2V1XA 1JKPC 3TO9A 9ANTA 4MTEA 1QQIA 3CTAA 4GO1A 3S3OA 5IP6A 1N78A 1VF9A 3GW2A 2V9VA 5HNHA 3KPHA 4JI7E 1UHWA 4YFXF 5FFZA 2P6SA 1UG8A 2KZVA 1GT0C 4JX4A 2GAUA 1BKNA 4YRVA 1Y4UA 1BJZA 4DPWA 2LTLA 2OUMA 4MNUA 4BY7J 1RR7A 1YI2I 2E36A 4DV7I 1STZA 2K9LA 1I6XA 3ZMZA 3M07A 2Z5EA 1RR8C 1RRJA 1X2MA 3FXMA 3Q0UA 4GCVA 4BHCA 4KMUX 2IA0A 2YU9J 4DOZA 1A5JA 5ELWA 1UG0A 4HSRA 3BR6A 2L7MP 3KP7A 4HSTA 1OCPA 5ICGA 2DMQA 4LCGA 1R22A 2QENA 3LAPA 5IOYA 4J19A 3QT7A 4NQWA 2DMPA 5F0HA 1QO0D 1FNMA 3LTOA 1BR1A 1LJ9A 2X6OA 5KAIC 4KFCA 2FE3A 4CSWA 2BVMA 4R8HA 2M30A 4EJWA 2TCTA 1MJBA
chains in the Genus database with same CATH topology
3L7ZB 4AIMA 4AIDA 2JE6A 2ANRA 4JVYA 5JEAC 1R6LA 2JEAB 2BL5A 1ZTGA 2JEAI 1VIGA 2BR2B 5JEAF 2NN6G 2JE6B 4B8TA 3M7ND 2PY9A 5K36F 2OPVA 4BA1B 2JE6I 2C39B 5K36G 2C38B 5JEAE 2NN6F 2PO2B 4IFDD 4OO1F 5JEAA 5JEAG 4AM3A 2BA0G 2AXYA 1DTJA 2WNRB 1OYRA 4JVHA 2BA1D 1ZZKA 1VIHA 5C0XD 1WVNA 4LIJA 4BA2A 2WP8A 1X4MA 2ANNA 3GCMA 5K36C 2CTEA 1UDNA 2QNDA 3CDJA 2JEBB 2PNZA 3HKMA 1J5KA 1OYSA 2JVZA 2NN6C 1J4WA 4IFDF 2NN6E 4OO1E 4BA2I 2PO2A 5C0XA 3U1KA 2PNZB 2PO0B 5K36E 2E3UA 5K36A 1WE8A 1ZZIA 2BR2A 3KRNA 1DT4A 2C37B 2NN6A 4BA1A 1K1GA 4QMFB 2WNRA 2FMRA 1UDQA 2HH3A 2JEBA 1ZZJA 2CTKA 2C37A 3GLLA 4IFDE 3AEVB 4IFDG 2PO1B 2CTMA 2Z0SA 1UDOA 5C0XG 2PO0A 4IFDB 3GMEA 4NBQA 4OO1C 3H36A 3M85G 2PO1A 5C0XF 2YQRA 2CTJA 2BA1G 2CTLA 4IFDA 2JEBI 1OYPA 1EC6A 4WANA 3M7NG 5C0XB 4BA2B 2NN6D 2P2RA 4OO1D 5K36B 2BA0D 2DGRA 2JZXA 5K36D 2NN6B 3VKEA 5JEAD 4BA1I 3V69A 5C0XC 1KHMA 1TUAA 1UDSA 3DD6A 2HH2A 2CTFA 1E3HA 2C39A 3M85D 1R6MA 4OO1A 3H1CA 1E3PA 5C0XE 2BA0A 2CPQA 2JA9A 3L7ZC 4IFDC 4OO1B 2OPUA 2PQUA 2MJHA 2WP8B 1X4NA 3L7ZA 4OO1G 5JEAB 4WALA 3B4TA 2C38A 3CDIA 1WHUA 2JEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7Z B;  4AIM A;  4AID A;  2JE6 A;  2ANR A;  4JVY A;  5JEA C;  1R6L A;  2JEA B;  2BL5 A;  1ZTG A;  2JEA I;  1VIG A;  2BR2 B;  5JEA F;  2NN6 G;  2JE6 B;  4B8T A;  3M7N D;  2PY9 A;  5K36 F;  2OPV A;  4BA1 B;  2JE6 I;  2C39 B;  5K36 G;  2C38 B;  5JEA E;  2NN6 F;  2PO2 B;  4IFD D;  4OO1 F;  5JEA A;  5JEA G;  4AM3 A;  2BA0 G;  2AXY A;  1DTJ A;  2WNR B;  1OYR A;  4JVH A;  2BA1 D;  1ZZK A;  1VIH A;  5C0X D;  1WVN A;  4LIJ A;  4BA2 A;  2WP8 A;  1X4M A;  2ANN A;  3GCM A;  5K36 C;  2CTE A;  1UDN A;  2QND A;  3CDJ A;  2JEB B;  2PNZ A;  3HKM A;  1J5K A;  1OYS A;  2JVZ A;  2NN6 C;  1J4W A;  4IFD F;  2NN6 E;  4OO1 E;  4BA2 I;  2PO2 A;  5C0X A;  3U1K A;  2PNZ B;  2PO0 B;  5K36 E;  2E3U A;  5K36 A;  1WE8 A;  1ZZI A;  2BR2 A;  3KRN A;  1DT4 A;  2C37 B;  2NN6 A;  4BA1 A;  1K1G A;  4QMF B;  2WNR A;  2FMR A;  1UDQ A;  2HH3 A;  2JEB A;  1ZZJ A;  2CTK A;  2C37 A;  3GLL A;  4IFD E;  3AEV B;  4IFD G;  2PO1 B;  2CTM A;  2Z0S A;  1UDO A;  5C0X G;  2PO0 A;  4IFD B;  3GME A;  4NBQ A;  4OO1 C;  3H36 A;  3M85 G;  2PO1 A;  5C0X F;  2YQR A;  2CTJ A;  2BA1 G;  2CTL A;  4IFD A;  2JEB I;  1OYP A;  1EC6 A;  4WAN A;  3M7N G;  5C0X B;  4BA2 B;  2NN6 D;  2P2R A;  4OO1 D;  5K36 B;  2BA0 D;  2DGR A;  2JZX A;  5K36 D;  2NN6 B;  3VKE A;  5JEA D;  4BA1 I;  3V69 A;  5C0X C;  1KHM A;  1TUA A;  1UDS A;  3DD6 A;  2HH2 A;  2CTF A;  1E3H A;  2C39 A;  3M85 D;  1R6M A;  4OO1 A;  3H1C A;  1E3P A;  5C0X E;  2BA0 A;  2CPQ A;  2JA9 A;  3L7Z C;  4IFD C;  4OO1 B;  2OPU A;  2PQU A;  2MJH A;  2WP8 B;  1X4N A;  3L7Z A;  4OO1 G;  5JEA B;  4WAL A;  3B4T A;  2C38 A;  3CDI A;  1WHU A;  2JEA A; 
#chains in the Genus database with same CATH topology
 2PX9 A;  2BOL A;  1SC7 A;  3ZXS A;  3JRH A;  2QSG X;  4G6D A;  2DO7 A;  4NC6 A;  1IBK H;  2LNB A;  1GXQ A;  3RSN A;  4OZE A;  4BH9 A;  3JR9 A;  3IL2 A;  4BGD A;  2PY9 A;  5GAD J;  3GUD A;  3N97 A;  1ZLK A;  1FWK A;  4E9J A;  3MD2 A;  2MG4 A;  4HW0 A;  4LG0 B;  2C39 B;  3G6E I;  1ZH5 A;  2NVY J;  2KRC A;  4OO1 F;  3NRV A;  3S2W A;  4E7J A;  1XGN A;  3JRE A;  2VL8 A;  3V42 A;  1YJW I;  3T1B A;  3KZZ A;  1J2X A;  1FMW A;  3DBH B;  2UUA I;  2CRG A;  5DM6 F;  1ZK8 A;  4BBR J;  1RC9 A;  2WP8 A;  2DT7 B;  5ERI A;  1JTY A;  4Y15 A;  2EV5 A;  3WTZ A;  2JA5 J;  3CMY A;  1VQ6 I;  1Z3Y A;  4EVI A;  3GTP J;  3ABT A;  1QPM A;  4FE4 A;  2R7R A;  5IT9 Q;  4F92 B;  2EQR A;  2E2J J;  4KIS A;  1D3Y A;  4A0X A;  1Z7U A;  2OTL I;  4DV5 I;  1J75 A;  4XBF A;  4AQY H;  1JKQ C;  1UJ8 A;  1G8X A;  5B3S H;  5DM7 F;  1HNZ I;  4S0H B;  2GWR A;  2VKH A;  5LMN E;  4DZP A;  2H6C A;  1S16 A;  2K9S A;  2VKD A;  1U5T B;  4V2F A;  3CCR I;  3ZZT A;  5IP9 J;  1ZRD A;  3VOE A;  2E7X A;  2L9S A;  1F43 A;  4P5O A;  3LA3 A;  4LFU A;  2WB1 N;  3S8P A;  5J47 A;  1L3L A;  2LR8 A;  2O03 A;  2R7T A;  1FOW A;  4HNV A;  3P3C A;  4HX8 A;  4EJO A;  4DR7 E;  2Y2Z A;  3PL8 A;  5GTH C;  1ETV A;  1MMA A;  1GV2 A;  3O8H A;  1VQM I;  3CO6 C;  1TLH B;  4IRI A;  4LF6 H;  1ZAR A;  5H2F C;  3SEZ A;  1A36 A;  4O3M A;  2ZB9 A;  3T8T A;  4DV4 I;  1RRE A;  2BA1 G;  1QHG A;  2VC1 A;  2IP2 A;  4XKV A;  3FF5 A;  3TGN A;  6PAX A;  4DPY A;  1EC6 A;  3WG9 A;  1BL0 A;  1O4X A;  3KE2 A;  3IH3 A;  2UUZ A;  5LMU H;  3ZM7 A;  2VBW A;  1U2W A;  4A0Y A;  2RNJ A;  4BHB A;  5LEJ A;  4B3A A;  3E5X A;  4BJ6 C;  1VQ7 I;  4HAC A;  2WY8 Q;  2FX0 A;  3K2A A;  3K4B A;  2IRF G;  2Z16 A;  4LPF A;  2HI3 A;  2GXG A;  3ABU A;  4JX6 A;  2CTF A;  1ZTR A;  2C39 A;  4DJA A;  3W2V A;  5IWA E;  1OCR H;  4KMF A;  2IGO A;  3K9T A;  3KP5 A;  4RM3 A;  2HFS A;  1EV7 A;  5B1B H;  3QU3 A;  1TQM A;  1XMQ E;  4NXN E;  3LSJ A;  2KPM A;  2IS2 A;  3PSF A;  2HQN A;  4ZJZ A;  1Z67 A;  2PQ8 A;  1XMK A;  2ELJ A;  2MC4 A;  4AVP A;  5GME A;  4DV0 I;  4HYE A;  4K0K E;  1ZN2 A;  5A2Q C;  2PQU A;  2DOA A;  4WAL A;  4XQF A;  3B4T A;  2XB5 A;  3HHG A;  3SZG A;  3NZK A;  1FWZ A;  3SHF A;  3JRD A;  2CQQ A;  4X66 E;  3OIP A;  1OYY A;  3JRG A;  3BRO A;  1FTZ A;  3KYC B;  4A93 J;  2G0E A;  3QOD A;  3ROU A;  3FHZ A;  4QNJ A;  2HKX A;  1PP8 F;  5FKL A;  1NG7 A;  1W7P A;  2HPM A;  2GM4 A;  2M8G X;  3I59 A;  1VQO I;  5JEA F;  2NN6 G;  4PJM A;  1IRZ A;  1EJ9 A;  1HDP A;  4GXO A;  4N9I A;  3OYI A;  3FKI J;  1D0Y A;  1N33 E;  4JI1 H;  3VEP A;  1W7P B;  2CMP A;  2F5C A;  1SFX A;  2VLA A;  2CQK A;  4USK A;  3IWZ A;  2BA1 D;  4XKB A;  4JI0 H;  2ZC2 A;  4BE0 A;  4LFA E;  1YLF A;  2M2E A;  1MBE A;  2PNM A;  4YY3 I;  5M5Y J;  4X64 E;  2HR3 A;  4L5I A;  1B6A A;  1NHA A;  2O3F A;  3BR0 A;  3E0J B;  4CYC A;  3P9K A;  4TV7 A;  3A03 A;  2QND A;  3M6A A;  3CCV I;  2XRL A;  1W1W E;  2JVZ A;  5GPA A;  3DXJ F;  4G08 A;  1FP2 A;  2EFO A;  2OZU A;  4G7O F;  3KP3 A;  2O7O A;  2AXL A;  3H0G J;  3L7W A;  4LJZ F;  3V8L A;  5DNL A;  1TNS A;  3I0T A;  3LNU A;  4X64 I;  3DF8 A;  4IXA A;  3E5Q A;  1YX5 A;  3L9F A;  3GFL A;  4DV7 H;  5CLS A;  1DAR A;  5M5X J;  5TGT A;  3CF5 F;  3RKY A;  5HOD A;  4GFB A;  2G7U A;  4UVA A;  4PFO A;  1ZZJ A;  3H92 A;  2E5N A;  2X6Y A;  3H9J A;  2G8Y A;  1YO5 C;  2NS0 A;  3F21 A;  2C37 A;  2A2D A;  4PGH A;  2BW3 B;  4DV4 H;  3S1R J;  3BJ6 A;  3SYT A;  1U5T C;  3OWT A;  2BW3 A;  2L4M A;  3FHN A;  3K70 D;  3K1J A;  5C0X F;  2CTJ A;  4CCJ A;  5K5R A;  1NK3 P;  2STT A;  1SMY F;  1OYP A;  5F64 A;  4UUT A;  1JUM A;  2HXI A;  4YFK F;  4B4C A;  2DOF A;  4E7I A;  4KIB A;  4DV6 E;  4X65 E;  5J1U A;  2XAG A;  3PQJ A;  2F6C A;  2Q1Z B;  2A05 A;  4DUZ H;  4F55 A;  2DGR A;  2VQF H;  3FXL A;  2D1H A;  5ED4 A;  1DDN A;  4PJL A;  1U8R A;  1IBM E;  3D4J A;  1N25 A;  4BUP A;  4BXX J;  4RS8 A;  4N3O A;  2Y9Y A;  3SQN A;  4OO1 A;  3LSK A;  3K7A J;  1QBJ A;  1HXD A;  3CCS I;  3LL7 A;  1WGX A;  3IH4 A;  2GBY A;  1MNE A;  4II2 A;  5LHG A;  3JAM Z;  4I98 B;  5AON A;  1USU A;  2XGC A;  1ZM4 A;  5E8I A;  5L3J A;  4IZJ A;  5CKT A;  5K5Q A;  1DP3 A;  2CJJ A;  4N4O B;  4ZZL A;  3TO6 A;  4PRX A;  3E6D A;  3HKZ N;  4BXF A;  1VQK I;  3LSM A;  3LAJ A;  4FN5 A;  1FZP B;  2KL4 A;  2VAS A;  4BXU A;  5FFX A;  4BYY A;  2HEO A;  4A5M A;  4G9Y A;  2GO3 A;  1MH3 A;  4LF9 H;  3GXO A;  2JEA B;  3HUG A;  1HDD C;  3H3V K;  2KDO A;  3IAM 2;  1AWC A;  4FW5 A;  3EUK L;  2XSJ C;  2KIM A;  4FW7 A;  4JI1 I;  1ZG3 A;  3QOP A;  4RGX A;  4DR3 H;  2BXY A;  1RI7 A;  3BPX A;  1K83 J;  3M7N D;  5K36 F;  4PK4 A;  2R7X A;  3SDG A;  4FWG A;  2HHH E;  4LF8 H;  2EZL A;  5FO5 A;  5LMU E;  5K36 G;  4AC0 A;  3V4G A;  2XHK A;  2RN7 A;  3CJT B;  3PO2 J;  2WNR B;  1R4M B;  4JI3 H;  2P5K A;  2RDP A;  4RA2 A;  4C3J J;  3KLO A;  3IV5 A;  1OIS A;  1CF7 A;  2HWV A;  4HZF A;  1ZRF A;  3OL4 A;  2QWW A;  5EJC A;  2Q0O A;  1AKH B;  2K9N A;  4XN0 A;  3OY9 A;  3FXK A;  3HC7 A;  3ECO A;  2L9N A;  4DR6 E;  4DV0 H;  1PYV A;  1H7U A;  4OX9 I;  4C2M J;  3ERE D;  3M8E A;  2FRH A;  1R1U A;  1U9O A;  2F5F A;  1H88 C;  2X1D A;  3I53 A;  3PO3 J;  1TWF J;  3HOY J;  5C0X A;  3GR5 A;  1MMN A;  1SFO J;  2O4C A;  1WJF A;  2ZFW A;  3HZJ A;  4IQ4 A;  4DUY E;  2UUA E;  2PT7 G;  2PG4 A;  3DKX A;  4JI2 I;  2LFB A;  3ABM H;  1OCO H;  2VJ5 A;  2WAD A;  3HOU J;  4B3R I;  3E97 A;  3L2C A;  3ERM A;  5JHF A;  4BE1 A;  2UXD E;  2HH3 A;  3GFI A;  3T1H I;  1NHI A;  2IGN A;  4IFD E;  1FKA E;  2LYC A;  1H9T A;  1I1G A;  4PCQ A;  1S3J A;  2L5Q A;  4DZJ A;  2Z9O A;  2GIV A;  2XGD A;  3H36 A;  3M85 G;  2Q8K A;  2FBH A;  3L00 A;  4A3E J;  3QRF F;  2PO1 A;  4IZK A;  4BNC A;  2K4J A;  3CQZ J;  3WTT C;  1WJC A;  2NNY A;  4UT4 A;  1YOV B;  1FIP A;  1F1Z A;  1XPX A;  3J7Z I;  1H89 C;  2R92 J;  1Y0U A;  2DEJ A;  1Z3X A;  3KFW X;  3RZO J;  2XAU A;  5J8F A;  3ZQL A;  5LGU A;  1I6H J;  2JUG A;  4Q48 A;  4ASN A;  3LPS A;  1IRF A;  3JW4 A;  2JVG A;  2R5Z A;  1Y39 A;  2HK2 A;  1E17 A;  3GZ5 A;  3Q6N A;  1FC3 A;  3HKZ A;  2COB A;  4C3I J;  4EAT A;  5E17 F;  2J7K A;  3WU6 A;  4DR2 I;  3NQO A;  1PVG A;  4JP0 A;  2JJ7 A;  1KU2 A;  4LK1 F;  4OAY A;  2NNN A;  3F6V A;  4AIH A;  2A3S A;  4KIC A;  4S04 A;  4CGZ A;  2HDC A;  5JR3 A;  1R6M A;  2I10 A;  5BQT A;  3GLX A;  5LBQ A;  1HKQ A;  1N32 I;  1JHF A;  2DA3 A;  1WJB A;  4BL0 B;  2HKO A;  3B78 A;  3ASN H;  1PUF B;  4OX9 H;  2JZY A;  1LFP A;  3PM1 A;  5L3E A;  1CGP A;  4L0Z B;  2UXC I;  1O3R A;  4FJU A;  4RLF A;  3W6V A;  2WAE A;  3OYJ A;  2CGE A;  1VTN C;  1K61 A;  5LHH A;  4PJN A;  2ANR A;  4A0Z A;  1O57 A;  2Y75 A;  5FKM A;  3I4M J;  3H4L A;  5FLX Q;  3OMY A;  3G1O A;  4AUX A;  2DA6 A;  3FKJ A;  2UUB E;  4XRF A;  2LJP A;  1WH7 A;  5B5E C;  2IA2 A;  4UXN A;  4EMS A;  4JYA I;  1R5H A;  1N0V C;  4EM1 A;  4DV6 H;  4B3T H;  3SFZ A;  2NN6 F;  5JEA G;  3T1H H;  1RHY A;  2VBY A;  4YIF A;  5J4Y A;  2XGX A;  1H9G A;  1X19 A;  2P0W A;  3F3X A;  1IN7 A;  2JA8 J;  2OC6 A;  3BC8 A;  2HOS A;  2HKJ A;  3U9G A;  1OPC A;  1ZGW A;  1WI3 A;  4IHX A;  3H0D A;  1G6N A;  3WU2 C;  3TKY A;  3HKM A;  3FIS A;  2ZCW A;  2L9V A;  1LPQ A;  2AHQ A;  1MBK A;  3L2U A;  1IRX A;  1UB9 A;  3GFJ A;  5ILS A;  3OS1 A;  1N77 A;  3ESW B;  2JN6 A;  2K3P A;  3NWS A;  2Z5C B;  2E5Z A;  1XNQ I;  2Z2S B;  2A5W A;  4Z7Y A;  2XF7 A;  2X1E A;  1LQ1 A;  3N4M A;  2EB7 A;  1MNM C;  3A02 A;  4X0G A;  1ZXN A;  5KK1 A;  3J7A Y;  1P2F A;  2K3F A;  3PUF A;  2ZKZ A;  4IQJ A;  4ZDO A;  4A3G J;  3J80 Z;  4G94 A;  1E3O C;  4URL A;  2HNH A;  3HGG A;  2RVC A;  1Y8Q B;  2DQL A;  4DR3 E;  3AEV B;  2WW4 A;  2UUC I;  4NHJ A;  1AN7 A;  4D5F A;  2Z0S A;  2FNP A;  5C0X G;  4LF5 I;  4EC5 A;  1HK7 A;  1J09 A;  1XB4 A;  2FOK A;  2H1L A;  2JSP A;  4ZTF A;  5IT9 K;  3OS0 A;  3GX4 X;  3DU6 A;  4RGS A;  3R6S A;  3GZ6 A;  3LQQ A;  3P9C A;  2AS5 F;  2CPM A;  2W1O A;  3LSH A;  4GKK I;  4LF5 H;  1ZRE A;  4PSW A;  3SFI A;  2NVT J;  2M1B A;  1GUU A;  4B3R H;  3HYI A;  2UXB I;  1QVT A;  4HQM A;  3K17 A;  4Y7N J;  1LB2 A;  4C3H J;  3ZZ0 A;  4WXC A;  4CDG A;  3FK6 A;  4F7Z A;  3A2K A;  3DPU A;  2BE5 F;  2KT0 A;  2VIX A;  4Y17 A;  2EA2 A;  5F0C A;  3ZN1 A;  1K6O A;  2LC2 A;  1N32 E;  4XKC A;  1MBG A;  4I7H A;  4AU7 A;  1BR4 A;  1YW7 A;  3FXQ A;  5A2Q K;  4HDV A;  4ENM A;  1XNQ H;  2OU2 A;  4NC7 A;  5EEG A;  5F04 A;  1WKM A;  3F0C A;  2HK3 A;  3G3Z A;  4QSH A;  1RKW A;  3FIW A;  5KAF C;  1RNL A;  1YQA A;  3L7Z C;  1RZ4 A;  2JRT A;  4DR4 H;  4B44 A;  1S29 A;  1KKH A;  4U7B A;  1LFU P;  2QYO A;  2MJH A;  4KDP A;  3WE2 A;  2MD5 A;  2DW4 A;  4N4N B;  4X66 H;  2FMY A;  3WE3 A;  1EH8 A;  5E3N A;  1NHJ A;  3L7Z A;  3GAB A;  3ZRG A;  1DPR A;  1EKE A;  3K4J A;  3RTR A;  2M4G A;  5KHD A;  3IRQ A;  3GYH X;  3F0N A;  4EJT A;  5JHU A;  1Z1D A;  3IUO A;  2A6T A;  1BM9 A;  5D8L B;  3CMA I;  2A68 F;  3PFY A;  2V6C A;  5E3M A;  1W5S A;  4Z7C A;  2HVS A;  1FYK A;  3OET A;  1GV5 A;  3QOE A;  5EKW A;  1MBH A;  1SFU A;  2ZME B;  2CGP A;  4DYR A;  2NVQ J;  4HXZ A;  2DK5 A;  4RAG A;  2OBP A;  1XSD A;  1TP4 A;  4P55 A;  5JEA E;  4HQE A;  2E2H J;  2AXY A;  3L1P A;  2EV6 A;  4LFA H;  3G71 I;  4WWC A;  4M73 A;  4OMY A;  4E7H A;  1D5V A;  1BOB A;  1R5G A;  1TWG J;  2R7Z J;  1XMQ I;  1FEX A;  1DUX C;  1VIH A;  2K86 A;  4DUY I;  4IHS A;  4A5N A;  4RB1 A;  1Z0V A;  4RMN A;  1YIJ I;  5D6F A;  1OQY A;  2F5V A;  2E1M C;  2QEX I;  3C7J A;  1BC7 C;  2DJN A;  4EJV A;  2KRH A;  1LVK A;  4X62 H;  1ZGA A;  2XAQ A;  2QKL B;  1J59 A;  4ZYD A;  1WZ2 A;  2WAQ A;  3J7A M;  1ERD A;  1LDK B;  1MDM B;  2CQX A;  4CHU A;  4OD6 A;  1K47 A;  2WTE A;  1MU5 A;  1DP7 P;  1IUF A;  2VQF I;  1MJ9 A;  5K36 A;  4W1U A;  1USV A;  5CVI A;  4B09 A;  1YW9 A;  2R5Z B;  3VFZ A;  3TMO A;  1KTV A;  4HLX A;  3MWM A;  5FLV A;  3P3E A;  1MG7 A;  3DEE A;  2H27 A;  3HHH A;  4YY3 H;  4JI4 I;  3C18 A;  4JI8 H;  1H8A C;  2LKX A;  2BY1 A;  3T8R A;  1BI0 A;  4RB3 C;  4YFN F;  1A35 A;  1FNN A;  2KHM A;  1K4T A;  1IDZ A;  2K7L A;  3BCA A;  3TOB A;  3WG7 H;  1B72 A;  2PO1 B;  1IBL I;  2Z99 A;  1OJL A;  1G3T A;  5GMD A;  5GP9 A;  2XRO A;  3TO7 A;  4LFC I;  3JRC A;  5BR8 H;  3FK7 A;  2X48 A;  4JI5 I;  4MLO A;  3TBI A;  5EF6 A;  2IT0 A;  5FD6 A;  3S32 A;  4IFD A;  3J80 W;  3ECH A;  4D7M A;  3FX3 A;  1M1E B;  1FPQ A;  1OMI A;  2OV7 A;  3GTG J;  4KQV A;  1XCV A;  1IF1 A;  2RQP A;  4LB5 A;  4AVZ A;  1EF4 A;  4XLC A;  3WTU C;  4FET A;  4FQG A;  4A6E A;  4XLH A;  3J7A O;  4MYT A;  1S72 I;  2R93 J;  1P6R A;  1PP7 U;  3F23 A;  3RPQ A;  1B9M A;  3OIO A;  3OYE A;  4CH7 A;  1ITY A;  3CJR B;  4C9Y A;  3RQ4 A;  2DPD A;  1TUA A;  3DBL B;  3IC7 A;  2FPH X;  3MVP A;  1TTY A;  3BR1 A;  1QZZ A;  4LIU A;  2OJE D;  1X58 A;  4I09 A;  1MGT A;  2L2O A;  3JSP A;  3MKY B;  3BJA A;  1IUY A;  3E3V A;  4DV5 H;  1B4A A;  5IT9 C;  1GVJ A;  1QZE A;  4A3M J;  2JWT A;  4OIO F;  4KN7 X;  3CDL A;  2VPR A;  3K85 A;  4IFD C;  2BV6 A;  5BPD A;  4CCK A;  5FLX C;  2ZSH B;  5DV5 A;  3OOP A;  2LG4 A;  1N34 H;  5K5O A;  3KX2 A;  3VSK A;  5F27 A;  3SZT A;  5JEA B;  3BOQ A;  2ESH A;  1NG6 A;  1DGW Y;  5A2Q W;  1T98 A;  2QA4 I;  4OIP F;  3E6B A;  1H72 C;  2HDW A;  2UXB E;  1S20 A;  4JOM A;  1FJG I;  4YEJ A;  1R6L A;  1IGN A;  2HHH H;  3CDH A;  2BR2 B;  2EFG A;  2VES A;  4JI6 I;  4M9S A;  4I01 A;  5TRD A;  3F8N A;  1OR7 C;  2CQ7 A;  5E3L A;  1P92 A;  3QWL A;  4AM3 A;  1IBL H;  1HQC A;  1DTJ A;  4E70 A;  2DTR A;  2K85 A;  2V1N A;  1I3Q J;  3CO7 C;  3PJR A;  2OQG A;  5F6F A;  5HLT A;  2IAI A;  2KJC A;  2STW A;  1OYR A;  4L5J A;  4FWD A;  5K1Y A;  1B59 A;  3FDY A;  5FRN A;  2H8R A;  1B63 A;  1V5F A;  1VQ9 I;  4IOA F;  1XNQ E;  4H4K C;  1Q1H A;  4D5C A;  4BJT A;  2DU9 A;  3BZC A;  4BA2 A;  2F48 A;  4IHV A;  3I4P A;  2ZXJ A;  2EIK H;  5LGT A;  2AE8 A;  1LDD A;  5CYV A;  5K36 C;  1FY7 A;  2A2C A;  1ZG1 A;  3S1Q J;  1Z2I A;  1Y1V J;  4HLY A;  1P9Q C;  4FHT A;  2X6W A;  4BAY A;  3TED A;  3V5R A;  1D1A A;  2XKP A;  4I3H A;  3Q0W A;  4I76 A;  2ZQE A;  4JG4 A;  3HJE A;  4FWH A;  3A1Y A;  2DA7 A;  1SAX A;  2CV1 A;  5CVR A;  3V7C A;  2NN6 A;  4AQY E;  4P96 A;  2GXB A;  5FRO A;  2NRA C;  4GKK E;  3N05 A;  4KIT B;  4WUD A;  1IW7 F;  1SD6 A;  3ZZU A;  1KU9 A;  2RV8 A;  4KT5 C;  4A12 A;  3JTG A;  1FSE A;  1XDS A;  4JYA E;  4ZDL A;  2HFH A;  2KRF A;  4LF8 I;  4LF7 H;  4L9V A;  1H7S A;  1VQP I;  3DEU A;  3DLA A;  3SZP A;  3ZQF A;  4M6V A;  1I5Z A;  4DGW B;  4CYC B;  3GME A;  1TBX A;  1OCT C;  2COM A;  1HBX G;  3C1D A;  3KZY A;  3QYF A;  3QPL A;  2VOD A;  4LLL A;  2QQA A;  1VQ4 I;  1HR0 H;  1XSX A;  5H6R A;  4EGY A;  2DCE A;  3WOD F;  1OJ4 A;  3J80 C;  4M1K A;  1EI1 A;  4XLP F;  5D5V B;  2UXC E;  2GOX B;  4X1E A;  1VQ8 I;  2H1K A;  2NN6 D;  3ZQ7 A;  1O3Q A;  2DTZ A;  2R7U A;  1IXR C;  2KKO A;  3SEQ A;  2A5Y B;  1J9I A;  1V8C A;  4HG2 A;  4CCM A;  2B9S A;  1BR2 A;  1WJE A;  4UB8 C;  3WGH A;  5J6X A;  4IZJ D;  2YR2 A;  1E3H A;  5H6Q A;  4HDU A;  1T33 A;  1XRH A;  2Y30 A;  3GON A;  1TZL A;  4EMD A;  4ON0 A;  4XK4 A;  5K7F A;  4DR1 I;  1E3P A;  3HM5 A;  4HEA 2;  4LF4 I;  4G12 A;  3I55 I;  4HRI A;  5EL9 A;  1USS A;  3WTY C;  1JE8 A;  5J1R A;  2TRT A;  2VQH A;  4KYW A;  5DYM A;  3I58 A;  1ON1 A;  1Z5C A;  4M9Z A;  1G2H A;  2EZH A;  2RNG A;  3PS3 A;  3BWG A;  1XMO E;  1R23 A;  2ID3 A;  2VI6 A;  3GF2 A;  3PRY A;  1S7E A;  2D2W A;  2C38 A;  4IHT A;  4JQF A;  1R36 A;  2IJL A;  2J5P A;  2LTP A;  3OL3 A;  4HA8 A;  4CCO A;  1RR9 A;  4JI6 E;  1HA8 A;  3JCU C;  1ZEL A;  4L9N A;  1XC5 A;  2M5W A;  3HG9 A;  1QRY A;  4Y3O A;  1I39 A;  4BU2 A;  1VQ5 I;  3GZN B;  4NDL A;  2QBY B;  1KU3 A;  2FQ3 A;  1GDT A;  1PDN C;  1OCZ H;  4XTJ A;  2MLK A;  1S7O A;  4GRI A;  4G7Z F;  2H09 A;  3DP7 A;  2DDB A;  5A2Q Z;  5IYD J;  5DRR A;  1IG7 A;  4IFD D;  2MH2 A;  3PNV A;  1D8K A;  3TQN A;  2BVL A;  2UUC H;  3E5U A;  2VJJ A;  4PSX A;  3PIO F;  2PJP A;  3PS1 A;  1HW5 A;  2DN0 A;  2BYV E;  3S2H J;  5EGO A;  2V34 A;  3I54 A;  4XLE A;  4EM2 A;  1HLV A;  5DRO A;  1ZAO A;  1GVD A;  3LA2 A;  4E6K G;  3ZOB A;  4B3S E;  3B6C A;  3DBR B;  2JEB B;  2PNZ A;  1KVK A;  1ULY A;  2YSR A;  3OTO I;  1IN5 A;  2JT2 A;  1RIO H;  4KNY A;  3U21 A;  4M3E A;  4IFD F;  4M3B A;  2QQ9 A;  3HOT A;  4XN3 A;  4DPT A;  1SEI A;  4S05 A;  2W82 A;  1BI2 A;  4UV8 A;  1W5T A;  2M7B A;  4BS9 A;  4U3D A;  4MQY A;  2GO4 A;  1LVA A;  3QAH A;  2LLK A;  2E2I J;  3PFI A;  1HNW E;  1KYW A;  2UXB H;  1SFK A;  2X06 A;  5AIP A;  4DV7 E;  1AOY A;  3K4L A;  2LDU A;  3PNT A;  4ESJ A;  1VND A;  1X1A A;  3PYG A;  1B9N A;  5ILV A;  3U1Y A;  2O1V A;  3G2B A;  4XID A;  5DT9 A;  2V9P A;  3ASO H;  3JTH A;  2GZW A;  5E1X A;  3HRU A;  2XAH A;  4J01 A;  2VKV A;  2A61 A;  2DA2 A;  4BKX A;  1PJR A;  1JJ8 C;  2UWM A;  5BPI A;  4PJ0 C;  1IC8 A;  5HS7 A;  4I6Z A;  1HST A;  3LSR A;  4JI4 H;  4HNT A;  4M6X A;  4FE7 A;  5K36 D;  2ETH A;  3WHB A;  4LF4 E;  5IOZ A;  1I6U A;  2ZIT A;  1KA8 A;  1MKM A;  1T56 A;  2E60 A;  1Z7L A;  4DUZ E;  4FAS D;  1HNZ H;  3OOU A;  4LOC A;  1IRG A;  1F36 A;  3SJM A;  4F52 A;  2HYJ A;  3V8K A;  3Q1Q A;  2R42 A;  1G59 A;  5IYC J;  1R7J A;  3P3G A;  1ETX A;  5JI6 A;  2KZG A;  2DMN A;  1S7A A;  2V4J C;  3DPL C;  2JA7 J;  5C4X J;  1ON2 A;  4MU4 A;  2TDX A;  3K10 A;  4D1Q A;  3HSE A;  4MQ9 F;  3WGI A;  2DFI A;  4DR2 H;  4HF2 A;  2FBI A;  5LMU I;  1Y6Z A;  1Y1W J;  2BXZ A;  2VT3 A;  3NEU A;  1FYM A;  4AIM A;  2F5E A;  2E5L I;  2JE6 A;  2H8W A;  1U8B A;  2ZM6 E;  2FFM A;  4ENK A;  3A4C A;  3I0P A;  2RRE A;  4E7K A;  1FT9 A;  1QNT A;  2BZT A;  5F0F A;  1R9T J;  2CW8 A;  2JEA I;  2BHZ A;  3RKX A;  3M1C A;  2CWH A;  5FLX Z;  2OPV A;  2R4G A;  3OYC A;  2UXN A;  3KYL A;  1R4N B;  2HGC A;  4HF1 A;  2KIU A;  2P7V B;  3Q9S A;  5AIQ A;  4CXF A;  3O8G A;  3MZY A;  2PO2 B;  5CVU A;  1Z0T A;  4JV5 H;  3OR1 C;  4ENJ A;  4B1R A;  2UUB I;  2Y0M A;  4ISA A;  4DV3 I;  4LF8 E;  4ZVI A;  2W48 A;  3L2V A;  1Z6T A;  2ZXH A;  2HDD A;  2W7N A;  1N34 I;  1D1B A;  1BIA A;  1UMQ A;  1R1V A;  3OR2 C;  4HBL A;  3LOC A;  1B72 B;  4QWQ A;  1Z0E A;  1XGM A;  1REP C;  5BOX A;  2CG9 A;  2CWE A;  3PYE A;  4A3C J;  5C0X D;  4AQY I;  3AG3 H;  4QPO A;  2XAS A;  2OZ6 A;  4ABZ A;  4DR4 I;  3QD7 X;  1A6I A;  3UNG C;  4H0E A;  2LMD A;  3UKG A;  1W0T A;  2QVO A;  4BQN A;  4DV1 H;  2PO2 A;  2M8W A;  4IZJ B;  3U1K A;  4WF2 A;  1Z9C A;  1B8I B;  3I64 A;  4OAZ A;  1FBS A;  4Y4R A;  1P4A A;  3AL0 B;  4YY3 E;  4RGR A;  1BBY A;  1MDM A;  1OFC X;  3KP4 A;  5E79 C;  4ZYG A;  4K2E A;  3WTS C;  1KIJ A;  1N36 E;  3HB9 A;  1UST A;  3H5N A;  1HNX H;  5E1Z B;  3MQ0 A;  1NH3 A;  4Y52 J;  4BA1 A;  3T1Y E;  2NXN B;  4CCL A;  4DUY H;  2L7Z A;  2CUZ A;  1VI0 A;  2UUA H;  4CA0 A;  2QSH X;  1FTT A;  4XR6 A;  4EJU A;  3FMS A;  3CD6 I;  1J0R A;  4XOT A;  4MO7 A;  5BR8 E;  3FMQ A;  1XTA A;  1AHD P;  3O3K A;  2L3D A;  2V8P A;  1IZ1 A;  1R71 A;  3LST A;  1T39 A;  2EPF A;  3P9I A;  4XOP A;  2DYS H;  2M7A A;  2CW0 F;  4RAF A;  4ZYH A;  4M72 A;  1NTC A;  2KMU A;  3MAJ A;  3CLO A;  3S1M J;  4A3J J;  2B0L A;  2VOO A;  2R5Y B;  2CFO A;  5KCM A;  1S9H A;  4N0B A;  3HXL A;  5HDK A;  1LKX A;  2UV1 A;  2XUB A;  2Z33 A;  5EEH A;  5FJ8 J;  1IJW C;  1T8I A;  1YHQ I;  4MFD A;  5ICE A;  2E5L E;  1A6F A;  2EFP A;  2OD5 A;  1QA6 A;  2DDA A;  2P81 A;  4B3S H;  4MU0 A;  4KHP I;  4IHY A;  1WSU A;  4XLA A;  1WCM J;  2LY2 A;  5JEA D;  2FA5 A;  1OYI A;  2VE9 A;  4HNU A;  4F91 B;  2AJ4 A;  4AWX B;  4X64 H;  2VBX A;  1S4E A;  2LF0 A;  1P4W A;  4JI2 E;  1ONV A;  2BY0 A;  4RB0 A;  3QT6 A;  1S5L C;  1Y0N A;  5LGN A;  1MD0 A;  2DMT A;  2IS6 A;  3H1C A;  1MSE C;  2Z5B B;  3FXU A;  1HNW H;  3QPT A;  3U2R A;  5E20 A;  2D5V A;  2ISY A;  4WUC A;  4IL6 C;  4FCY A;  1QPI A;  2DA5 A;  4OU0 A;  3MCZ A;  2EA4 A;  2Z5B A;  2F4V I;  2LVS A;  3GTQ J;  1K78 B;  3TDZ C;  2IBD A;  2XDV A;  4XLF A;  5DEQ A;  4AYB A;  4OX9 E;  1BI3 A;  4LCF A;  1ZZK A;  5HLH A;  3FMR A;  3HEF A;  1D8J A;  2KIQ A;  2PJR B;  4BDZ A;  5LL6 R;  4A2U A;  2IS1 A;  1FBQ A;  1IDY A;  4OOI A;  1PUE E;  2DPU A;  1POG A;  1ORK A;  3W3C A;  3JAM Q;  4OMZ A;  4DR7 I;  2LRR A;  1X3W B;  1HCR A;  1HOM A;  2BEO A;  2QZ8 A;  4DV4 E;  2VQE I;  2W57 A;  5TJJ A;  2E35 A;  1GXP A;  4P9F A;  2CWF A;  2JE6 I;  1N75 A;  4JI5 E;  3GTM J;  1YW8 A;  4LMY A;  3R61 A;  1P4X A;  3H9G A;  2HPI A;  5K7H A;  2VQE E;  4JI4 E;  2LTM A;  2PLY A;  4IFD B;  1LE8 B;  1XDU A;  1TQP A;  4L9J A;  3I56 I;  3OS2 A;  1Y6I A;  5IWA I;  3EQL F;  1HNZ E;  2F4I A;  3HJC A;  4G7H F;  4LIJ A;  3VSL A;  5EG0 A;  1YH8 A;  3S3N A;  1HNW I;  1X1D A;  2CTE A;  1YHC A;  1ZR4 A;  3FAU A;  4O5V A;  2VQF E;  3BG7 A;  2NYX A;  3BG3 A;  4KT6 A;  3FXO A;  4BA2 I;  1WQ2 A;  1YS6 A;  2MGQ A;  5LLQ A;  3M4O J;  1QHH D;  3S16 J;  2PO0 B;  3I3L A;  1ZM3 A;  1MMD A;  4XSX F;  2R3S A;  4M71 A;  4IPA A;  2XPV A;  1FWL A;  3R4K A;  3HRT A;  3MKW B;  2L7K A;  3FXR A;  3V8J A;  3EZJ A;  3OYD A;  2H6B A;  2LF7 A;  1K79 A;  3L2W A;  1VQN I;  2GQQ A;  2CV0 A;  5JLW A;  1MZB A;  4A3L J;  2IGK A;  1QU3 A;  1HF0 A;  4MU1 A;  1U78 A;  4NXM E;  2DA1 A;  4DYQ A;  3ZQG A;  1YFH A;  1JT6 A;  3WU1 B;  1B1B A;  1T38 A;  4CYD A;  4OWR B;  3J81 Q;  4B3X A;  2DBB A;  3DU5 A;  2PO0 A;  1TT5 B;  1O7L A;  2P5L C;  4YHH E;  3K4C A;  4RB2 C;  3HTS B;  1MX0 A;  2VC0 A;  4WXD A;  3ZQC A;  4XKW A;  2ID6 A;  2M4K A;  4GDF A;  1W5C C;  2BV3 A;  4BY1 J;  3CCQ I;  3M9A A;  1XGO A;  2DOE A;  2V9K A;  5B1A H;  5F1R A;  5E18 F;  1RUO A;  5FWK A;  2IGM A;  2L02 A;  4ZDP A;  4LF5 E;  1T95 A;  3NAR A;  3SXY A;  4OO1 D;  2HVQ A;  4HV6 A;  2ECC A;  2ZJP F;  3HOX J;  1RPW A;  3OYF A;  2VT2 A;  5EYR A;  1W36 C;  2KP6 A;  2NN6 B;  5GAG J;  3E1S A;  3TW6 A;  4DPU A;  1ODD A;  4QPQ A;  3OTO E;  1Y56 A;  3DD6 A;  3ZMV A;  3DPT A;  3WHC A;  1VIS A;  4RPF A;  4OIQ F;  3T1Y I;  2HH2 A;  4PJJ A;  2VKC A;  1SVL A;  2UZK A;  1JUP A;  2G9W A;  2HOA A;  3BQY A;  4D0P A;  5F1J A;  1TWC J;  2JRM A;  3W6J B;  4V2G A;  4UUV A;  2JA9 A;  3LNQ A;  3T1Y H;  2JPB A;  1T6S A;  2P4W A;  4M3G A;  3DTK A;  2Y48 A;  2OPU A;  3MZH A;  1YRN A;  4XNF A;  3BR2 A;  2L54 A;  4DR4 E;  4XIC A;  1ZRC A;  4B3M H;  4HV5 A;  4A3B J;  3ZKB A;  1F5T A;  1WHR A;  4QIW N;  4ESF A;  3QU6 A;  1HW1 A;  5HLI A;  1S03 G;  1J5E E;  2VBZ A;  4C2T A;  1UFM A;  3I4N J;  4A3F J;  4UUS A;  2EZI A;  3CC4 I;  2CYY A;  4XLN F;  2UUC E;  3K1P A;  3Q0V A;  1JXS A;  4GQU A;  4A3K J;  1FIA A;  2CG4 A;  1N0U A;  1I94 I;  4I02 A;  1A04 A;  1UAA A;  3ZQI A;  2MBF A;  1F9N A;  2B63 J;  1IN6 A;  5E8G A;  1WVN A;  3J7A G;  2ANN A;  4JI2 H;  2LRD A;  4IJA A;  2QLZ A;  3GCM A;  4ETS A;  2F4V H;  3LSG A;  2XAF A;  1B8I A;  4C2U A;  5M3M J;  3DV8 A;  2F1D A;  4BAC A;  2HQR A;  3RQI A;  4DW6 A;  3L2R A;  2LF8 A;  1EA6 A;  1PQX A;  1LEA A;  1P7I A;  2NN6 E;  4OCH A;  3G1L A;  4QTR A;  1SFE A;  3I71 A;  4KUM A;  3EUA A;  4NQW B;  3MKL A;  5LRR A;  3WGG A;  4D9J A;  4YG2 F;  2EJR A;  2QKM B;  4Y33 A;  1HKT A;  3OSS D;  2DJI A;  3J81 Z;  5DCM B;  2ELK A;  1W0U A;  2BR2 A;  3FBI B;  4RAY A;  3KRN A;  4DXL A;  1L0O C;  2QQB A;  3GVA A;  1IXS B;  4I99 C;  4JI3 I;  4YII A;  3PUB A;  4R1F A;  4DU7 A;  2FMR A;  1EH6 A;  2JEB A;  2NAZ A;  2E1C A;  3WTX C;  2XSD C;  4BQQ A;  2OQR A;  1BJA A;  3F22 A;  4IFD G;  5LHI A;  3EUH C;  2V79 A;  1KU7 A;  2E1N A;  2HZT A;  4EGZ A;  1CF7 B;  2EWN A;  3BDD A;  1DPU A;  3ML6 A;  3CES A;  5EGO B;  2ADU A;  4JI5 H;  3BZK A;  3M8F A;  3VPR A;  4HF0 A;  1AA7 A;  1T0F A;  2NS7 A;  2VUM J;  4XMY A;  4G8X A;  4NBQ A;  1J5E I;  1RET A;  4OIN F;  2O3Z A;  2D9I A;  2VQE H;  3K4K A;  4B43 A;  2XRN A;  2LD5 A;  2Y9Z A;  3G1M A;  3CUQ A;  1Z21 A;  3I9V 2;  4KJZ A;  2X1C A;  4CCN A;  2OCC H;  4MEX F;  5L3G A;  4D7N A;  4HYM A;  3K0L A;  5C0X B;  2Y31 A;  2N8G A;  5DDG A;  5LEK A;  2ICW G;  3C2H A;  5HNF A;  2D1V A;  2O1U A;  1MSZ A;  1I1S A;  5D5U B;  3NAU A;  3A0H C;  2BY2 A;  3T5X A;  3RZD J;  2YPR A;  3H3U A;  4JYK A;  5LD2 C;  1WFX A;  4BA1 I;  3HTU A;  4J3D A;  4AIK A;  2X51 A;  5C0X C;  1ZQ3 P;  4A69 C;  1IV6 A;  2G7H A;  2Q2E A;  2WWY A;  1JUS A;  5C44 J;  1DU0 A;  4DR1 H;  4A3D J;  3O6B B;  2K9Q A;  2AO9 A;  3M1E A;  1WTJ A;  3ZQH A;  2CPQ A;  1OCC H;  1LDJ A;  4OO1 B;  5IT9 W;  4DV5 E;  2V2V A;  4U88 A;  4E7Z A;  1FYL A;  3PSI A;  1N33 I;  2JPC A;  4OO1 G;  3COA C;  2ZM6 H;  2FXA A;  2OTJ I;  2R3V A;  1BI1 A;  2V2Q A;  1J7K A;  4B3S I;  2ISZ A;  2JEA A;  1IXC A;  2E1R A;  2JT1 A;  4UUS B;  1Z0C A;  4LF6 E;  1WVR A;  2E1O A;  3ZGK A;  5BMZ A;  2F4O B;  1YYV A;  1BW5 A;  1ZTG A;  1QVU A;  4LLG F;  3R0A A;  2O1W A;  4UVC A;  2ZBK A;  4YIR X;  4IVN A;  4E4H A;  1ZYR F;  4RGU A;  2UU9 I;  4ENN A;  3A0B C;  1ZGJ A;  3ZP5 A;  1KZH A;  3QT5 A;  4K0K I;  3MKZ A;  5CQG A;  4B8C D;  2VE8 A;  2V1D A;  4B3R E;  4LFB E;  2BGC A;  2FF4 A;  2HFU A;  3RI4 A;  2ELH A;  1HC8 A;  4MU3 A;  4GYG A;  1TW2 A;  5IY5 H;  5LFA A;  1VBI A;  4FJS A;  1N32 H;  3PIP F;  3JRI A;  1MSF C;  1P42 A;  1PIE A;  2CUJ A;  3Q3S A;  1X4P A;  2WC2 A;  1UEK A;  1Z59 A;  4XL9 A;  5JFR A;  2DI3 A;  3K6G A;  2PNZ B;  3V2U C;  5HOO A;  5K36 E;  2LH9 A;  2VJI A;  2WAQ N;  2ZME A;  3F6O A;  2HTS A;  3LFK A;  1ZM9 A;  3VYT B;  1OLT A;  1OR7 A;  3KZI C;  5HVQ C;  2KDZ A;  5DRP A;  1XMA A;  4DR5 E;  3WU4 A;  3BR5 A;  3KYD B;  4R1H A;  1FJL A;  3C2G A;  3OYA A;  2R7V A;  1QZR A;  4ZYA A;  2P7C B;  1I94 H;  1SVM A;  2W84 A;  1MMG A;  4GKK H;  4LFC E;  4IRG A;  2CTM A;  2BBY A;  3CLQ A;  3E7L A;  4F3Q A;  5J40 A;  1UDO A;  3HOV J;  4JI7 I;  3AG2 H;  3ZQQ A;  2J65 A;  1S8N A;  4JI1 E;  3PQK A;  4JYA H;  4RBO A;  1XX5 A;  3CCJ I;  2CH0 A;  5EZG A;  3CZ6 A;  2GA1 A;  3TP3 A;  1VFC A;  1Y60 A;  1ELO A;  4JI7 H;  2E5L H;  2FQ4 A;  5CPR B;  4WUB A;  2ZME C;  2O9L A;  4HX7 A;  5IPA A;  3M7N G;  3LSP A;  3HUL A;  3AL0 C;  2QUF A;  3D5R C;  3LMM A;  2F4V E;  4Q4Z F;  1X3U A;  2HOE A;  2HZD A;  2W24 A;  2BM0 A;  4JI8 I;  5FRM A;  2ZNY A;  4DQ2 A;  2UXC H;  1XMX A;  3PNY A;  3J7Y J;  1I50 J;  5CQE A;  1D0Z A;  4FIS A;  1EA3 A;  1V55 H;  2ZXI A;  5BNG A;  4IRH A;  1SAN A;  1ENH A;  1V9N A;  2HQ5 A;  2A69 F;  4FW3 A;  3L09 A;  4L18 B;  4GKJ E;  5C0X E;  3BTC A;  3K1M A;  2A6E F;  3RIR A;  4L0Y B;  2BA0 A;  3NCV A;  4FW6 A;  3AKZ A;  1QGP A;  3BTI A;  3HPG A;  2BM1 A;  2A6H F;  2NS8 A;  5K7Z A;  3J80 K;  2DT5 A;  3H35 A;  1SD5 A;  1ZKG A;  4GGG A;  4DNC A;  2ZNZ A;  3KCC A;  5GTI C;  2CUE A;  2IER A;  1U9N A;  2ZFU A;  1YE9 A;  3CDI A;  1UEL B;  2E19 A;  3LWF A;  1XMO H;  4B3T I;  1U0J A;  4AID A;  4DIQ A;  3ZMU A;  2OF7 A;  1U2R A;  1NZ0 A;  4LOM A;  4JVY A;  4LFA I;  5L3B A;  3DFG A;  4NC8 A;  2BY3 A;  5IT9 Z;  2JTV A;  2HU9 A;  2EIN H;  2CZ9 A;  5C3E J;  3HRS A;  2QM3 A;  4P7A A;  3JAM C;  5BS6 A;  2KJB A;  4M3D A;  3LA7 A;  2V26 A;  5BR8 I;  2MFZ A;  5L3C A;  1X0A A;  4X65 H;  1Z5A A;  2W85 A;  4BDY A;  3A01 B;  4LF9 I;  3P06 A;  1FSH A;  1YIT I;  5M5W J;  2LRE A;  4R79 A;  3C3W A;  2V7F A;  3ISP A;  3JRA A;  2MW8 A;  2WB1 A;  3F8F A;  1FJG E;  2NPF A;  3BJO A;  3B6A A;  1IBM H;  2K02 A;  3G4S I;  5J3L A;  4NZT M;  2AQF A;  2LY9 A;  5EEA A;  2X4H A;  5TIS C;  2EFQ A;  3ZN0 A;  4MDT A;  2D45 A;  1KQ0 A;  3E6M A;  3WTV C;  4L5E A;  4USM A;  2IVM A;  4G6T B;  1YJ9 I;  4U0V A;  2GIZ A;  2DQR A;  5JVG F;  3MN2 A;  3GTJ J;  4ZTJ A;  1TT0 A;  2Z5U A;  2KFD A;  1X4O A;  4GKJ I;  3ZKD A;  3C2B A;  1QZY A;  3UHM A;  1ETW A;  1NHH A;  5FD5 A;  4X6A J;  2V2Z A;  1Q1V A;  4PZJ A;  1O3S A;  4Q5S F;  4LF9 E;  2R0Q C;  4KIF A;  1R5I D;  3HL2 A;  3GTK J;  1N34 E;  2DAO A;  3H5A A;  3FXJ A;  1FLI A;  1MND A;  4P9U A;  4OIR F;  2DXI A;  3PS2 A;  1TL8 A;  4DV3 E;  3L2Q A;  2MA3 A;  2JMW A;  2XF5 A;  2GS8 A;  1I3A A;  4LCH A;  4CIC A;  1XHK A;  4RAZ A;  1WWX A;  1PUF A;  3P76 A;  3BTJ A;  3R60 A;  4PDB A;  3HSF A;  2IPQ X;  3F8C A;  3J81 C;  3F8M A;  3GFM A;  5DD4 A;  4RDU A;  2IS4 A;  3BQZ A;  3UR3 C;  5L3D A;  2FSW A;  1K7A A;  2W00 A;  4MEY F;  4CZC A;  5J8C A;  3RCO A;  1UHM A;  3BCB A;  3M7G A;  1WI9 A;  2PMH A;  3OIQ A;  1TC3 C;  4BA2 B;  2VKE A;  2XEX A;  2JA2 A;  5KVR A;  4DV0 E;  4DR6 H;  1F4K A;  4LLN A;  2Y0S A;  1MJA A;  1SD7 A;  1IBL E;  2CU7 A;  2IA1 A;  2CO5 A;  2M87 A;  1YRN B;  4NXN I;  3I5U A;  2HVR A;  1TW3 A;  2V6E A;  3VKE A;  3HOZ J;  3V69 A;  1G3S A;  3B8H A;  3IH2 A;  3PYF A;  2CFX A;  1WJA A;  4LG3 A;  3M85 D;  4ZZD A;  1X1P A;  4DU8 A;  1D5Y A;  1IN8 A;  2K5C A;  3DLL F;  4MIM A;  1WH5 A;  3U1D A;  3KP2 A;  4IX7 A;  4B3M E;  2VN2 A;  4DUZ I;  2A1S A;  2CVE A;  4LG0 A;  3CP8 A;  3CUQ B;  1TWH J;  2IES A;  1H74 A;  3S1N J;  1I94 E;  3OSF A;  1JGS A;  4NB5 A;  2DK8 A;  1FKA H;  1VI7 A;  1X1B A;  4KHP H;  4IO9 F;  2F5D A;  3OV8 A;  4HAM A;  3A01 A;  4AIJ A;  4Z6Y A;  2PMZ N;  3P5J A;  1VZ0 A;  4M74 A;  5FB2 A;  3HDD A;  2LSO A;  5FKN A;  2LKP A;  1PKP A;  5D6E A;  2H94 A;  1FBU A;  3CP2 A;  2EFN A;  2P6T A;  3ELK A;  3B73 A;  3BZ6 A;  1KGS A;  3LFU A;  4CO8 A;  2JE6 B;  3GO5 A;  3D0S A;  4LF7 I;  4EM0 B;  3QP6 A;  5FKK A;  2DEI A;  1JTX A;  4DBQ A;  3PYD A;  1XG1 A;  2XKO A;  2AQE A;  1Y4S A;  2E7W A;  2XVC A;  3CME I;  1ETQ A;  3E6C C;  4PRV A;  2R7F A;  2KIF A;  3IKT A;  4I0B A;  2VON A;  2HOT A;  2VXZ A;  4DV2 I;  4JV5 E;  3HBL A;  1A6Q A;  2HXO A;  2UXD I;  4ZYE A;  2GOM A;  1HNX I;  2ZJQ F;  3EUH A;  1H0M A;  1V5E A;  4A3I J;  1W36 D;  2CSO A;  4II3 A;  3CC7 I;  1J5K A;  5DTD A;  4BQO A;  1V5G A;  1Z77 A;  1OYS A;  1FI4 A;  3WU3 A;  4FX4 A;  4GKJ H;  3DCF A;  3GTO J;  1TWA J;  4NNJ A;  4DBR A;  4OO1 E;  3GBG A;  1KQ8 A;  3KDG A;  5D8K B;  2BHY A;  4LFB I;  3AG1 H;  2M0C A;  3BG6 A;  1IO2 A;  1X1C A;  1V3F A;  2CQN A;  2LK2 A;  2XB0 X;  3ABL H;  4U0W A;  3KET A;  1DT4 A;  1JGG A;  3P7N A;  2RQQ A;  4ANJ A;  1YG2 A;  2I8D A;  2WV0 A;  3LSI A;  2GLO A;  1K1G A;  3DTI A;  1N36 H;  2FJ1 A;  4WX9 A;  4U7D A;  3CMM A;  2NVU B;  3FM3 A;  1O3T A;  1NK2 P;  4PU9 A;  4YHH I;  1JT0 A;  2VXD A;  3IRR A;  5FGM A;  4ED4 A;  2F4M B;  1Z0W A;  1WJ5 A;  1ZR2 A;  2QF7 A;  3RJP A;  4JI6 H;  3RDI A;  3GWZ A;  3ONQ A;  2R7S A;  3B82 A;  4NXM I;  3VDX A;  5CVV A;  4BEH A;  3T1H E;  1MIJ A;  4A6D A;  2HHH I;  2YX4 A;  3ZCO A;  4LF6 I;  3HOS A;  1X9Z A;  2EBI A;  3HRM A;  3IAS 2;  4PGG A;  2K40 A;  3RKW A;  2VQG A;  1YX3 A;  2KIS A;  2VQL A;  1XGS A;  2E71 A;  2IOP A;  1IN4 A;  3J80 Q;  1XMO I;  1SAU A;  2FU4 A;  3UOE A;  3BR3 A;  2B7E A;  2FEZ A;  2R7D A;  2R7Q A;  4UNO A;  4UTG A;  5IP7 J;  1B62 A;  3BP8 A;  2LOO A;  4UB6 C;  1C0W A;  2KLO A;  4PUS A;  4AD9 A;  3QYE A;  4BJ5 C;  2P5V A;  3J7A K;  1HW2 A;  5FLX K;  1BA5 A;  1ACI A;  4DR1 E;  1NXU A;  2K27 A;  1KHM A;  1UDS A;  4XSZ F;  3CCU I;  3DKY A;  1TNT A;  3HGY A;  3OSG A;  4KN4 X;  2OPT A;  1T08 B;  1T0F C;  3KLN A;  4NZR M;  4M9X A;  1I27 A;  1RUN A;  1AU7 A;  5CJ9 A;  5DUI A;  2RGV A;  2IW5 A;  1R6R A;  3FM5 A;  2L4A A;  2JSC A;  1Z91 A;  4G6Q A;  2PFB A;  4X62 I;  4MHG A;  4I2O A;  3H9Q A;  1DGR M;  3D1N I;  3RKQ A;  5DD8 A;  3MEX A;  2CW7 A;  5DS9 A;  2MD0 A;  3NWT A;  2XC7 A;  3Q9V A;  4DV3 H;  3CCL I;  2M45 A;  4FW4 A;  3FZV A;  3W6K B;  2EZK A;  2IOQ A;  2MAB A;  1Z0X A;  2FNA A;  3L7Z B;  3GKU A;  4BEH B;  3Q5F A;  4DV6 I;  2Q2E B;  2CUF A;  3R0J A;  4IS9 A;  2MC3 A;  2ZBK B;  4XM3 A;  1ETK A;  2Z1D A;  3HPH A;  2VF3 A;  2UU9 H;  2R7W A;  2R5Y A;  2EK5 A;  3Q6M A;  3F8B A;  4XRS G;  4FT8 A;  2JK3 A;  4HPQ A;  4IF4 A;  5CVJ A;  1MBF A;  3GTL J;  3KDK A;  2MSY A;  1IBK E;  3CC2 I;  4PFP A;  4MFE A;  3VYS B;  2OI2 A;  2C38 B;  1SVO A;  1ZHF A;  2E34 A;  3DKW A;  1O7F A;  2ZXW H;  3BTL A;  4RM2 A;  3V7S A;  3QP5 A;  2M9H A;  3CCE I;  3S2D J;  2HKE A;  3QPS A;  4B3M I;  3S93 A;  2GXA A;  1RKT A;  1K4S A;  3BPV A;  4IOC F;  1SEU A;  3OYL A;  2FUG 2;  1X4M A;  4I0A A;  4LK0 F;  1UDN A;  1SMT A;  1YS7 A;  2DMU A;  4GYI A;  4E7S A;  4XRM A;  5E3O A;  3MZ8 A;  2CS3 A;  1J4W A;  2DT6 A;  2MLG A;  1OYW A;  4DPX A;  4LF4 H;  2NOJ B;  3ZMD A;  1WUU A;  1FX7 A;  3DEW A;  1GHC A;  3OYN A;  1LE8 A;  1R58 A;  2AXT C;  3RYP A;  1UHS A;  2WBM A;  3EET A;  3KEY A;  1BN5 A;  2VQC A;  1H73 A;  3I59 B;  3FBN B;  2UXD H;  3WU0 A;  1XNR E;  1D6T A;  4Q47 A;  1ODH A;  1JHH A;  5LMN H;  2I5U A;  3H5R A;  4KIG A;  5D4R A;  3SB1 A;  5FLM J;  1HKS A;  3KEO A;  3RF2 A;  2ECB A;  2LBF A;  3CJQ B;  4XON A;  2FOW A;  4DR2 E;  1U6G A;  2EIJ H;  2DA4 A;  3S17 J;  3IHU A;  5J1Y A;  1HR0 I;  3ZR8 X;  4BQA A;  4WK8 F;  4NXM H;  2Z5C A;  1G3Y A;  5F08 A;  1XN7 A;  2E1M B;  2WA0 A;  1R49 A;  3K4N A;  3JRB A;  4MQV A;  2QGU A;  5LRS A;  2YQR A;  2CTL A;  3CJN A;  2PNL A;  2PMZ A;  1K78 A;  2JEB I;  5DUK A;  4DR7 H;  3J81 W;  1A31 A;  3M8J A;  2ACJ A;  3QQA A;  3QT8 A;  5DNX A;  3VYR B;  4WAN A;  1N36 I;  2YUS A;  2YS9 A;  5HDG A;  3KIO A;  4HX4 A;  2IXS A;  3AG4 H;  4U87 A;  2JUC A;  1FOY A;  3BG5 A;  1OKR A;  3HUG B;  5DCM A;  4EQQ A;  4XRS A;  1ZG5 A;  4FW9 A;  5B66 C;  4LGW A;  2XGE A;  2OAZ A;  5GPC A;  2IEK A;  4V19 K;  1Y8R B;  4LD5 A;  4ZH4 F;  2XF6 A;  4JK1 X;  2L7F P;  2HYF A;  3X2Q H;  2OA4 A;  2FBK A;  3K69 A;  1JJ6 C;  3OTO H;  2M34 A;  4BBS J;  1Z0G A;  2O5R A;  3QPH A;  3F9K A;  5D4S A;  1TQI A;  5KNL A;  2DOD A;  2V1U A;  1F0X A;  2DYR H;  2Y0S N;  2XIG A;  4Z2Y A;  5J4V A;  4JI8 E;  4DV1 E;  5JVT A;  1IV8 A;  4DYC A;  2XPW A;  3ZPL A;  2O1T A;  3RPU D;  2X9D A;  2KQR A;  3BY6 A;  2PMU A;  2C6Y A;  3BT9 A;  3S3M A;  2WP8 B;  4E7L A;  1XMQ H;  2PBI A;  5FLX W;  2YX7 A;  4CUG A;  4DR6 I;  4ESB A;  5LL6 b;  1WHU A;  3S14 J;  1HNX E;  2NOG A;  5EZH A;  2ME0 A;  3W2W A;  2UUB H;  3HOW J;  1LUJ B;  4DV2 E;  4IZK B;  2K9M A;  3K2Z A;  4JV5 I;  2X85 A;  1D1C A;  4B3T E;  1XD7 A;  4L9T A;  1VIG A;  1JI8 A;  4X62 E;  1UG2 A;  2W4S A;  3TOA A;  2LKS A;  1J5E H;  2EIL H;  4BA1 B;  3RYR A;  2DFH A;  4ITV A;  3JAM W;  3EDP A;  5JEA A;  1FJG H;  2BA0 G;  4DR5 I;  4N9H A;  3IP4 B;  2XPU A;  1U3E M;  1Y5Y A;  3ULQ B;  2L0K A;  1ZXM A;  3H3Z A;  1N33 H;  3K1N A;  3SDB A;  3EYY A;  1BIB A;  1YTY A;  2Y3M A;  3JRF A;  5HDN A;  3QYB A;  1V4R A;  1Z05 A;  3LQR A;  1ETO A;  4UVB A;  1R00 A;  4JI0 E;  3S15 J;  1DU6 A;  2L01 A;  1WRJ A;  3FWE A;  2XV4 S;  4PDK A;  4QLC U;  2JQ7 A;  1GLN A;  4CZZ A;  4EV0 A;  2LP0 A;  2NVX J;  1XS9 A;  3DQV C;  3WU5 A;  5EDN A;  4C30 A;  4UY8 I;  1FOX A;  3IWF A;  2O8K A;  2QCO A;  3B02 A;  4M6Y A;  2E3U A;  2LY1 A;  3BLY A;  1KQ9 A;  3CUO A;  3KEQ A;  2EFW A;  4IKF A;  1ZZI A;  4W97 A;  1KYZ A;  1E2X A;  2W25 A;  4JI0 I;  2XAJ A;  1WPK A;  3DTE A;  2GA2 A;  5HS9 A;  5HLG A;  1MMS A;  1IBM I;  4QMF B;  2L9R A;  2WNR A;  1UDQ A;  2GQ0 A;  2UU9 E;  2CTK A;  3T0Y A;  1R1T A;  1HSJ A;  1W4M A;  3OYB A;  3JSO A;  4HOB A;  4IZZ A;  2ME6 A;  3GLL A;  3REO A;  1X3Z B;  2Y69 H;  3ZMT A;  1ZLJ A;  3VB2 A;  2LBF B;  4X65 I;  4P52 A;  4RLQ A;  3M3Y J;  5H20 A;  5EG0 B;  3CF2 A;  4B8X A;  3OYG A;  4OO1 C;  3DWL E;  3V7R A;  2K4B A;  2R7O A;  1X2N A;  4P1W A;  1Z5B A;  2QBY A;  3EYI A;  2HS5 A;  4QNK A;  1XSV A;  2FML A;  3TW7 A;  1LNW A;  4H8A A;  4AYB N;  3F72 A;  5LMN I;  1RES A;  1FOK A;  2X6X A;  1AKH A;  2EV0 A;  2M0M A;  1Z0B A;  1W7P D;  2P2R A;  5K36 B;  5E1W A;  1BC8 C;  1G3W A;  2UXX A;  1DQU A;  2M3A A;  2JA6 J;  2BA0 D;  4J00 A;  2JZX A;  1EH7 A;  2JVH A;  1PVE A;  4UV9 A;  3WTW C;  2PI0 A;  4IEJ A;  1V54 H;  1BW6 A;  4LIV A;  4DV1 I;  1XNR I;  4M3F A;  2DFE A;  2PJR A;  1K6Y A;  3J81 K;  5M3F J;  4YEL A;  1YIO A;  2ZSI B;  3TL4 X;  4OKG A;  1XNR H;  3HIF A;  4ZC3 A;  4KHP E;  2X36 A;  4U0Y A;  4FTH A;  3O2P E;  1CQT A;  2EH3 A;  3K70 C;  1X4N A;  4O6J A;  5HS8 A;  3G73 A;  2PEX A;  2RC4 A;  4LF7 E;  1SD4 A;  4KA4 A;  2VOP A;  2O6G E;  1FP1 D;  1XXE A;  5C4J J;  4IHW A;  1E0E A;  2O0Y A;  4HAC B;  5JEA C;  1P7J A;  2BL5 A;  2ZJR F;  5FKO A;  5A2Q Q;  1UCR A;  2YU3 A;  4FX0 A;  1D0X A;  4F93 B;  4HY1 A;  3VWB A;  4B8T A;  1HR0 E;  2VJ4 A;  2DFF A;  2EIM H;  4DR3 I;  3OYK A;  2O61 A;  3TP0 A;  4MGR A;  1IBK I;  4YHH H;  4WCG A;  1MH4 A;  4B48 A;  5ILU A;  4JVH A;  5GAE J;  2CV2 A;  1WJD A;  3CCY A;  3HSR A;  2A07 F;  1BOA A;  2HYG D;  2ZM6 I;  5DCF A;  2WY7 Q;  3EPZ A;  5L3F A;  1JKO C;  4X66 I;  1T2K A;  2HQA A;  4JI3 E;  3KP6 A;  3VOD A;  3CDJ A;  3K4M A;  4LB6 B;  2WAF A;  3ABK H;  5ICC A;  4JBA A;  1LEB A;  4LFB H;  1S6L A;  2J5O A;  1ETY A;  5D5X B;  4BE2 A;  2RAE A;  4XOR A;  3JAM K;  3CCM I;  2NN6 C;  3AFH A;  4MYU A;  2O8X A;  1U5T A;  5D5W B;  3AAF A;  2Z3Y A;  1APL C;  3IKV A;  3MMY B;  1G4D A;  2DLL A;  3TDU C;  4UHT A;  3OYM A;  1YJN I;  1MW7 A;  1WE8 A;  2M6Q A;  3RPU A;  4LIT A;  1IAW A;  2QSF X;  4BHP A;  4Y13 A;  5IWA H;  2FD5 A;  2QQ8 A;  5ICF A;  1VQL I;  3MFK A;  2C37 B;  5GAH J;  4NXN H;  2OCE A;  2X7I A;  4DV2 H;  4JX5 A;  1MBJ A;  4B47 A;  4K0K H;  2M8E A;  2ZJ2 A;  1Z6R A;  2P8T A;  3VYU B;  4U3B A;  4MTD A;  2X0L A;  1ZM2 A;  1JKR C;  4NUB A;  4DR5 H;  5DRQ A;  2VB6 A;  3BG9 A;  2HTJ A;  1J5Y A;  2WV1 A;  1LFB A;  4EEF G;  3CUQ C;  3W2A A;  2K1H A;  3CWV A;  3OYH A;  2MH9 A;  2RKH A;  3D5L A;  1XCB A;  2ZO4 A;  4LFC H;  1FMV A;  5JLX A;  2PN6 A;  3GEZ A;  2ESN A;  3D5S C;  3ZMS A;  5IT3 A;  2F2E A;  4WXH A;  1UZC A;  2VPL A;  2MYS A;  5IYB J;  1KON A;  2V1X A;  1JKP C;  3TO9 A;  9ANT A;  4MTE A;  1QQI A;  3CTA A;  4GO1 A;  3S3O A;  5IP6 A;  1N78 A;  1VF9 A;  3GW2 A;  2V9V A;  5HNH A;  3KPH A;  4JI7 E;  1UHW A;  4YFX F;  5FFZ A;  2P6S A;  1UG8 A;  2KZV A;  1GT0 C;  4JX4 A;  2GAU A;  1BKN A;  4YRV A;  1Y4U A;  1BJZ A;  4DPW A;  2LTL A;  2OUM A;  4MNU A;  4BY7 J;  1RR7 A;  1YI2 I;  2E36 A;  4DV7 I;  1STZ A;  2K9L A;  1I6X A;  3ZMZ A;  3M07 A;  2Z5E A;  1RR8 C;  1RRJ A;  1X2M A;  3FXM A;  3Q0U A;  4GCV A;  4BHC A;  4KMU X;  2IA0 A;  2YU9 J;  4DOZ A;  1A5J A;  5ELW A;  1UG0 A;  4HSR A;  3BR6 A;  2L7M P;  3KP7 A;  4HST A;  1OCP A;  5ICG A;  2DMQ A;  4LCG A;  1R22 A;  2QEN A;  3LAP A;  5IOY A;  4J19 A;  3QT7 A;  4NQW A;  2DMP A;  5F0H A;  1QO0 D;  1FNM A;  3LTO A;  1BR1 A;  1LJ9 A;  2X6O A;  5KAI C;  4KFC A;  2FE3 A;  4CSW A;  2BVM A;  4R8H A;  2M30 A;  4EJW A;  2TCT A;  1MJB A; 
#chains in the Genus database with same CATH homology
 3L7Z B;  4AIM A;  4AID A;  2JE6 A;  2ANR A;  4JVY A;  5JEA C;  1R6L A;  2JEA B;  2BL5 A;  1ZTG A;  2JEA I;  1VIG A;  2BR2 B;  5JEA F;  2NN6 G;  2JE6 B;  4B8T A;  3M7N D;  2PY9 A;  5K36 F;  2OPV A;  4BA1 B;  2JE6 I;  2C39 B;  5K36 G;  2C38 B;  5JEA E;  2NN6 F;  2PO2 B;  4IFD D;  4OO1 F;  5JEA A;  5JEA G;  4AM3 A;  2BA0 G;  2AXY A;  1DTJ A;  2WNR B;  1OYR A;  4JVH A;  2BA1 D;  1ZZK A;  1VIH A;  5C0X D;  1WVN A;  4LIJ A;  4BA2 A;  2WP8 A;  1X4M A;  2ANN A;  3GCM A;  5K36 C;  2CTE A;  1UDN A;  2QND A;  3CDJ A;  2JEB B;  2PNZ A;  3HKM A;  1J5K A;  1OYS A;  2JVZ A;  2NN6 C;  1J4W A;  4IFD F;  2NN6 E;  4OO1 E;  4BA2 I;  2PO2 A;  5C0X A;  3U1K A;  2PNZ B;  2PO0 B;  5K36 E;  2E3U A;  5K36 A;  1WE8 A;  1ZZI A;  2BR2 A;  3KRN A;  1DT4 A;  2C37 B;  2NN6 A;  4BA1 A;  1K1G A;  4QMF B;  2WNR A;  2FMR A;  1UDQ A;  2HH3 A;  2JEB A;  1ZZJ A;  2CTK A;  2C37 A;  3GLL A;  4IFD E;  3AEV B;  4IFD G;  2PO1 B;  2CTM A;  2Z0S A;  1UDO A;  5C0X G;  2PO0 A;  4IFD B;  3GME A;  4NBQ A;  4OO1 C;  3H36 A;  3M85 G;  2PO1 A;  5C0X F;  2YQR A;  2CTJ A;  2BA1 G;  2CTL A;  4IFD A;  2JEB I;  1OYP A;  1EC6 A;  4WAN A;  3M7N G;  5C0X B;  4BA2 B;  2NN6 D;  2P2R A;  4OO1 D;  5K36 B;  2BA0 D;  2DGR A;  2JZX A;  5K36 D;  2NN6 B;  3VKE A;  5JEA D;  4BA1 I;  3V69 A;  5C0X C;  1KHM A;  1TUA A;  1UDS A;  3DD6 A;  2HH2 A;  2CTF A;  1E3H A;  2C39 A;  3M85 D;  1R6M A;  4OO1 A;  3H1C A;  1E3P A;  5C0X E;  2BA0 A;  2CPQ A;  2JA9 A;  3L7Z C;  4IFD C;  4OO1 B;  2OPU A;  2PQU A;  2MJH A;  2WP8 B;  1X4N A;  3L7Z A;  4OO1 G;  5JEA B;  4WAL A;  3B4T A;  2C38 A;  3CDI A;  1WHU A;  2JEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...