4AM3A

Crystal structure of c. crescentus pnpase bound to rna
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
622
structure length
622
Chain Sequence
b'GSMFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAVFAKSQKPGQDFFPLTVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVKGFKNEVQVVVTVLQHDLENDPDILGMVAASAALCLSGAPFMGPIGAARVGWVDGAYVLNPTLDEMKESKMDLVVAGTADAVMMVESEIQELSEEIVLGGVNFAHQQMQAVIDAIIDLAEHAAKEPFAFEPEDTDAIKAKMKDLVGADIAAAYKIQKKQDRYEAVGAAKKKAIAALGLSDENPTGYDPLKLGAIFKELEADVVRRGILDTGLRIDGRDVKTVRPILGEVGILPRTHGSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKESFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLAMMDAGVPLVRPVSGIAMGLILEQDGFAVLSDILGDEDHLGDMDFKVAGTSEGLTSLQMDIKIAGITPAIMEQALAQAKEGRAHILGEMNKAMDAPRADVGDFAPKIETINIPTDKIREVIGSGGKVIREIVATTGAKVDINDDGVVKVSASDGAKIKAAIDWIKSITDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYRIBONUCLEOTIDE NUCLEOTIDYLTRANSFERASE
publication title Crystal Structure of Caulobacter Crescentus Polynucleotide Phosphorylase Reveals a Mechanism of RNA Substrate Channelling and RNA Degradosome Assembly.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase/rna
total genus 175
structure length 622
sequence length 622
chains with identical sequence B, C
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2012-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF00575 S1 S1 RNA binding domain
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 4am3A02
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4am3A03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4am3A01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4am3A04
2BA1G 2PO1B 2HH2A 3L7ZA 5K36E 1UDNA 3L7ZC 2JA9A 2JVZA 2OPUA 1ZZJA 2E3UA 2PNZB 2PO1A 5C0XB 2WP8B 2CPQA 2CTLA 2NN6G 1VIHA 3KRNA 4AIMA 3VKEA 2JE6I 1UDOA 4IFDB 4LIJA 2Z0SA 1ZZIA 2PNZA 4AIDA 5C0XA 2WP8A 2PQUA 1DT4A 2MJHA 5C0XC 1VIGA 5C0XF 1X4NA 2BL5A 2FMRA 2JEAB 3AEVB 1E3PA 4IFDA 5K36G 2JZXA 4BA2I 5C0XE 4IFDC 1ZZKA 5JEAB 4IFDF 4WALA 1DTJA 3DD6A 3GMEA 2AXYA 1EC6A 2JEAA 4IFDE 2DGRA 3U1KA 3H1CA 5C0XD 1KHMA 5JEAA 1J5KA 1OYRA 3GCMA 2JEBB 2JE6B 2C39B 2PO2B 2HH3A 5JEAC 5JEAF 4OO1B 4IFDD 1X4MA 5JEAE 3M7ND 4BA1I 2PY9A 5C0XG 3M85D 2CTKA 2JEBA 2JE6A 2C39A 2PO2A 4NBQA 4B8TA 2NN6C 1E3HA 4OO1A 4BA2B 2NN6F 3H36A 3V69A 1R6MA 4IFDG 4OO1C 1UDSA 2PO0B 4OO1F 2BA1D 2C38B 3M7NG 5JEAD 2CTFA 3M85G 4AM3A 1WE8A 1WHUA 2QNDA 1J4WA 4WANA 4JVHA 2C37B 4BA2A 1OYSA 2NN6B 2ANRA 2PO0A 2JEAI 2C38A 3CDIA 4QMFB 5K36C 5JEAG 5K36F 2NN6D 2P2RA 1TUAA 3GLLA 2BA0D 4OO1D 3B4TA 2C37A 4BA1B 1R6LA 3HKMA 2NN6A 4JVYA 2BR2B 2BA0A 1WVNA 5K36B 2ANNA 2WNRB 1ZTGA 2BA0G 2JEBI 2YQRA 4OO1G 2NN6E 4BA1A 2OPVA 5K36D 1UDQA 4OO1E 3L7ZB 2CTEA 2BR2A 1K1GA 3CDJA 2CTMA 5K36A 1OYPA 2CTJA 2WNRA
chains in the Genus database with same CATH superfamily
1FOKA 2BA1G 5FB2A 1ZH5A 4NXNE 4X65H 4CCOA 1RUNA 2DA6A 2V9PA 5HLTA 3A01B 4CO8A 4DR5E 3QU6A 3L7ZC 3EUAA 1VFCA 3JRHA 2FEZA 1MDMA 3GFIA 2JA6J 2OZUA 1AKHB 2FPHX 4YY3I 3BR3A 2CPQA 3Q6MA 4PFOA 4M3FA 3KRNA 3QOEA 3P7NA 4KMFA 2L9SA 2F5CA 5HLHA 4FWDA 3EQLF 3MKLA 3L7WA 2R7ZJ 1ULYA 4JI1E 1ZGAA 1F0XA 2XB5A 1G3WA 1ZR2A 2WP8A 4OX9H 2PN6A 3BZCA 2V2VA 1VQOI 2NVQJ 1T6SA 1X4NA 3SB1A 3J80Q 2OZ6A 4DR3E 3E97A 5IWAE 1E3PA 1TWFJ 1WCMJ 4LK1F 4YFXF 3T1HE 2XAFA 4F52A 4F93B 2M34A 4DR5I 4V2FA 4HY1A 4A0XA 3CMAI 3K1JA 1X9ZA 2X85A 2RAEA 3L2WA 2JEAA 3WU6A 3OYAA 1STZA 4LF5E 1KQ9A 2AXLA 4P9UA 3K0LA 3H1CA 4JG4A 1W0TA 1GVJA 3QT7A 1XB4A 4EM0B 1X2NA 1JKOC 3S1QJ 3M3YJ 4E9JA 4G7HF 3UR3C 1HSJA 4OO1B 1R49A 4JI1I 4DV0I 3CUQC 4QPQA 3J80K 1MIJA 3ZPLA 2MG4A 4HF2A 4BAYA 1QZEA 1XMOE 3ERMA 2DU9A 2VC0A 3L2CA 1PVGA 3ECHA 3H4LA 3KDKA 4DZJA 2XV4S 5D4RA 2JEBA 3QAHA 5IWAI 5EF6A 4DR3I 3T1HI 3PSFA 5IP7J 2EILH 2ZJQF 1NHHA 3BTCA 3NAUA 3VYTB 1PIEA 1XN7A 1FNMA 4X66E 3PL8A 5JI6A 3Q5FA 1REPC 3RPUD 2O8XA 3IKVA 2PO0B 3E0JB 1HBXG 4UY8I 3BLYA 1W36D 2DAOA 3ZP5A 2QUFA 4FX0A 3T1YI 2KIQA 1YX5A 1TWGJ 1SD6A 2C37B 4DR2H 2KRHA 4CH7A 5E18F 2FE3A 2UUBI 2GIZA 4ZYEA 5F27A 5D5XB 1WTJA 4EEFG 4MQVA 1FSEA 2HWVA 1U78A 2V79A 4M6VA 3CJQB 1LQ1A 1FPQA 1X3UA 3BTJA 5FKMA 2C6YA 2XUBA 4LJZF 2ECBA 3HUGB 4BL0B 4HQEA 5EZHA 5F04A 4OX9E 3PFYA 2V26A 3GTMJ 1LDKB 2VJ5A 4JI6E 2EFOA 1X19A 2M2EA 2M8EA 3DF8A 3TP0A 3P3GA 1QVUA 3GTLJ 2V6CA 2GO4A 1V8CA 1TL8A 3OYGA 4PJNA 3TDUC 5E3LA 3TKYA 1G59A 3SZPA 4MIMA 3G3ZA 2WNRA 1R7JA 3ABKH 1KYZA 3OOPA 4NC7A 3W2WA 3F6VA 1TT5B 1HC8A 1PQXA 2CV1A 3V42A 4BY1J 3CCJI 4XKCA 3ABTA 1G2HA 2NRAC 1DP3A 4PJ0C 1FIAA 3LFKA 2H09A 4G6DA 2FBHA 4CCNA 1UCRA 1QPIA 4PRXA 2W84A 3ZN0A 3KYLA 2HOSA 3Q0UA 4OX9I 1VNDA 1B6AA 2X1EA 3IWFA 2DA2A 4AD9A 5J1RA 3CZ6A 2HKXA 5F1RA 1GXPA 3A01A 3H3UA 4F7ZA 1CQTA 1BR4A 4BXFA 1IBME 4HA8A 1J75A 3QT8A 1AKHA 3CCUI 1ETOA 2CW7A 3AFHA 5FFXA 1JTXA 2IGOA 2LY9A 3CUOA 2HI3A 3DBHB 3GXOA 2M8GX 4KT5C 4U87A 1X0AA 3MVPA 4EMDA 3TQNA 5F08A 3LSPA 2O8KA 1ZM4A 3T8TA 4JI4E 2W1OA 2W85A 4DJAA 3WGHA 4G7OF 3S3NA 1JJ8C 1ZRDA 2PT7G 3PQJA 4UNOA 3FM3A 1QU3A 3PNTA 4BA2I 3GR5A 2ZFUA 4IFDC 3K1NA 3EUHA 1YITI 3BCAA 3ZMSA 2HZTA 4IZJD 5DNLA 1D0ZA 3LOCA 1KYWA 2VONA 4XSZF 1NXUA 2ZNZA 1S9HA 4LCGA 2VBYA 1NK2P 3WG7H 2F1DA 1BR2A 3G1OA 2HH3A 5JEAC 3R6SA 4Y17A 2QF7A 3WU4A 5ICFA 3GX4X 3L2RA 3FK6A 2BY3A 2EA2A 5LLQA 2O61A 4B3MH 2PY9A 2HYFA 2CG9A 3HGYA 1WPKA 3S16J 4RAFA 2G9WA 1MG7A 2YX4A 1YLFA 4BA2B 1JXSA 3IH4A 4OO1A 2X48A 3DTEA 4IFDG 3TO9A 1N0VC 2WBMA 4BE2A 3ZKDA 3RYPA 5JLWA 5DEQA 2CWEA 4AM3A 5FLXC 4FASD 4X62E 3IRQA 1S7EA 1USSA 5CYVA 5HNHA 1J09A 4WK8F 2DYSH 3BPVA 1EA6A 3EYYA 2PO0A 2IA1A 2XGDA 1YW7A 1TWCJ 3CDIA 4YEJA 1Y8RB 1RETA 5E8GA 4M71A 2H1KA 2EFNA 4OIPF 1KKHA 4LF7E 5JEAG 1OCPA 1N34H 2P2RA 1MSFC 3BQYA 3OR2C 2C37A 2M6QA 1V3FA 1CGPA 2CGEA 1ZXNA 4Z6YA 3CCRI 2VC1A 4M3DA 3K2AA 5CVRA 3OSGA 2H27A 3MKZA 2UXDE 4Y7NJ 1FKAH 3Q9VA 2CO5A 4B48A 2NN6E 5GAHJ 3RF2A 2JTVA 1SC7A 3NWTA 4LG3A 1A5JA 1X3ZB 2Y0SN 1XXEA 3HUGA 5K36A 3SFZA 1RR8C 3SJMA 2BW3B 4KIBA 2MC3A 4LFUA 2LKPA 3OIPA 3J7AM 4HOBA 1Z77A 3VYRB 2HK3A 4U7DA 1FIPA 3GEZA 2ZCWA 5HLIA 5FGMA 4JBAA 4DV4E 2L4AA 1XC5A 1VZ0A 2WA0A 1JHHA 5DYMA 3OR1C 1MJ9A 3CO6C 2HU9A 1FOXA 1N33E 4KIGA 2QM3A 3OSSD 4OIOF 5JFRA 3CF2A 2Z9OA 2KIFA 5F1JA 2O9LA 2QGUA 1SVLA 2HYGD 3ISPA 2BGCA 2UXCE 1K47A 1FBQA 1IF1A 4MDTA 4I09A 3R4KA 2EFGA 4BXXJ 3F0NA 2IBDA 2LK2A 2A2DA 3SXYA 3FWEA 1FEXA 1DARA 2MJHA 1VIGA 2NXNB 4ZH4F 4U0YA 5A2QZ 4RGXA 3BG5A 2DMQA 2LKSA 2IPQX 2R7FA 2DEJA 1FLIA 1RKWA 4JX5A 4JI7H 4DR7E 1PVEA 3AAFA 2HQAA 4IZJB 1VQNI 3ASNH 1O3RA 4DV4I 4IVNA 1B8IB 3M8FA 4PUSA 2R42A 1UMQA 2CU7A 1FYLA 2Y30A 2FD5A 2VLAA 1ZQ3P 4JI2H 3LA7A 2H8WA 1HOMA 4B3MI 3AL0C 3TOAA 4IL6C 3I54A 2ZMEC 4A3LJ 2LTLA 2PBIA 4U7BA 3ZOBA 3BZKA 5L3CA 1VQLI 2EH3A 2BBYA 2ICWG 2E1NA 1ZLJA 1MMGA 1YHCA 1X4MA 4ASNA 2BVLA 4LF8H 1MJAA 1I6HJ 3T0YA 5FJ8J 1UG2A 2JN6A 3HKZA 1V5FA 4CZZA 3CC7I 4G08A 4M9ZA 5EG0B 4HACB 2Y69H 4D9JA 1OJLA 4PRVA 2H6BA 1P2FA 4OAZA 2BA1D 3TP3A 4OO1F 4R79A 1B1BA 3TGNA 3LFUA 4YG2F 1W4MA 1N34I 4OD6A 5JVGF 5DROA 3PUFA 1Z59A 3F0CA 1Z0XA 4BQOA 2EZHA 3RPUA 1K4TA 1P42A 4BA2A 4RGSA 3W6JB 1OR7C 1EJ9A 5HDKA 3K70D 2Q1ZB 2Y9YA 2Z16A 5LL6R 2WY7Q 3TOBA 3MZHA 2GS8A 1O7LA 4A2UA 4A3DJ 2LJPA 4Y15A 2DA4A 5BOXA 1YE9A 4OAYA 5EZGA 2OPTA 4MGRA 4DYCA 4BQQA 5FWKA 4QPOA 3PO2J 1ELOA 5LL6b 2YUSA 3QOPA 4OCHA 2VQEH 3J81Q 3ZGKA 4IOCF 4HDUA 4NXMH 4BS9A 4C3IJ 3M4OJ 1KA8A 3OTOE 2JPBA 1FBUA 3OMYA 1B62A 2D9IA 3JAMC 2ESNA 2OI2A 4HF1A 4O3MA 1XG1A 1LE8B 3HYIA 2A68F 4Q48A 1YJNI 5JLXA 4LFCE 4BE0A 1PP7U 2PNLA 1IN8A 1ON2A 2BHZA 2J5OA 2JK3A 2LOOA 4KICA 5HS9A 2R5YB 3J81C 4MTEA 3N05A 5HOOA 4GKKE 4I99C 2IW5A 5DUKA 1FZPB 3ULQB 3FMRA 2E1OA 2BW3A 2UUAE 1J2XA 4WUDA 1U2WA 2OV7A 2CTLA 2VASA 1LNWA 2GIVA 2PX9A 3KFWX 5D6EA 1X4OA 3LQRA 2JE6I 2IA0A 4LG0B 3BR5A 1MH4A 4AUXA 3SHFA 4JI7I 2LTPA 3U9GA 2XF5A 5F64A 2GLOA 2CV0A 2BEOA 3LNQA 1IN6A 1XSVA 3DTIA 3ZQGA 2L9VA 3JRFA 3BPXA 2CMPA 2NVYJ 4I2OA 4LPFA 1HQCA 3PIOF 2D1HA 4LB6B 3JTGA 3JRGA 2XB0X 4HZFA 4JI2I 5IYBJ 4DV5H 3PYGA 2YSRA 2FMLA 4C2TA 1TNTA 1BN5A 1YIJI 4KN7X 3ZQIA 1O57A 3K6GA 2KDZA 3SZGA 2EFQA 4DV3H 2A6TA 2JUGA 3L09A 4IHYA 2I10A 2LF7A 4LF8I 1JGSA 1ZXMA 1N32E 3V7RA 1P92A 1LFPA 2HFUA 2JE6B 3FMSA 2VF3A 3WGIA 2JQ7A 1B8IA 2NOJB 3K7AJ 1TW2A 3OWTA 3WU1B 1WJDA 2CSOA 4CYCB 1GUUA 2L4MA 1OJ4A 1S16A 3DP7A 2NVTJ 1WUUA 1DQUA 3ZMDA 2FX0A 1W5SA 3W2AA 3KEOA 2CUFA 4A12A 1X1AA 4XR6A 2X4HA 1E17A 4ZJZA 3OYHA 1R22A 2BE5F 2DTZA 1K6OA 1Q1VA 2PFBA 4DR1H 4B3TH 3KP2A 2F5VA 4CZCA 4LF4E 3V4GA 5K5QA 4MQ9F 5EG0A 3C7JA 4HACA 4CA0A 2EIMH 3HRTA 1S4EA 2VQEI 2MLKA 4HRIA 5JHFA 2EV6A 2L2OA 2MA3A 3FXQA 2Z5UA 4NXMI 1QO0D 2WAFA 2P5KA 3DU5A 1D1AA 2IRFG 4RDUA 3B4TA 4GYIA 3JREA 3CCLI 1IV8A 3GFLA 4GFBA 4RM3A 3DEUA 1TT0A 5DDGA 2DLLA 2JRTA 2UXNA 1MZBA 3CDHA 3VB2A 2RVCA 1Y60A 4E4HA 1RC9A 1J5EE 1Y1WJ 4DOZA 1ZTGA 3H0DA 3IV5A 5H6RA 4DV5E 1F43A 2FFMA 1ETKA 4L9NA 3WHCA 2ZXHA 2VBXA 3IHUA 3O3KA 5IPAA 1WZ2A 1XDSA 3VFZA 1HKTA 5IT3A 2OPVA 3L7ZB 2IGNA 4I01A 1YS7A 4CCJA 3CCEI 4ITVA 5J47A 2CTJA 3K17A 1HR0H 1ZAOA 1POGA 3QODA 1PUEE 2O1VA 4Z7CA 5FKNA 1YOVB 3BG9A 5D6FA 4A6DA 1BI2A 2E35A 4P1WA 3HOZJ 1LE8A 3KDGA 3BC8A 3DTKA 4N4NB 4B4CA 3PYDA 2NS8A 1SEUA 4FQGA 2XF7A 3K69A 1DU0A 3OYIA 3GONA 1X1DA 2IOQA 1SFXA 2R5YA 1NZ0A 2L5QA 2BYVE 2NN6G 2VE9A 3T8RA 1R36A 3FKJA 4RAGA 5FLMJ 3FXMA 4DV5I 4XN0A 4B43A 3QP6A 3TDZC 3P06A 2E1CA 3WTXC 4M74A 4BHBA 1H74A 5FKOA 2VESA 3GTKJ 4QNJA 4R1HA 2TDXA 2A3SA 2VQHA 2FRHA 1FSHA 1PJRA 2RGVA 1QRYA 1B72B 1I3QJ 3B82A 4DV3I 5FO5A 1HNZH 2W57A 1N75A 2WTEA 4LG0A 2HEOA 3QT6A 2ZQEA 5EEAA 1F4KA 1IN7A 5C0XE 3NRVA 4XONA 2BV3A 2K85A 1V5EA 1SVMA 1PDNC 3DBRB 4II2A 4XORA 3CUQB 5HDGA 4CICA 2KMUA 2Z33A 2X6OA 4ZYAA 4LOMA 1N36H 2DDBA 4HW0A 3HSRA 2EK5A 2VJ4A 1OLTA 3WE2A 2M7AA 3W6KB 4YHHH 1KHMA 3GCMA 1IC8A 2P4WA 5L3JA 2I8DA 1OYWA 2V4JC 4N3OA 2E7XA 4FE4A 3WTVC 1Y56A 2ME0A 2OJED 5KCMA 4ENJA 2ZSIB 1Q1HA 2DK8A 1XNRH 3S8PA 3ZMZA 2F5DA 4U88A 4BA1I 2HKJA 3UHMA 1JT6A 3FBIB 4S04A 2JE6A 4DR1I 4B3TI 2GA1A 1Z1DA 1T33A 4NBQA 3WTTC 3EPZA 2ZFWA 1IO2A 2KISA 2JA2A 4CYCA 3DPLC 5JHUA 4Q4ZF 2R5ZB 2HOTA 1Z7LA 1KVKA 1HR0E 2K4BA 3S93A 5LHHA 2QSFX 4ZTJA 1ZG3A 4NXNH 3I53A 1XGNA 1TQIA 5J1UA 5LHGA 5LMNE 2CUJA 2M5WA 2HPMA 4B3XA 4DR5H 3P5JA 3I58A 2W48A 5A2QQ 3K1MA 1FMVA 3HKZN 4HV5A 3D0SA 3KYCB 2R7RA 3HJEA 2VBZA 2EWNA 3PNVA 1TWAJ 4ESFA 4OO1D 4MFEA 4GXOA 1Y6ZA 4BA1B 4DPTA 3CDLA 5B1BH 4D7NA 3HHGA 1T2KA 1WSUA 2R7DA 4KJZA 1X1BA 3ZR8X 3ABMH 4NC6A 4AWXB 1LUJB 2K02A 4BKXA 3LAPA 1R71A 1W5TA 2FU4A 1P6RA 4JI1H 2O5RA 1HR0I 3S15J 2IESA 2BA0G 1BR1A 1YTYA 2DA1A 3FK7A 4DR3H 3T1HH 3SEZA 3HC7A 5A2QK 4E7KA 3CDJA 3RTRA 2CTMA 2W7NA 1E3OC 1R9TJ 3JRCA 1JKQC 3RKWA 2PMZA 2BM1A 1JUPA 4EVIA 1OQYA 2K3PA 3LSIA 2Y0SA 3IKTA 1D3YA 5CVJA 5D8KB 4ENMA 3L7ZA 2O4CA 2X06A 1BM9A 1NG7A 4LF5H 1MMDA 5FLXW 1V5GA 2JVZA 2X6XA 3P9CA 4C3HJ 4FX4A 4E7IA 4DPYA 2VI6A 4GRIA 3VSKA 4B3AA 3KE2A 5F0CA 3KETA 3WTWC 1HNZI 2IS1A 4ZZLA 1XMOH 3KCCA 4IFDB 2VQFH 9ANTA 1XPXA 4JK1X 1HXDA 1YI2I 2CPMA 4FJSA 1LFBA 2WB1N 1DT4A 2JJ7A 3FHZA 4X66H 3N4MA 4AVPA 1N36I 1R4NB 1G8XA 2KZGA 4XRMA 1YFHA 3KP5A 3E6DA 3FAUA 2FUG2 2LH9A 3CCYA 4YHHI 5JEAB 1DPUA 3FMQA 1DTJA 2V1XA 3BCBA 1R4MB 1IUYA 1B72A 1A6QA 1TQPA 1UG0A 4FETA 3U21A 1XMQE 2A2CA 1XNRI 2XGEA 4E7JA 4DUYE 4ZYGA 4A3JJ 3J7ZI 1X2MA 2DA7A 4NUBA 3OS1A 2STTA 3CUQA 2DK5A 5IP6A 1D1CA 5TISC 4ANJA 4WUBA 1BIBA 4G6TB 3I56I 3FZVA 1G4DA 4LF9E 4KUMA 3JTHA 1VQPI 4LIUA 4M6XA 3OYFA 5GMDA 4Y13A 4NXNI 4JI6H 2F4VE 3AKZA 5GTHC 1FOYA 2ZJRF 3KYDB 1P4AA 3HBLA 2IOPA 2ISYA 2LDUA 4HLXA 3F72A 2RKHA 3C2HA 1HNXE 1ZM3A 2EZKA 3M7NG 1LFUP 1XGSA 3PS3A 4IHSA 3J80C 1VQMI 1MD0A 2CYYA 2CZ9A 1BJZA 5M5YJ 3KIOA 5IT9Q 2ANRA 1Z5CA 1E2XA 3OS2A 5ICCA 5K36C 3RCOA 4X64E 5C3EJ 1Y6IA 2LY2A 1OCRH 3I3LA 3OS0A 2P6TA 2VQFE 1MBHA 2CWHA 1IBMH 3PO3J 3RZDJ 5M5WJ 2BR2B 1ODHA 4OINF 2BXZA 1OPCA 4OMZA 5AONA 3IH3A 2XDVA 1RUOA 4BA1A 4JI4H 2LG4A 3P3EA 1UDQA 1RI7A 5IT9K 4LF5I 1MW7A 5M3FJ 3A02A 4M3EA 2CS3A 4MNUA 4A5NA 1Z21A 1U5TB 2VIXA 1WJAA 4UV8A 3A0HC 4ZDPA 4LD5A 2HQRA 4XQFA 2ADUA 2ZXJA 1XMOI 4JX4A 4ZC3A 4ESBA 3QQAA 2VQFI 4B8XA 3HOTA 3M1EA 2VPLA 4MEYF 3HXLA 5GTIC 2E3UA 4IHVA 3S1NJ 2QENA 1GT0C 2COMA 4X66I 3EETA 3RIRA 2UUCE 1ZHFA 1BW5A 1G3SA 1HSTA 2LTMA 3S1MJ 1RESA 2KIUA 4HXZA 4P9FA 1UDOA 4AQYE 2AS5F 2KL4A 2A61A 3W6VA 1QNTA 3P9IA 2HNHA 1K7AA 2M9HA 4B3SE 3VODA 4E70A 1TTYA 1UHSA 5DCMB 4HYMA 3BJAA 5C0XC 3ML6A 2VKHA 3IWZA 2DT5A 4E7HA 3AL0B 2DMTA 4RLQA 2MW8A 4NDLA 1SFOJ 5GPAA 4IFDA 4JI3H 4URLA 5FD6A 2L7ZA 2TRTA 5GAEJ 1SAUA 4X62H 2VKVA 4NZTM 1HNWH 3NARA 4H4KC 4GQUA 3JAMW 2XRNA 3GMEA 2AXYA 1Y0NA 3O2PE 4RGUA 2KRCA 2Y31A 4LF7H 4B09A 4JQFA 3D4JA 2VKEA 2W82A 3ZXSA 2KIMA 3OYNA 2Y3MA 5JEAA 4JI6I 4D5CA 4AQYI 2RV8A 3QT5A 5J40A 3BR2A 3WU3A 3L2QA 4B3SI 3H5NA 1XMKA 2FSWA 3BG3A 2UXDH 1S8NA 4RM2A 4W1UA 1SFEA 5C0XG 4I3HA 2VL8A 3L00A 4D0PA 2XAQA 2ID6A 1FP1D 2FBKA 2VOOA 3D5LA 2JZYA 2WY8Q 5CVIA 3U2RA 1JJ6C 1Z9CA 5J3LA 2J7KA 3F8MA 2VJIA 3DQVC 3FXRA 2NS0A 3JRDA 2R0QC 1Y39A 1VQKI 4AIKA 4DYRA 2L54A 4L9JA 1IBMI 2XPWA 3LSHA 4DV4H 1JGGA 1D0YA 2ZM6H 2ZC2A 1YJ9I 2DODA 2DT6A 2R7VA 3JR9A 2NN6D 3HZJA 1N33H 1MMAA 4XSXF 4JI4I 2R7WA 1VISA 4HNVA 2CWFA 3E5QA 3H5RA 4BJ5C 3QU3A 2DW4A 2UXCH 1APLC 1ZM9A 2HOEA 2HKOA 5HS7A 3PJRA 3S2DJ 5CQEA 2FXAA 3SFIA 2R92J 1KIJA 4JI3E 3AG2H 3JRBA 3SQNA 3T5XA 2HFSA 1Z05A 1XCVA 2BR2A 2B9SA 1HNWE 3LSTA 3V2UC 2VQGA 4DR7H 3BT9A 4KN4X 1MSZA 2FA5A 1QVTA 1IBKE 2A1SA 4MO7A 5BQTA 3ERED 2BZTA 2PJPA 2R3SA 4EQQA 2DYRH 1DGWY 2MD0A 2DEIA 3RZOJ 4UB6C 3CJTB 3QP5A 2LREA 1ZG1A 1Y0UA 3OL3A 4PZJA 2HK2A 1UZCA 1U5TA 5EGOB 2NN6F 1R5HA 2UXXA 4DPXA 2M4GA 3J7AK 5FKLA 4JYKA 1FTZA 2K9NA 4E7LA 2Z5BB 1ZN2A 4JI3I 3E7LA 1ZELA 2PMZN 3CESA 4FW5A 1SD4A 1QHHD 2Y48A 4X62I 1KQ0A 1Y5YA 1A31A 1HNWI 4AIDA 2TCTA 2R7SA 1I6XA 1XGOA 5BMZA 1ETWA 3R0AA 2M0MA 2BL5A 3S3MA 1Z91A 4LF7I 3V7CA 1MBGA 5KK1A 1AA7A 1QQIA 1FY7A 5D5VB 1K78B 1N25A 3CF5F 1IXSB 4DR4H 1FI4A 1FX7A 4IFDF 2G7UA 5ICEA 3FXOA 1S72I 2NOGA 3BOQA 3K2ZA 2VJJA 3O8HA 5DCMA 2ZM6E 4DU8A 4J3DA 2HQNA 1UB9A 5L3DA 2XC7A 3WTUC 2YU9J 1XRHA 2UXDI 1H9GA 2HQ5A 4DIQA 4LF6E 4E6KG 2KPMA 4UUVA 3TO7A 4UXNA 5B1AH 5JEAF 4B3RE 1W0UA 3SYTA 4S0HB 4MFDA 2Z5EA 5GMEA 3SDBA 2LBFB 2DI3A 4RLFA 5CQGA 1RZ4A 1X1CA 4UUSB 5E3MA 4PJJA 4XMYA 5FROA 3V8LA 4GKJE 3M85D 4RPFA 3OTOH 2P6SA 3GTOJ 4GO1A 5LRSA 1I5ZA 5L3FA 2P5LC 2JVHA 2XAUA 1XD7A 2PJRB 5EYRA 2IERA 4LLLA 1R6MA 3PM1A 5E8IA 2ZM6I 4LFCH 4L5IA 3I5UA 4ETSA 1ZARA 1FJGE 1N33I 1PUFB 1YQAA 2MABA 4IF4A 5J1YA 1D0XA 2QNDA 2GWRA 1OR7A 3S2HJ 4JVHA 4GKKH 1NK3P 1S5LC 2I5UA 2RNGA 2XKOA 5FLVA 2Z1DA 2NN6B 4JYAE 2UXCI 1WGXA 3LSGA 4IJAA 3X2QH 3CCSI 3RQ4A 2UUAH 1T0FC 3CJRB 3P76A 1H9TA 2JPCA 2DMPA 4N4OB 4GGGA 1R6LA 3RPQA 2HVRA 4BYYA 3KLOA 2L3DA 3HJCA 4A3KJ 2DA3A 1Z5BA 4HDVA 3CO7C 4DR7I 4NZRM 2V1UA 1WFXA 3CP8A 2Z3YA 1P7JA 2IA2A 4BY7J 4CCMA 3ASOH 2DOEA 2LVSA 2YQRA 4DR4E 2F4OB 1FC3A 1HA8A 1HCRA 1YG2A 4OU0A 3VYUB 2QQ9A 3B73A 2ELHA 4XL9A 3GZ5A 4XLCA 5GPCA 3HOXJ 3DLLF 3E6CC 4FW7A 2O0YA 1IG7A 3N97A 1FJLA 1XS9A 3Q0VA 4M3BA 5BR8H 4XRSG 3RI4A 2DJNA 2CQQA 1WQ2A 3VSLA 1N77A 4LFBE 4DGWB 2OA4A 3UNGC 4IEJA 4WX9A 1N32H 2OPUA 3GZ6A 1P7IA 3LSRA 1OCOH 2X6YA 1OYIA 3ZMVA 3JRIA 4LCHA 1R1TA 2LP0A 4UVCA 1VIHA 5E17F 3GTGJ 3VKEA 4XLAA 4DR4I 2QCOA 4LIJA 2Z0SA 1ACIA 2Q0OA 4N9HA 3VEPA 5HLGA 1BW6A 4FCYA 5EGOA 3U1YA 2VUMJ 3BQZA 3ESWB 3ZZ0A 1KU2A 1WH5A 1I1GA 1TLHB 1FNNA 4IQJA 2Z5BA 1IRXA 1USVA 2OF7A 2B0LA 5M5XJ 2WB1A 3I0PA 3I0TA 4LMYA 4USKA 2W4SA 1RRJA 2XASA 4LF4H 2QQ8A 3HHHA 1ITYA 3E5XA 1IUFA 1CF7B 1VQ9I 5F0FA 3EDPA 3E6MA 4ESJA 2CRGA 4J19A 1K78A 3DKXA 1ZM2A 3OTOI 1R00A 2RDPA 4HV6A 1LEBA 1V54H 2C39B 1I50J 5LGTA 4FW6A 1W36C 2WAQN 1RNLA 4E7SA 2JA8J 3S32A 3GFJA 3RKYA 2XKPA 5EDNA 1J7KA 4MTDA 4LFCI 1D1BA 1VI7A 4XTJA 2UU9E 1J5EH 4USMA 4HAMA 2KZVA 3KZZA 3J80Z 2X6WA 4UB8C 3RDIA 2M7BA 5H2FC 3B8HA 4GKKI 2KJBA 3V69A 2LBFA 1Z6RA 4UUSA 1EI1A 5BR8E 5C4XJ 2UUAI 1MGTA 5GADJ 1IN4A 3KLNA 2O1WA 3PS2A 1H73A 2W24A 4MEXF 4U0WA 2JT2A 1WE8A 4CGZA 1ZREA 2ME6A 1BI0A 3ZQFA 2PJRA 4DV2E 2HZDA 3WU0A 4K0KE 3BG7A 3WTSC 3G6EI 4BNCA 3OIOA 4G12A 1ETVA 3OY9A 3RSNA 2XEXA 1S03G 4XLPF 2CW8A 1E0EA 1PUFA 4F92B 3HDDA 3LQQA 3LSMA 3D5SC 2R7OA 1RIOH 2YU3A 3TW7A 4XBFA 2NN6A 4FTHA 2MLGA 4JVYA 1WH7A 1X58A 1NHAA 1H88C 2LRDA 2AE8A 2NYXA 2Z99A 2FNAA 5D8LB 1FYKA 3QPHA 1XGMA 4U3DA 2ZNYA 5BR8I 3GABA 1EV7A 4FT8A 3W2VA 3DLAA 1U6GA 5TJJA 3VDXA 1ZR4A 1PP8F 1ENHA 5L3GA 3V5RA 2LY1A 3MZYA 4P52A 1V9NA 4MU0A 2AHQA 1N32I 5J8CA 1DU6A 1TBXA 4DV2I 2CG4A 1Z3YA 1QGPA 4BEHB 1J9IA 3LL7A 1OYPA 1R23A 3RJPA 5IYCJ 1N0UA 2IAIA 5FD5A 5K7HA 3L1PA 4IO9F 1L3LA 1C0WA 1VQ5I 3P3CA 5IOYA 4AU7A 1AU7A 3E3VA 5CVUA 3D5RC 3F8FA 5LGNA 3OYCA 2CH0A 3LTOA 3IC7A 3H9JA 5K36E 3OYJA 4DW6A 2E5LH 3GKUA 3J80W 2E1RA 4DV6H 3CTAA 5E3NA 2F4MB 3IUOA 4OIRF 1WHRA 1ZK8A 4G94A 4AIMA 2FJ1A 1Z67A 2MD5A 2DMUA 1D8KA 4UV9A 1XCBA 3WODF 4HX7A 3R0JA 2CVEA 2CQ7A 4WUCA 4Y33A 4LF4I 3FISA 2K3FA 5E3OA 2HXOA 2OTLI 3GF2A 2FMRA 3JRAA 4RGRA 5D5WB 1XMXA 5E1WA 3S3OA 4BBRJ 5LMNH 2VXDA 1AOYA 3MKWB 1ZTRA 2JRMA 4R1FA 4HSRA 2P81A 4IZJA 1UELB 1O3TA 1EC6A 4LLGF 3TW6A 1T8IA 3H92A 3HPHA 4BDYA 2HVSA 2COBA 4IHWA 2DGRA 2BV6A 1J5EI 3C18A 4ABZA 2AXTC 5J4YA 2R7UA 1IRFA 2GOMA 1J5KA 2M0CA 2XAJA 2OCCH 2LSOA 3C3WA 2F6CA 4EJVA 2JMWA 2NNNA 3MD2A 1CF7A 1ON1A 2KP6A 1BI3A 2VPRA 1WVRA 3BTLA 4AIHA 2QQBA 1K61A 5LMUE 4IFDD 2FNPA 1R5GA 4O5VA 4ON0A 2HOAA 3K4NA 1GVDA 3BR1A 3HRSA 4BE1A 5HODA 2ELJA 4WXDA 3HGGA 2C39A 2O7OA 4DV7H 2GXAA 2D45A 1E3HA 3DXJF 4YFNF 3KZYA 4JI5H 1MKMA 4WXHA 3TBIA 4P7AA 4KHPH 3KEYA 1LVAA 2QKMB 4GCVA 1JUMA 2E2IJ 5JEAD 1JI8A 1RR7A 2QZ8A 2NS7A 2VKDA 1QZYA 2EIKH 2EZLA 4CXFA 2LF0A 3SEQA 5HDNA 2W00A 2E5LE 1UFMA 1G6NA 1BOAA 4LLNA 2L7FP 4IHTA 2JEAI 4EJUA 4DV6E 2RREA 2VOPA 5CKTA 4HX4A 4CCKA 3C2BA 3DU6A 3I4NJ 3M6AA 4QNKA 3NQOA 2ISZA 2PLYA 2P7CB 4G6QA 2LNBA 1M1EB 2P0WA 5FLXZ 2XSDC 1USUA 3PYFA 2JVGA 2OC6A 1V4RA 5D4SA 2ZITA 3LSKA 3CP2A 3ECOA 1KZHA 1TWHJ 3ZM7A 5LGUA 1L0OC 2JEBI 3BWGA 2GQ0A 4A3FJ 5D5UB 4IZKB 4BHPA 4RB1A 3LPSA 2JWTA 4AC0A 4F91B 1P9QC 2LFBA 3HEFA 4BQNA 1QBJA 3DCFA 2IT0A 1I94E 2E5LI 2ZO4A 4PDKA 4HYEA 3K9TA 4DV6I 2ECCA 2KJCA 2VQCA 4RMNA 4FWGA 3CD6I 1XMQH 3NEUA 1Z0BA 1XSXA 1D6TA 3OIQA 1B63A 2CW0F 4DUYH 4EMSA 3O6BB 5DT9A 2QKLB 5ILUA 4AIJA 2A5YB 4FJUA 4BEHA 3WG9A 3J7YJ 5BPIA 3R61A 1IRGA 1SD7A 3S17J 5DCFA 3ZQHA 5C0XB 4CSWA 2BY1A 3KP3A 5A2QC 3F3XA 4WXCA 1ZLKA 3PS1A 2OQRA 2JUCA 2L01A 3IAM2 4L18B 4LF9H 4BH9A 4DV7E 3F8BA 2OCEA 5LMNI 2V8PA 1ZZIA 4JI5E 2DMNA 2F4VH 3G1MA 1GV2A 1HKQA 4KHPE 3QPSA 2H94A 4U3BA 5DV5A 4C30A 1H7UA 3ZQQA 4MQYA 1HNXH 3F9KA 4OMYA 2R4GA 2XIGA 2DBBA 3MWMA 4CCLA 4QIWN 1D5VA 4DQ2A 1ZZKA 4PGGA 4WALA 2XVCA 4M72A 3RYRA 3L2VA 3IAS2 3Q9SA 3Q0WA 1KONA 3I64A 4I76A 1TC3C 1B9MA 4JV5E 2QBYB 2UXBE 3QD7X 4X64H 1ONVA 2KQRA 2P7VB 3BROA 1NTCA 2ZJ2A 1LDDA 1OKRA 1DGRM 4MYUA 4DV7I 2PO2B 1S7AA 3CWVA 3EYIA 3FXLA 5DUIA 2E1MC 5LEKA 4JI5I 4U0VA 4ZYDA 1WRJA 4KHPI 2HDDA 5ICGA 1XTAA 1YS6A 2IXSA 2N8GA 2GA2A 3K10A 1IN5A 1H89C 5M3MJ 2CTKA 1NH3A 1AN7A 3OV8A 5FKKA 1ZGJA 4BU2A 2V9VA 4LGWA 1JE8A 2GM4A 2HKEA 5B5EC 4YY3E 2DA5A 2KRFA 3H36A 2AQFA 2HHHH 2DPUA 3UOEA 1RPWA 2EV0A 1IBLH 2ZKZA 3A2KA 5L3EA 4DV1H 2K9LA 2K7LA 2MC4A 1B9NA 2CTFA 4UUTA 3LSJA 4ED4A 2UXBI 2MYSA 1XHKA 1KQ8A 1J4WA 3TMOA 1FWKA 1Z3XA 2ETHA 1Z6TA 1OYSA 3L9FA 5TRDA 1BKNA 5ILVA 4LFAE 5DRQA 4C9YA 3K4KA 1T95A 1USTA 2UUZA 5IY5H 3JSOA 3PUBA 4I7HA 1VBIA 5B66C 5LFAA 3QRFF 2RQQA 1H8AC 4FW3A 1VTNC 2OD5A 2UUCH 4XKWA 4EGYA 1TQMA 4C3JJ 1U8BA 3CMEI 2K9SA 3B6AA 1OCCH 4AQYH 3KZIC 5DS9A 4Z2YA 4MU4A 1FP2A 1W5CC 3RKQA 4B3SH 4BGDA 3HOUJ 1HF0A 4IX7A 1R1VA 2D1VA 4L9VA 1XMQI 1MBKA 4DUYI 3U1DA 2K4JA 3OL4A 2E2JJ 2FOKA 4DV0E 2NAZA 2Y75A 2R5ZA 1QA6A 1ZRCA 2FF4A 3CQZJ 2BY2A 2MBFA 4M9XA 4DYQA 5LD2C 3HPGA 4CHUA 1I1SA 4LFAI 2PO1B 2PI0A 2QLZA 4IZKA 3WHBA 5FFZA 4A3BJ 4XN3A 4WWCA 4LF9I 3H9GA 3JAMZ 1TZLA 3MMYB 4MLOA 1UDNA 3A4CA 1N78A 3PSIA 3A03A 2PNMA 2QWWA 4MU1A 2F4VI 1MBJA 2F5EA 3AG4H 2V34A 3K85A 5IT9C 3BDDA 3E6BA 2MSYA 3T1YE 4A0YA 3J81Z 3DPTA 4CDGA 4OIQF 1WJ5A 1HNXI 1YH8A 2DFEA 4NNJA 4HEA2 4DBQA 1LPQA 2UUBE 5E20A 4M6YA 2FMYA 1DP7P 2HHHE 4WF2A 3HULA 5C0XA 1IBLE 4DV1E 1W7PD 2Y0MA 4LOCA 2FQ3A 1H7SA 4IXAA 4FN5A 3DBLB 3AEVB 4X64I 1KU9A 2CFXA 5K36G 4KNYA 2DO7A 1P4XA 4BACA 1OMIA 2XPVA 1Z2IA 5J6XA 3DD6A 5GP9A 3C2GA 4H0EA 1BIAA 2EB7A 4X65E 3OYLA 4O6JA 3I4PA 2OAZA 2BVMA 4D7MA 4L5EA 1VF9A 4K2EA 4ISAA 3ZMTA 3GW2A 1LB2A 2M4KA 2XROA 2L7MP 3ELKA 2WC2A 1Z0TA 2EJRA 2HTSA 1WJCA 4M73A 2HHHI 5E1XA 1IBLI 3OOUA 4DV1I 1I3AA 2QBYA 4A0ZA 1QHGA 5F0HA 3HOWJ 1Z7UA 3T1BA 5DM6F 2DPDA 4C2UA 4DBRA 2MH2A 1GV5A 1Z5AA 3COAC 2WAQA 2X1DA 1J0RA 2ZMEB 3O8GA 1RHYA 2PO2A 1B59A 4OOIA 4JI8H 1SAXA 2M45A 4NB5A 3ZQ7A 5BPDA 2PG4A 2CUEA 3KP4A 1WJBA 1UDSA 4EC5A 4XLNF 4X65I 3LA3A 2ZB9A 3D1NI 1IBKH 1UHMA 1MX0A 1RREA 4YIRX 3OSFA 2UUCI 4QSHA 3FXUA 3ABLH 3VOEA 2WWYA 4EM2A 1HW2A 2BM0A 2LRRA 1DUXC 3J81W 4A69C 3KP7A 2O1TA 1OISA 2Y2ZA 3F6OA 4B44A 4FW4A 3WU5A 1UG8A 2Z5CB 1I27A 4YIFA 5K36F 2A69F 3GYHX 1S29A 3BP8A 2WW4A 3QYEA 5AIQA 2H6CA 3G4SI 4IOAF 1GLNA 1V55H 2A5WA 3GO5A 5IP9J 1G3YA 2EPFA 4Y3OA 5J4VA 1IW7F 3ABUA 3IP4B 4I02A 5BS6A 2HS5A 2JA7J 1U2RA 1MH3A 1WJEA 5K5OA 2CFOA 2FOWA 1Z0GA 3DKWA 1BC8C 3L2UA 2D2WA 2MFZA 1K6YA 1LJ9A 3K4LA 2V1NA 4N0BA 1U8RA 1EH7A 4ZYHA 4PJMA 2AQEA 3G1LA 2IEKA 4QTRA 1SFKA 1FWZA 4XKBA 2EV5A 3FM5A 2WV0A 1LVKA 2UZKA 1EKEA 2VE8A 3MQ0A 5ILSA 3V8JA 2EBIA 1Y8QB 1Z0WA 4BHCA 2V9KA 4J01A 4DR2E 5EEGA 2BY0A 1SANA 5JR3A 1HDPA 2QVOA 2K1HA 2L9RA 1ZZJA 3B02A 4OKGA 5DRRA 2Z2SB 4LF6H 2PO1A 1KGSA 3CC4I 2L02A 4B3RH 5DNXA 1YW9A 2K9QA 2RNJA 5ERIA 1F9NA 3H35A 3BG6A 2XRLA 4R8HA 1YX3A 3Q6NA 4UVAA 4JI8E 1W7PB 2A6HF 4GKJH 1F36A 1SD5A 1UHWA 4NQWB 4KFCA 1EA3A 3BTIA 1A35A 5FLXQ 4DPWA 4NHJA 5C0XF 2GBYA 2DCEA 4B47A 1WI3A 1HLVA 1XX5A 3WTYC 1YW8A 1T56A 1P4WA 2LKXA 2O3FA 2JZXA 3S14J 1FJGH 2A6EF 4Y4RA 4DR2I 3BR6A 4B8CD 1K4SA 2UWMA 1D8JA 3VPRA 2KFDA 3EUHC 4D1QA 1JKPC 5CLSA 4JYAH 4P96A 2XAGA 1YYVA 1HDDC 3B78A 3KP6A 3GVAA 3HSEA 2VXZA 5KAFC 2OQGA 2PMHA 5KNLA 4UTGA 2XSJC 2O6GE 6PAXA 2EQRA 2BOLA 3PYEA 3GTQJ 3LNUA 4DU7A 3F8CA 4JI8I 4LITA 1A04A 4IZZA 1GXQA 1X3WB 2E60A 2CJJA 5FLXK 2PQ8A 2OBPA 3DWLE 3OYBA 3KX2A 4XK4A 1IBKI 3OETA 1MBFA 2CQKA 2V2ZA 1JKRC 4H8AA 1EH6A 3A0BC 5ED4A 1MMSA 1U9NA 3TEDA 2VB6A 1KU7A 2K40A 4M1KA 3CCQI 5ELWA 2DOAA 3MEXA 4OO1C 3WE3A 5DM7F 4X0GA 2KT0A 3CLQA 4KQVA 3J7AG 1MJBA 1R1UA 5CPRB 4YFKF 3Q1QA 3I4MJ 3H3ZA 4IPAA 2ZMEA 1FT9A 2VQLA 3CC2I 3MCZA 2EZIA 1IZ1A 5J8FA 1S3JA 2QYOA 4EM1A 3HIFA 1MNEA 4PSXA 5F6FA 4XRSA 4LFBH 1MNDA 2OUMA 3G73A 4ZDOA 3AG1H 2O1UA 1T0FA 5H6QA 1W1WE 3NCVA 3ONQA 3ZCOA 4GYGA 2BA0D 2EIJH 2JT1A 3QPTA 2YR2A 2K5CA 4AVZA 4XIDA 2QEXI 3FXJA 4EJOA 4HF0A 2Z5CA 2VT3A 1ETYA 4CUGA 4HSTA 1U5TC 4G7ZF 1Y4SA 3F8NA 4B3ME 3BJ6A 1S6LA 4XOTA 4OO1G 1F5TA 3K1PA 1F1ZA 1Y1VJ 1BA5A 4HNUA 3LMMA 1YHQI 4M3GA 2OTJI 2E34A 2EINH 2LC2A 1VQ7I 4LF6I 2X7IA 3ZMUA 1EH8A 2QA4I 4A5MA 1QZRA 2E7WA 2DT7B 4B3RI 1IV6A 1ORKA 4ZDLA 1IXCA 2E2HJ 4ZVIA 3GZNB 2HH2A 4HG2A 2P8TA 3GTJJ 3ZKBA 2HPIA 4GKJI 2JA9A 2DQLA 1XDUA 1ODDA 4KIFA 4L0YB 4MU3A 4HBLA 4LIVA 3TO6A 2PEXA 1XNQH 1BL0A 3HL2A 1N34E 2VBWA 1IRZA 4RBOA 3M7GA 1UJ8A 3FF5A 1BI1A 1U9OA 1WKMA 1ZYRF 2UU9H 3LA2A 3J7AO 2XAHA 3F23A 5KAIC 1FJGI 3SZTA 1O3QA 2HDWA 4CYDA 4XM3A 5K1YA 3DEWA 4ENNA 3TL4X 4YRVA 4XICA 4YELA 1FKAE 4JYAI 2X0LA 2XHKA 1TNSA 4EV0A 3I71A 2X9DA 1W7PA 3MFKA 1WWXA 4QLCU 2M30A 2KLOA 2F2EA 4NQWA 1XSDA 2QSGX 4A3MJ 3OYEA 5E1ZB 4DV2H 2Y9ZA 1IXRC 3IL2A 1FYMA 4K0KH 5K7FA 3M9AA 2M87A 4DXLA 4PSWA 2NNYA 5HNFA 3HG9A 3FHNA 3NWSA 1O7FA 1SVOA 1OCTC 5K7ZA 2ZJPF 5FRNA 4P55A 4B1RA 2V7FA 1MBEA 2HR3A 2IS6A 2GQQA 3B6CA 4V2GA 3LAJA 2AJ4A 3MKYB 2E71A 5CJ9A 1VQ8I 4GDFA 1ERDA 3A1YA 3E1SA 1PYVA 1IJWC 2R7XA 5HS8A 1OFCX 2EFPA 3NZKA 4II3A 4UHTA 3JAMQ 3FDYA 3M7ND 3IH2A 1R5ID 4AYBA 2E5NA 5A2QW 3VYSB 1BJAA 2Q2EB 3WGGA 2DN0A 2LYCA 3MZ8A 4EJTA 2F5FA 4FE7A 1EF4A 4LFBI 3QWLA 2GOXB 1HW5A 2C38B 4UVBA 1FOWA 4EATA 3K4BA 3E5UA 3I9V2 3S1RJ 1X4PA 1VQ4I 2IJLA 4JI7E 1RR9A 1K79A 2IS2A 2ACJA 5CVVA 1XNQE 3BZ6A 4KA4A 1A6IA 1JHFA 2HFHA 2FBIA 2CQXA 4FWHA 4RS8A 2X51A 2CUZA 3JAMK 2R7TA 4QMFB 4JI2E 2VT2A 4RB3C 3S2WA 1MSEC 2E5ZA 2GZWA 4F3QA 3OYKA 1ZRFA 2R93J 5EL9A 1TUAA 1NHJA 2ID3A 2F48A 3RQIA 3J81K 2X36A 4IS9A 1J5YA 4HLYA 4A6EA 1WVNA 5C4JJ 3AG3H 4LF8E 3EUKL 2ZXIA 3G71I 4DPUA 1Z0CA 2HDCA 4EJWA 2LLKA 2IS4A 5K36D 4FW9A 2HVQA 3I59B 2V6EA 2GXBA 2XGCA 4IRHA 3LWFA 4A3IJ 3HM5A 3R60A 3GLXA 5LRRA 2E19A 1Z0VA 1XNQI 4HNTA 2L7KA 2W25A 3FKIJ 5IT9Z 4PCQA 1JT0A 1DDNA 2JA5J 1NG6A 4PDBA 1Z0EA 3ZN1A 2DDAA 3QYBA 2UU9I 1I39A 1SEIA 4L5JA 4KITB 4MHGA 1BC7C 2K27A 1K1GA 2B63J 2KKOA 1YRNB 2PNZB 1IDZA 3JSPA 1MU5A 5LMUH 2JSPA 2M8WA 4PU9A 2NVXJ 1T98A 1QPMA 1J59A 4I0BA 3ZQCA 2A07F 4FHTA 4ENKA 4A93J 3OYDA 2VQEE 1VI0A 1TW3A 1UEKA 4K0KI 2CV2A 3W3CA 1DPRA 3F22A 3FXKA 1GHCA 4NXME 2VKCA 2LMDA 4BBSJ 3MAJA 1Y4UA 1MNMC 5EJCA 5H20A 4N9IA 3BR0A 1JUSA 3HSFA 4IRGA 4J00A 1KU3A 1MMNA 2ZXWH 4V19K 4FISA 1XMAA 2MGQA 2AO9A 2GXGA 3JW4A 1B4AA 2E1MB 4G9YA 3HOYJ 1A6FA 3BJOA 1KTVA 3G2BA 1OYYA 5HVQC 3SDGA 2Q8KA 2GO3A 1T39A 2VODA 4I0AA 3U1KA 4LCFA 5C0XD 4ZTFA 3GBGA 3ROUA 2L0KA 1FWLA 4KYWA 4QWQA 2RC4A 3WTZA 4IHXA 1AWCA 2J65A 4XNFA 2IVMA 4DR6H 1YO5C 3FBNB 2D5VA 2EA4A 3JCUC 3VWBA 2CQNA 1VQ6I 2X1CA 5IT9W 4XLHA 3P9KA 4S05A 1FMWA 4B8TA 2NN6C 2HGCA 5E79C 2VN2A 2IGKA 5FRMA 4XOPA 4XRFA 1I94H 2MH9A 4A3CJ 4BQAA 1U0JA 1K83J 2IGMA 2ZBKB 3REOA 5B3SH 2O03A 2Q2EA 2R3VA 3GWZA 2DXIA 4WANA 3PIPF 1SMTA 1R58A 2EFWA 1FBSA 4XLFA 4DUZH 1ZG5A 2DFFA 1FTTA 2QQAA 3UKGA 2C38A 4DV3E 2M1BA 3PRYA 3ZZTA 4G8XA 4RAYA 2ESHA 4IQ4A 3V8KA 1YIOA 3GLLA 4W97A 1ZGWA 1YJWI 3KEQA 1SMYF 4PFPA 3QYFA 5L3BA 2ZSHB 1T38A 5DRPA 2KHMA 2BA0A 2ELKA 2IP2A 3H9QA 4JI0H 1HW1A 3FIWA 4BUPA 5K36B 4UT4A 2ANNA 4LK0F 4HPQA 3RKXA 2LR8A 4E7ZA 1JTYA 5LEJA 1NHIA 3M8EA 4JP0A 2FQ4A 1S20A 2UV1A 2WADA 2CTEA 3DV8A 1PKPA 3HTUA 3HB9A 1H0MA 1G3TA 4HX8A 2LD5A 1A36A 1MDMB 5DTDA 1D5YA 1IDYA 2A05A 5LBQA 3KPHA 2DFHA 3M1CA 3CMMA 5LMUI 4DR1E 3K4MA 2PMUA 4B3TE 2YX7A 4JV5H 3I59A 2DOFA 4DNCA 3FX3A 4Q5SF 2UXBH 4HQMA 4A3GJ 4MYTA 2R7QA 3H0GJ 4C2MJ 3GFMA 3J7AY 4EGZA 3M07A 3F21A 4Z7YA 4LB5A 3K4CA 2WP8B 4DR6E 2CGPA 1AHDP 3GUDA 3ZZUA 5IOZA 4KDPA 3I55I 4KT6A 5EEHA 3EZJA 2NVUB 2QSHX 2G8YA 3IRRA 1HK7A 3Q3SA 1YRNA 3CCVI 1HKSA 1SFUA 2WAEA 4I98B 2PNZA 3BY6A 2PQUA 4YY3H 1X1PA 2BXYA 3CCMI 2JEAB 2DQRA 3OYMA 4F55A 4KMUX 3C1DA 4RB0A 4DUZE 2DJIA 2H1LA 5IYDJ 1T08B 2RQPA 3M8JA 4Q47A 1WJFA 4D5FA 3HOVJ 4LFAH 5GAGJ 1LEAA 4IFDE 4L0ZB 4DR6I 1O3SA 4BJ6C 1OCZH 5K5RA 2M3AA 2DTRA 1BOBA 1S7OA 1TP4A 2KDOA 3H5AA 2J5PA 1OYRA 3HTSB 2JEBB 3ZQLA 2XGXA 2YS9A 4PK4A 1ETXA 1LKXA 4IRIA 4JI0E 1I94I 3CMYA 4BDZA 4Y52J 5JEAE 2K86A 5KVRA 2BHYA 2K9MA 4BJTA 4YIIA 4DZPA 4M9SA 4RAZA 3HRUA 3HRMA 5DD8A 4IKFA 2OU2A 3CJNA 4X6AJ 4DUZI 1QZZA 4X1EA 3PFIA 3MN2A 4DV0H 1I6UA 2XF6A 4JOMA 1HNZE 4I6ZA 5C44J 1IAWA 5KHDA 3M85G 2LF8A 1H72C 5JVTA 2P5VA 4JX6A 2XPUA 5AIPA 1LDJA 3H3VK 2G0EA 4L9TA 5IWAH 1WHUA 2G7HA 3HOSA 2V1DA 4AYBN 1N36E 4PJLA 1ZKGA 3CLOA 4XLEA 3WU2C 2V2QA 1ETQA 4JI0I 2ZBKA 4OZEA 2H8RA 3DPUA 2GAUA 3GTPJ 3PQKA 3ZRGA 5EKWA 4YHHE 3T1YH 1IGNA 2DFIA 1GDTA 2HTJA 4XKVA 3HKMA 4RB2C 3K70C 5TGTA 4NC8A 1O4XA 2UUBH 3PNYA 4PGHA 1UAAA 1XNRE 3QPLA 2WV1A 3DFGA 5DD4A 3DKYA 2O3ZA 4RA2A 2WNRB 3V7SA 4TV7A 4A3EJ 4KISA 1WI9A 2E36A 2HYJA 4JV5I 3K4JA 4ZZDA 4OO1E 1BBYA 2F4IA 5BNGA 2L9NA 2JSCA 1RKTA 1U3EM 2NPFA 5LHIA 2YPRA 4WCGA 2B7EA 1R6RA 2HXIA 4OWRB 3DEEA 2RN7A 4P5OA 4BXUA 2STWA
chains in the Genus database with same CATH topology
2BA1G 2PO1B 2HH2A 3L7ZA 5K36E 1UDNA 3L7ZC 2JA9A 2JVZA 2OPUA 1ZZJA 2E3UA 2PNZB 2PO1A 5C0XB 2WP8B 2CPQA 2CTLA 2NN6G 1VIHA 3KRNA 4AIMA 3VKEA 2JE6I 1UDOA 4IFDB 4LIJA 2Z0SA 1ZZIA 2PNZA 4AIDA 5C0XA 2WP8A 2PQUA 1DT4A 2MJHA 5C0XC 1VIGA 5C0XF 1X4NA 2BL5A 2FMRA 2JEAB 3AEVB 1E3PA 4IFDA 5K36G 2JZXA 4BA2I 5C0XE 4IFDC 1ZZKA 5JEAB 4IFDF 4WALA 1DTJA 3DD6A 3GMEA 2AXYA 1EC6A 2JEAA 4IFDE 2DGRA 3U1KA 3H1CA 5C0XD 1KHMA 5JEAA 1J5KA 1OYRA 3GCMA 2JEBB 2JE6B 2C39B 2PO2B 2HH3A 5JEAC 5JEAF 4OO1B 4IFDD 1X4MA 5JEAE 3M7ND 4BA1I 2PY9A 5C0XG 3M85D 2CTKA 2JEBA 2JE6A 2C39A 2PO2A 4NBQA 4B8TA 2NN6C 1E3HA 4OO1A 4BA2B 2NN6F 3H36A 3V69A 1R6MA 4IFDG 4OO1C 1UDSA 2PO0B 4OO1F 2BA1D 2C38B 3M7NG 5JEAD 2CTFA 3M85G 4AM3A 1WE8A 1WHUA 2QNDA 1J4WA 4WANA 4JVHA 2C37B 4BA2A 1OYSA 2NN6B 2ANRA 2PO0A 2JEAI 2C38A 3CDIA 4QMFB 5K36C 5JEAG 5K36F 2NN6D 2P2RA 1TUAA 3GLLA 2BA0D 4OO1D 3B4TA 2C37A 4BA1B 1R6LA 3HKMA 2NN6A 4JVYA 2BR2B 2BA0A 1WVNA 5K36B 2ANNA 2WNRB 1ZTGA 2BA0G 2JEBI 2YQRA 4OO1G 2NN6E 4BA1A 2OPVA 5K36D 1UDQA 4OO1E 3L7ZB 2CTEA 2BR2A 1K1GA 3CDJA 2CTMA 5K36A 1OYPA 2CTJA 2WNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA1 G;  2PO1 B;  2HH2 A;  3L7Z A;  5K36 E;  1UDN A;  3L7Z C;  2JA9 A;  2JVZ A;  2OPU A;  1ZZJ A;  2E3U A;  2PNZ B;  2PO1 A;  5C0X B;  2WP8 B;  2CPQ A;  2CTL A;  2NN6 G;  1VIH A;  3KRN A;  4AIM A;  3VKE A;  2JE6 I;  1UDO A;  4IFD B;  4LIJ A;  2Z0S A;  1ZZI A;  2PNZ A;  4AID A;  5C0X A;  2WP8 A;  2PQU A;  1DT4 A;  2MJH A;  5C0X C;  1VIG A;  5C0X F;  1X4N A;  2BL5 A;  2FMR A;  2JEA B;  3AEV B;  1E3P A;  4IFD A;  5K36 G;  2JZX A;  4BA2 I;  5C0X E;  4IFD C;  1ZZK A;  5JEA B;  4IFD F;  4WAL A;  1DTJ A;  3DD6 A;  3GME A;  2AXY A;  1EC6 A;  2JEA A;  4IFD E;  2DGR A;  3U1K A;  3H1C A;  5C0X D;  1KHM A;  5JEA A;  1J5K A;  1OYR A;  3GCM A;  2JEB B;  2JE6 B;  2C39 B;  2PO2 B;  2HH3 A;  5JEA C;  5JEA F;  4OO1 B;  4IFD D;  1X4M A;  5JEA E;  3M7N D;  4BA1 I;  2PY9 A;  5C0X G;  3M85 D;  2CTK A;  2JEB A;  2JE6 A;  2C39 A;  2PO2 A;  4NBQ A;  4B8T A;  2NN6 C;  1E3H A;  4OO1 A;  4BA2 B;  2NN6 F;  3H36 A;  3V69 A;  1R6M A;  4IFD G;  4OO1 C;  1UDS A;  2PO0 B;  4OO1 F;  2BA1 D;  2C38 B;  3M7N G;  5JEA D;  2CTF A;  3M85 G;  4AM3 A;  1WE8 A;  1WHU A;  2QND A;  1J4W A;  4WAN A;  4JVH A;  2C37 B;  4BA2 A;  1OYS A;  2NN6 B;  2ANR A;  2PO0 A;  2JEA I;  2C38 A;  3CDI A;  4QMF B;  5K36 C;  5JEA G;  5K36 F;  2NN6 D;  2P2R A;  1TUA A;  3GLL A;  2BA0 D;  4OO1 D;  3B4T A;  2C37 A;  4BA1 B;  1R6L A;  3HKM A;  2NN6 A;  4JVY A;  2BR2 B;  2BA0 A;  1WVN A;  5K36 B;  2ANN A;  2WNR B;  1ZTG A;  2BA0 G;  2JEB I;  2YQR A;  4OO1 G;  2NN6 E;  4BA1 A;  2OPV A;  5K36 D;  1UDQ A;  4OO1 E;  3L7Z B;  2CTE A;  2BR2 A;  1K1G A;  3CDJ A;  2CTM A;  5K36 A;  1OYP A;  2CTJ A;  2WNR A; 
#chains in the Genus database with same CATH topology
 1FOK A;  2BA1 G;  5FB2 A;  1ZH5 A;  4NXN E;  4X65 H;  4CCO A;  1RUN A;  2DA6 A;  2V9P A;  5HLT A;  3A01 B;  4CO8 A;  4DR5 E;  3QU6 A;  3L7Z C;  3EUA A;  1VFC A;  3JRH A;  2FEZ A;  1MDM A;  3GFI A;  2JA6 J;  2OZU A;  1AKH B;  2FPH X;  4YY3 I;  3BR3 A;  2CPQ A;  3Q6M A;  4PFO A;  4M3F A;  3KRN A;  3QOE A;  3P7N A;  4KMF A;  2L9S A;  2F5C A;  5HLH A;  4FWD A;  3EQL F;  3MKL A;  3L7W A;  2R7Z J;  1ULY A;  4JI1 E;  1ZGA A;  1F0X A;  2XB5 A;  1G3W A;  1ZR2 A;  2WP8 A;  4OX9 H;  2PN6 A;  3BZC A;  2V2V A;  1VQO I;  2NVQ J;  1T6S A;  1X4N A;  3SB1 A;  3J80 Q;  2OZ6 A;  4DR3 E;  3E97 A;  5IWA E;  1E3P A;  1TWF J;  1WCM J;  4LK1 F;  4YFX F;  3T1H E;  2XAF A;  4F52 A;  4F93 B;  2M34 A;  4DR5 I;  4V2F A;  4HY1 A;  4A0X A;  3CMA I;  3K1J A;  1X9Z A;  2X85 A;  2RAE A;  3L2W A;  2JEA A;  3WU6 A;  3OYA A;  1STZ A;  4LF5 E;  1KQ9 A;  2AXL A;  4P9U A;  3K0L A;  3H1C A;  4JG4 A;  1W0T A;  1GVJ A;  3QT7 A;  1XB4 A;  4EM0 B;  1X2N A;  1JKO C;  3S1Q J;  3M3Y J;  4E9J A;  4G7H F;  3UR3 C;  1HSJ A;  4OO1 B;  1R49 A;  4JI1 I;  4DV0 I;  3CUQ C;  4QPQ A;  3J80 K;  1MIJ A;  3ZPL A;  2MG4 A;  4HF2 A;  4BAY A;  1QZE A;  1XMO E;  3ERM A;  2DU9 A;  2VC0 A;  3L2C A;  1PVG A;  3ECH A;  3H4L A;  3KDK A;  4DZJ A;  2XV4 S;  5D4R A;  2JEB A;  3QAH A;  5IWA I;  5EF6 A;  4DR3 I;  3T1H I;  3PSF A;  5IP7 J;  2EIL H;  2ZJQ F;  1NHH A;  3BTC A;  3NAU A;  3VYT B;  1PIE A;  1XN7 A;  1FNM A;  4X66 E;  3PL8 A;  5JI6 A;  3Q5F A;  1REP C;  3RPU D;  2O8X A;  3IKV A;  2PO0 B;  3E0J B;  1HBX G;  4UY8 I;  3BLY A;  1W36 D;  2DAO A;  3ZP5 A;  2QUF A;  4FX0 A;  3T1Y I;  2KIQ A;  1YX5 A;  1TWG J;  1SD6 A;  2C37 B;  4DR2 H;  2KRH A;  4CH7 A;  5E18 F;  2FE3 A;  2UUB I;  2GIZ A;  4ZYE A;  5F27 A;  5D5X B;  1WTJ A;  4EEF G;  4MQV A;  1FSE A;  2HWV A;  1U78 A;  2V79 A;  4M6V A;  3CJQ B;  1LQ1 A;  1FPQ A;  1X3U A;  3BTJ A;  5FKM A;  2C6Y A;  2XUB A;  4LJZ F;  2ECB A;  3HUG B;  4BL0 B;  4HQE A;  5EZH A;  5F04 A;  4OX9 E;  3PFY A;  2V26 A;  3GTM J;  1LDK B;  2VJ5 A;  4JI6 E;  2EFO A;  1X19 A;  2M2E A;  2M8E A;  3DF8 A;  3TP0 A;  3P3G A;  1QVU A;  3GTL J;  2V6C A;  2GO4 A;  1V8C A;  1TL8 A;  3OYG A;  4PJN A;  3TDU C;  5E3L A;  3TKY A;  1G59 A;  3SZP A;  4MIM A;  3G3Z A;  2WNR A;  1R7J A;  3ABK H;  1KYZ A;  3OOP A;  4NC7 A;  3W2W A;  3F6V A;  1TT5 B;  1HC8 A;  1PQX A;  2CV1 A;  3V42 A;  4BY1 J;  3CCJ I;  4XKC A;  3ABT A;  1G2H A;  2NRA C;  1DP3 A;  4PJ0 C;  1FIA A;  3LFK A;  2H09 A;  4G6D A;  2FBH A;  4CCN A;  1UCR A;  1QPI A;  4PRX A;  2W84 A;  3ZN0 A;  3KYL A;  2HOS A;  3Q0U A;  4OX9 I;  1VND A;  1B6A A;  2X1E A;  3IWF A;  2DA2 A;  4AD9 A;  5J1R A;  3CZ6 A;  2HKX A;  5F1R A;  1GXP A;  3A01 A;  3H3U A;  4F7Z A;  1CQT A;  1BR4 A;  4BXF A;  1IBM E;  4HA8 A;  1J75 A;  3QT8 A;  1AKH A;  3CCU I;  1ETO A;  2CW7 A;  3AFH A;  5FFX A;  1JTX A;  2IGO A;  2LY9 A;  3CUO A;  2HI3 A;  3DBH B;  3GXO A;  2M8G X;  4KT5 C;  4U87 A;  1X0A A;  3MVP A;  4EMD A;  3TQN A;  5F08 A;  3LSP A;  2O8K A;  1ZM4 A;  3T8T A;  4JI4 E;  2W1O A;  2W85 A;  4DJA A;  3WGH A;  4G7O F;  3S3N A;  1JJ8 C;  1ZRD A;  2PT7 G;  3PQJ A;  4UNO A;  3FM3 A;  1QU3 A;  3PNT A;  4BA2 I;  3GR5 A;  2ZFU A;  4IFD C;  3K1N A;  3EUH A;  1YIT I;  3BCA A;  3ZMS A;  2HZT A;  4IZJ D;  5DNL A;  1D0Z A;  3LOC A;  1KYW A;  2VON A;  4XSZ F;  1NXU A;  2ZNZ A;  1S9H A;  4LCG A;  2VBY A;  1NK2 P;  3WG7 H;  2F1D A;  1BR2 A;  3G1O A;  2HH3 A;  5JEA C;  3R6S A;  4Y17 A;  2QF7 A;  3WU4 A;  5ICF A;  3GX4 X;  3L2R A;  3FK6 A;  2BY3 A;  2EA2 A;  5LLQ A;  2O61 A;  4B3M H;  2PY9 A;  2HYF A;  2CG9 A;  3HGY A;  1WPK A;  3S16 J;  4RAF A;  2G9W A;  1MG7 A;  2YX4 A;  1YLF A;  4BA2 B;  1JXS A;  3IH4 A;  4OO1 A;  2X48 A;  3DTE A;  4IFD G;  3TO9 A;  1N0V C;  2WBM A;  4BE2 A;  3ZKD A;  3RYP A;  5JLW A;  5DEQ A;  2CWE A;  4AM3 A;  5FLX C;  4FAS D;  4X62 E;  3IRQ A;  1S7E A;  1USS A;  5CYV A;  5HNH A;  1J09 A;  4WK8 F;  2DYS H;  3BPV A;  1EA6 A;  3EYY A;  2PO0 A;  2IA1 A;  2XGD A;  1YW7 A;  1TWC J;  3CDI A;  4YEJ A;  1Y8R B;  1RET A;  5E8G A;  4M71 A;  2H1K A;  2EFN A;  4OIP F;  1KKH A;  4LF7 E;  5JEA G;  1OCP A;  1N34 H;  2P2R A;  1MSF C;  3BQY A;  3OR2 C;  2C37 A;  2M6Q A;  1V3F A;  1CGP A;  2CGE A;  1ZXN A;  4Z6Y A;  3CCR I;  2VC1 A;  4M3D A;  3K2A A;  5CVR A;  3OSG A;  2H27 A;  3MKZ A;  2UXD E;  4Y7N J;  1FKA H;  3Q9V A;  2CO5 A;  4B48 A;  2NN6 E;  5GAH J;  3RF2 A;  2JTV A;  1SC7 A;  3NWT A;  4LG3 A;  1A5J A;  1X3Z B;  2Y0S N;  1XXE A;  3HUG A;  5K36 A;  3SFZ A;  1RR8 C;  3SJM A;  2BW3 B;  4KIB A;  2MC3 A;  4LFU A;  2LKP A;  3OIP A;  3J7A M;  4HOB A;  1Z77 A;  3VYR B;  2HK3 A;  4U7D A;  1FIP A;  3GEZ A;  2ZCW A;  5HLI A;  5FGM A;  4JBA A;  4DV4 E;  2L4A A;  1XC5 A;  1VZ0 A;  2WA0 A;  1JHH A;  5DYM A;  3OR1 C;  1MJ9 A;  3CO6 C;  2HU9 A;  1FOX A;  1N33 E;  4KIG A;  2QM3 A;  3OSS D;  4OIO F;  5JFR A;  3CF2 A;  2Z9O A;  2KIF A;  5F1J A;  2O9L A;  2QGU A;  1SVL A;  2HYG D;  3ISP A;  2BGC A;  2UXC E;  1K47 A;  1FBQ A;  1IF1 A;  4MDT A;  4I09 A;  3R4K A;  2EFG A;  4BXX J;  3F0N A;  2IBD A;  2LK2 A;  2A2D A;  3SXY A;  3FWE A;  1FEX A;  1DAR A;  2MJH A;  1VIG A;  2NXN B;  4ZH4 F;  4U0Y A;  5A2Q Z;  4RGX A;  3BG5 A;  2DMQ A;  2LKS A;  2IPQ X;  2R7F A;  2DEJ A;  1FLI A;  1RKW A;  4JX5 A;  4JI7 H;  4DR7 E;  1PVE A;  3AAF A;  2HQA A;  4IZJ B;  1VQN I;  3ASN H;  1O3R A;  4DV4 I;  4IVN A;  1B8I B;  3M8F A;  4PUS A;  2R42 A;  1UMQ A;  2CU7 A;  1FYL A;  2Y30 A;  2FD5 A;  2VLA A;  1ZQ3 P;  4JI2 H;  3LA7 A;  2H8W A;  1HOM A;  4B3M I;  3AL0 C;  3TOA A;  4IL6 C;  3I54 A;  2ZME C;  4A3L J;  2LTL A;  2PBI A;  4U7B A;  3ZOB A;  3BZK A;  5L3C A;  1VQL I;  2EH3 A;  2BBY A;  2ICW G;  2E1N A;  1ZLJ A;  1MMG A;  1YHC A;  1X4M A;  4ASN A;  2BVL A;  4LF8 H;  1MJA A;  1I6H J;  3T0Y A;  5FJ8 J;  1UG2 A;  2JN6 A;  3HKZ A;  1V5F A;  4CZZ A;  3CC7 I;  4G08 A;  4M9Z A;  5EG0 B;  4HAC B;  2Y69 H;  4D9J A;  1OJL A;  4PRV A;  2H6B A;  1P2F A;  4OAZ A;  2BA1 D;  3TP3 A;  4OO1 F;  4R79 A;  1B1B A;  3TGN A;  3LFU A;  4YG2 F;  1W4M A;  1N34 I;  4OD6 A;  5JVG F;  5DRO A;  3PUF A;  1Z59 A;  3F0C A;  1Z0X A;  4BQO A;  2EZH A;  3RPU A;  1K4T A;  1P42 A;  4BA2 A;  4RGS A;  3W6J B;  1OR7 C;  1EJ9 A;  5HDK A;  3K70 D;  2Q1Z B;  2Y9Y A;  2Z16 A;  5LL6 R;  2WY7 Q;  3TOB A;  3MZH A;  2GS8 A;  1O7L A;  4A2U A;  4A3D J;  2LJP A;  4Y15 A;  2DA4 A;  5BOX A;  1YE9 A;  4OAY A;  5EZG A;  2OPT A;  4MGR A;  4DYC A;  4BQQ A;  5FWK A;  4QPO A;  3PO2 J;  1ELO A;  5LL6 b;  2YUS A;  3QOP A;  4OCH A;  2VQE H;  3J81 Q;  3ZGK A;  4IOC F;  4HDU A;  4NXM H;  4BS9 A;  4C3I J;  3M4O J;  1KA8 A;  3OTO E;  2JPB A;  1FBU A;  3OMY A;  1B62 A;  2D9I A;  3JAM C;  2ESN A;  2OI2 A;  4HF1 A;  4O3M A;  1XG1 A;  1LE8 B;  3HYI A;  2A68 F;  4Q48 A;  1YJN I;  5JLX A;  4LFC E;  4BE0 A;  1PP7 U;  2PNL A;  1IN8 A;  1ON2 A;  2BHZ A;  2J5O A;  2JK3 A;  2LOO A;  4KIC A;  5HS9 A;  2R5Y B;  3J81 C;  4MTE A;  3N05 A;  5HOO A;  4GKK E;  4I99 C;  2IW5 A;  5DUK A;  1FZP B;  3ULQ B;  3FMR A;  2E1O A;  2BW3 A;  2UUA E;  1J2X A;  4WUD A;  1U2W A;  2OV7 A;  2CTL A;  2VAS A;  1LNW A;  2GIV A;  2PX9 A;  3KFW X;  5D6E A;  1X4O A;  3LQR A;  2JE6 I;  2IA0 A;  4LG0 B;  3BR5 A;  1MH4 A;  4AUX A;  3SHF A;  4JI7 I;  2LTP A;  3U9G A;  2XF5 A;  5F64 A;  2GLO A;  2CV0 A;  2BEO A;  3LNQ A;  1IN6 A;  1XSV A;  3DTI A;  3ZQG A;  2L9V A;  3JRF A;  3BPX A;  2CMP A;  2NVY J;  4I2O A;  4LPF A;  1HQC A;  3PIO F;  2D1H A;  4LB6 B;  3JTG A;  3JRG A;  2XB0 X;  4HZF A;  4JI2 I;  5IYB J;  4DV5 H;  3PYG A;  2YSR A;  2FML A;  4C2T A;  1TNT A;  1BN5 A;  1YIJ I;  4KN7 X;  3ZQI A;  1O57 A;  3K6G A;  2KDZ A;  3SZG A;  2EFQ A;  4DV3 H;  2A6T A;  2JUG A;  3L09 A;  4IHY A;  2I10 A;  2LF7 A;  4LF8 I;  1JGS A;  1ZXM A;  1N32 E;  3V7R A;  1P92 A;  1LFP A;  2HFU A;  2JE6 B;  3FMS A;  2VF3 A;  3WGI A;  2JQ7 A;  1B8I A;  2NOJ B;  3K7A J;  1TW2 A;  3OWT A;  3WU1 B;  1WJD A;  2CSO A;  4CYC B;  1GUU A;  2L4M A;  1OJ4 A;  1S16 A;  3DP7 A;  2NVT J;  1WUU A;  1DQU A;  3ZMD A;  2FX0 A;  1W5S A;  3W2A A;  3KEO A;  2CUF A;  4A12 A;  1X1A A;  4XR6 A;  2X4H A;  1E17 A;  4ZJZ A;  3OYH A;  1R22 A;  2BE5 F;  2DTZ A;  1K6O A;  1Q1V A;  2PFB A;  4DR1 H;  4B3T H;  3KP2 A;  2F5V A;  4CZC A;  4LF4 E;  3V4G A;  5K5Q A;  4MQ9 F;  5EG0 A;  3C7J A;  4HAC A;  4CA0 A;  2EIM H;  3HRT A;  1S4E A;  2VQE I;  2MLK A;  4HRI A;  5JHF A;  2EV6 A;  2L2O A;  2MA3 A;  3FXQ A;  2Z5U A;  4NXM I;  1QO0 D;  2WAF A;  2P5K A;  3DU5 A;  1D1A A;  2IRF G;  4RDU A;  3B4T A;  4GYI A;  3JRE A;  3CCL I;  1IV8 A;  3GFL A;  4GFB A;  4RM3 A;  3DEU A;  1TT0 A;  5DDG A;  2DLL A;  2JRT A;  2UXN A;  1MZB A;  3CDH A;  3VB2 A;  2RVC A;  1Y60 A;  4E4H A;  1RC9 A;  1J5E E;  1Y1W J;  4DOZ A;  1ZTG A;  3H0D A;  3IV5 A;  5H6R A;  4DV5 E;  1F43 A;  2FFM A;  1ETK A;  4L9N A;  3WHC A;  2ZXH A;  2VBX A;  3IHU A;  3O3K A;  5IPA A;  1WZ2 A;  1XDS A;  3VFZ A;  1HKT A;  5IT3 A;  2OPV A;  3L7Z B;  2IGN A;  4I01 A;  1YS7 A;  4CCJ A;  3CCE I;  4ITV A;  5J47 A;  2CTJ A;  3K17 A;  1HR0 H;  1ZAO A;  1POG A;  3QOD A;  1PUE E;  2O1V A;  4Z7C A;  5FKN A;  1YOV B;  3BG9 A;  5D6F A;  4A6D A;  1BI2 A;  2E35 A;  4P1W A;  3HOZ J;  1LE8 A;  3KDG A;  3BC8 A;  3DTK A;  4N4N B;  4B4C A;  3PYD A;  2NS8 A;  1SEU A;  4FQG A;  2XF7 A;  3K69 A;  1DU0 A;  3OYI A;  3GON A;  1X1D A;  2IOQ A;  1SFX A;  2R5Y A;  1NZ0 A;  2L5Q A;  2BYV E;  2NN6 G;  2VE9 A;  3T8R A;  1R36 A;  3FKJ A;  4RAG A;  5FLM J;  3FXM A;  4DV5 I;  4XN0 A;  4B43 A;  3QP6 A;  3TDZ C;  3P06 A;  2E1C A;  3WTX C;  4M74 A;  4BHB A;  1H74 A;  5FKO A;  2VES A;  3GTK J;  4QNJ A;  4R1H A;  2TDX A;  2A3S A;  2VQH A;  2FRH A;  1FSH A;  1PJR A;  2RGV A;  1QRY A;  1B72 B;  1I3Q J;  3B82 A;  4DV3 I;  5FO5 A;  1HNZ H;  2W57 A;  1N75 A;  2WTE A;  4LG0 A;  2HEO A;  3QT6 A;  2ZQE A;  5EEA A;  1F4K A;  1IN7 A;  5C0X E;  3NRV A;  4XON A;  2BV3 A;  2K85 A;  1V5E A;  1SVM A;  1PDN C;  3DBR B;  4II2 A;  4XOR A;  3CUQ B;  5HDG A;  4CIC A;  2KMU A;  2Z33 A;  2X6O A;  4ZYA A;  4LOM A;  1N36 H;  2DDB A;  4HW0 A;  3HSR A;  2EK5 A;  2VJ4 A;  1OLT A;  3WE2 A;  2M7A A;  3W6K B;  4YHH H;  1KHM A;  3GCM A;  1IC8 A;  2P4W A;  5L3J A;  2I8D A;  1OYW A;  2V4J C;  4N3O A;  2E7X A;  4FE4 A;  3WTV C;  1Y56 A;  2ME0 A;  2OJE D;  5KCM A;  4ENJ A;  2ZSI B;  1Q1H A;  2DK8 A;  1XNR H;  3S8P A;  3ZMZ A;  2F5D A;  4U88 A;  4BA1 I;  2HKJ A;  3UHM A;  1JT6 A;  3FBI B;  4S04 A;  2JE6 A;  4DR1 I;  4B3T I;  2GA1 A;  1Z1D A;  1T33 A;  4NBQ A;  3WTT C;  3EPZ A;  2ZFW A;  1IO2 A;  2KIS A;  2JA2 A;  4CYC A;  3DPL C;  5JHU A;  4Q4Z F;  2R5Z B;  2HOT A;  1Z7L A;  1KVK A;  1HR0 E;  2K4B A;  3S93 A;  5LHH A;  2QSF X;  4ZTJ A;  1ZG3 A;  4NXN H;  3I53 A;  1XGN A;  1TQI A;  5J1U A;  5LHG A;  5LMN E;  2CUJ A;  2M5W A;  2HPM A;  4B3X A;  4DR5 H;  3P5J A;  3I58 A;  2W48 A;  5A2Q Q;  3K1M A;  1FMV A;  3HKZ N;  4HV5 A;  3D0S A;  3KYC B;  2R7R A;  3HJE A;  2VBZ A;  2EWN A;  3PNV A;  1TWA J;  4ESF A;  4OO1 D;  4MFE A;  4GXO A;  1Y6Z A;  4BA1 B;  4DPT A;  3CDL A;  5B1B H;  4D7N A;  3HHG A;  1T2K A;  1WSU A;  2R7D A;  4KJZ A;  1X1B A;  3ZR8 X;  3ABM H;  4NC6 A;  4AWX B;  1LUJ B;  2K02 A;  4BKX A;  3LAP A;  1R71 A;  1W5T A;  2FU4 A;  1P6R A;  4JI1 H;  2O5R A;  1HR0 I;  3S15 J;  2IES A;  2BA0 G;  1BR1 A;  1YTY A;  2DA1 A;  3FK7 A;  4DR3 H;  3T1H H;  3SEZ A;  3HC7 A;  5A2Q K;  4E7K A;  3CDJ A;  3RTR A;  2CTM A;  2W7N A;  1E3O C;  1R9T J;  3JRC A;  1JKQ C;  3RKW A;  2PMZ A;  2BM1 A;  1JUP A;  4EVI A;  1OQY A;  2K3P A;  3LSI A;  2Y0S A;  3IKT A;  1D3Y A;  5CVJ A;  5D8K B;  4ENM A;  3L7Z A;  2O4C A;  2X06 A;  1BM9 A;  1NG7 A;  4LF5 H;  1MMD A;  5FLX W;  1V5G A;  2JVZ A;  2X6X A;  3P9C A;  4C3H J;  4FX4 A;  4E7I A;  4DPY A;  2VI6 A;  4GRI A;  3VSK A;  4B3A A;  3KE2 A;  5F0C A;  3KET A;  3WTW C;  1HNZ I;  2IS1 A;  4ZZL A;  1XMO H;  3KCC A;  4IFD B;  2VQF H;  9ANT A;  1XPX A;  4JK1 X;  1HXD A;  1YI2 I;  2CPM A;  4FJS A;  1LFB A;  2WB1 N;  1DT4 A;  2JJ7 A;  3FHZ A;  4X66 H;  3N4M A;  4AVP A;  1N36 I;  1R4N B;  1G8X A;  2KZG A;  4XRM A;  1YFH A;  3KP5 A;  3E6D A;  3FAU A;  2FUG 2;  2LH9 A;  3CCY A;  4YHH I;  5JEA B;  1DPU A;  3FMQ A;  1DTJ A;  2V1X A;  3BCB A;  1R4M B;  1IUY A;  1B72 A;  1A6Q A;  1TQP A;  1UG0 A;  4FET A;  3U21 A;  1XMQ E;  2A2C A;  1XNR I;  2XGE A;  4E7J A;  4DUY E;  4ZYG A;  4A3J J;  3J7Z I;  1X2M A;  2DA7 A;  4NUB A;  3OS1 A;  2STT A;  3CUQ A;  2DK5 A;  5IP6 A;  1D1C A;  5TIS C;  4ANJ A;  4WUB A;  1BIB A;  4G6T B;  3I56 I;  3FZV A;  1G4D A;  4LF9 E;  4KUM A;  3JTH A;  1VQP I;  4LIU A;  4M6X A;  3OYF A;  5GMD A;  4Y13 A;  4NXN I;  4JI6 H;  2F4V E;  3AKZ A;  5GTH C;  1FOY A;  2ZJR F;  3KYD B;  1P4A A;  3HBL A;  2IOP A;  2ISY A;  2LDU A;  4HLX A;  3F72 A;  2RKH A;  3C2H A;  1HNX E;  1ZM3 A;  2EZK A;  3M7N G;  1LFU P;  1XGS A;  3PS3 A;  4IHS A;  3J80 C;  1VQM I;  1MD0 A;  2CYY A;  2CZ9 A;  1BJZ A;  5M5Y J;  3KIO A;  5IT9 Q;  2ANR A;  1Z5C A;  1E2X A;  3OS2 A;  5ICC A;  5K36 C;  3RCO A;  4X64 E;  5C3E J;  1Y6I A;  2LY2 A;  1OCR H;  3I3L A;  3OS0 A;  2P6T A;  2VQF E;  1MBH A;  2CWH A;  1IBM H;  3PO3 J;  3RZD J;  5M5W J;  2BR2 B;  1ODH A;  4OIN F;  2BXZ A;  1OPC A;  4OMZ A;  5AON A;  3IH3 A;  2XDV A;  1RUO A;  4BA1 A;  4JI4 H;  2LG4 A;  3P3E A;  1UDQ A;  1RI7 A;  5IT9 K;  4LF5 I;  1MW7 A;  5M3F J;  3A02 A;  4M3E A;  2CS3 A;  4MNU A;  4A5N A;  1Z21 A;  1U5T B;  2VIX A;  1WJA A;  4UV8 A;  3A0H C;  4ZDP A;  4LD5 A;  2HQR A;  4XQF A;  2ADU A;  2ZXJ A;  1XMO I;  4JX4 A;  4ZC3 A;  4ESB A;  3QQA A;  2VQF I;  4B8X A;  3HOT A;  3M1E A;  2VPL A;  4MEY F;  3HXL A;  5GTI C;  2E3U A;  4IHV A;  3S1N J;  2QEN A;  1GT0 C;  2COM A;  4X66 I;  3EET A;  3RIR A;  2UUC E;  1ZHF A;  1BW5 A;  1G3S A;  1HST A;  2LTM A;  3S1M J;  1RES A;  2KIU A;  4HXZ A;  4P9F A;  1UDO A;  4AQY E;  2AS5 F;  2KL4 A;  2A61 A;  3W6V A;  1QNT A;  3P9I A;  2HNH A;  1K7A A;  2M9H A;  4B3S E;  3VOD A;  4E70 A;  1TTY A;  1UHS A;  5DCM B;  4HYM A;  3BJA A;  5C0X C;  3ML6 A;  2VKH A;  3IWZ A;  2DT5 A;  4E7H A;  3AL0 B;  2DMT A;  4RLQ A;  2MW8 A;  4NDL A;  1SFO J;  5GPA A;  4IFD A;  4JI3 H;  4URL A;  5FD6 A;  2L7Z A;  2TRT A;  5GAE J;  1SAU A;  4X62 H;  2VKV A;  4NZT M;  1HNW H;  3NAR A;  4H4K C;  4GQU A;  3JAM W;  2XRN A;  3GME A;  2AXY A;  1Y0N A;  3O2P E;  4RGU A;  2KRC A;  2Y31 A;  4LF7 H;  4B09 A;  4JQF A;  3D4J A;  2VKE A;  2W82 A;  3ZXS A;  2KIM A;  3OYN A;  2Y3M A;  5JEA A;  4JI6 I;  4D5C A;  4AQY I;  2RV8 A;  3QT5 A;  5J40 A;  3BR2 A;  3WU3 A;  3L2Q A;  4B3S I;  3H5N A;  1XMK A;  2FSW A;  3BG3 A;  2UXD H;  1S8N A;  4RM2 A;  4W1U A;  1SFE A;  5C0X G;  4I3H A;  2VL8 A;  3L00 A;  4D0P A;  2XAQ A;  2ID6 A;  1FP1 D;  2FBK A;  2VOO A;  3D5L A;  2JZY A;  2WY8 Q;  5CVI A;  3U2R A;  1JJ6 C;  1Z9C A;  5J3L A;  2J7K A;  3F8M A;  2VJI A;  3DQV C;  3FXR A;  2NS0 A;  3JRD A;  2R0Q C;  1Y39 A;  1VQK I;  4AIK A;  4DYR A;  2L54 A;  4L9J A;  1IBM I;  2XPW A;  3LSH A;  4DV4 H;  1JGG A;  1D0Y A;  2ZM6 H;  2ZC2 A;  1YJ9 I;  2DOD A;  2DT6 A;  2R7V A;  3JR9 A;  2NN6 D;  3HZJ A;  1N33 H;  1MMA A;  4XSX F;  4JI4 I;  2R7W A;  1VIS A;  4HNV A;  2CWF A;  3E5Q A;  3H5R A;  4BJ5 C;  3QU3 A;  2DW4 A;  2UXC H;  1APL C;  1ZM9 A;  2HOE A;  2HKO A;  5HS7 A;  3PJR A;  3S2D J;  5CQE A;  2FXA A;  3SFI A;  2R92 J;  1KIJ A;  4JI3 E;  3AG2 H;  3JRB A;  3SQN A;  3T5X A;  2HFS A;  1Z05 A;  1XCV A;  2BR2 A;  2B9S A;  1HNW E;  3LST A;  3V2U C;  2VQG A;  4DR7 H;  3BT9 A;  4KN4 X;  1MSZ A;  2FA5 A;  1QVT A;  1IBK E;  2A1S A;  4MO7 A;  5BQT A;  3ERE D;  2BZT A;  2PJP A;  2R3S A;  4EQQ A;  2DYR H;  1DGW Y;  2MD0 A;  2DEI A;  3RZO J;  4UB6 C;  3CJT B;  3QP5 A;  2LRE A;  1ZG1 A;  1Y0U A;  3OL3 A;  4PZJ A;  2HK2 A;  1UZC A;  1U5T A;  5EGO B;  2NN6 F;  1R5H A;  2UXX A;  4DPX A;  2M4G A;  3J7A K;  5FKL A;  4JYK A;  1FTZ A;  2K9N A;  4E7L A;  2Z5B B;  1ZN2 A;  4JI3 I;  3E7L A;  1ZEL A;  2PMZ N;  3CES A;  4FW5 A;  1SD4 A;  1QHH D;  2Y48 A;  4X62 I;  1KQ0 A;  1Y5Y A;  1A31 A;  1HNW I;  4AID A;  2TCT A;  2R7S A;  1I6X A;  1XGO A;  5BMZ A;  1ETW A;  3R0A A;  2M0M A;  2BL5 A;  3S3M A;  1Z91 A;  4LF7 I;  3V7C A;  1MBG A;  5KK1 A;  1AA7 A;  1QQI A;  1FY7 A;  5D5V B;  1K78 B;  1N25 A;  3CF5 F;  1IXS B;  4DR4 H;  1FI4 A;  1FX7 A;  4IFD F;  2G7U A;  5ICE A;  3FXO A;  1S72 I;  2NOG A;  3BOQ A;  3K2Z A;  2VJJ A;  3O8H A;  5DCM A;  2ZM6 E;  4DU8 A;  4J3D A;  2HQN A;  1UB9 A;  5L3D A;  2XC7 A;  3WTU C;  2YU9 J;  1XRH A;  2UXD I;  1H9G A;  2HQ5 A;  4DIQ A;  4LF6 E;  4E6K G;  2KPM A;  4UUV A;  3TO7 A;  4UXN A;  5B1A H;  5JEA F;  4B3R E;  1W0U A;  3SYT A;  4S0H B;  4MFD A;  2Z5E A;  5GME A;  3SDB A;  2LBF B;  2DI3 A;  4RLF A;  5CQG A;  1RZ4 A;  1X1C A;  4UUS B;  5E3M A;  4PJJ A;  4XMY A;  5FRO A;  3V8L A;  4GKJ E;  3M85 D;  4RPF A;  3OTO H;  2P6S A;  3GTO J;  4GO1 A;  5LRS A;  1I5Z A;  5L3F A;  2P5L C;  2JVH A;  2XAU A;  1XD7 A;  2PJR B;  5EYR A;  2IER A;  4LLL A;  1R6M A;  3PM1 A;  5E8I A;  2ZM6 I;  4LFC H;  4L5I A;  3I5U A;  4ETS A;  1ZAR A;  1FJG E;  1N33 I;  1PUF B;  1YQA A;  2MAB A;  4IF4 A;  5J1Y A;  1D0X A;  2QND A;  2GWR A;  1OR7 A;  3S2H J;  4JVH A;  4GKK H;  1NK3 P;  1S5L C;  2I5U A;  2RNG A;  2XKO A;  5FLV A;  2Z1D A;  2NN6 B;  4JYA E;  2UXC I;  1WGX A;  3LSG A;  4IJA A;  3X2Q H;  3CCS I;  3RQ4 A;  2UUA H;  1T0F C;  3CJR B;  3P76 A;  1H9T A;  2JPC A;  2DMP A;  4N4O B;  4GGG A;  1R6L A;  3RPQ A;  2HVR A;  4BYY A;  3KLO A;  2L3D A;  3HJC A;  4A3K J;  2DA3 A;  1Z5B A;  4HDV A;  3CO7 C;  4DR7 I;  4NZR M;  2V1U A;  1WFX A;  3CP8 A;  2Z3Y A;  1P7J A;  2IA2 A;  4BY7 J;  4CCM A;  3ASO H;  2DOE A;  2LVS A;  2YQR A;  4DR4 E;  2F4O B;  1FC3 A;  1HA8 A;  1HCR A;  1YG2 A;  4OU0 A;  3VYU B;  2QQ9 A;  3B73 A;  2ELH A;  4XL9 A;  3GZ5 A;  4XLC A;  5GPC A;  3HOX J;  3DLL F;  3E6C C;  4FW7 A;  2O0Y A;  1IG7 A;  3N97 A;  1FJL A;  1XS9 A;  3Q0V A;  4M3B A;  5BR8 H;  4XRS G;  3RI4 A;  2DJN A;  2CQQ A;  1WQ2 A;  3VSL A;  1N77 A;  4LFB E;  4DGW B;  2OA4 A;  3UNG C;  4IEJ A;  4WX9 A;  1N32 H;  2OPU A;  3GZ6 A;  1P7I A;  3LSR A;  1OCO H;  2X6Y A;  1OYI A;  3ZMV A;  3JRI A;  4LCH A;  1R1T A;  2LP0 A;  4UVC A;  1VIH A;  5E17 F;  3GTG J;  3VKE A;  4XLA A;  4DR4 I;  2QCO A;  4LIJ A;  2Z0S A;  1ACI A;  2Q0O A;  4N9H A;  3VEP A;  5HLG A;  1BW6 A;  4FCY A;  5EGO A;  3U1Y A;  2VUM J;  3BQZ A;  3ESW B;  3ZZ0 A;  1KU2 A;  1WH5 A;  1I1G A;  1TLH B;  1FNN A;  4IQJ A;  2Z5B A;  1IRX A;  1USV A;  2OF7 A;  2B0L A;  5M5X J;  2WB1 A;  3I0P A;  3I0T A;  4LMY A;  4USK A;  2W4S A;  1RRJ A;  2XAS A;  4LF4 H;  2QQ8 A;  3HHH A;  1ITY A;  3E5X A;  1IUF A;  1CF7 B;  1VQ9 I;  5F0F A;  3EDP A;  3E6M A;  4ESJ A;  2CRG A;  4J19 A;  1K78 A;  3DKX A;  1ZM2 A;  3OTO I;  1R00 A;  2RDP A;  4HV6 A;  1LEB A;  1V54 H;  2C39 B;  1I50 J;  5LGT A;  4FW6 A;  1W36 C;  2WAQ N;  1RNL A;  4E7S A;  2JA8 J;  3S32 A;  3GFJ A;  3RKY A;  2XKP A;  5EDN A;  1J7K A;  4MTD A;  4LFC I;  1D1B A;  1VI7 A;  4XTJ A;  2UU9 E;  1J5E H;  4USM A;  4HAM A;  2KZV A;  3KZZ A;  3J80 Z;  2X6W A;  4UB8 C;  3RDI A;  2M7B A;  5H2F C;  3B8H A;  4GKK I;  2KJB A;  3V69 A;  2LBF A;  1Z6R A;  4UUS A;  1EI1 A;  5BR8 E;  5C4X J;  2UUA I;  1MGT A;  5GAD J;  1IN4 A;  3KLN A;  2O1W A;  3PS2 A;  1H73 A;  2W24 A;  4MEX F;  4U0W A;  2JT2 A;  1WE8 A;  4CGZ A;  1ZRE A;  2ME6 A;  1BI0 A;  3ZQF A;  2PJR A;  4DV2 E;  2HZD A;  3WU0 A;  4K0K E;  3BG7 A;  3WTS C;  3G6E I;  4BNC A;  3OIO A;  4G12 A;  1ETV A;  3OY9 A;  3RSN A;  2XEX A;  1S03 G;  4XLP F;  2CW8 A;  1E0E A;  1PUF A;  4F92 B;  3HDD A;  3LQQ A;  3LSM A;  3D5S C;  2R7O A;  1RIO H;  2YU3 A;  3TW7 A;  4XBF A;  2NN6 A;  4FTH A;  2MLG A;  4JVY A;  1WH7 A;  1X58 A;  1NHA A;  1H88 C;  2LRD A;  2AE8 A;  2NYX A;  2Z99 A;  2FNA A;  5D8L B;  1FYK A;  3QPH A;  1XGM A;  4U3D A;  2ZNY A;  5BR8 I;  3GAB A;  1EV7 A;  4FT8 A;  3W2V A;  3DLA A;  1U6G A;  5TJJ A;  3VDX A;  1ZR4 A;  1PP8 F;  1ENH A;  5L3G A;  3V5R A;  2LY1 A;  3MZY A;  4P52 A;  1V9N A;  4MU0 A;  2AHQ A;  1N32 I;  5J8C A;  1DU6 A;  1TBX A;  4DV2 I;  2CG4 A;  1Z3Y A;  1QGP A;  4BEH B;  1J9I A;  3LL7 A;  1OYP A;  1R23 A;  3RJP A;  5IYC J;  1N0U A;  2IAI A;  5FD5 A;  5K7H A;  3L1P A;  4IO9 F;  1L3L A;  1C0W A;  1VQ5 I;  3P3C A;  5IOY A;  4AU7 A;  1AU7 A;  3E3V A;  5CVU A;  3D5R C;  3F8F A;  5LGN A;  3OYC A;  2CH0 A;  3LTO A;  3IC7 A;  3H9J A;  5K36 E;  3OYJ A;  4DW6 A;  2E5L H;  3GKU A;  3J80 W;  2E1R A;  4DV6 H;  3CTA A;  5E3N A;  2F4M B;  3IUO A;  4OIR F;  1WHR A;  1ZK8 A;  4G94 A;  4AIM A;  2FJ1 A;  1Z67 A;  2MD5 A;  2DMU A;  1D8K A;  4UV9 A;  1XCB A;  3WOD F;  4HX7 A;  3R0J A;  2CVE A;  2CQ7 A;  4WUC A;  4Y33 A;  4LF4 I;  3FIS A;  2K3F A;  5E3O A;  2HXO A;  2OTL I;  3GF2 A;  2FMR A;  3JRA A;  4RGR A;  5D5W B;  1XMX A;  5E1W A;  3S3O A;  4BBR J;  5LMN H;  2VXD A;  1AOY A;  3MKW B;  1ZTR A;  2JRM A;  4R1F A;  4HSR A;  2P81 A;  4IZJ A;  1UEL B;  1O3T A;  1EC6 A;  4LLG F;  3TW6 A;  1T8I A;  3H92 A;  3HPH A;  4BDY A;  2HVS A;  2COB A;  4IHW A;  2DGR A;  2BV6 A;  1J5E I;  3C18 A;  4ABZ A;  2AXT C;  5J4Y A;  2R7U A;  1IRF A;  2GOM A;  1J5K A;  2M0C A;  2XAJ A;  2OCC H;  2LSO A;  3C3W A;  2F6C A;  4EJV A;  2JMW A;  2NNN A;  3MD2 A;  1CF7 A;  1ON1 A;  2KP6 A;  1BI3 A;  2VPR A;  1WVR A;  3BTL A;  4AIH A;  2QQB A;  1K61 A;  5LMU E;  4IFD D;  2FNP A;  1R5G A;  4O5V A;  4ON0 A;  2HOA A;  3K4N A;  1GVD A;  3BR1 A;  3HRS A;  4BE1 A;  5HOD A;  2ELJ A;  4WXD A;  3HGG A;  2C39 A;  2O7O A;  4DV7 H;  2GXA A;  2D45 A;  1E3H A;  3DXJ F;  4YFN F;  3KZY A;  4JI5 H;  1MKM A;  4WXH A;  3TBI A;  4P7A A;  4KHP H;  3KEY A;  1LVA A;  2QKM B;  4GCV A;  1JUM A;  2E2I J;  5JEA D;  1JI8 A;  1RR7 A;  2QZ8 A;  2NS7 A;  2VKD A;  1QZY A;  2EIK H;  2EZL A;  4CXF A;  2LF0 A;  3SEQ A;  5HDN A;  2W00 A;  2E5L E;  1UFM A;  1G6N A;  1BOA A;  4LLN A;  2L7F P;  4IHT A;  2JEA I;  4EJU A;  4DV6 E;  2RRE A;  2VOP A;  5CKT A;  4HX4 A;  4CCK A;  3C2B A;  3DU6 A;  3I4N J;  3M6A A;  4QNK A;  3NQO A;  2ISZ A;  2PLY A;  2P7C B;  4G6Q A;  2LNB A;  1M1E B;  2P0W A;  5FLX Z;  2XSD C;  1USU A;  3PYF A;  2JVG A;  2OC6 A;  1V4R A;  5D4S A;  2ZIT A;  3LSK A;  3CP2 A;  3ECO A;  1KZH A;  1TWH J;  3ZM7 A;  5LGU A;  1L0O C;  2JEB I;  3BWG A;  2GQ0 A;  4A3F J;  5D5U B;  4IZK B;  4BHP A;  4RB1 A;  3LPS A;  2JWT A;  4AC0 A;  4F91 B;  1P9Q C;  2LFB A;  3HEF A;  4BQN A;  1QBJ A;  3DCF A;  2IT0 A;  1I94 E;  2E5L I;  2ZO4 A;  4PDK A;  4HYE A;  3K9T A;  4DV6 I;  2ECC A;  2KJC A;  2VQC A;  4RMN A;  4FWG A;  3CD6 I;  1XMQ H;  3NEU A;  1Z0B A;  1XSX A;  1D6T A;  3OIQ A;  1B63 A;  2CW0 F;  4DUY H;  4EMS A;  3O6B B;  5DT9 A;  2QKL B;  5ILU A;  4AIJ A;  2A5Y B;  4FJU A;  4BEH A;  3WG9 A;  3J7Y J;  5BPI A;  3R61 A;  1IRG A;  1SD7 A;  3S17 J;  5DCF A;  3ZQH A;  5C0X B;  4CSW A;  2BY1 A;  3KP3 A;  5A2Q C;  3F3X A;  4WXC A;  1ZLK A;  3PS1 A;  2OQR A;  2JUC A;  2L01 A;  3IAM 2;  4L18 B;  4LF9 H;  4BH9 A;  4DV7 E;  3F8B A;  2OCE A;  5LMN I;  2V8P A;  1ZZI A;  4JI5 E;  2DMN A;  2F4V H;  3G1M A;  1GV2 A;  1HKQ A;  4KHP E;  3QPS A;  2H94 A;  4U3B A;  5DV5 A;  4C30 A;  1H7U A;  3ZQQ A;  4MQY A;  1HNX H;  3F9K A;  4OMY A;  2R4G A;  2XIG A;  2DBB A;  3MWM A;  4CCL A;  4QIW N;  1D5V A;  4DQ2 A;  1ZZK A;  4PGG A;  4WAL A;  2XVC A;  4M72 A;  3RYR A;  3L2V A;  3IAS 2;  3Q9S A;  3Q0W A;  1KON A;  3I64 A;  4I76 A;  1TC3 C;  1B9M A;  4JV5 E;  2QBY B;  2UXB E;  3QD7 X;  4X64 H;  1ONV A;  2KQR A;  2P7V B;  3BRO A;  1NTC A;  2ZJ2 A;  1LDD A;  1OKR A;  1DGR M;  4MYU A;  4DV7 I;  2PO2 B;  1S7A A;  3CWV A;  3EYI A;  3FXL A;  5DUI A;  2E1M C;  5LEK A;  4JI5 I;  4U0V A;  4ZYD A;  1WRJ A;  4KHP I;  2HDD A;  5ICG A;  1XTA A;  1YS6 A;  2IXS A;  2N8G A;  2GA2 A;  3K10 A;  1IN5 A;  1H89 C;  5M3M J;  2CTK A;  1NH3 A;  1AN7 A;  3OV8 A;  5FKK A;  1ZGJ A;  4BU2 A;  2V9V A;  4LGW A;  1JE8 A;  2GM4 A;  2HKE A;  5B5E C;  4YY3 E;  2DA5 A;  2KRF A;  3H36 A;  2AQF A;  2HHH H;  2DPU A;  3UOE A;  1RPW A;  2EV0 A;  1IBL H;  2ZKZ A;  3A2K A;  5L3E A;  4DV1 H;  2K9L A;  2K7L A;  2MC4 A;  1B9N A;  2CTF A;  4UUT A;  3LSJ A;  4ED4 A;  2UXB I;  2MYS A;  1XHK A;  1KQ8 A;  1J4W A;  3TMO A;  1FWK A;  1Z3X A;  2ETH A;  1Z6T A;  1OYS A;  3L9F A;  5TRD A;  1BKN A;  5ILV A;  4LFA E;  5DRQ A;  4C9Y A;  3K4K A;  1T95 A;  1UST A;  2UUZ A;  5IY5 H;  3JSO A;  3PUB A;  4I7H A;  1VBI A;  5B66 C;  5LFA A;  3QRF F;  2RQQ A;  1H8A C;  4FW3 A;  1VTN C;  2OD5 A;  2UUC H;  4XKW A;  4EGY A;  1TQM A;  4C3J J;  1U8B A;  3CME I;  2K9S A;  3B6A A;  1OCC H;  4AQY H;  3KZI C;  5DS9 A;  4Z2Y A;  4MU4 A;  1FP2 A;  1W5C C;  3RKQ A;  4B3S H;  4BGD A;  3HOU J;  1HF0 A;  4IX7 A;  1R1V A;  2D1V A;  4L9V A;  1XMQ I;  1MBK A;  4DUY I;  3U1D A;  2K4J A;  3OL4 A;  2E2J J;  2FOK A;  4DV0 E;  2NAZ A;  2Y75 A;  2R5Z A;  1QA6 A;  1ZRC A;  2FF4 A;  3CQZ J;  2BY2 A;  2MBF A;  4M9X A;  4DYQ A;  5LD2 C;  3HPG A;  4CHU A;  1I1S A;  4LFA I;  2PO1 B;  2PI0 A;  2QLZ A;  4IZK A;  3WHB A;  5FFZ A;  4A3B J;  4XN3 A;  4WWC A;  4LF9 I;  3H9G A;  3JAM Z;  1TZL A;  3MMY B;  4MLO A;  1UDN A;  3A4C A;  1N78 A;  3PSI A;  3A03 A;  2PNM A;  2QWW A;  4MU1 A;  2F4V I;  1MBJ A;  2F5E A;  3AG4 H;  2V34 A;  3K85 A;  5IT9 C;  3BDD A;  3E6B A;  2MSY A;  3T1Y E;  4A0Y A;  3J81 Z;  3DPT A;  4CDG A;  4OIQ F;  1WJ5 A;  1HNX I;  1YH8 A;  2DFE A;  4NNJ A;  4HEA 2;  4DBQ A;  1LPQ A;  2UUB E;  5E20 A;  4M6Y A;  2FMY A;  1DP7 P;  2HHH E;  4WF2 A;  3HUL A;  5C0X A;  1IBL E;  4DV1 E;  1W7P D;  2Y0M A;  4LOC A;  2FQ3 A;  1H7S A;  4IXA A;  4FN5 A;  3DBL B;  3AEV B;  4X64 I;  1KU9 A;  2CFX A;  5K36 G;  4KNY A;  2DO7 A;  1P4X A;  4BAC A;  1OMI A;  2XPV A;  1Z2I A;  5J6X A;  3DD6 A;  5GP9 A;  3C2G A;  4H0E A;  1BIA A;  2EB7 A;  4X65 E;  3OYL A;  4O6J A;  3I4P A;  2OAZ A;  2BVM A;  4D7M A;  4L5E A;  1VF9 A;  4K2E A;  4ISA A;  3ZMT A;  3GW2 A;  1LB2 A;  2M4K A;  2XRO A;  2L7M P;  3ELK A;  2WC2 A;  1Z0T A;  2EJR A;  2HTS A;  1WJC A;  4M73 A;  2HHH I;  5E1X A;  1IBL I;  3OOU A;  4DV1 I;  1I3A A;  2QBY A;  4A0Z A;  1QHG A;  5F0H A;  3HOW J;  1Z7U A;  3T1B A;  5DM6 F;  2DPD A;  4C2U A;  4DBR A;  2MH2 A;  1GV5 A;  1Z5A A;  3COA C;  2WAQ A;  2X1D A;  1J0R A;  2ZME B;  3O8G A;  1RHY A;  2PO2 A;  1B59 A;  4OOI A;  4JI8 H;  1SAX A;  2M45 A;  4NB5 A;  3ZQ7 A;  5BPD A;  2PG4 A;  2CUE A;  3KP4 A;  1WJB A;  1UDS A;  4EC5 A;  4XLN F;  4X65 I;  3LA3 A;  2ZB9 A;  3D1N I;  1IBK H;  1UHM A;  1MX0 A;  1RRE A;  4YIR X;  3OSF A;  2UUC I;  4QSH A;  3FXU A;  3ABL H;  3VOE A;  2WWY A;  4EM2 A;  1HW2 A;  2BM0 A;  2LRR A;  1DUX C;  3J81 W;  4A69 C;  3KP7 A;  2O1T A;  1OIS A;  2Y2Z A;  3F6O A;  4B44 A;  4FW4 A;  3WU5 A;  1UG8 A;  2Z5C B;  1I27 A;  4YIF A;  5K36 F;  2A69 F;  3GYH X;  1S29 A;  3BP8 A;  2WW4 A;  3QYE A;  5AIQ A;  2H6C A;  3G4S I;  4IOA F;  1GLN A;  1V55 H;  2A5W A;  3GO5 A;  5IP9 J;  1G3Y A;  2EPF A;  4Y3O A;  5J4V A;  1IW7 F;  3ABU A;  3IP4 B;  4I02 A;  5BS6 A;  2HS5 A;  2JA7 J;  1U2R A;  1MH3 A;  1WJE A;  5K5O A;  2CFO A;  2FOW A;  1Z0G A;  3DKW A;  1BC8 C;  3L2U A;  2D2W A;  2MFZ A;  1K6Y A;  1LJ9 A;  3K4L A;  2V1N A;  4N0B A;  1U8R A;  1EH7 A;  4ZYH A;  4PJM A;  2AQE A;  3G1L A;  2IEK A;  4QTR A;  1SFK A;  1FWZ A;  4XKB A;  2EV5 A;  3FM5 A;  2WV0 A;  1LVK A;  2UZK A;  1EKE A;  2VE8 A;  3MQ0 A;  5ILS A;  3V8J A;  2EBI A;  1Y8Q B;  1Z0W A;  4BHC A;  2V9K A;  4J01 A;  4DR2 E;  5EEG A;  2BY0 A;  1SAN A;  5JR3 A;  1HDP A;  2QVO A;  2K1H A;  2L9R A;  1ZZJ A;  3B02 A;  4OKG A;  5DRR A;  2Z2S B;  4LF6 H;  2PO1 A;  1KGS A;  3CC4 I;  2L02 A;  4B3R H;  5DNX A;  1YW9 A;  2K9Q A;  2RNJ A;  5ERI A;  1F9N A;  3H35 A;  3BG6 A;  2XRL A;  4R8H A;  1YX3 A;  3Q6N A;  4UVA A;  4JI8 E;  1W7P B;  2A6H F;  4GKJ H;  1F36 A;  1SD5 A;  1UHW A;  4NQW B;  4KFC A;  1EA3 A;  3BTI A;  1A35 A;  5FLX Q;  4DPW A;  4NHJ A;  5C0X F;  2GBY A;  2DCE A;  4B47 A;  1WI3 A;  1HLV A;  1XX5 A;  3WTY C;  1YW8 A;  1T56 A;  1P4W A;  2LKX A;  2O3F A;  2JZX A;  3S14 J;  1FJG H;  2A6E F;  4Y4R A;  4DR2 I;  3BR6 A;  4B8C D;  1K4S A;  2UWM A;  1D8J A;  3VPR A;  2KFD A;  3EUH C;  4D1Q A;  1JKP C;  5CLS A;  4JYA H;  4P96 A;  2XAG A;  1YYV A;  1HDD C;  3B78 A;  3KP6 A;  3GVA A;  3HSE A;  2VXZ A;  5KAF C;  2OQG A;  2PMH A;  5KNL A;  4UTG A;  2XSJ C;  2O6G E;  6PAX A;  2EQR A;  2BOL A;  3PYE A;  3GTQ J;  3LNU A;  4DU7 A;  3F8C A;  4JI8 I;  4LIT A;  1A04 A;  4IZZ A;  1GXQ A;  1X3W B;  2E60 A;  2CJJ A;  5FLX K;  2PQ8 A;  2OBP A;  3DWL E;  3OYB A;  3KX2 A;  4XK4 A;  1IBK I;  3OET A;  1MBF A;  2CQK A;  2V2Z A;  1JKR C;  4H8A A;  1EH6 A;  3A0B C;  5ED4 A;  1MMS A;  1U9N A;  3TED A;  2VB6 A;  1KU7 A;  2K40 A;  4M1K A;  3CCQ I;  5ELW A;  2DOA A;  3MEX A;  4OO1 C;  3WE3 A;  5DM7 F;  4X0G A;  2KT0 A;  3CLQ A;  4KQV A;  3J7A G;  1MJB A;  1R1U A;  5CPR B;  4YFK F;  3Q1Q A;  3I4M J;  3H3Z A;  4IPA A;  2ZME A;  1FT9 A;  2VQL A;  3CC2 I;  3MCZ A;  2EZI A;  1IZ1 A;  5J8F A;  1S3J A;  2QYO A;  4EM1 A;  3HIF A;  1MNE A;  4PSX A;  5F6F A;  4XRS A;  4LFB H;  1MND A;  2OUM A;  3G73 A;  4ZDO A;  3AG1 H;  2O1U A;  1T0F A;  5H6Q A;  1W1W E;  3NCV A;  3ONQ A;  3ZCO A;  4GYG A;  2BA0 D;  2EIJ H;  2JT1 A;  3QPT A;  2YR2 A;  2K5C A;  4AVZ A;  4XID A;  2QEX I;  3FXJ A;  4EJO A;  4HF0 A;  2Z5C A;  2VT3 A;  1ETY A;  4CUG A;  4HST A;  1U5T C;  4G7Z F;  1Y4S A;  3F8N A;  4B3M E;  3BJ6 A;  1S6L A;  4XOT A;  4OO1 G;  1F5T A;  3K1P A;  1F1Z A;  1Y1V J;  1BA5 A;  4HNU A;  3LMM A;  1YHQ I;  4M3G A;  2OTJ I;  2E34 A;  2EIN H;  2LC2 A;  1VQ7 I;  4LF6 I;  2X7I A;  3ZMU A;  1EH8 A;  2QA4 I;  4A5M A;  1QZR A;  2E7W A;  2DT7 B;  4B3R I;  1IV6 A;  1ORK A;  4ZDL A;  1IXC A;  2E2H J;  4ZVI A;  3GZN B;  2HH2 A;  4HG2 A;  2P8T A;  3GTJ J;  3ZKB A;  2HPI A;  4GKJ I;  2JA9 A;  2DQL A;  1XDU A;  1ODD A;  4KIF A;  4L0Y B;  4MU3 A;  4HBL A;  4LIV A;  3TO6 A;  2PEX A;  1XNQ H;  1BL0 A;  3HL2 A;  1N34 E;  2VBW A;  1IRZ A;  4RBO A;  3M7G A;  1UJ8 A;  3FF5 A;  1BI1 A;  1U9O A;  1WKM A;  1ZYR F;  2UU9 H;  3LA2 A;  3J7A O;  2XAH A;  3F23 A;  5KAI C;  1FJG I;  3SZT A;  1O3Q A;  2HDW A;  4CYD A;  4XM3 A;  5K1Y A;  3DEW A;  4ENN A;  3TL4 X;  4YRV A;  4XIC A;  4YEL A;  1FKA E;  4JYA I;  2X0L A;  2XHK A;  1TNS A;  4EV0 A;  3I71 A;  2X9D A;  1W7P A;  3MFK A;  1WWX A;  4QLC U;  2M30 A;  2KLO A;  2F2E A;  4NQW A;  1XSD A;  2QSG X;  4A3M J;  3OYE A;  5E1Z B;  4DV2 H;  2Y9Z A;  1IXR C;  3IL2 A;  1FYM A;  4K0K H;  5K7F A;  3M9A A;  2M87 A;  4DXL A;  4PSW A;  2NNY A;  5HNF A;  3HG9 A;  3FHN A;  3NWS A;  1O7F A;  1SVO A;  1OCT C;  5K7Z A;  2ZJP F;  5FRN A;  4P55 A;  4B1R A;  2V7F A;  1MBE A;  2HR3 A;  2IS6 A;  2GQQ A;  3B6C A;  4V2G A;  3LAJ A;  2AJ4 A;  3MKY B;  2E71 A;  5CJ9 A;  1VQ8 I;  4GDF A;  1ERD A;  3A1Y A;  3E1S A;  1PYV A;  1IJW C;  2R7X A;  5HS8 A;  1OFC X;  2EFP A;  3NZK A;  4II3 A;  4UHT A;  3JAM Q;  3FDY A;  3M7N D;  3IH2 A;  1R5I D;  4AYB A;  2E5N A;  5A2Q W;  3VYS B;  1BJA A;  2Q2E B;  3WGG A;  2DN0 A;  2LYC A;  3MZ8 A;  4EJT A;  2F5F A;  4FE7 A;  1EF4 A;  4LFB I;  3QWL A;  2GOX B;  1HW5 A;  2C38 B;  4UVB A;  1FOW A;  4EAT A;  3K4B A;  3E5U A;  3I9V 2;  3S1R J;  1X4P A;  1VQ4 I;  2IJL A;  4JI7 E;  1RR9 A;  1K79 A;  2IS2 A;  2ACJ A;  5CVV A;  1XNQ E;  3BZ6 A;  4KA4 A;  1A6I A;  1JHF A;  2HFH A;  2FBI A;  2CQX A;  4FWH A;  4RS8 A;  2X51 A;  2CUZ A;  3JAM K;  2R7T A;  4QMF B;  4JI2 E;  2VT2 A;  4RB3 C;  3S2W A;  1MSE C;  2E5Z A;  2GZW A;  4F3Q A;  3OYK A;  1ZRF A;  2R93 J;  5EL9 A;  1TUA A;  1NHJ A;  2ID3 A;  2F48 A;  3RQI A;  3J81 K;  2X36 A;  4IS9 A;  1J5Y A;  4HLY A;  4A6E A;  1WVN A;  5C4J J;  3AG3 H;  4LF8 E;  3EUK L;  2ZXI A;  3G71 I;  4DPU A;  1Z0C A;  2HDC A;  4EJW A;  2LLK A;  2IS4 A;  5K36 D;  4FW9 A;  2HVQ A;  3I59 B;  2V6E A;  2GXB A;  2XGC A;  4IRH A;  3LWF A;  4A3I J;  3HM5 A;  3R60 A;  3GLX A;  5LRR A;  2E19 A;  1Z0V A;  1XNQ I;  4HNT A;  2L7K A;  2W25 A;  3FKI J;  5IT9 Z;  4PCQ A;  1JT0 A;  1DDN A;  2JA5 J;  1NG6 A;  4PDB A;  1Z0E A;  3ZN1 A;  2DDA A;  3QYB A;  2UU9 I;  1I39 A;  1SEI A;  4L5J A;  4KIT B;  4MHG A;  1BC7 C;  2K27 A;  1K1G A;  2B63 J;  2KKO A;  1YRN B;  2PNZ B;  1IDZ A;  3JSP A;  1MU5 A;  5LMU H;  2JSP A;  2M8W A;  4PU9 A;  2NVX J;  1T98 A;  1QPM A;  1J59 A;  4I0B A;  3ZQC A;  2A07 F;  4FHT A;  4ENK A;  4A93 J;  3OYD A;  2VQE E;  1VI0 A;  1TW3 A;  1UEK A;  4K0K I;  2CV2 A;  3W3C A;  1DPR A;  3F22 A;  3FXK A;  1GHC A;  4NXM E;  2VKC A;  2LMD A;  4BBS J;  3MAJ A;  1Y4U A;  1MNM C;  5EJC A;  5H20 A;  4N9I A;  3BR0 A;  1JUS A;  3HSF A;  4IRG A;  4J00 A;  1KU3 A;  1MMN A;  2ZXW H;  4V19 K;  4FIS A;  1XMA A;  2MGQ A;  2AO9 A;  2GXG A;  3JW4 A;  1B4A A;  2E1M B;  4G9Y A;  3HOY J;  1A6F A;  3BJO A;  1KTV A;  3G2B A;  1OYY A;  5HVQ C;  3SDG A;  2Q8K A;  2GO3 A;  1T39 A;  2VOD A;  4I0A A;  3U1K A;  4LCF A;  5C0X D;  4ZTF A;  3GBG A;  3ROU A;  2L0K A;  1FWL A;  4KYW A;  4QWQ A;  2RC4 A;  3WTZ A;  4IHX A;  1AWC A;  2J65 A;  4XNF A;  2IVM A;  4DR6 H;  1YO5 C;  3FBN B;  2D5V A;  2EA4 A;  3JCU C;  3VWB A;  2CQN A;  1VQ6 I;  2X1C A;  5IT9 W;  4XLH A;  3P9K A;  4S05 A;  1FMW A;  4B8T A;  2NN6 C;  2HGC A;  5E79 C;  2VN2 A;  2IGK A;  5FRM A;  4XOP A;  4XRF A;  1I94 H;  2MH9 A;  4A3C J;  4BQA A;  1U0J A;  1K83 J;  2IGM A;  2ZBK B;  3REO A;  5B3S H;  2O03 A;  2Q2E A;  2R3V A;  3GWZ A;  2DXI A;  4WAN A;  3PIP F;  1SMT A;  1R58 A;  2EFW A;  1FBS A;  4XLF A;  4DUZ H;  1ZG5 A;  2DFF A;  1FTT A;  2QQA A;  3UKG A;  2C38 A;  4DV3 E;  2M1B A;  3PRY A;  3ZZT A;  4G8X A;  4RAY A;  2ESH A;  4IQ4 A;  3V8K A;  1YIO A;  3GLL A;  4W97 A;  1ZGW A;  1YJW I;  3KEQ A;  1SMY F;  4PFP A;  3QYF A;  5L3B A;  2ZSH B;  1T38 A;  5DRP A;  2KHM A;  2BA0 A;  2ELK A;  2IP2 A;  3H9Q A;  4JI0 H;  1HW1 A;  3FIW A;  4BUP A;  5K36 B;  4UT4 A;  2ANN A;  4LK0 F;  4HPQ A;  3RKX A;  2LR8 A;  4E7Z A;  1JTY A;  5LEJ A;  1NHI A;  3M8E A;  4JP0 A;  2FQ4 A;  1S20 A;  2UV1 A;  2WAD A;  2CTE A;  3DV8 A;  1PKP A;  3HTU A;  3HB9 A;  1H0M A;  1G3T A;  4HX8 A;  2LD5 A;  1A36 A;  1MDM B;  5DTD A;  1D5Y A;  1IDY A;  2A05 A;  5LBQ A;  3KPH A;  2DFH A;  3M1C A;  3CMM A;  5LMU I;  4DR1 E;  3K4M A;  2PMU A;  4B3T E;  2YX7 A;  4JV5 H;  3I59 A;  2DOF A;  4DNC A;  3FX3 A;  4Q5S F;  2UXB H;  4HQM A;  4A3G J;  4MYT A;  2R7Q A;  3H0G J;  4C2M J;  3GFM A;  3J7A Y;  4EGZ A;  3M07 A;  3F21 A;  4Z7Y A;  4LB5 A;  3K4C A;  2WP8 B;  4DR6 E;  2CGP A;  1AHD P;  3GUD A;  3ZZU A;  5IOZ A;  4KDP A;  3I55 I;  4KT6 A;  5EEH A;  3EZJ A;  2NVU B;  2QSH X;  2G8Y A;  3IRR A;  1HK7 A;  3Q3S A;  1YRN A;  3CCV I;  1HKS A;  1SFU A;  2WAE A;  4I98 B;  2PNZ A;  3BY6 A;  2PQU A;  4YY3 H;  1X1P A;  2BXY A;  3CCM I;  2JEA B;  2DQR A;  3OYM A;  4F55 A;  4KMU X;  3C1D A;  4RB0 A;  4DUZ E;  2DJI A;  2H1L A;  5IYD J;  1T08 B;  2RQP A;  3M8J A;  4Q47 A;  1WJF A;  4D5F A;  3HOV J;  4LFA H;  5GAG J;  1LEA A;  4IFD E;  4L0Z B;  4DR6 I;  1O3S A;  4BJ6 C;  1OCZ H;  5K5R A;  2M3A A;  2DTR A;  1BOB A;  1S7O A;  1TP4 A;  2KDO A;  3H5A A;  2J5P A;  1OYR A;  3HTS B;  2JEB B;  3ZQL A;  2XGX A;  2YS9 A;  4PK4 A;  1ETX A;  1LKX A;  4IRI A;  4JI0 E;  1I94 I;  3CMY A;  4BDZ A;  4Y52 J;  5JEA E;  2K86 A;  5KVR A;  2BHY A;  2K9M A;  4BJT A;  4YII A;  4DZP A;  4M9S A;  4RAZ A;  3HRU A;  3HRM A;  5DD8 A;  4IKF A;  2OU2 A;  3CJN A;  4X6A J;  4DUZ I;  1QZZ A;  4X1E A;  3PFI A;  3MN2 A;  4DV0 H;  1I6U A;  2XF6 A;  4JOM A;  1HNZ E;  4I6Z A;  5C44 J;  1IAW A;  5KHD A;  3M85 G;  2LF8 A;  1H72 C;  5JVT A;  2P5V A;  4JX6 A;  2XPU A;  5AIP A;  1LDJ A;  3H3V K;  2G0E A;  4L9T A;  5IWA H;  1WHU A;  2G7H A;  3HOS A;  2V1D A;  4AYB N;  1N36 E;  4PJL A;  1ZKG A;  3CLO A;  4XLE A;  3WU2 C;  2V2Q A;  1ETQ A;  4JI0 I;  2ZBK A;  4OZE A;  2H8R A;  3DPU A;  2GAU A;  3GTP J;  3PQK A;  3ZRG A;  5EKW A;  4YHH E;  3T1Y H;  1IGN A;  2DFI A;  1GDT A;  2HTJ A;  4XKV A;  3HKM A;  4RB2 C;  3K70 C;  5TGT A;  4NC8 A;  1O4X A;  2UUB H;  3PNY A;  4PGH A;  1UAA A;  1XNR E;  3QPL A;  2WV1 A;  3DFG A;  5DD4 A;  3DKY A;  2O3Z A;  4RA2 A;  2WNR B;  3V7S A;  4TV7 A;  4A3E J;  4KIS A;  1WI9 A;  2E36 A;  2HYJ A;  4JV5 I;  3K4J A;  4ZZD A;  4OO1 E;  1BBY A;  2F4I A;  5BNG A;  2L9N A;  2JSC A;  1RKT A;  1U3E M;  2NPF A;  5LHI A;  2YPR A;  4WCG A;  2B7E A;  1R6R A;  2HXI A;  4OWR B;  3DEE A;  2RN7 A;  4P5O A;  4BXU A;  2STW A; 
#chains in the Genus database with same CATH homology
 2BA1 G;  2PO1 B;  2HH2 A;  3L7Z A;  5K36 E;  1UDN A;  3L7Z C;  2JA9 A;  2JVZ A;  2OPU A;  1ZZJ A;  2E3U A;  2PNZ B;  2PO1 A;  5C0X B;  2WP8 B;  2CPQ A;  2CTL A;  2NN6 G;  1VIH A;  3KRN A;  4AIM A;  3VKE A;  2JE6 I;  1UDO A;  4IFD B;  4LIJ A;  2Z0S A;  1ZZI A;  2PNZ A;  4AID A;  5C0X A;  2WP8 A;  2PQU A;  1DT4 A;  2MJH A;  5C0X C;  1VIG A;  5C0X F;  1X4N A;  2BL5 A;  2FMR A;  2JEA B;  3AEV B;  1E3P A;  4IFD A;  5K36 G;  2JZX A;  4BA2 I;  5C0X E;  4IFD C;  1ZZK A;  5JEA B;  4IFD F;  4WAL A;  1DTJ A;  3DD6 A;  3GME A;  2AXY A;  1EC6 A;  2JEA A;  4IFD E;  2DGR A;  3U1K A;  3H1C A;  5C0X D;  1KHM A;  5JEA A;  1J5K A;  1OYR A;  3GCM A;  2JEB B;  2JE6 B;  2C39 B;  2PO2 B;  2HH3 A;  5JEA C;  5JEA F;  4OO1 B;  4IFD D;  1X4M A;  5JEA E;  3M7N D;  4BA1 I;  2PY9 A;  5C0X G;  3M85 D;  2CTK A;  2JEB A;  2JE6 A;  2C39 A;  2PO2 A;  4NBQ A;  4B8T A;  2NN6 C;  1E3H A;  4OO1 A;  4BA2 B;  2NN6 F;  3H36 A;  3V69 A;  1R6M A;  4IFD G;  4OO1 C;  1UDS A;  2PO0 B;  4OO1 F;  2BA1 D;  2C38 B;  3M7N G;  5JEA D;  2CTF A;  3M85 G;  4AM3 A;  1WE8 A;  1WHU A;  2QND A;  1J4W A;  4WAN A;  4JVH A;  2C37 B;  4BA2 A;  1OYS A;  2NN6 B;  2ANR A;  2PO0 A;  2JEA I;  2C38 A;  3CDI A;  4QMF B;  5K36 C;  5JEA G;  5K36 F;  2NN6 D;  2P2R A;  1TUA A;  3GLL A;  2BA0 D;  4OO1 D;  3B4T A;  2C37 A;  4BA1 B;  1R6L A;  3HKM A;  2NN6 A;  4JVY A;  2BR2 B;  2BA0 A;  1WVN A;  5K36 B;  2ANN A;  2WNR B;  1ZTG A;  2BA0 G;  2JEB I;  2YQR A;  4OO1 G;  2NN6 E;  4BA1 A;  2OPV A;  5K36 D;  1UDQ A;  4OO1 E;  3L7Z B;  2CTE A;  2BR2 A;  1K1G A;  3CDJ A;  2CTM A;  5K36 A;  1OYP A;  2CTJ A;  2WNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...