4AM3A

Crystal structure of c. crescentus pnpase bound to rna
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
622
structure length
622
Chain Sequence
GSMFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAVFAKSQKPGQDFFPLTVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVKGFKNEVQVVVTVLQHDLENDPDILGMVAASAALCLSGAPFMGPIGAARVGWVDGAYVLNPTLDEMKESKMDLVVAGTADAVMMVESEIQELSEEIVLGGVNFAHQQMQAVIDAIIDLAEHAAKEPFAFEPEDTDAIKAKMKDLVGADIAAAYKIQKKQDRYEAVGAAKKKAIAALGLSDENPTGYDPLKLGAIFKELEADVVRRGILDTGLRIDGRDVKTVRPILGEVGILPRTHGSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKESFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLAMMDAGVPLVRPVSGIAMGLILEQDGFAVLSDILGDEDHLGDMDFKVAGTSEGLTSLQMDIKIAGITPAIMEQALAQAKEGRAHILGEMNKAMDAPRADVGDFAPKIETINIPTDKIREVIGSGGKVIREIVATTGAKVDINDDGVVKVSASDGAKIKAAIDWIKSITDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Caulobacter Crescentus Polynucleotide Phosphorylase Reveals a Mechanism of RNA Substrate Channelling and RNA Degradosome Assembly.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase/rna
molecule keywords POLYRIBONUCLEOTIDE NUCLEOTIDYLTRANSFERASE
total genus 175
structure length 622
sequence length 622
chains with identical sequence B, C
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2012-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF00575 S1 S1 RNA binding domain
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 4am3A02
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4am3A03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4am3A01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4am3A04
2NN6B 5C0XD 4IFDE 3L7ZC 1WVNA 2PNZB 4NBQA 2NN6E 2ANRA 5JEAG 2BA0G 1DT4A 4AIDA 3M85D 5K36C 1VIHA 1E3HA 2PO1A 4OO1E 5JEAB 1J4WA 2C37A 2BA1G 4BA1A 1UDQA 2CPQA 2CTMA 4IFDF 1OYSA 2PO1B 1X4MA 2PY9A 2FMRA 2HH3A 2CTEA 1ZZKA 1J5KA 2BR2A 5K36D 2C38A 2JE6I 2CTKA 2JEBI 2OPVA 4BA1B 2DGRA 2WNRB 5JEAD 5JEAA 1E3PA 4AM3A 5K36F 1DTJA 2JZXA 1WHUA 3B4TA 2JEBA 1ZZIA 2JEAB 2NN6F 2WP8B 4OO1A 3M7NG 2BA1D 3HKMA 3CDIA 3GCMA 1WE8A 1K1GA 4AIMA 3M85G 2ANNA 5C0XB 4OO1B 2WNRA 4IFDA 1KHMA 2Z0SA 2JEAA 4LIJA 2WP8A 2HH2A 2JA9A 5K36B 1OYPA 2JEBB 4B8TA 3AEVB 4JVHA 2PQUA 2NN6C 5C0XE 5JEAC 3H36A 4IFDC 2BA0A 3V69A 4BA2B 2C37B 5C0XG 2BR2B 2CTLA 4IFDD 4OO1D 3M7ND 3L7ZB 3KRNA 1ZTGA 5C0XF 4OO1F 2PNZA 4BA2A 1EC6A 3GMEA 1UDOA 2NN6A 1R6LA 2JE6A 3DD6A 1UDNA 4OO1G 2BL5A 2QNDA 2YQRA 2E3UA 3L7ZA 4BA2I 3VKEA 2NN6D 2OPUA 4OO1C 2PO0B 4JVYA 4WANA 2CTJA 3GLLA 2PO2B 2C39B 3U1KA 2P2RA 5JEAF 2C38B 5K36A 1UDSA 2C39A 2CTFA 4IFDB 1R6MA 2BA0D 2PO0A 5K36E 5K36G 2MJHA 1X4NA 3CDJA 2JEAI 5JEAE 4QMFB 2AXYA 5C0XC 2NN6G 2PO2A 3H1CA 5C0XA 4WALA 1VIGA 4IFDG 1TUAA 4BA1I 1ZZJA 2JE6B 1OYRA 2JVZA
chains in the Genus database with same CATH superfamily
1RHYA 1FYKA 2XEXA 4DUYE 4OAYA 3I4PA 4A69C 1TNTA 4AIJA 2HPMA 2BV6A 2VT2A 3OR1C 4DV6I 2OF7A 3EPZA 4FN5A 1FMVA 2RAEA 1VBIA 1ENHA 4B4CA 1QZZA 2ELKA 1MIJA 5K7FA 4WF2A 1OLTA 1Z1DA 1SVMA 2W4SA 1OYSA 3CLQA 2JTVA 1WI3A 4JI8I 2FE3A 4J19A 2X48A 2JVGA 5IT9C 2G9WA 4XL9A 5ICFA 1IBKE 2ZJQF 4ON0A 2NYXA 3LSJA 4Y52J 3S15J 4LF8H 3ASOH 3HYIA 3RIRA 2EH3A 1B6AA 5EG0B 2FXAA 1YITI 5K5OA 5FFXA 4LF9E 2M4GA 3OTOE 3OETA 3TOBA 5KVRA 2LFBA 1MJBA 1SVLA 4I7HA 1ULYA 1VF9A 5HODA 5E3OA 1SEUA 3AL0B 4GO1A 3HULA 3VSKA 1PP7U 5C4XJ 1WSUA 3ZGKA 1J09A 5EG0A 4URLA 1F36A 3G3ZA 4LFBI 4OO1B 1S03G 3ELKA 1ERDA 3OYMA 3PUFA 3LSIA 2CJJA 3OS1A 5K36B 1HKSA 2FD5A 1I3AA 1WRJA 1YJNI 4LB5A 1EH8A 4E70A 3DV8A 3X2QH 3QPSA 4UUVA 3LSKA 4IXAA 4IFDC 4L5IA 1BKNA 3CJNA 4XNFA 4NQWA 4S0HB 2MGQA 1XNQI 1ZAOA 4HA8A 3FMRA 2NVXJ 2IA1A 2Y31A 2K9SA 4A0ZA 1GT0C 1FKAH 4LF7E 5E3LA 1FPQA 4B09A 2ZM6I 3T1HE 5CVIA 2UV1A 4UB8C 1TTYA 2UUBI 2JE6A 4DUZH 5ICGA 4OO1G 2QNDA 4XLCA 3D0SA 1KU2A 4DUZI 2V6EA 2VIXA 2QZ8A 3L7ZA 2UXDE 3JRDA 3WU3A 2QKMB 1LDDA 1DDNA 3VKEA 3DBHB 1MH3A 1IN7A 1Z0TA 5K7HA 1NZ0A 4U0VA 3FXMA 2CTJA 1QO0D 2PLYA 1MZBA 4A3DJ 4BXUA 2O1VA 1E17A 1ORKA 2FQ4A 4M9XA 4JI4E 5GADJ 3G71I 4KIBA 1T56A 1Z0CA 3DKYA 4IQJA 3GXOA 3D5LA 3V7SA 5LHGA 1BJAA 4YIRX 3I55I 1ZREA 2VUMJ 1S4EA 3S3OA 4K0KE 5TISC 3H0GJ 2OQGA 3IHUA 2GS8A 2JUGA 4PGHA 1GV2A 1BR4A 4QSHA 2MLGA 4CZCA 3PQJA 1J0RA 2VOOA 4YY3I 5C0XA 5L3BA 1X9ZA 3KDGA 3J81W 2MD5A 1TUAA 3DLLF 1J75A 4DV0E 4LLLA 4A6EA 2EWNA 5C0XD 4LG3A 3HOTA 1LEAA 3QOEA 2HPIA 3CUQC 2NN6E 4K0KI 4AIDA 1TQIA 4LF8I 3DTEA 1IW7F 4EV0A 4B3TI 1R7JA 1KU9A 4U3DA 3M85D 1HR0E 4KDPA 3K10A 5DYMA 1D1AA 4BJ6C 4DW6A 1Z0BA 2EILH 4B43A 1DU0A 2GO4A 1I94E 3IH2A 3KP7A 2Q2EA 4NDLA 3KP4A 4BDYA 4OX9H 4DV0I 2HFHA 1MMAA 2R7TA 1XD7A 5DTDA 1FJGI 3GR5A 5FD6A 1J5KA 2L7MP 4UVAA 1Z0XA 2P81A 5K36D 2C38A 3OL3A 4XRSG 4E7LA 3V5RA 3HJEA 3GTPJ 3JRAA 4FWHA 2JJ7A 1CF7B 1N36I 2PT7G 4HNTA 4RAZA 1TBXA 3RI4A 1XGOA 3V4GA 3J7AM 2STTA 4JI3H 4JI7H 4ESJA 2WP8B 1USVA 4IVNA 5CLSA 5A2QQ 4BGDA 2HTSA 2LSOA 1S3JA 1FBQA 4Z2YA 4PRXA 2F4VI 4JI6H 2M0MA 1IO2A 3R60A 5ED4A 3M4OJ 2MH2A 1CGPA 4UT4A 2EFWA 3JSOA 1ETYA 1QRYA 4LIJA 1N32E 2LLKA 5J8FA 3WTYC 4AWXB 3PYDA 4M3DA 5HVQC 2XAJA 4IZJD 1ON1A 3WE3A 2K3FA 3BCAA 3G73A 5FLMJ 3L2VA 1G3SA 2BA0A 1IZ1A 3F9KA 5HLGA 3HHGA 5E8GA 2DOEA 4M3BA 2UZKA 2E35A 2F4MB 1H7UA 1G8XA 2OCCH 3QOPA 4ZYDA 4E7KA 1KYWA 2UXXA 1VQPI 4XSZF 5J4YA 1DGRM 3DPTA 1FLIA 3CC7I 1OJLA 3NEUA 4XKWA 1D5YA 1RZ4A 2VKDA 5F1JA 1I6XA 3DP7A 3ESWB 3DD6A 2DEJA 3PO2J 5FKOA 3RZOJ 1WVRA 2BYVE 2K86A 2WAFA 3GUDA 1XGMA 1Z7LA 1P7JA 2PI0A 1BN5A 3BG9A 4RA2A 1DP3A 1QVTA 4LFBE 4JV5I 3MZ8A 3QODA 2KIFA 3GYHX 2DBBA 1FBUA 3BCBA 3R6SA 4GKJI 3SZPA 3OYBA 1LFUP 2K40A 2UUBE 5LFAA 1VI0A 1I27A 3MCZA 3REOA 4ZDPA 2Z5BB 5IP9J 1UDSA 4PJLA 3L9FA 2C39A 4DV1I 1R5GA 2I10A 4IZZA 1XNQE 3ZOBA 2GA2A 3WTZA 1TT5B 3UKGA 1VQ6I 5LMUE 2Z5BA 2LP0A 4IPAA 3M8JA 3E6MA 5DRQA 5M3FJ 5LL6R 4IRGA 2FRHA 4LF9I 5FO5A 4E6KG 1UHSA 4YFKF 3AG2H 2G7UA 2K1HA 2JT1A 4HXZA 1P7IA 4KISA 2DT6A 4IFDE 3L7ZC 3CC2I 2E1RA 2UXDI 3H9GA 1T38A 4CYDA 3LSPA 1A6FA 5F04A 4DV7I 2XPUA 5M5WJ 3ZQGA 1ZRCA 2FSWA 4BDZA 2DOAA 2NS7A 2QENA 2ID6A 4QPOA 2UUZA 4LG0B 4DZPA 2DA7A 3TQNA 3GBGA 4RBOA 1UDQA 4LLGF 4P1WA 1REPC 2CUJA 3ABTA 2NOGA 5EEHA 2GXAA 4RB3C 1TNSA 4HV5A 4K2EA 2BR2A 1OYWA 3CJTB 2XGDA 3ONQA 2JEBI 4AU7A 2X51A 4FWDA 5L3JA 1XMOI 3IAS2 3C7JA 2ZC2A 4MFEA 2AS5F 2W00A 2IESA 4KYWA 2O3ZA 3PS1A 2FU4A 4IHYA 5DRRA 1DTJA 2NOJB 4DR1E 1QGPA 2HWVA 1AKHB 1WHRA 4RM2A 4BL0B 5IYDJ 4BEHB 2F5CA 4RAGA 1NK2P 2VE9A 3HKMA 1Y39A 4FASD 4HDUA 1X58A 5K7ZA 3S16J 1AA7A 3ROUA 4PRVA 4ESBA 3OYAA 2VBZA 4IFDA 2DK8A 2XDVA 1TWAJ 2E34A 1QNTA 4ENKA 1VZ0A 2L9NA 4DPXA 5BR8H 4XOTA 5FFZA 2BM0A 2EA2A 1OCCH 2UU9I 1BC7C 3TKYA 2WW4A 1HNWE 2DQLA 2GXBA 4DV6H 3QYFA 1B72B 2MSYA 2BE5F 4BXFA 5J8CA 2YU9J 1X4PA 2A61A 1ETWA 4Y33A 5FLXQ 3F6OA 4M71A 4X0GA 2BVMA 1U5TC 1LVAA 1ZM2A 3MAJA 4EMDA 4JI1E 1JE8A 2AJ4A 3NCVA 3BJAA 2CYYA 4D0PA 2C6YA 3G4SI 5D8LB 5E20A 4ISAA 3MD2A 3OTOI 1A6IA 2GAUA 1X1CA 2MW8A 4XR6A 5D4SA 2UUAI 1D8JA 4XM3A 3ZPLA 3VSLA 1IXRC 1W1WE 3OS2A 3M1CA 2WWYA 4BACA 4IZJB 4FWGA 2VJ5A 1G2HA 4OO1C 4G6TB 3QPLA 1JUSA 2DTRA 5FKMA 3WE2A 1UG8A 4OWRB 1LFBA 3JRFA 1N36H 1IJWC 4M9ZA 3HTSB 4NXMI 4BY7J 1AHDP 4CICA 1N33I 3F0NA 3JSPA 1ZXMA 4B3SH 1B1BA 2NXNB 3Q9SA 1AU7A 4IFDB 4EGZA 5JR3A 2IOQA 3PFIA 4EJTA 3AL0C 3J7AK 2KKOA 3SZGA 3OTOH 4LFCH 3CWVA 4B48A 3Q0VA 3S93A 4N4OB 4KITB 4FX0A 1HDDC 2ZSHB 1NHHA 3MEXA 2KLOA 4BEHA 3ZQIA 1KYZA 5L3FA 4CDGA 1AKHA 2IERA 4JYAI 4BBSJ 1T95A 2LDUA 1QU3A 3Q6MA 4M3FA 2D5VA 1T39A 4DR2H 1XMAA 1MD0A 3RF2A 2WAQN 3QQAA 2KRFA 2DODA 2OV7A 3ZKDA 4Q48A 2DFHA 3BZKA 3H4LA 4G7HF 3DCFA 1PKPA 4LFCE 5D6FA 1YW9A 2EFOA 4DV3E 3HOWJ 2VI6A 2CQ7A 3ZM7A 2EZKA 4LJZF 1LE8B 3RSNA 5FB2A 4DV4H 5EGOB 2PFBA 1GDTA 5DUKA 1HA8A 1PIEA 4IS9A 1Z9CA 1FWLA 2XRNA 2BGCA 1KONA 1QPMA 3FHZA 3VYRB 2LD5A 4DR7E 2NVTJ 4M73A 4ZYHA 2Y2ZA 3E5UA 3OIOA 4MQ9F 4WUBA 1P42A 2Z5UA 3GZ5A 2L9SA 2RV8A 4B3ME 4BA1B 2W1OA 3Q6NA 2XRLA 4X6AJ 1Y0UA 1TLHB 1KQ8A 1VNDA 1ZGJA 3TO7A 3B4TA 1RI7A 5KK1A 5L3GA 1N0UA 2X6OA 2RC4A 4LK1F 1IGNA 5EJCA 3V8JA 4EEFG 5E18F 4AYBN 5HS8A 4HX8A 3DTKA 4HYMA 2D2WA 3LSHA 3W6JB 2FOKA 2IS2A 1RC9A 2WA0A 5CJ9A 3CO7C 5ERIA 1K78A 2CV0A 3M85G 2ZQEA 3FISA 2WNRA 1ZH5A 3FAUA 1MBKA 1BW6A 1X3WB 1DP7P 2JA9A 1ZARA 4KQVA 5LGUA 1NHIA 4UV8A 5GAHJ 3S3NA 4NXME 1VFCA 3QT7A 5C0XE 4JVHA 3PYFA 1YH8A 2V9PA 3GZNB 4EM0B 4M6XA 1NHJA 1F5TA 2BM1A 4ESFA 3WU6A 3KPHA 3OYFA 3OS0A 4ITVA 4L18B 1WFXA 3CMMA 4L5JA 4ABZA 4C2MJ 2QQ9A 4A0YA 3ZZ0A 1YLFA 1FBSA 1ZTGA 3CDLA 2KDOA 4Y7NJ 2B9SA 2DAOA 3ZQQA 4GKJE 2GIVA 1ZGAA 4QIWN 4I02A 2BL5A 3BR5A 1YG2A 1NTCA 3R0JA 1ON2A 1XGNA 4JP0A 1LNWA 1D0ZA 2CMPA 2VXDA 4CHUA 1H74A 1HKTA 1ZG5A 4FHTA 3O3KA 3RKXA 2Z5EA 3EDPA 2VQEE 1S5LC 1X1AA 2R7OA 2STWA 1F43A 5H20A 3IH4A 3QPTA 1O57A 4PFOA 1WJEA 2XAHA 3HGYA 5GPAA 3KIOA 1ZQ3P 1D6TA 5FKKA 4YELA 3HOYJ 1Y6IA 1SD5A 2ZMEB 4JI6E 3FBNB 3ZMTA 2LBFA 2LF7A 1N78A 4JI5I 1RR9A 2EBIA 2BXZA 4WXCA 3P3EA 3FXOA 4CUGA 3QPHA 4D1QA 2M8WA 1XSDA 4LMYA 2Y48A 2UWMA 2QBYA 2CGPA 1BIBA 1PUFA 2P6SA 1MBJA 1ZLJA 4HBLA 1IBLI 3J7YJ 1B8IB 1OYRA 3T8RA 1R23A 1SFOJ 4NXNE 2RDPA 3SB1A 3U2RA 2L7KA 4S04A 2BBYA 1YYVA 1JKPC 3CO6C 3V2UC 2ZNZA 2HDCA 5K36C 1MNDA 3EUAA 4KN7X 1T08B 5D6EA 5E17F 1I1SA 1XDUA 2CQXA 3OYLA 5FLXK 4JI3E 2FOWA 2R7QA 1IN8A 2M8GX 1RREA 5CKTA 1MMGA 4RAFA 5BPIA 5DRPA 2N8GA 1X4MA 5D4RA 4Y4RA 4WXDA 5BPDA 2EFGA 3OOUA 2FBHA 4JI6I 3V7RA 4G8XA 5F0HA 2OU2A 2RN7A 3F6VA 2M2EA 3G2BA 3ZMUA 3ZXSA 5F1RA 3LAPA 2ELHA 2LBFB 4AM3A 3OL4A 3VDXA 4KICA 2CZ9A 2JZXA 2OZUA 1HNZH 1MSEC 4X65E 2BY2A 4KT6A 5J47A 1Y1WJ 4MU1A 1I50J 2QEXI 2RNGA 1IN5A 3OV8A 3HBLA 3P9KA 2UXCH 3ERMA 3BTCA 4GCVA 2IBDA 1UG0A 1CQTA 3OYHA 2LRRA 1IUYA 5LBQA 3K2ZA 3J81C 1R4NB 2DDBA 4GFBA 3BR1A 1PP8F 1G4DA 3FKJA 5CPRB 4ZZDA 1QZYA 3KETA 2IRFG 5KNLA 3PO3J 4K0KH 1WH7A 4CCNA 2PJRB 4MYTA 3LFUA 3J80Q 4AIHA 3EYIA 2HOEA 3L7ZB 1HNXE 2G7HA 5HDKA 2CFXA 2DDAA 5DCFA 5C0XF 1K7AA 2EFNA 3KEYA 3BZCA 4YIFA 2QSHX 2CUFA 1MMSA 3F8NA 3S1RJ 4HNVA 3LA2A 2ID3A 1H73A 1JJ8C 3P06A 2E5NA 1O3QA 3AG3H 2X36A 3BZ6A 3FMQA 3ISPA 4G6QA 3JAMW 2MC3A 1XMQH 5FLXZ 2CW0F 1Z67A 1X4OA 2PMZN 5GP9A 1AOYA 1N77A 4IHWA 1LB2A 3BR6A 2V34A 2A1SA 3P9CA 4OIQF 5DCMB 1LVKA 2MH9A 2IOPA 4DR6H 2KJBA 2A6HF 1UAAA 4OMZA 2P2RA 1UG2A 2GIZA 3DXJF 5JEAF 2CU7A 2Y3MA 2IGNA 5H6RA 4E7ZA 1W7PA 1MNEA 2PMUA 3JRBA 4QNJA 1S7EA 3ECHA 3E6DA 1SFEA 4KMFA 3OSGA 2X1CA 3M1EA 2QVOA 1XN7A 3CP8A 3PM1A 3TO6A 2D1VA 1T33A 2DJIA 2H27A 2CQNA 3GTJJ 2ME6A 3I5UA 2JPCA 4HACA 2VPRA 4MEYF 4HG2A 2NVUB 5JLXA 3H9JA 1DPUA 2JVZA 3ML6A 1KKHA 3PNTA 3TEDA 1FJLA 1J5EE 4YRVA 4YHHH 4LF6H 3DLAA 3B6CA 1DT4A 4X1EA 1IBLH 2VONA 4FQGA 2A5YB 2CW8A 4CSWA 1UELB 3IKTA 1S20A 2R42A 2LY1A 3GF2A 1RR8C 2XIGA 4UB6C 2FPHX 3A03A 3I59A 1P4WA 2WAQA 5J3LA 2DXIA 1XSVA 4X66E 3L2RA 1EH7A 2ETHA 2F48A 4JYKA 3MKZA 4OIRF 2BV3A 2Y69H 4IZKA 3CCEI 3J80Z 4DPYA 4L0ZB 2M3AA 2DTZA 4DPTA 2BHZA 2JZYA 5FGMA 5EGOA 1TQMA 3HUGB 4N0BA 2DW4A 2IS1A 2DMTA 1XMQE 3LWFA 3LSMA 4F91B 1VQNI 4KMUX 2EV0A 3E97A 2NNNA 1IV6A 4RB0A 4H0EA 4YY3E 4BHBA 1ZN2A 4UV9A 5M5YJ 3SQNA 5GPCA 1JJ6C 5A2QK 4NHJA 1XC5A 3I64A 3T1HH 2QM3A 2E2HJ 2ANNA 3O8HA 4FW5A 2HK2A 1F4KA 3PUBA 1S8NA 5DS9A 4OINF 1OYPA 4B8TA 1WPKA 3Q3SA 4OU0A 4E4HA 1I94I 4IF4A 2BW3B 2LH9A 3QYEA 4HZFA 5JEAC 2M45A 1U78A 3CCRI 3HB9A 1FP2A 1EA6A 4XIDA 1B59A 3GONA 1U5TA 3B8HA 4LF4I 1S9HA 3W2VA 4ZYGA 4I09A 4G94A 3KEOA 2VQFE 2J7KA 2FBKA 4UUTA 2Z1DA 1B72A 3JAMC 2F5VA 5HS7A 3WG7H 2QBYB 2QWWA 2VC0A 4LCFA 4NNJA 2UXBI 1ZRDA 4AUXA 3WTSC 3VFZA 3QP6A 3GO5A 2E1MC 2KJCA 5DD8A 1VQKI 2R7WA 4DOZA 2NNYA 3GLLA 2PO2B 1FOWA 2HYGD 2IGMA 3LTOA 1TWCJ 5BMZA 1J7KA 1ACIA 4XRFA 2O61A 2CQKA 3F8CA 1MJ9A 1WQ2A 2DA4A 1G6NA 2EZIA 3E6BA 4A3GJ 2UUCH 2BA0D 4LF9H 2B63J 2CQQA 1ODDA 2VOPA 4FCYA 4KHPI 4IZJA 2PBIA 1JHHA 3CP2A 2P4WA 1N34E 4R1HA 2V26A 4A3BJ 2F1DA 4LIVA 4JI0E 4B3RE 3BOQA 3Q5FA 4CCLA 4PJ0C 5A2QZ 3SXYA 4A5NA 2OPTA 2XF6A 4LG0A 3RKQA 1X0AA 2E5LH 2NN6B 3DWLE 5IT3A 5EEAA 2K3PA 3I9V2 2CGEA 5E3MA 3V7CA 2E5LI 2V1XA 1RKWA 4U7DA 4MIMA 1WJDA 4Q5SF 1LEBA 4EM2A 3J7ZI 3ASNH 1VQ8I 1I1GA 3K1PA 3CCVI 2PO1A 2DI3A 1BOAA 3GEZA 3BC8A 4C9YA 2JRMA 4BJ5C 4F92B 3GFLA 5J4VA 3EETA 5L3CA 2XHKA 2ZSIB 4KT5C 1BM9A 3FK7A 1VQ7I 4KHPH 2X6YA 1O3TA 2CWEA 2OAZA 2PY9A 1ZZKA 3B02A 1S6LA 2IXSA 3GTKJ 5D5WB 5CVUA 1HK7A 2F4VE 2OD5A 1USTA 3K17A 4DV2I 1IBME 2R5ZA 2IW5A 4A3CJ 1RIOH 2ZM6E 4BJTA 2V1DA 4KFCA 1WHUA 4Y13A 4PFPA 2LC2A 2V79A 3N97A 2JEAB 2WC2A 4DV3H 4JX5A 1OFCX 3QP5A 5C44J 2O6GE 4OD6A 4JYAH 3MWMA 1PYVA 2E1CA 1S7OA 2ZMEC 3VYUB 2W85A 4XN3A 3FDYA 4A3FJ 3NQOA 2O1WA 4J01A 2JEBB 4I76A 1Z59A 3G1MA 2VJ4A 4MU3A 3K9TA 4UNOA 2JA6J 4X62E 3HOSA 1ETXA 4UUSA 2A2CA 4NXMH 2ZBKB 4CO8A 2M5WA 2KZGA 2E19A 1ZG3A 4OAZA 2FF4A 1C0WA 1NHAA 2IS4A 2R7UA 3IUOA 2KT0A 4C3JJ 2DPUA 2RKHA 4MNUA 3LNUA 1N36E 3TP0A 2IEKA 1SANA 1EC6A 2UXBH 3RKWA 2ZJPF 1Y1VJ 3L00A 1HW2A 1UDNA 4JI5H 3K4JA 4PSWA 5AIQA 2KZVA 5IY5H 1ZK8A 3L2WA 3VPRA 1YX3A 2A68F 3V8LA 2LKXA 4A0XA 3C2BA 2DMQA 3BJ6A 3CMYA 4DV6E 1RR7A 3I0TA 3K70C 2HR3A 2W25A 4KN4X 5LLQA 1VQ5I 1FSHA 3QT6A 2D45A 3HOZJ 1W5TA 4IOCF 1MNMC 2QA4I 2XV4S 1ZLKA 2EJRA 5JHFA 4HACB 3DF8A 3KZZA 5B1BH 2KDZA 3SJMA 1MW7A 2QQBA 1LPQA 3U1KA 4DV1H 1X1DA 1NK3P 1K47A 3RPUD 5IP7J 4DYRA 4GRIA 3CCUI 2Y0MA 2MABA 4JK1X 1P92A 4YY3H 1J5EI 4NXNI 5K36G 4GDFA 1ZM3A 1HNWH 5GMEA 2QKLB 3L2CA 4DR1I 1TW2A 3KZIC 4G9YA 4DYCA 1OISA 3P5JA 3VYSB 2PO2A 3T1HI 3HSFA 2OJED 1JUMA 4ED4A 2Q2EB 4GXOA 1RESA 3K7AJ 4PGGA 3IRQA 4DV7H 3LFKA 4XSXF 1P4AA 3NAUA 2V2VA 4X66H 3K4NA 2D9IA 3GFIA 3WTUC 2NVQJ 2A07F 2F4OB 1XSXA 2G8YA 1FSEA 5B66C 2Y75A 5D8KB 1CF7A 4OO1E 3MZYA 1L3LA 3WU4A 3S32A 3AG4H 3QYBA 3E5XA 3FX3A 5DV5A 3ULQB 3M9AA 2ZITA 4IFDF 5F0CA 2PO1B 3HC7A 3CCSI 2QYOA 1XMKA 4BQOA 4HQMA 2CTEA 2COMA 3GLXA 3DBRB 4JQFA 3FXLA 2M30A 1Z7UA 4LFUA 4BHCA 1DGWY 4PDKA 5K36F 1E3PA 3S1NJ 2CRGA 2VQHA 2ECCA 2GBYA 3DQVC 1OMIA 3IKVA 2PEXA 5F0FA 2E71A 5F64A 1XB4A 2IVMA 2M4KA 3M07A 1D0XA 1YX5A 4Z6YA 4AQYE 1TWGJ 3E1SA 4YFNF 3WU1B 1WE8A 2MD0A 3DKWA 1U2WA 2G0EA 1H9TA 4AIMA 5C0XB 2OA4A 5ICEA 3R61A 2KQRA 4R79A 2VQLA 3T5XA 2K4BA 3K70D 5LGNA 4DBQA 1VQMI 3FXKA 4X64E 1KZHA 4KA4A 2JA8J 2LNBA 5LMUH 3BQZA 2F2EA 3FMSA 3HGGA 4KUMA 4HNUA 3CQZJ 2C37B 4DR6I 1KQ9A 2L2OA 3GX4X 2V9VA 3UNGC 3MKWB 2BW3A 1OR7C 3HHHA 4NC7A 2K5CA 1HW5A 1YOVB 1ODHA 3FHNA 1POGA 1N32I 4UHTA 1HNXH 2HTJA 1WWXA 3WGHA 2NS0A 4X65I 4FX4A 2EIMH 2VODA 3D4JA 4M72A 3N4MA 4Y3OA 2XAUA 3T8TA 5AONA 1ZXNA 4GYGA 4E7JA 1YS6A 3OYCA 1VQ4I 3S8PA 2JT2A 4BH9A 4OZEA 3P76A 4B3SI 1HNZE 3TW6A 4GKKI 3L09A 1N33H 2DK5A 2H6CA 2CFOA 1MSFC 3HZJA 1WKMA 4XK4A 1IRZA 4JI3I 2CW7A 4HYEA 5ICCA 2F5DA 1X2NA 2RQQA 3FXJA 1Z6TA 1GHCA 4ZTJA 2HEOA 4PU9A 3B78A 4IZKB 4MEXF 4DPWA 4B8XA 1IXSB 3F8FA 1IBMI 1OKRA 1YS7A 1IAWA 1X4NA 1H8AC 4JOMA 3LMMA 4E7SA 4RB1A 4C2UA 3GABA 3JTHA 2CV1A 4LFAI 2OBPA 1BI0A 3VWBA 5JVTA 4ENNA 5C4JJ 2EPFA 2XAQA 3S14J 2OZ6A 2LTPA 1HXDA 1BI3A 4WX9A 1XG1A 3ZCOA 3A0HC 3JRHA 2WB1A 5DM7F 1QBJA 4L0YB 2FNAA 2CO5A 2Y9YA 5KHDA 3KYLA 1LQ1A 1E3HA 3E3VA 1S16A 1I94H 4JI7E 2IA0A 2EIJH 4NQWB 2HKOA 4XKCA 3BT9A 2TRTA 2CG9A 3WU5A 4Q4ZF 3H9QA 3ZZUA 1H7SA 1FEXA 1DQUA 4F3QA 4U3BA 2M0CA 4MQVA 3SEQA 4ENJA 1AN7A 4B3MH 1W7PB 1P6RA 4M6YA 2VF3A 3CD6I 2LR8A 2ZXIA 3Q0UA 1USSA 2AQFA 4XQFA 3CDHA 4ENMA 1K79A 1J59A 3HRUA 4M1KA 2HK3A 3S2HJ 1O3SA 4LF5H 5BS6A 3A0BC 1SAUA 1FOKA 1T98A 4AYBA 5JLWA 1YO5C 3AAFA 2OC6A 4OKGA 4P9FA 4BE0A 2EZHA 3CJQB 2GXGA 4EQQA 4FTHA 2BA1D 4F55A 3CCJI 1YE9A 4C3HJ 4AD9A 5IPAA 3TO9A 3ZR8X 4BYYA 1MBHA 1YFHA 2LMDA 4BHPA 4IL6C 4LF7I 4MYUA 1S7AA 3T1BA 3MMYB 4XRMA 2KL4A 2NVYJ 1QQIA 2IGOA 3C2GA 2V6CA 3TP3A 1KU3A 2UUAE 2UXDH 4E7HA 2UXNA 1K4TA 2HQRA 2R7ZJ 4B3SE 2JSCA 4CH7A 2XROA 4MU4A 2GZWA 3M7GA 3RYRA 4JI0I 4B3RI 5IWAH 1U9NA 4YG2F 4F52A 2KIUA 4IOAF 1GXQA 1MBFA 4BA2A 4LF7H 2HDDA 2DFFA 4Q47A 2YX7A 3BROA 4B3XA 1HLVA 2Q1ZB 4LCHA 2ISYA 2VC1A 4HQEA 4G12A 2RVCA 1PUEE 2DN0A 3E0JB 1HF0A 4L9NA 4JI5E 4P52A 1BC8C 4CCKA 5KCMA 2EFQA 2K9LA 1VQ9I 2HU9A 3QRFF 3M6AA 4A3JJ 1BIAA 2HI3A 2XGCA 4O5VA 5D5XB 1RPWA 1JUPA 4EGYA 5FRNA 5CVJA 1IDYA 4QTRA 2QQ8A 1D3YA 1ZGWA 2QGUA 1H9GA 2ZMEA 3ZMDA 3SYTA 3CESA 3ERED 4X62H 2L3DA 2GOMA 2ZJ2A 2EZLA 3K4KA 3HG9A 1IXCA 1FNMA 4WCGA 4LOCA 3GTLJ 1G3WA 3KZYA 2IS6A 1MU5A 1ZR2A 1R1UA 1WCMJ 1IUFA 4DR7H 4RPFA 1Y8RB 2QLZA 4AVPA 4LB6B 2HZDA 3WG9A 2JE6B 1Z3XA 1O7FA 1YJ9I 4DV1E 1U9OA 3OYEA 2K9QA 2P6TA 2ANRA 2XPVA 2P0WA 2YUSA 1JHFA 4GKKE 2XB0X 4RGSA 4R1FA 2EFPA 2OTJI 3U1YA 2VKVA 3HKZN 1GV5A 1TT0A 5JEAB 1J4WA 2WY7Q 3I56I 2BA1G 5DROA 3BDDA 3KP2A 1LUJB 2E5ZA 3S2WA 1U2RA 3K1MA 4DQ2A 2RGVA 2ZCWA 1RUNA 2QUFA 5HDGA 4PCQA 1IBMH 3FK6A 2FMRA 1W36C 4DUYI 1KGSA 4U0YA 2L4MA 2WAEA 4ZTFA 4DV4I 2UXCI 4MQYA 2KIMA 1JKRC 1W4MA 2GA1A 3F8BA 4ZC3A 4Y17A 4A3IJ 4LCGA 2AQEA 3QU3A 2O8KA 1ZR4A 2R93J 1ZZIA 5E1WA 4N3OA 4DR2I 5DUIA 2Z5CB 4HF0A 4DUZE 4FT8A 1OCRH 2X06A 4N4NB 1R9TJ 1EA3A 4EC5A 3DKXA 3GFMA 3T1YI 4DUYH 1V55H 1J5YA 2IA2A 2DT7B 1UHWA 2HDWA 2L9VA 2E1MB 1N25A 4B3TE 2PQ8A 2BY0A 5FROA 2W84A 3AEVB 4DNCA 1N75A 2V9KA 4KIGA 4LPFA 1SFKA 2DYRH 1A35A 4CYCB 2Y30A 2LVSA 2IAIA 1I3QJ 4PUSA 1X3UA 2CWHA 2P7VB 4ZVIA 3CJRB 1W5CC 2JRTA 4A93J 2VPLA 5C0XG 2VJIA 3L2QA 3GVAA 2BY1A 3KLNA 2BR2B 4XICA 2KPMA 4HAMA 1J9IA 5DNLA 4IFDD 3HIFA 1UHMA 5LMUI 3M7ND 2LKSA 2BEOA 3H35A 2O3FA 3IWFA 2F5FA 2V1NA 2ZBKA 1Z0GA 4OO1F 1Z2IA 1U8BA 4G6DA 3MN2A 3CUQA 2YX4A 3WODF 3PSFA 2LY9A 1UDOA 1UFMA 5J1YA 3SDBA 2UUAH 1H89C 3JRCA 4IRHA 2CV2A 4L9TA 4XLAA 4I99C 4BY1J 1HQCA 2KISA 3JW4A 4P5OA 3M3YJ 1F1ZA 4EM1A 2HHHI 3J7AG 1IG7A 3ZN0A 2KIQA 2VBWA 3W2WA 3W2AA 1IBKH 1G3TA 1K83J 1ZHFA 2YSRA 5K5RA 3OMYA 4LK0F 1R00A 5IT9Q 4IHXA 4JI8E 3I58A 3E5QA 4PZJA 4UUSB 1ETVA 2E7XA 4ZYAA 2PO0A 5IT9K 2L9RA 3DEEA 5ELWA 3CDJA 2JMWA 5BOXA 2GQ0A 4CCMA 4UXNA 1YHCA 2W24A 3N05A 1U6GA 2VESA 4DV5I 3IV5A 2AXYA 2ECBA 5IWAI 3P9IA 4PJMA 1VIGA 5EKWA 3RQ4A 5M3MJ 4DPUA 1WTJA 1OCPA 1P9QC 4BQQA 1W0TA 3K6GA 5HNFA 3W6KB 4IHVA 4MDTA 4DU7A 3LL7A 3A01A 5J40A 1HBXG 4A6DA 2HOAA 2BA0G 1YW8A 1K4SA 1N34I 1MH4A 2HXIA 2VQEI 5LD2C 2V1UA 2PNMA 1Z05A 1BL0A 1PVEA 1MMNA 1H0MA 2BY3A 3W3CA 2R5ZB 2C37A 4DV5H 3HTUA 3C18A 2VLAA 2KMUA 5DNXA 2A6TA 2Q0OA 2RQPA 1YIOA 2ISZA 3HPHA 4HF1A 3PS3A 1HNWI 4JI1I 3BG3A 5GAGJ 2R3VA 3O8GA 1OPCA 4IKFA 4YHHE 1J2XA 1E2XA 1T0FA 2UUBH 5IYBJ 1J5EH 1XCBA 2QSGX 2VE8A 4EATA 5DM6F 2VKEA 1WH5A 4HV6A 3ABKH 2DGRA 4DIQA 1T8IA 4JI0H 2ZFUA 3T0YA 1DARA 1MGTA 4B3RH 4RGRA 3JRIA 1N34H 2XKPA 1FOYA 2AHQA 1YQAA 5TGTA 1ETKA 2ZNYA 3RPQA 5FJ8J 1XNQH 2IGKA 2LJPA 1S29A 2UUCE 4JV5H 1FJGE 2JWTA 3FWEA 1WZ2A 1Z91A 2DA2A 2GLOA 1IBLE 4A3LJ 3M7NG 4G08A 4NC6A 5ILUA 4L9VA 4N9IA 3BQYA 4C30A 3DU5A 1V8CA 3CCQI 2LYCA 1XCVA 1YIJI 4FW9A 5IP6A 1JGGA 4LFBH 2WP8A 1VI7A 3OYNA 1NG6A 1TWFJ 5EZHA 4EJWA 4HEA2 3WHBA 1ZM9A 3H36A 4ZH4F 1R71A 4OIPF 2HKJA 1XTAA 3WU0A 1V9NA 2O1TA 2ME0A 5E1ZB 1FMWA 1HDPA 4DV2E 2H09A 1JXSA 1Z5AA 4JI4H 3CCLI 3S2DJ 1SMTA 4DR3I 4A3EJ 3HOVJ 3OYDA 1VTNC 2WTEA 2ZJRF 4LFAH 4UTGA 3VOEA 3PS2A 4QNKA 1H88C 2HXOA 2XF7A 3F72A 3GMEA 2NN6A 1R6LA 1RKTA 2NAZA 2TCTA 2X0LA 2YR2A 3B73A 1YHQI 3WTTC 1V5GA 3QAHA 1YI2I 3ZQFA 2NPFA 2PG4A 4BQAA 4DR5I 4HLXA 2XB5A 1B9NA 5E1XA 3OYJA 2P5VA 3F21A 3MKYB 1NH3A 1JTYA 2R7VA 1IRXA 1KA8A 3IRRA 4DV3I 5JVGF 1ZTRA 3BTJA 4A12A 1U3EM 4HY1A 1WGXA 4LFAE 2CWFA 1B62A 2JN6A 2WY8Q 1R1TA 2BOLA 2CH0A 2XGEA 2R7DA 3BP8A 1Q1VA 1HOMA 2AXTC 2K85A 5CQGA 4DV2H 2HVQA 2K9NA 5D5UB 4KJZA 2ZO4A 2ZXJA 2VT3A 2A5WA 3HEFA 3KX2A 5IT9W 2HHHE 1G3YA 4XBFA 2HVSA 5TJJA 2DA5A 2UXCE 3KP5A 3M8EA 4AC0A 1RETA 4J3DA 1SVOA 4JV5E 4FJUA 1FJGH 2L02A 3JRGA 1XS9A 2F5EA 2VQFI 4OIOF 5JEAE 3I3LA 4X65H 3KCCA 4G7ZF 4DR3H 4JX6A 1AWCA 4BA1I 2BHYA 3I59B 4MU0A 3EYYA 3E7LA 2LKPA 2MLKA 2X4HA 4ZJZA 1B63A 3W6VA 2WBMA 3KYCB 1MX0A 1UMQA 3K85A 1FOXA 1JKOC 3QT8A 2FEZA 3IWZA 2JK3A 3TW7A 2B7EA 2DYSH 2ZXWH 4EVIA 2OQRA 4UY8I 5HOOA 2V8PA 4MTDA 1OYYA 3O2PE 3ZP5A 1U5TB 4MO7A 5LEJA 1SAXA 4IEJA 1USUA 4CZZA 2O7OA 1X19A 2XGXA 5L3DA 2UU9E 5DT9A 4P96A 2ELJA 2QSFX 4DV0H 3OIQA 4OOIA 3SDGA 4FETA 4LITA 3H3VK 2EV5A 3WTVC 2X6XA 3AKZA 1QHHD 1A31A 2VJJA 1ONVA 1FTZA 2VQGA 3GFJA 2PMZA 3MVPA 1SFXA 1R1VA 1HNXI 2CUZA 5JEAD 4E9JA 3S1QJ 2TDXA 3DBLB 1HKQA 2JVHA 2L7FP 1IN6A 1QVUA 2MYSA 5C3EJ 4RGXA 2YU3A 2P7CB 1XPXA 4FJSA 3H92A 2XC7A 2O8XA 2R7SA 2Z16A 3KDKA 2H94A 3HL2A 3HOXJ 4DR7I 4OO1A 1O7LA 1OR7A 1G59A 4F7ZA 1HCRA 3CDIA 3J80K 3GCMA 4CGZA 1IN4A 1U8RA 1MBEA 3HUGA 4ANJA 2J65A 1BI2A 2ICWG 3PJRA 2KP6A 1GVDA 5L3EA 4W1UA 5E3NA 3BPVA 4JI2I 4BE2A 2OUMA 1ZELA 1XNRH 2VQEH 2Z2SB 3EUKL 1GLNA 4EMSA 3BG6A 4L5EA 5LHIA 4NB5A 3J80C 3QU6A 4LLNA 4LD5A 3T1YE 1XNRE 4U0WA 4CYCA 2UXBE 2MBFA 5LL6b 1TZLA 4CA0A 3ZN1A 2DMUA 2P5KA 1D1BA 4DR4I 4BUPA 3LSGA 4XLHA 3A2KA 2BXYA 4USKA 1X3ZB 5JHUA 3U21A 3WTWC 3PFYA 4OCHA 3EUHC 3OSSD 1IV8A 3ZQ7A 1EF4A 1JTXA 4DBRA 2RNJA 4W97A 3JAMZ 1MSZA 5EEGA 3RKYA 2HYJA 3U9GA 4LGWA 4MGRA 1O3RA 1SMYF 1EV7A 2A05A 2P8TA 1Z0VA 2V4JC 1IF1A 4JVYA 5F6FA 1P4XA 4CXFA 3CF5F 4GKJH 1V5EA 4WANA 2JA7J 1Z6RA 3EQLF 1PVGA 3PL8A 4QWQA 5IYCJ 2M8EA 4RDUA 2C38B 4JYAE 4JBAA 4R8HA 3GTOJ 1UCRA 1D8KA 3LAJA 4F93B 3C3WA 2R92J 2XSDC 1FWZA 1WI9A 3FBIB 5LRRA 2PJPA 3FKIJ 1R6MA 2V2QA 2Z99A 1EJ9A 4B3MI 4NZTM 3E6CC 2M34A 4H4KC 3H5AA 4RLQA 4FW7A 3BLYA 2GQQA 1Z5CA 5LMNI 3HRMA 3JAMK 3IL2A 2Z5CA 2NN6G 2M87A 3QWLA 4NXNH 4IHSA 3WGGA 3I4NJ 1VQOI 3KE2A 5EF6A 2E2IJ 4WXHA 4P55A 1WJBA 4HX7A 2IP2A 5CVVA 5J1UA 5IOYA 1RUOA 4LF6I 1VISA 2W7NA 2W48A 3M8FA 2PNZB 4MLOA 2V2ZA 2LK2A 4B1RA 3PRYA 6PAXA 3CCYA 1Z3YA 5LEKA 2HVRA 3U1DA 1ETQA 1QZRA 3NRVA 2IT0A 3BR2A 1T0FC 4JI2E 1R49A 1TW3A 2R7RA 2VN2A 3Q0WA 5CYVA 5HLHA 1YRNA 2CPQA 2HKXA 1GXPA 2PJRA 4JI8H 2LF0A 3NARA 4DGWB 5FRMA 3S3MA 3HSRA 3ABUA 2HH3A 5EDNA 1FIAA 1WJCA 2JA2A 1R6RA 2VB6A 5B5EC 1YRNB 4O3MA 3SEZA 2DA6A 4DXLA 1FY7A 3R4KA 3I0PA 1K61A 4XONA 5LHHA 1ITYA 5EL9A 2R0QC 1HC8A 1LKXA 1HSTA 4Z7YA 2DA3A 1NG7A 2J5OA 3P3CA 2VKHA 1YJWI 2DMNA 4GKKH 2DO7A 3NWSA 2WV1A 3H0DA 3J80W 2ACJA 5F08A 1B8IA 4CCOA 1T2KA 1E0EA 4USMA 3H5RA 4M3GA 1K6YA 5ILVA 4YIIA 1XMOE 4BKXA 3RZDJ 1I6HJ 4OX9I 1WJ5A 2LRDA 4XMYA 5FKLA 3UR3C 3K1NA 1KHMA 3MQ0A 3K4CA 2FMYA 4BNCA 3LQRA 3J7AO 2O0YA 5FLVA 4AVZA 1FWKA 2HYFA 3HKZA 3V69A 3BY6A 1BBYA 3IH3A 4NUBA 2A69F 5LRSA 2M1BA 3JCUC 5DEQA 4EJVA 2LTMA 2CUEA 1OCOH 2HHHH 3O6BB 4A2UA 2HQ5A 4C3IJ 5IOZA 1OCTC 4P7AA 4IX7A 2OI2A 1BW5A 1F0XA 2FJ1A 2FQ3A 1SD7A 3KRNA 1FIPA 2GM4A 3EZJA 2M7BA 4E7IA 3BWGA 5IWAE 2QF7A 2Y0SN 1L0OC 4DR5H 3ZQCA 4X62I 3MKLA 3PYEA 2EK5A 1I39A 1OCZH 3DU6A 3A02A 4Y15A 3B6AA 1SD6A 3CMEI 2I8DA 2MA3A 4LF4E 4JX4A 1K78B 2KRHA 3ZMZA 3GTQJ 4RMNA 2NN6D 4PDBA 3CCMI 2JA5J 1H72C 2VXZA 2KFDA 2RREA 2VL8A 3SZTA 4WWCA 5BR8E 4HOBA 2HFUA 2Z9OA 2CSOA 2GO3A 3H3ZA 4ETSA 3JREA 1FT9A 5K36A 3LA7A 1OJ4A 3LOCA 3P3GA 5DCMA 3TMOA 1A6QA 3CZ6A 1PQXA 5K36E 4HSRA 2QCOA 4QPQA 2MJHA 4XKVA 3GW2A 1FP1D 1ZYRF 4LFCI 4XORA 4LF5E 4XLNF 3TBIA 1N0VC 1HSJA 3HRTA 2ZM6H 4WALA 2UUCI 4MFDA 4DR2E 4PSXA 3OWTA 1ZKGA 1ZZJA 4D5FA 4B3AA 2MG4A 2HOTA 4I2OA 4HSTA 1JT6A 2VQCA 4L9JA 5HNHA 4NBQA 1STZA 4KHPE 3BTIA 4DV4E 1MBGA 4A3MJ 1O4XA 1I5ZA 1TC3C 2EINH 1ZM4A 1VIHA 3RTRA 1KQ0A 5B3SH 3COAC 2O1UA 2K9MA 2OCEA 4DR1H 4BA1A 5LMNH 2AE8A 3CF2A 1B4AA 3F22A 5F27A 4BE1A 5AIPA 1MDMA 2ESNA 2K7LA 1TP4A 1XNRI 2E5LE 1SD4A 2KRCA 3DFGA 3K4MA 3BR3A 2A2DA 2JE6I 3TOAA 4KNYA 2LF8A 1MKMA 5LGTA 1LE8A 4D5CA 3ZZTA 2FUG2 2K4JA 3WTXC 3FXUA 4LF5I 3OIPA 4LF4H 4XOPA 3IC7A 2X1EA 3F8MA 3FM5A 4X66I 2JEBA 5HS9A 2DEIA 3PIPF 2HQAA 3NWTA 4HW0A 2A3SA 3K69A 1GVJA 4G7OF 1ETOA 2VBXA 1TQPA 1EKEA 4DR6E 3TGNA 5CVRA 1XRHA 1K1GA 5FKNA 4I6ZA 2L0KA 3Q1QA 4RB2C 1WJFA 3D5SC 1K6OA 2PN6A 4LIUA 4XTJA 2Z0SA 1TWHJ 1HR0I 2ESHA 3K0LA 3CUOA 3EUHA 2LG4A 2EA4A 3V8KA 2R3SA 4XKBA 4FW6A 2NN6C 3C1DA 2KHMA 2K27A 2HKEA 1R36A 3HSEA 3LSRA 3IP4B 3J81Z 2HQNA 4XLEA 2WV0A 1MG7A 3HRSA 4IJAA 1QHGA 2L54A 2CTLA 4RLFA 1R5ID 3PQKA 3TDUC 1XMOH 5TRDA 2AXLA 2DT5A 2VBYA 1DU6A 3ZMVA 2PNZA 4D7MA 3SHFA 4GYIA 2NRAC 3G1OA 4X64I 2GOXB 4J00A 1JKQC 4PJJA 1PUFB 1N33E 2DOFA 1BR2A 3A1YA 2YQRA 4M9SA 3C2HA 2HFSA 1X1BA 5GTHC 2ZXHA 3WHCA 3OSFA 4GQUA 3I54A 2Z3YA 2L7ZA 4M6VA 4UVCA 4KIFA 1JI8A 1Z5BA 3K4BA 5J1RA 1FC3A 3HOUJ 4DR4H 1IC8A 1UEKA 2FX0A 1YTYA 4XLFA 1OQYA 4V19K 3GTMJ 5FLXC 1PJRA 1D0YA 4B44A 4BQNA 4FE7A 2X6WA 2QQAA 4YEJA 3UHMA 3ZQHA 3TDZC 3K1JA 2X9DA 2XAFA 3VEPA 3ZKBA 1Z21A 4WK8F 2XKOA 3CLOA 1W36D 4JI2H 3TL4X 4BXXJ 1DPRA 2X1DA 4P9UA 3ABMH 2E60A 2Z33A 5KAIC 1XMXA 5GTIC 5GAEJ 4NZRM 4QMFB 4HDVA 3H1CA 1N32H 1KU7A 2V7FA 3WU2C 5KAFC 1VQLI 1GUUA 2LREA 1I6UA 2H6BA 3GZ6A 1MMDA 1T6SA 2AO9A 4RAYA 2L4AA 1JT0A 5E79C 1WVNA 1Q1HA 4AQYH 2Q8KA 4II2A 2F6CA 2F4IA 3OY9A 3BTLA 4OX9E 1LJ9A 5EZGA 1R4MB 1IRFA 5JI6A 4LOMA 4OMYA 2XAGA 3KLOA 3VODA 5HLTA 3J81K 1QZEA 2Y9ZA 1ZRFA 2H8RA 2DFIA 3I71A 1SFUA 3CMAI 2WB1N 1XGSA 3BG7A 3J81Q 3BG5A 4I98B 4LF6E 4V2GA 2DJNA 1ZG1A 4I3HA 2O5RA 4DV7E 3ZMSA 2CTKA 5E8IA 2X85A 3PSIA 4FISA 4I0BA 4B47A 2WNRB 3H5NA 1EH6A 2O4CA 3F3XA 2D1HA 4IHTA 1NXUA 1FYLA 5LMNE 2JSPA 1D5VA 4HLYA 2R4GA 1FYMA 4D9JA 1EI1A 2NN6F 2R5YB 3AG1H 2R7FA 1LDJA 2ZKZA 1KIJA 5BNGA 3LA3A 3OR2C 3KYDB 2XF5A 5M5XJ 5HLIA 3MZHA 4FW3A 3LPSA 2HNHA 2XSJC 2M6QA 3VB2A 3RCOA 3NZKA 2LOOA 4BAYA 2JEAA 4DR4E 1A5JA 2HH2A 4DR3E 3H3UA 4M3EA 3SFZA 4Z7CA 4A3KJ 3T1YH 2PQUA 1FTTA 1R58A 1SC7A 2O9LA 3CUQB 4V2FA 3OYGA 2E1NA 3R0AA 2K02A 5A2QW 1WJAA 5B1AH 2M9HA 1OYIA 4U88A 1QA6A 1V3FA 4ZDLA 3VYTB 1W7PD 4ZYEA 1HNZI 3DPUA 4AIKA 1RRJA 1W5SA 2GWRA 4RM3A 1XXEA 5BR8I 3FF5A 5H6QA 4DZJA 3A01B 4I01A 5H2FC 1TL8A 1V5FA 3DTIA 2L01A 3D5RC 2E3UA 1QPIA 2CVEA 3L1PA 1Y8QB 4X64H 2R5YA 2EQRA 2FBIA 3B82A 1FI4A 4BA2I 3PNYA 4M74A 4BBRJ 2Y0SA 1Z0EA 2O03A 3ZRGA 2OPUA 3KP3A 4PK4A 4WUCA 3AFHA 3OYKA 1R22A 3PYGA 5BQTA 3FXQA 2COBA 1BOBA 2JPBA 4YFXF 4IO9F 3K4LA 4A5MA 1Y4UA 1JGSA 3IAM2 2E1OA 1A04A 3I4MJ 4ZDOA 1FKAE 3L7WA 1APLC 4U87A 3I53A 2UU9H 3OYIA 1A36A 1LFPA 4XLPF 4HRIA 5FD5A 1U0JA 4JI1H 3BJOA 2PMHA 1X1PA 1HR0H 3Q9VA 1XX5A 1FNNA 3CC4I 1FZPB 2ZB9A 1F9NA 3HDDA 3F23A 2OTLI 1IRGA 3QD7X 3KFWX 2DCEA 2E2JJ 4IFDG 2FMLA 3HM5A 4ASNA 2E7WA 2EV6A 4GGGA 1S72I 1E3OC 2DFEA 2XUBA 1BI1A 2LY2A 2VASA 2XASA 3LNQA 1Y6ZA 5A2QC 2DQRA 4YHHI 3RPUA 4EJOA 5JEAG 4HX4A 9ANTA 2J5PA 1KTVA 3RJPA 2DLLA 2HS5A 1BR1A 1Y60A 3KEQA 3HXLA 5GMDA 2EIKH 2DU9A 2CTMA 2W57A 3OOPA 5JFRA 2H1KA 2X7IA 4C2TA 2H8WA 4MTEA 4EJUA 3RQIA 2CPMA 1Y0NA 2E36A 4D7NA 1UJ8A 3D1NI 3RDIA 3HJCA 4I0AA 3JR9A 4IRIA 2OPVA 5JEAA 2R7XA 5K1YA 4N9HA 1Y56A 5EYRA 2P5LC 1R5HA 1RNLA 2MC4A 2IJLA 1W0UA 2EB7A 4DV5E 3UOEA 4S05A 4CCJA 1UZCA 4MHGA 3CTAA 2BZTA 3FZVA 2NS8A 4RS8A 2JUCA 3LSTA 1BA5A 3P7NA 4TV7A 5J6XA 2DMPA 4FW4A 4DR5E 1XHKA 3SFIA 5D5VB 4QLCU 4XN0A 4H8AA 1B9MA 2I5UA 2YPRA 3DEUA 3K2AA 4PJNA 3L2UA 5DDGA 3FM3A 2YS9A 4DYQA 4BA2B 3KP6A 4DJAA 3A4CA 3ZQLA 4AQYI 3QT5A 2JQ7A 1WUUA 4B8CD 4BS9A 4XRSA 2HGCA 1FX7A 1V4RA 1MDMB 3RYPA 1MJAA 4OO1D 4JG4A 1IBKI 1ELOA 2HZTA 2M7AA 3BPXA 3GTGJ 3G6EI 3HPGA 4IQ4A 2LTLA 3JTGA 2FA5A 1XMQI 2IPQX 5FWKA 2VQFH 4RGUA 4DU8A 4BU2A 3ECOA 2PNLA 3J7AY 3MFKA 5CQEA 2DPDA 1M1EB 3F0CA 2PX9A 1X2MA 3GKUA 3DPLC 3FIWA 5ILSA 3DEWA 3FXRA 3G1LA 2FFMA 4FE4A 2WADA 2A6EF 2XPWA 4JI7I 2FNPA 5FLXW 4ZZLA 1Y5YA 2PO0B 5DD4A 1UB9A 1DUXC 4NC8A 2C39B 2CG4A 1HW1A 2L5QA 5K5QA 3V42A 4HF2A 4II3A 1BJZA 2XVCA 2CTFA 2B0LA 3PNVA 2H1LA 2VKCA 3ABLH 2DA1A 2HOSA 3S17J 1Z0WA 2ZFWA 1KVKA 1IDZA 5IT9Z 2ADUA 3PIOF 2BVLA 5HDNA 4LF8E 2JEAI 1Z77A 2CS3A 4U7BA 1D1CA 2MFZA 3WGIA 3LQQA 1Y4SA 1V54H 3GWZA 3S1MJ 5C0XC 1SEIA 1PDNC 4WUDA 1XDSA 2F4VH 4JI4I 4HPQA 4UVBA 4B3TH 3JAMQ 1LDKB 4O6JA 3BR0A 1YW7A 2W82A 1P2FA
chains in the Genus database with same CATH topology
2NN6B 5C0XD 4IFDE 3L7ZC 1WVNA 2PNZB 4NBQA 2NN6E 2ANRA 5JEAG 2BA0G 1DT4A 4AIDA 3M85D 5K36C 1VIHA 1E3HA 2PO1A 4OO1E 5JEAB 1J4WA 2C37A 2BA1G 4BA1A 1UDQA 2CPQA 2CTMA 4IFDF 1OYSA 2PO1B 1X4MA 2PY9A 2FMRA 2HH3A 2CTEA 1ZZKA 1J5KA 2BR2A 5K36D 2C38A 2JE6I 2CTKA 2JEBI 2OPVA 4BA1B 2DGRA 2WNRB 5JEAD 5JEAA 1E3PA 4AM3A 5K36F 1DTJA 2JZXA 1WHUA 3B4TA 2JEBA 1ZZIA 2JEAB 2NN6F 2WP8B 4OO1A 3M7NG 2BA1D 3HKMA 3CDIA 3GCMA 1WE8A 1K1GA 4AIMA 3M85G 2ANNA 5C0XB 4OO1B 2WNRA 4IFDA 1KHMA 2Z0SA 2JEAA 4LIJA 2WP8A 2HH2A 2JA9A 5K36B 1OYPA 2JEBB 4B8TA 3AEVB 4JVHA 2PQUA 2NN6C 5C0XE 5JEAC 3H36A 4IFDC 2BA0A 3V69A 4BA2B 2C37B 5C0XG 2BR2B 2CTLA 4IFDD 4OO1D 3M7ND 3L7ZB 3KRNA 1ZTGA 5C0XF 4OO1F 2PNZA 4BA2A 1EC6A 3GMEA 1UDOA 2NN6A 1R6LA 2JE6A 3DD6A 1UDNA 4OO1G 2BL5A 2QNDA 2YQRA 2E3UA 3L7ZA 4BA2I 3VKEA 2NN6D 2OPUA 4OO1C 2PO0B 4JVYA 4WANA 2CTJA 3GLLA 2PO2B 2C39B 3U1KA 2P2RA 5JEAF 2C38B 5K36A 1UDSA 2C39A 2CTFA 4IFDB 1R6MA 2BA0D 2PO0A 5K36E 5K36G 2MJHA 1X4NA 3CDJA 2JEAI 5JEAE 4QMFB 2AXYA 5C0XC 2NN6G 2PO2A 3H1CA 5C0XA 4WALA 1VIGA 4IFDG 1TUAA 4BA1I 1ZZJA 2JE6B 1OYRA 2JVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 B;  5C0X D;  4IFD E;  3L7Z C;  1WVN A;  2PNZ B;  4NBQ A;  2NN6 E;  2ANR A;  5JEA G;  2BA0 G;  1DT4 A;  4AID A;  3M85 D;  5K36 C;  1VIH A;  1E3H A;  2PO1 A;  4OO1 E;  5JEA B;  1J4W A;  2C37 A;  2BA1 G;  4BA1 A;  1UDQ A;  2CPQ A;  2CTM A;  4IFD F;  1OYS A;  2PO1 B;  1X4M A;  2PY9 A;  2FMR A;  2HH3 A;  2CTE A;  1ZZK A;  1J5K A;  2BR2 A;  5K36 D;  2C38 A;  2JE6 I;  2CTK A;  2JEB I;  2OPV A;  4BA1 B;  2DGR A;  2WNR B;  5JEA D;  5JEA A;  1E3P A;  4AM3 A;  5K36 F;  1DTJ A;  2JZX A;  1WHU A;  3B4T A;  2JEB A;  1ZZI A;  2JEA B;  2NN6 F;  2WP8 B;  4OO1 A;  3M7N G;  2BA1 D;  3HKM A;  3CDI A;  3GCM A;  1WE8 A;  1K1G A;  4AIM A;  3M85 G;  2ANN A;  5C0X B;  4OO1 B;  2WNR A;  4IFD A;  1KHM A;  2Z0S A;  2JEA A;  4LIJ A;  2WP8 A;  2HH2 A;  2JA9 A;  5K36 B;  1OYP A;  2JEB B;  4B8T A;  3AEV B;  4JVH A;  2PQU A;  2NN6 C;  5C0X E;  5JEA C;  3H36 A;  4IFD C;  2BA0 A;  3V69 A;  4BA2 B;  2C37 B;  5C0X G;  2BR2 B;  2CTL A;  4IFD D;  4OO1 D;  3M7N D;  3L7Z B;  3KRN A;  1ZTG A;  5C0X F;  4OO1 F;  2PNZ A;  4BA2 A;  1EC6 A;  3GME A;  1UDO A;  2NN6 A;  1R6L A;  2JE6 A;  3DD6 A;  1UDN A;  4OO1 G;  2BL5 A;  2QND A;  2YQR A;  2E3U A;  3L7Z A;  4BA2 I;  3VKE A;  2NN6 D;  2OPU A;  4OO1 C;  2PO0 B;  4JVY A;  4WAN A;  2CTJ A;  3GLL A;  2PO2 B;  2C39 B;  3U1K A;  2P2R A;  5JEA F;  2C38 B;  5K36 A;  1UDS A;  2C39 A;  2CTF A;  4IFD B;  1R6M A;  2BA0 D;  2PO0 A;  5K36 E;  5K36 G;  2MJH A;  1X4N A;  3CDJ A;  2JEA I;  5JEA E;  4QMF B;  2AXY A;  5C0X C;  2NN6 G;  2PO2 A;  3H1C A;  5C0X A;  4WAL A;  1VIG A;  4IFD G;  1TUA A;  4BA1 I;  1ZZJ A;  2JE6 B;  1OYR A;  2JVZ A; 
#chains in the Genus database with same CATH topology
 1RHY A;  1FYK A;  2XEX A;  4DUY E;  4OAY A;  3I4P A;  4A69 C;  1TNT A;  4AIJ A;  2HPM A;  2BV6 A;  2VT2 A;  3OR1 C;  4DV6 I;  2OF7 A;  3EPZ A;  4FN5 A;  1FMV A;  2RAE A;  1VBI A;  1ENH A;  4B4C A;  1QZZ A;  2ELK A;  1MIJ A;  5K7F A;  4WF2 A;  1OLT A;  1Z1D A;  1SVM A;  2W4S A;  1OYS A;  3CLQ A;  2JTV A;  1WI3 A;  4JI8 I;  2FE3 A;  4J19 A;  2X48 A;  2JVG A;  5IT9 C;  2G9W A;  4XL9 A;  5ICF A;  1IBK E;  2ZJQ F;  4ON0 A;  2NYX A;  3LSJ A;  4Y52 J;  3S15 J;  4LF8 H;  3ASO H;  3HYI A;  3RIR A;  2EH3 A;  1B6A A;  5EG0 B;  2FXA A;  1YIT I;  5K5O A;  5FFX A;  4LF9 E;  2M4G A;  3OTO E;  3OET A;  3TOB A;  5KVR A;  2LFB A;  1MJB A;  1SVL A;  4I7H A;  1ULY A;  1VF9 A;  5HOD A;  5E3O A;  1SEU A;  3AL0 B;  4GO1 A;  3HUL A;  3VSK A;  1PP7 U;  5C4X J;  1WSU A;  3ZGK A;  1J09 A;  5EG0 A;  4URL A;  1F36 A;  3G3Z A;  4LFB I;  4OO1 B;  1S03 G;  3ELK A;  1ERD A;  3OYM A;  3PUF A;  3LSI A;  2CJJ A;  3OS1 A;  5K36 B;  1HKS A;  2FD5 A;  1I3A A;  1WRJ A;  1YJN I;  4LB5 A;  1EH8 A;  4E70 A;  3DV8 A;  3X2Q H;  3QPS A;  4UUV A;  3LSK A;  4IXA A;  4IFD C;  4L5I A;  1BKN A;  3CJN A;  4XNF A;  4NQW A;  4S0H B;  2MGQ A;  1XNQ I;  1ZAO A;  4HA8 A;  3FMR A;  2NVX J;  2IA1 A;  2Y31 A;  2K9S A;  4A0Z A;  1GT0 C;  1FKA H;  4LF7 E;  5E3L A;  1FPQ A;  4B09 A;  2ZM6 I;  3T1H E;  5CVI A;  2UV1 A;  4UB8 C;  1TTY A;  2UUB I;  2JE6 A;  4DUZ H;  5ICG A;  4OO1 G;  2QND A;  4XLC A;  3D0S A;  1KU2 A;  4DUZ I;  2V6E A;  2VIX A;  2QZ8 A;  3L7Z A;  2UXD E;  3JRD A;  3WU3 A;  2QKM B;  1LDD A;  1DDN A;  3VKE A;  3DBH B;  1MH3 A;  1IN7 A;  1Z0T A;  5K7H A;  1NZ0 A;  4U0V A;  3FXM A;  2CTJ A;  1QO0 D;  2PLY A;  1MZB A;  4A3D J;  4BXU A;  2O1V A;  1E17 A;  1ORK A;  2FQ4 A;  4M9X A;  4JI4 E;  5GAD J;  3G71 I;  4KIB A;  1T56 A;  1Z0C A;  3DKY A;  4IQJ A;  3GXO A;  3D5L A;  3V7S A;  5LHG A;  1BJA A;  4YIR X;  3I55 I;  1ZRE A;  2VUM J;  1S4E A;  3S3O A;  4K0K E;  5TIS C;  3H0G J;  2OQG A;  3IHU A;  2GS8 A;  2JUG A;  4PGH A;  1GV2 A;  1BR4 A;  4QSH A;  2MLG A;  4CZC A;  3PQJ A;  1J0R A;  2VOO A;  4YY3 I;  5C0X A;  5L3B A;  1X9Z A;  3KDG A;  3J81 W;  2MD5 A;  1TUA A;  3DLL F;  1J75 A;  4DV0 E;  4LLL A;  4A6E A;  2EWN A;  5C0X D;  4LG3 A;  3HOT A;  1LEA A;  3QOE A;  2HPI A;  3CUQ C;  2NN6 E;  4K0K I;  4AID A;  1TQI A;  4LF8 I;  3DTE A;  1IW7 F;  4EV0 A;  4B3T I;  1R7J A;  1KU9 A;  4U3D A;  3M85 D;  1HR0 E;  4KDP A;  3K10 A;  5DYM A;  1D1A A;  4BJ6 C;  4DW6 A;  1Z0B A;  2EIL H;  4B43 A;  1DU0 A;  2GO4 A;  1I94 E;  3IH2 A;  3KP7 A;  2Q2E A;  4NDL A;  3KP4 A;  4BDY A;  4OX9 H;  4DV0 I;  2HFH A;  1MMA A;  2R7T A;  1XD7 A;  5DTD A;  1FJG I;  3GR5 A;  5FD6 A;  1J5K A;  2L7M P;  4UVA A;  1Z0X A;  2P81 A;  5K36 D;  2C38 A;  3OL3 A;  4XRS G;  4E7L A;  3V5R A;  3HJE A;  3GTP J;  3JRA A;  4FWH A;  2JJ7 A;  1CF7 B;  1N36 I;  2PT7 G;  4HNT A;  4RAZ A;  1TBX A;  3RI4 A;  1XGO A;  3V4G A;  3J7A M;  2STT A;  4JI3 H;  4JI7 H;  4ESJ A;  2WP8 B;  1USV A;  4IVN A;  5CLS A;  5A2Q Q;  4BGD A;  2HTS A;  2LSO A;  1S3J A;  1FBQ A;  4Z2Y A;  4PRX A;  2F4V I;  4JI6 H;  2M0M A;  1IO2 A;  3R60 A;  5ED4 A;  3M4O J;  2MH2 A;  1CGP A;  4UT4 A;  2EFW A;  3JSO A;  1ETY A;  1QRY A;  4LIJ A;  1N32 E;  2LLK A;  5J8F A;  3WTY C;  4AWX B;  3PYD A;  4M3D A;  5HVQ C;  2XAJ A;  4IZJ D;  1ON1 A;  3WE3 A;  2K3F A;  3BCA A;  3G73 A;  5FLM J;  3L2V A;  1G3S A;  2BA0 A;  1IZ1 A;  3F9K A;  5HLG A;  3HHG A;  5E8G A;  2DOE A;  4M3B A;  2UZK A;  2E35 A;  2F4M B;  1H7U A;  1G8X A;  2OCC H;  3QOP A;  4ZYD A;  4E7K A;  1KYW A;  2UXX A;  1VQP I;  4XSZ F;  5J4Y A;  1DGR M;  3DPT A;  1FLI A;  3CC7 I;  1OJL A;  3NEU A;  4XKW A;  1D5Y A;  1RZ4 A;  2VKD A;  5F1J A;  1I6X A;  3DP7 A;  3ESW B;  3DD6 A;  2DEJ A;  3PO2 J;  5FKO A;  3RZO J;  1WVR A;  2BYV E;  2K86 A;  2WAF A;  3GUD A;  1XGM A;  1Z7L A;  1P7J A;  2PI0 A;  1BN5 A;  3BG9 A;  4RA2 A;  1DP3 A;  1QVT A;  4LFB E;  4JV5 I;  3MZ8 A;  3QOD A;  2KIF A;  3GYH X;  2DBB A;  1FBU A;  3BCB A;  3R6S A;  4GKJ I;  3SZP A;  3OYB A;  1LFU P;  2K40 A;  2UUB E;  5LFA A;  1VI0 A;  1I27 A;  3MCZ A;  3REO A;  4ZDP A;  2Z5B B;  5IP9 J;  1UDS A;  4PJL A;  3L9F A;  2C39 A;  4DV1 I;  1R5G A;  2I10 A;  4IZZ A;  1XNQ E;  3ZOB A;  2GA2 A;  3WTZ A;  1TT5 B;  3UKG A;  1VQ6 I;  5LMU E;  2Z5B A;  2LP0 A;  4IPA A;  3M8J A;  3E6M A;  5DRQ A;  5M3F J;  5LL6 R;  4IRG A;  2FRH A;  4LF9 I;  5FO5 A;  4E6K G;  1UHS A;  4YFK F;  3AG2 H;  2G7U A;  2K1H A;  2JT1 A;  4HXZ A;  1P7I A;  4KIS A;  2DT6 A;  4IFD E;  3L7Z C;  3CC2 I;  2E1R A;  2UXD I;  3H9G A;  1T38 A;  4CYD A;  3LSP A;  1A6F A;  5F04 A;  4DV7 I;  2XPU A;  5M5W J;  3ZQG A;  1ZRC A;  2FSW A;  4BDZ A;  2DOA A;  2NS7 A;  2QEN A;  2ID6 A;  4QPO A;  2UUZ A;  4LG0 B;  4DZP A;  2DA7 A;  3TQN A;  3GBG A;  4RBO A;  1UDQ A;  4LLG F;  4P1W A;  1REP C;  2CUJ A;  3ABT A;  2NOG A;  5EEH A;  2GXA A;  4RB3 C;  1TNS A;  4HV5 A;  4K2E A;  2BR2 A;  1OYW A;  3CJT B;  2XGD A;  3ONQ A;  2JEB I;  4AU7 A;  2X51 A;  4FWD A;  5L3J A;  1XMO I;  3IAS 2;  3C7J A;  2ZC2 A;  4MFE A;  2AS5 F;  2W00 A;  2IES A;  4KYW A;  2O3Z A;  3PS1 A;  2FU4 A;  4IHY A;  5DRR A;  1DTJ A;  2NOJ B;  4DR1 E;  1QGP A;  2HWV A;  1AKH B;  1WHR A;  4RM2 A;  4BL0 B;  5IYD J;  4BEH B;  2F5C A;  4RAG A;  1NK2 P;  2VE9 A;  3HKM A;  1Y39 A;  4FAS D;  4HDU A;  1X58 A;  5K7Z A;  3S16 J;  1AA7 A;  3ROU A;  4PRV A;  4ESB A;  3OYA A;  2VBZ A;  4IFD A;  2DK8 A;  2XDV A;  1TWA J;  2E34 A;  1QNT A;  4ENK A;  1VZ0 A;  2L9N A;  4DPX A;  5BR8 H;  4XOT A;  5FFZ A;  2BM0 A;  2EA2 A;  1OCC H;  2UU9 I;  1BC7 C;  3TKY A;  2WW4 A;  1HNW E;  2DQL A;  2GXB A;  4DV6 H;  3QYF A;  1B72 B;  2MSY A;  2BE5 F;  4BXF A;  5J8C A;  2YU9 J;  1X4P A;  2A61 A;  1ETW A;  4Y33 A;  5FLX Q;  3F6O A;  4M71 A;  4X0G A;  2BVM A;  1U5T C;  1LVA A;  1ZM2 A;  3MAJ A;  4EMD A;  4JI1 E;  1JE8 A;  2AJ4 A;  3NCV A;  3BJA A;  2CYY A;  4D0P A;  2C6Y A;  3G4S I;  5D8L B;  5E20 A;  4ISA A;  3MD2 A;  3OTO I;  1A6I A;  2GAU A;  1X1C A;  2MW8 A;  4XR6 A;  5D4S A;  2UUA I;  1D8J A;  4XM3 A;  3ZPL A;  3VSL A;  1IXR C;  1W1W E;  3OS2 A;  3M1C A;  2WWY A;  4BAC A;  4IZJ B;  4FWG A;  2VJ5 A;  1G2H A;  4OO1 C;  4G6T B;  3QPL A;  1JUS A;  2DTR A;  5FKM A;  3WE2 A;  1UG8 A;  4OWR B;  1LFB A;  3JRF A;  1N36 H;  1IJW C;  4M9Z A;  3HTS B;  4NXM I;  4BY7 J;  1AHD P;  4CIC A;  1N33 I;  3F0N A;  3JSP A;  1ZXM A;  4B3S H;  1B1B A;  2NXN B;  3Q9S A;  1AU7 A;  4IFD B;  4EGZ A;  5JR3 A;  2IOQ A;  3PFI A;  4EJT A;  3AL0 C;  3J7A K;  2KKO A;  3SZG A;  3OTO H;  4LFC H;  3CWV A;  4B48 A;  3Q0V A;  3S93 A;  4N4O B;  4KIT B;  4FX0 A;  1HDD C;  2ZSH B;  1NHH A;  3MEX A;  2KLO A;  4BEH A;  3ZQI A;  1KYZ A;  5L3F A;  4CDG A;  1AKH A;  2IER A;  4JYA I;  4BBS J;  1T95 A;  2LDU A;  1QU3 A;  3Q6M A;  4M3F A;  2D5V A;  1T39 A;  4DR2 H;  1XMA A;  1MD0 A;  3RF2 A;  2WAQ N;  3QQA A;  2KRF A;  2DOD A;  2OV7 A;  3ZKD A;  4Q48 A;  2DFH A;  3BZK A;  3H4L A;  4G7H F;  3DCF A;  1PKP A;  4LFC E;  5D6F A;  1YW9 A;  2EFO A;  4DV3 E;  3HOW J;  2VI6 A;  2CQ7 A;  3ZM7 A;  2EZK A;  4LJZ F;  1LE8 B;  3RSN A;  5FB2 A;  4DV4 H;  5EGO B;  2PFB A;  1GDT A;  5DUK A;  1HA8 A;  1PIE A;  4IS9 A;  1Z9C A;  1FWL A;  2XRN A;  2BGC A;  1KON A;  1QPM A;  3FHZ A;  3VYR B;  2LD5 A;  4DR7 E;  2NVT J;  4M73 A;  4ZYH A;  2Y2Z A;  3E5U A;  3OIO A;  4MQ9 F;  4WUB A;  1P42 A;  2Z5U A;  3GZ5 A;  2L9S A;  2RV8 A;  4B3M E;  4BA1 B;  2W1O A;  3Q6N A;  2XRL A;  4X6A J;  1Y0U A;  1TLH B;  1KQ8 A;  1VND A;  1ZGJ A;  3TO7 A;  3B4T A;  1RI7 A;  5KK1 A;  5L3G A;  1N0U A;  2X6O A;  2RC4 A;  4LK1 F;  1IGN A;  5EJC A;  3V8J A;  4EEF G;  5E18 F;  4AYB N;  5HS8 A;  4HX8 A;  3DTK A;  4HYM A;  2D2W A;  3LSH A;  3W6J B;  2FOK A;  2IS2 A;  1RC9 A;  2WA0 A;  5CJ9 A;  3CO7 C;  5ERI A;  1K78 A;  2CV0 A;  3M85 G;  2ZQE A;  3FIS A;  2WNR A;  1ZH5 A;  3FAU A;  1MBK A;  1BW6 A;  1X3W B;  1DP7 P;  2JA9 A;  1ZAR A;  4KQV A;  5LGU A;  1NHI A;  4UV8 A;  5GAH J;  3S3N A;  4NXM E;  1VFC A;  3QT7 A;  5C0X E;  4JVH A;  3PYF A;  1YH8 A;  2V9P A;  3GZN B;  4EM0 B;  4M6X A;  1NHJ A;  1F5T A;  2BM1 A;  4ESF A;  3WU6 A;  3KPH A;  3OYF A;  3OS0 A;  4ITV A;  4L18 B;  1WFX A;  3CMM A;  4L5J A;  4ABZ A;  4C2M J;  2QQ9 A;  4A0Y A;  3ZZ0 A;  1YLF A;  1FBS A;  1ZTG A;  3CDL A;  2KDO A;  4Y7N J;  2B9S A;  2DAO A;  3ZQQ A;  4GKJ E;  2GIV A;  1ZGA A;  4QIW N;  4I02 A;  2BL5 A;  3BR5 A;  1YG2 A;  1NTC A;  3R0J A;  1ON2 A;  1XGN A;  4JP0 A;  1LNW A;  1D0Z A;  2CMP A;  2VXD A;  4CHU A;  1H74 A;  1HKT A;  1ZG5 A;  4FHT A;  3O3K A;  3RKX A;  2Z5E A;  3EDP A;  2VQE E;  1S5L C;  1X1A A;  2R7O A;  2STW A;  1F43 A;  5H20 A;  3IH4 A;  3QPT A;  1O57 A;  4PFO A;  1WJE A;  2XAH A;  3HGY A;  5GPA A;  3KIO A;  1ZQ3 P;  1D6T A;  5FKK A;  4YEL A;  3HOY J;  1Y6I A;  1SD5 A;  2ZME B;  4JI6 E;  3FBN B;  3ZMT A;  2LBF A;  2LF7 A;  1N78 A;  4JI5 I;  1RR9 A;  2EBI A;  2BXZ A;  4WXC A;  3P3E A;  3FXO A;  4CUG A;  3QPH A;  4D1Q A;  2M8W A;  1XSD A;  4LMY A;  2Y48 A;  2UWM A;  2QBY A;  2CGP A;  1BIB A;  1PUF A;  2P6S A;  1MBJ A;  1ZLJ A;  4HBL A;  1IBL I;  3J7Y J;  1B8I B;  1OYR A;  3T8R A;  1R23 A;  1SFO J;  4NXN E;  2RDP A;  3SB1 A;  3U2R A;  2L7K A;  4S04 A;  2BBY A;  1YYV A;  1JKP C;  3CO6 C;  3V2U C;  2ZNZ A;  2HDC A;  5K36 C;  1MND A;  3EUA A;  4KN7 X;  1T08 B;  5D6E A;  5E17 F;  1I1S A;  1XDU A;  2CQX A;  3OYL A;  5FLX K;  4JI3 E;  2FOW A;  2R7Q A;  1IN8 A;  2M8G X;  1RRE A;  5CKT A;  1MMG A;  4RAF A;  5BPI A;  5DRP A;  2N8G A;  1X4M A;  5D4R A;  4Y4R A;  4WXD A;  5BPD A;  2EFG A;  3OOU A;  2FBH A;  4JI6 I;  3V7R A;  4G8X A;  5F0H A;  2OU2 A;  2RN7 A;  3F6V A;  2M2E A;  3G2B A;  3ZMU A;  3ZXS A;  5F1R A;  3LAP A;  2ELH A;  2LBF B;  4AM3 A;  3OL4 A;  3VDX A;  4KIC A;  2CZ9 A;  2JZX A;  2OZU A;  1HNZ H;  1MSE C;  4X65 E;  2BY2 A;  4KT6 A;  5J47 A;  1Y1W J;  4MU1 A;  1I50 J;  2QEX I;  2RNG A;  1IN5 A;  3OV8 A;  3HBL A;  3P9K A;  2UXC H;  3ERM A;  3BTC A;  4GCV A;  2IBD A;  1UG0 A;  1CQT A;  3OYH A;  2LRR A;  1IUY A;  5LBQ A;  3K2Z A;  3J81 C;  1R4N B;  2DDB A;  4GFB A;  3BR1 A;  1PP8 F;  1G4D A;  3FKJ A;  5CPR B;  4ZZD A;  1QZY A;  3KET A;  2IRF G;  5KNL A;  3PO3 J;  4K0K H;  1WH7 A;  4CCN A;  2PJR B;  4MYT A;  3LFU A;  3J80 Q;  4AIH A;  3EYI A;  2HOE A;  3L7Z B;  1HNX E;  2G7H A;  5HDK A;  2CFX A;  2DDA A;  5DCF A;  5C0X F;  1K7A A;  2EFN A;  3KEY A;  3BZC A;  4YIF A;  2QSH X;  2CUF A;  1MMS A;  3F8N A;  3S1R J;  4HNV A;  3LA2 A;  2ID3 A;  1H73 A;  1JJ8 C;  3P06 A;  2E5N A;  1O3Q A;  3AG3 H;  2X36 A;  3BZ6 A;  3FMQ A;  3ISP A;  4G6Q A;  3JAM W;  2MC3 A;  1XMQ H;  5FLX Z;  2CW0 F;  1Z67 A;  1X4O A;  2PMZ N;  5GP9 A;  1AOY A;  1N77 A;  4IHW A;  1LB2 A;  3BR6 A;  2V34 A;  2A1S A;  3P9C A;  4OIQ F;  5DCM B;  1LVK A;  2MH9 A;  2IOP A;  4DR6 H;  2KJB A;  2A6H F;  1UAA A;  4OMZ A;  2P2R A;  1UG2 A;  2GIZ A;  3DXJ F;  5JEA F;  2CU7 A;  2Y3M A;  2IGN A;  5H6R A;  4E7Z A;  1W7P A;  1MNE A;  2PMU A;  3JRB A;  4QNJ A;  1S7E A;  3ECH A;  3E6D A;  1SFE A;  4KMF A;  3OSG A;  2X1C A;  3M1E A;  2QVO A;  1XN7 A;  3CP8 A;  3PM1 A;  3TO6 A;  2D1V A;  1T33 A;  2DJI A;  2H27 A;  2CQN A;  3GTJ J;  2ME6 A;  3I5U A;  2JPC A;  4HAC A;  2VPR A;  4MEY F;  4HG2 A;  2NVU B;  5JLX A;  3H9J A;  1DPU A;  2JVZ A;  3ML6 A;  1KKH A;  3PNT A;  3TED A;  1FJL A;  1J5E E;  4YRV A;  4YHH H;  4LF6 H;  3DLA A;  3B6C A;  1DT4 A;  4X1E A;  1IBL H;  2VON A;  4FQG A;  2A5Y B;  2CW8 A;  4CSW A;  1UEL B;  3IKT A;  1S20 A;  2R42 A;  2LY1 A;  3GF2 A;  1RR8 C;  2XIG A;  4UB6 C;  2FPH X;  3A03 A;  3I59 A;  1P4W A;  2WAQ A;  5J3L A;  2DXI A;  1XSV A;  4X66 E;  3L2R A;  1EH7 A;  2ETH A;  2F48 A;  4JYK A;  3MKZ A;  4OIR F;  2BV3 A;  2Y69 H;  4IZK A;  3CCE I;  3J80 Z;  4DPY A;  4L0Z B;  2M3A A;  2DTZ A;  4DPT A;  2BHZ A;  2JZY A;  5FGM A;  5EGO A;  1TQM A;  3HUG B;  4N0B A;  2DW4 A;  2IS1 A;  2DMT A;  1XMQ E;  3LWF A;  3LSM A;  4F91 B;  1VQN I;  4KMU X;  2EV0 A;  3E97 A;  2NNN A;  1IV6 A;  4RB0 A;  4H0E A;  4YY3 E;  4BHB A;  1ZN2 A;  4UV9 A;  5M5Y J;  3SQN A;  5GPC A;  1JJ6 C;  5A2Q K;  4NHJ A;  1XC5 A;  3I64 A;  3T1H H;  2QM3 A;  2E2H J;  2ANN A;  3O8H A;  4FW5 A;  2HK2 A;  1F4K A;  3PUB A;  1S8N A;  5DS9 A;  4OIN F;  1OYP A;  4B8T A;  1WPK A;  3Q3S A;  4OU0 A;  4E4H A;  1I94 I;  4IF4 A;  2BW3 B;  2LH9 A;  3QYE A;  4HZF A;  5JEA C;  2M45 A;  1U78 A;  3CCR I;  3HB9 A;  1FP2 A;  1EA6 A;  4XID A;  1B59 A;  3GON A;  1U5T A;  3B8H A;  4LF4 I;  1S9H A;  3W2V A;  4ZYG A;  4I09 A;  4G94 A;  3KEO A;  2VQF E;  2J7K A;  2FBK A;  4UUT A;  2Z1D A;  1B72 A;  3JAM C;  2F5V A;  5HS7 A;  3WG7 H;  2QBY B;  2QWW A;  2VC0 A;  4LCF A;  4NNJ A;  2UXB I;  1ZRD A;  4AUX A;  3WTS C;  3VFZ A;  3QP6 A;  3GO5 A;  2E1M C;  2KJC A;  5DD8 A;  1VQK I;  2R7W A;  4DOZ A;  2NNY A;  3GLL A;  2PO2 B;  1FOW A;  2HYG D;  2IGM A;  3LTO A;  1TWC J;  5BMZ A;  1J7K A;  1ACI A;  4XRF A;  2O61 A;  2CQK A;  3F8C A;  1MJ9 A;  1WQ2 A;  2DA4 A;  1G6N A;  2EZI A;  3E6B A;  4A3G J;  2UUC H;  2BA0 D;  4LF9 H;  2B63 J;  2CQQ A;  1ODD A;  2VOP A;  4FCY A;  4KHP I;  4IZJ A;  2PBI A;  1JHH A;  3CP2 A;  2P4W A;  1N34 E;  4R1H A;  2V26 A;  4A3B J;  2F1D A;  4LIV A;  4JI0 E;  4B3R E;  3BOQ A;  3Q5F A;  4CCL A;  4PJ0 C;  5A2Q Z;  3SXY A;  4A5N A;  2OPT A;  2XF6 A;  4LG0 A;  3RKQ A;  1X0A A;  2E5L H;  2NN6 B;  3DWL E;  5IT3 A;  5EEA A;  2K3P A;  3I9V 2;  2CGE A;  5E3M A;  3V7C A;  2E5L I;  2V1X A;  1RKW A;  4U7D A;  4MIM A;  1WJD A;  4Q5S F;  1LEB A;  4EM2 A;  3J7Z I;  3ASN H;  1VQ8 I;  1I1G A;  3K1P A;  3CCV I;  2PO1 A;  2DI3 A;  1BOA A;  3GEZ A;  3BC8 A;  4C9Y A;  2JRM A;  4BJ5 C;  4F92 B;  3GFL A;  5J4V A;  3EET A;  5L3C A;  2XHK A;  2ZSI B;  4KT5 C;  1BM9 A;  3FK7 A;  1VQ7 I;  4KHP H;  2X6Y A;  1O3T A;  2CWE A;  2OAZ A;  2PY9 A;  1ZZK A;  3B02 A;  1S6L A;  2IXS A;  3GTK J;  5D5W B;  5CVU A;  1HK7 A;  2F4V E;  2OD5 A;  1UST A;  3K17 A;  4DV2 I;  1IBM E;  2R5Z A;  2IW5 A;  4A3C J;  1RIO H;  2ZM6 E;  4BJT A;  2V1D A;  4KFC A;  1WHU A;  4Y13 A;  4PFP A;  2LC2 A;  2V79 A;  3N97 A;  2JEA B;  2WC2 A;  4DV3 H;  4JX5 A;  1OFC X;  3QP5 A;  5C44 J;  2O6G E;  4OD6 A;  4JYA H;  3MWM A;  1PYV A;  2E1C A;  1S7O A;  2ZME C;  3VYU B;  2W85 A;  4XN3 A;  3FDY A;  4A3F J;  3NQO A;  2O1W A;  4J01 A;  2JEB B;  4I76 A;  1Z59 A;  3G1M A;  2VJ4 A;  4MU3 A;  3K9T A;  4UNO A;  2JA6 J;  4X62 E;  3HOS A;  1ETX A;  4UUS A;  2A2C A;  4NXM H;  2ZBK B;  4CO8 A;  2M5W A;  2KZG A;  2E19 A;  1ZG3 A;  4OAZ A;  2FF4 A;  1C0W A;  1NHA A;  2IS4 A;  2R7U A;  3IUO A;  2KT0 A;  4C3J J;  2DPU A;  2RKH A;  4MNU A;  3LNU A;  1N36 E;  3TP0 A;  2IEK A;  1SAN A;  1EC6 A;  2UXB H;  3RKW A;  2ZJP F;  1Y1V J;  3L00 A;  1HW2 A;  1UDN A;  4JI5 H;  3K4J A;  4PSW A;  5AIQ A;  2KZV A;  5IY5 H;  1ZK8 A;  3L2W A;  3VPR A;  1YX3 A;  2A68 F;  3V8L A;  2LKX A;  4A0X A;  3C2B A;  2DMQ A;  3BJ6 A;  3CMY A;  4DV6 E;  1RR7 A;  3I0T A;  3K70 C;  2HR3 A;  2W25 A;  4KN4 X;  5LLQ A;  1VQ5 I;  1FSH A;  3QT6 A;  2D45 A;  3HOZ J;  1W5T A;  4IOC F;  1MNM C;  2QA4 I;  2XV4 S;  1ZLK A;  2EJR A;  5JHF A;  4HAC B;  3DF8 A;  3KZZ A;  5B1B H;  2KDZ A;  3SJM A;  1MW7 A;  2QQB A;  1LPQ A;  3U1K A;  4DV1 H;  1X1D A;  1NK3 P;  1K47 A;  3RPU D;  5IP7 J;  4DYR A;  4GRI A;  3CCU I;  2Y0M A;  2MAB A;  4JK1 X;  1P92 A;  4YY3 H;  1J5E I;  4NXN I;  5K36 G;  4GDF A;  1ZM3 A;  1HNW H;  5GME A;  2QKL B;  3L2C A;  4DR1 I;  1TW2 A;  3KZI C;  4G9Y A;  4DYC A;  1OIS A;  3P5J A;  3VYS B;  2PO2 A;  3T1H I;  3HSF A;  2OJE D;  1JUM A;  4ED4 A;  2Q2E B;  4GXO A;  1RES A;  3K7A J;  4PGG A;  3IRQ A;  4DV7 H;  3LFK A;  4XSX F;  1P4A A;  3NAU A;  2V2V A;  4X66 H;  3K4N A;  2D9I A;  3GFI A;  3WTU C;  2NVQ J;  2A07 F;  2F4O B;  1XSX A;  2G8Y A;  1FSE A;  5B66 C;  2Y75 A;  5D8K B;  1CF7 A;  4OO1 E;  3MZY A;  1L3L A;  3WU4 A;  3S32 A;  3AG4 H;  3QYB A;  3E5X A;  3FX3 A;  5DV5 A;  3ULQ B;  3M9A A;  2ZIT A;  4IFD F;  5F0C A;  2PO1 B;  3HC7 A;  3CCS I;  2QYO A;  1XMK A;  4BQO A;  4HQM A;  2CTE A;  2COM A;  3GLX A;  3DBR B;  4JQF A;  3FXL A;  2M30 A;  1Z7U A;  4LFU A;  4BHC A;  1DGW Y;  4PDK A;  5K36 F;  1E3P A;  3S1N J;  2CRG A;  2VQH A;  2ECC A;  2GBY A;  3DQV C;  1OMI A;  3IKV A;  2PEX A;  5F0F A;  2E71 A;  5F64 A;  1XB4 A;  2IVM A;  2M4K A;  3M07 A;  1D0X A;  1YX5 A;  4Z6Y A;  4AQY E;  1TWG J;  3E1S A;  4YFN F;  3WU1 B;  1WE8 A;  2MD0 A;  3DKW A;  1U2W A;  2G0E A;  1H9T A;  4AIM A;  5C0X B;  2OA4 A;  5ICE A;  3R61 A;  2KQR A;  4R79 A;  2VQL A;  3T5X A;  2K4B A;  3K70 D;  5LGN A;  4DBQ A;  1VQM I;  3FXK A;  4X64 E;  1KZH A;  4KA4 A;  2JA8 J;  2LNB A;  5LMU H;  3BQZ A;  2F2E A;  3FMS A;  3HGG A;  4KUM A;  4HNU A;  3CQZ J;  2C37 B;  4DR6 I;  1KQ9 A;  2L2O A;  3GX4 X;  2V9V A;  3UNG C;  3MKW B;  2BW3 A;  1OR7 C;  3HHH A;  4NC7 A;  2K5C A;  1HW5 A;  1YOV B;  1ODH A;  3FHN A;  1POG A;  1N32 I;  4UHT A;  1HNX H;  2HTJ A;  1WWX A;  3WGH A;  2NS0 A;  4X65 I;  4FX4 A;  2EIM H;  2VOD A;  3D4J A;  4M72 A;  3N4M A;  4Y3O A;  2XAU A;  3T8T A;  5AON A;  1ZXN A;  4GYG A;  4E7J A;  1YS6 A;  3OYC A;  1VQ4 I;  3S8P A;  2JT2 A;  4BH9 A;  4OZE A;  3P76 A;  4B3S I;  1HNZ E;  3TW6 A;  4GKK I;  3L09 A;  1N33 H;  2DK5 A;  2H6C A;  2CFO A;  1MSF C;  3HZJ A;  1WKM A;  4XK4 A;  1IRZ A;  4JI3 I;  2CW7 A;  4HYE A;  5ICC A;  2F5D A;  1X2N A;  2RQQ A;  3FXJ A;  1Z6T A;  1GHC A;  4ZTJ A;  2HEO A;  4PU9 A;  3B78 A;  4IZK B;  4MEX F;  4DPW A;  4B8X A;  1IXS B;  3F8F A;  1IBM I;  1OKR A;  1YS7 A;  1IAW A;  1X4N A;  1H8A C;  4JOM A;  3LMM A;  4E7S A;  4RB1 A;  4C2U A;  3GAB A;  3JTH A;  2CV1 A;  4LFA I;  2OBP A;  1BI0 A;  3VWB A;  5JVT A;  4ENN A;  5C4J J;  2EPF A;  2XAQ A;  3S14 J;  2OZ6 A;  2LTP A;  1HXD A;  1BI3 A;  4WX9 A;  1XG1 A;  3ZCO A;  3A0H C;  3JRH A;  2WB1 A;  5DM7 F;  1QBJ A;  4L0Y B;  2FNA A;  2CO5 A;  2Y9Y A;  5KHD A;  3KYL A;  1LQ1 A;  1E3H A;  3E3V A;  1S16 A;  1I94 H;  4JI7 E;  2IA0 A;  2EIJ H;  4NQW B;  2HKO A;  4XKC A;  3BT9 A;  2TRT A;  2CG9 A;  3WU5 A;  4Q4Z F;  3H9Q A;  3ZZU A;  1H7S A;  1FEX A;  1DQU A;  4F3Q A;  4U3B A;  2M0C A;  4MQV A;  3SEQ A;  4ENJ A;  1AN7 A;  4B3M H;  1W7P B;  1P6R A;  4M6Y A;  2VF3 A;  3CD6 I;  2LR8 A;  2ZXI A;  3Q0U A;  1USS A;  2AQF A;  4XQF A;  3CDH A;  4ENM A;  1K79 A;  1J59 A;  3HRU A;  4M1K A;  2HK3 A;  3S2H J;  1O3S A;  4LF5 H;  5BS6 A;  3A0B C;  1SAU A;  1FOK A;  1T98 A;  4AYB A;  5JLW A;  1YO5 C;  3AAF A;  2OC6 A;  4OKG A;  4P9F A;  4BE0 A;  2EZH A;  3CJQ B;  2GXG A;  4EQQ A;  4FTH A;  2BA1 D;  4F55 A;  3CCJ I;  1YE9 A;  4C3H J;  4AD9 A;  5IPA A;  3TO9 A;  3ZR8 X;  4BYY A;  1MBH A;  1YFH A;  2LMD A;  4BHP A;  4IL6 C;  4LF7 I;  4MYU A;  1S7A A;  3T1B A;  3MMY B;  4XRM A;  2KL4 A;  2NVY J;  1QQI A;  2IGO A;  3C2G A;  2V6C A;  3TP3 A;  1KU3 A;  2UUA E;  2UXD H;  4E7H A;  2UXN A;  1K4T A;  2HQR A;  2R7Z J;  4B3S E;  2JSC A;  4CH7 A;  2XRO A;  4MU4 A;  2GZW A;  3M7G A;  3RYR A;  4JI0 I;  4B3R I;  5IWA H;  1U9N A;  4YG2 F;  4F52 A;  2KIU A;  4IOA F;  1GXQ A;  1MBF A;  4BA2 A;  4LF7 H;  2HDD A;  2DFF A;  4Q47 A;  2YX7 A;  3BRO A;  4B3X A;  1HLV A;  2Q1Z B;  4LCH A;  2ISY A;  2VC1 A;  4HQE A;  4G12 A;  2RVC A;  1PUE E;  2DN0 A;  3E0J B;  1HF0 A;  4L9N A;  4JI5 E;  4P52 A;  1BC8 C;  4CCK A;  5KCM A;  2EFQ A;  2K9L A;  1VQ9 I;  2HU9 A;  3QRF F;  3M6A A;  4A3J J;  1BIA A;  2HI3 A;  2XGC A;  4O5V A;  5D5X B;  1RPW A;  1JUP A;  4EGY A;  5FRN A;  5CVJ A;  1IDY A;  4QTR A;  2QQ8 A;  1D3Y A;  1ZGW A;  2QGU A;  1H9G A;  2ZME A;  3ZMD A;  3SYT A;  3CES A;  3ERE D;  4X62 H;  2L3D A;  2GOM A;  2ZJ2 A;  2EZL A;  3K4K A;  3HG9 A;  1IXC A;  1FNM A;  4WCG A;  4LOC A;  3GTL J;  1G3W A;  3KZY A;  2IS6 A;  1MU5 A;  1ZR2 A;  1R1U A;  1WCM J;  1IUF A;  4DR7 H;  4RPF A;  1Y8R B;  2QLZ A;  4AVP A;  4LB6 B;  2HZD A;  3WG9 A;  2JE6 B;  1Z3X A;  1O7F A;  1YJ9 I;  4DV1 E;  1U9O A;  3OYE A;  2K9Q A;  2P6T A;  2ANR A;  2XPV A;  2P0W A;  2YUS A;  1JHF A;  4GKK E;  2XB0 X;  4RGS A;  4R1F A;  2EFP A;  2OTJ I;  3U1Y A;  2VKV A;  3HKZ N;  1GV5 A;  1TT0 A;  5JEA B;  1J4W A;  2WY7 Q;  3I56 I;  2BA1 G;  5DRO A;  3BDD A;  3KP2 A;  1LUJ B;  2E5Z A;  3S2W A;  1U2R A;  3K1M A;  4DQ2 A;  2RGV A;  2ZCW A;  1RUN A;  2QUF A;  5HDG A;  4PCQ A;  1IBM H;  3FK6 A;  2FMR A;  1W36 C;  4DUY I;  1KGS A;  4U0Y A;  2L4M A;  2WAE A;  4ZTF A;  4DV4 I;  2UXC I;  4MQY A;  2KIM A;  1JKR C;  1W4M A;  2GA1 A;  3F8B A;  4ZC3 A;  4Y17 A;  4A3I J;  4LCG A;  2AQE A;  3QU3 A;  2O8K A;  1ZR4 A;  2R93 J;  1ZZI A;  5E1W A;  4N3O A;  4DR2 I;  5DUI A;  2Z5C B;  4HF0 A;  4DUZ E;  4FT8 A;  1OCR H;  2X06 A;  4N4N B;  1R9T J;  1EA3 A;  4EC5 A;  3DKX A;  3GFM A;  3T1Y I;  4DUY H;  1V55 H;  1J5Y A;  2IA2 A;  2DT7 B;  1UHW A;  2HDW A;  2L9V A;  2E1M B;  1N25 A;  4B3T E;  2PQ8 A;  2BY0 A;  5FRO A;  2W84 A;  3AEV B;  4DNC A;  1N75 A;  2V9K A;  4KIG A;  4LPF A;  1SFK A;  2DYR H;  1A35 A;  4CYC B;  2Y30 A;  2LVS A;  2IAI A;  1I3Q J;  4PUS A;  1X3U A;  2CWH A;  2P7V B;  4ZVI A;  3CJR B;  1W5C C;  2JRT A;  4A93 J;  2VPL A;  5C0X G;  2VJI A;  3L2Q A;  3GVA A;  2BY1 A;  3KLN A;  2BR2 B;  4XIC A;  2KPM A;  4HAM A;  1J9I A;  5DNL A;  4IFD D;  3HIF A;  1UHM A;  5LMU I;  3M7N D;  2LKS A;  2BEO A;  3H35 A;  2O3F A;  3IWF A;  2F5F A;  2V1N A;  2ZBK A;  1Z0G A;  4OO1 F;  1Z2I A;  1U8B A;  4G6D A;  3MN2 A;  3CUQ A;  2YX4 A;  3WOD F;  3PSF A;  2LY9 A;  1UDO A;  1UFM A;  5J1Y A;  3SDB A;  2UUA H;  1H89 C;  3JRC A;  4IRH A;  2CV2 A;  4L9T A;  4XLA A;  4I99 C;  4BY1 J;  1HQC A;  2KIS A;  3JW4 A;  4P5O A;  3M3Y J;  1F1Z A;  4EM1 A;  2HHH I;  3J7A G;  1IG7 A;  3ZN0 A;  2KIQ A;  2VBW A;  3W2W A;  3W2A A;  1IBK H;  1G3T A;  1K83 J;  1ZHF A;  2YSR A;  5K5R A;  3OMY A;  4LK0 F;  1R00 A;  5IT9 Q;  4IHX A;  4JI8 E;  3I58 A;  3E5Q A;  4PZJ A;  4UUS B;  1ETV A;  2E7X A;  4ZYA A;  2PO0 A;  5IT9 K;  2L9R A;  3DEE A;  5ELW A;  3CDJ A;  2JMW A;  5BOX A;  2GQ0 A;  4CCM A;  4UXN A;  1YHC A;  2W24 A;  3N05 A;  1U6G A;  2VES A;  4DV5 I;  3IV5 A;  2AXY A;  2ECB A;  5IWA I;  3P9I A;  4PJM A;  1VIG A;  5EKW A;  3RQ4 A;  5M3M J;  4DPU A;  1WTJ A;  1OCP A;  1P9Q C;  4BQQ A;  1W0T A;  3K6G A;  5HNF A;  3W6K B;  4IHV A;  4MDT A;  4DU7 A;  3LL7 A;  3A01 A;  5J40 A;  1HBX G;  4A6D A;  2HOA A;  2BA0 G;  1YW8 A;  1K4S A;  1N34 I;  1MH4 A;  2HXI A;  2VQE I;  5LD2 C;  2V1U A;  2PNM A;  1Z05 A;  1BL0 A;  1PVE A;  1MMN A;  1H0M A;  2BY3 A;  3W3C A;  2R5Z B;  2C37 A;  4DV5 H;  3HTU A;  3C18 A;  2VLA A;  2KMU A;  5DNX A;  2A6T A;  2Q0O A;  2RQP A;  1YIO A;  2ISZ A;  3HPH A;  4HF1 A;  3PS3 A;  1HNW I;  4JI1 I;  3BG3 A;  5GAG J;  2R3V A;  3O8G A;  1OPC A;  4IKF A;  4YHH E;  1J2X A;  1E2X A;  1T0F A;  2UUB H;  5IYB J;  1J5E H;  1XCB A;  2QSG X;  2VE8 A;  4EAT A;  5DM6 F;  2VKE A;  1WH5 A;  4HV6 A;  3ABK H;  2DGR A;  4DIQ A;  1T8I A;  4JI0 H;  2ZFU A;  3T0Y A;  1DAR A;  1MGT A;  4B3R H;  4RGR A;  3JRI A;  1N34 H;  2XKP A;  1FOY A;  2AHQ A;  1YQA A;  5TGT A;  1ETK A;  2ZNY A;  3RPQ A;  5FJ8 J;  1XNQ H;  2IGK A;  2LJP A;  1S29 A;  2UUC E;  4JV5 H;  1FJG E;  2JWT A;  3FWE A;  1WZ2 A;  1Z91 A;  2DA2 A;  2GLO A;  1IBL E;  4A3L J;  3M7N G;  4G08 A;  4NC6 A;  5ILU A;  4L9V A;  4N9I A;  3BQY A;  4C30 A;  3DU5 A;  1V8C A;  3CCQ I;  2LYC A;  1XCV A;  1YIJ I;  4FW9 A;  5IP6 A;  1JGG A;  4LFB H;  2WP8 A;  1VI7 A;  3OYN A;  1NG6 A;  1TWF J;  5EZH A;  4EJW A;  4HEA 2;  3WHB A;  1ZM9 A;  3H36 A;  4ZH4 F;  1R71 A;  4OIP F;  2HKJ A;  1XTA A;  3WU0 A;  1V9N A;  2O1T A;  2ME0 A;  5E1Z B;  1FMW A;  1HDP A;  4DV2 E;  2H09 A;  1JXS A;  1Z5A A;  4JI4 H;  3CCL I;  3S2D J;  1SMT A;  4DR3 I;  4A3E J;  3HOV J;  3OYD A;  1VTN C;  2WTE A;  2ZJR F;  4LFA H;  4UTG A;  3VOE A;  3PS2 A;  4QNK A;  1H88 C;  2HXO A;  2XF7 A;  3F72 A;  3GME A;  2NN6 A;  1R6L A;  1RKT A;  2NAZ A;  2TCT A;  2X0L A;  2YR2 A;  3B73 A;  1YHQ I;  3WTT C;  1V5G A;  3QAH A;  1YI2 I;  3ZQF A;  2NPF A;  2PG4 A;  4BQA A;  4DR5 I;  4HLX A;  2XB5 A;  1B9N A;  5E1X A;  3OYJ A;  2P5V A;  3F21 A;  3MKY B;  1NH3 A;  1JTY A;  2R7V A;  1IRX A;  1KA8 A;  3IRR A;  4DV3 I;  5JVG F;  1ZTR A;  3BTJ A;  4A12 A;  1U3E M;  4HY1 A;  1WGX A;  4LFA E;  2CWF A;  1B62 A;  2JN6 A;  2WY8 Q;  1R1T A;  2BOL A;  2CH0 A;  2XGE A;  2R7D A;  3BP8 A;  1Q1V A;  1HOM A;  2AXT C;  2K85 A;  5CQG A;  4DV2 H;  2HVQ A;  2K9N A;  5D5U B;  4KJZ A;  2ZO4 A;  2ZXJ A;  2VT3 A;  2A5W A;  3HEF A;  3KX2 A;  5IT9 W;  2HHH E;  1G3Y A;  4XBF A;  2HVS A;  5TJJ A;  2DA5 A;  2UXC E;  3KP5 A;  3M8E A;  4AC0 A;  1RET A;  4J3D A;  1SVO A;  4JV5 E;  4FJU A;  1FJG H;  2L02 A;  3JRG A;  1XS9 A;  2F5E A;  2VQF I;  4OIO F;  5JEA E;  3I3L A;  4X65 H;  3KCC A;  4G7Z F;  4DR3 H;  4JX6 A;  1AWC A;  4BA1 I;  2BHY A;  3I59 B;  4MU0 A;  3EYY A;  3E7L A;  2LKP A;  2MLK A;  2X4H A;  4ZJZ A;  1B63 A;  3W6V A;  2WBM A;  3KYC B;  1MX0 A;  1UMQ A;  3K85 A;  1FOX A;  1JKO C;  3QT8 A;  2FEZ A;  3IWZ A;  2JK3 A;  3TW7 A;  2B7E A;  2DYS H;  2ZXW H;  4EVI A;  2OQR A;  4UY8 I;  5HOO A;  2V8P A;  4MTD A;  1OYY A;  3O2P E;  3ZP5 A;  1U5T B;  4MO7 A;  5LEJ A;  1SAX A;  4IEJ A;  1USU A;  4CZZ A;  2O7O A;  1X19 A;  2XGX A;  5L3D A;  2UU9 E;  5DT9 A;  4P96 A;  2ELJ A;  2QSF X;  4DV0 H;  3OIQ A;  4OOI A;  3SDG A;  4FET A;  4LIT A;  3H3V K;  2EV5 A;  3WTV C;  2X6X A;  3AKZ A;  1QHH D;  1A31 A;  2VJJ A;  1ONV A;  1FTZ A;  2VQG A;  3GFJ A;  2PMZ A;  3MVP A;  1SFX A;  1R1V A;  1HNX I;  2CUZ A;  5JEA D;  4E9J A;  3S1Q J;  2TDX A;  3DBL B;  1HKQ A;  2JVH A;  2L7F P;  1IN6 A;  1QVU A;  2MYS A;  5C3E J;  4RGX A;  2YU3 A;  2P7C B;  1XPX A;  4FJS A;  3H92 A;  2XC7 A;  2O8X A;  2R7S A;  2Z16 A;  3KDK A;  2H94 A;  3HL2 A;  3HOX J;  4DR7 I;  4OO1 A;  1O7L A;  1OR7 A;  1G59 A;  4F7Z A;  1HCR A;  3CDI A;  3J80 K;  3GCM A;  4CGZ A;  1IN4 A;  1U8R A;  1MBE A;  3HUG A;  4ANJ A;  2J65 A;  1BI2 A;  2ICW G;  3PJR A;  2KP6 A;  1GVD A;  5L3E A;  4W1U A;  5E3N A;  3BPV A;  4JI2 I;  4BE2 A;  2OUM A;  1ZEL A;  1XNR H;  2VQE H;  2Z2S B;  3EUK L;  1GLN A;  4EMS A;  3BG6 A;  4L5E A;  5LHI A;  4NB5 A;  3J80 C;  3QU6 A;  4LLN A;  4LD5 A;  3T1Y E;  1XNR E;  4U0W A;  4CYC A;  2UXB E;  2MBF A;  5LL6 b;  1TZL A;  4CA0 A;  3ZN1 A;  2DMU A;  2P5K A;  1D1B A;  4DR4 I;  4BUP A;  3LSG A;  4XLH A;  3A2K A;  2BXY A;  4USK A;  1X3Z B;  5JHU A;  3U21 A;  3WTW C;  3PFY A;  4OCH A;  3EUH C;  3OSS D;  1IV8 A;  3ZQ7 A;  1EF4 A;  1JTX A;  4DBR A;  2RNJ A;  4W97 A;  3JAM Z;  1MSZ A;  5EEG A;  3RKY A;  2HYJ A;  3U9G A;  4LGW A;  4MGR A;  1O3R A;  1SMY F;  1EV7 A;  2A05 A;  2P8T A;  1Z0V A;  2V4J C;  1IF1 A;  4JVY A;  5F6F A;  1P4X A;  4CXF A;  3CF5 F;  4GKJ H;  1V5E A;  4WAN A;  2JA7 J;  1Z6R A;  3EQL F;  1PVG A;  3PL8 A;  4QWQ A;  5IYC J;  2M8E A;  4RDU A;  2C38 B;  4JYA E;  4JBA A;  4R8H A;  3GTO J;  1UCR A;  1D8K A;  3LAJ A;  4F93 B;  3C3W A;  2R92 J;  2XSD C;  1FWZ A;  1WI9 A;  3FBI B;  5LRR A;  2PJP A;  3FKI J;  1R6M A;  2V2Q A;  2Z99 A;  1EJ9 A;  4B3M I;  4NZT M;  3E6C C;  2M34 A;  4H4K C;  3H5A A;  4RLQ A;  4FW7 A;  3BLY A;  2GQQ A;  1Z5C A;  5LMN I;  3HRM A;  3JAM K;  3IL2 A;  2Z5C A;  2NN6 G;  2M87 A;  3QWL A;  4NXN H;  4IHS A;  3WGG A;  3I4N J;  1VQO I;  3KE2 A;  5EF6 A;  2E2I J;  4WXH A;  4P55 A;  1WJB A;  4HX7 A;  2IP2 A;  5CVV A;  5J1U A;  5IOY A;  1RUO A;  4LF6 I;  1VIS A;  2W7N A;  2W48 A;  3M8F A;  2PNZ B;  4MLO A;  2V2Z A;  2LK2 A;  4B1R A;  3PRY A;  6PAX A;  3CCY A;  1Z3Y A;  5LEK A;  2HVR A;  3U1D A;  1ETQ A;  1QZR A;  3NRV A;  2IT0 A;  3BR2 A;  1T0F C;  4JI2 E;  1R49 A;  1TW3 A;  2R7R A;  2VN2 A;  3Q0W A;  5CYV A;  5HLH A;  1YRN A;  2CPQ A;  2HKX A;  1GXP A;  2PJR A;  4JI8 H;  2LF0 A;  3NAR A;  4DGW B;  5FRM A;  3S3M A;  3HSR A;  3ABU A;  2HH3 A;  5EDN A;  1FIA A;  1WJC A;  2JA2 A;  1R6R A;  2VB6 A;  5B5E C;  1YRN B;  4O3M A;  3SEZ A;  2DA6 A;  4DXL A;  1FY7 A;  3R4K A;  3I0P A;  1K61 A;  4XON A;  5LHH A;  1ITY A;  5EL9 A;  2R0Q C;  1HC8 A;  1LKX A;  1HST A;  4Z7Y A;  2DA3 A;  1NG7 A;  2J5O A;  3P3C A;  2VKH A;  1YJW I;  2DMN A;  4GKK H;  2DO7 A;  3NWS A;  2WV1 A;  3H0D A;  3J80 W;  2ACJ A;  5F08 A;  1B8I A;  4CCO A;  1T2K A;  1E0E A;  4USM A;  3H5R A;  4M3G A;  1K6Y A;  5ILV A;  4YII A;  1XMO E;  4BKX A;  3RZD J;  1I6H J;  4OX9 I;  1WJ5 A;  2LRD A;  4XMY A;  5FKL A;  3UR3 C;  3K1N A;  1KHM A;  3MQ0 A;  3K4C A;  2FMY A;  4BNC A;  3LQR A;  3J7A O;  2O0Y A;  5FLV A;  4AVZ A;  1FWK A;  2HYF A;  3HKZ A;  3V69 A;  3BY6 A;  1BBY A;  3IH3 A;  4NUB A;  2A69 F;  5LRS A;  2M1B A;  3JCU C;  5DEQ A;  4EJV A;  2LTM A;  2CUE A;  1OCO H;  2HHH H;  3O6B B;  4A2U A;  2HQ5 A;  4C3I J;  5IOZ A;  1OCT C;  4P7A A;  4IX7 A;  2OI2 A;  1BW5 A;  1F0X A;  2FJ1 A;  2FQ3 A;  1SD7 A;  3KRN A;  1FIP A;  2GM4 A;  3EZJ A;  2M7B A;  4E7I A;  3BWG A;  5IWA E;  2QF7 A;  2Y0S N;  1L0O C;  4DR5 H;  3ZQC A;  4X62 I;  3MKL A;  3PYE A;  2EK5 A;  1I39 A;  1OCZ H;  3DU6 A;  3A02 A;  4Y15 A;  3B6A A;  1SD6 A;  3CME I;  2I8D A;  2MA3 A;  4LF4 E;  4JX4 A;  1K78 B;  2KRH A;  3ZMZ A;  3GTQ J;  4RMN A;  2NN6 D;  4PDB A;  3CCM I;  2JA5 J;  1H72 C;  2VXZ A;  2KFD A;  2RRE A;  2VL8 A;  3SZT A;  4WWC A;  5BR8 E;  4HOB A;  2HFU A;  2Z9O A;  2CSO A;  2GO3 A;  3H3Z A;  4ETS A;  3JRE A;  1FT9 A;  5K36 A;  3LA7 A;  1OJ4 A;  3LOC A;  3P3G A;  5DCM A;  3TMO A;  1A6Q A;  3CZ6 A;  1PQX A;  5K36 E;  4HSR A;  2QCO A;  4QPQ A;  2MJH A;  4XKV A;  3GW2 A;  1FP1 D;  1ZYR F;  4LFC I;  4XOR A;  4LF5 E;  4XLN F;  3TBI A;  1N0V C;  1HSJ A;  3HRT A;  2ZM6 H;  4WAL A;  2UUC I;  4MFD A;  4DR2 E;  4PSX A;  3OWT A;  1ZKG A;  1ZZJ A;  4D5F A;  4B3A A;  2MG4 A;  2HOT A;  4I2O A;  4HST A;  1JT6 A;  2VQC A;  4L9J A;  5HNH A;  4NBQ A;  1STZ A;  4KHP E;  3BTI A;  4DV4 E;  1MBG A;  4A3M J;  1O4X A;  1I5Z A;  1TC3 C;  2EIN H;  1ZM4 A;  1VIH A;  3RTR A;  1KQ0 A;  5B3S H;  3COA C;  2O1U A;  2K9M A;  2OCE A;  4DR1 H;  4BA1 A;  5LMN H;  2AE8 A;  3CF2 A;  1B4A A;  3F22 A;  5F27 A;  4BE1 A;  5AIP A;  1MDM A;  2ESN A;  2K7L A;  1TP4 A;  1XNR I;  2E5L E;  1SD4 A;  2KRC A;  3DFG A;  3K4M A;  3BR3 A;  2A2D A;  2JE6 I;  3TOA A;  4KNY A;  2LF8 A;  1MKM A;  5LGT A;  1LE8 A;  4D5C A;  3ZZT A;  2FUG 2;  2K4J A;  3WTX C;  3FXU A;  4LF5 I;  3OIP A;  4LF4 H;  4XOP A;  3IC7 A;  2X1E A;  3F8M A;  3FM5 A;  4X66 I;  2JEB A;  5HS9 A;  2DEI A;  3PIP F;  2HQA A;  3NWT A;  4HW0 A;  2A3S A;  3K69 A;  1GVJ A;  4G7O F;  1ETO A;  2VBX A;  1TQP A;  1EKE A;  4DR6 E;  3TGN A;  5CVR A;  1XRH A;  1K1G A;  5FKN A;  4I6Z A;  2L0K A;  3Q1Q A;  4RB2 C;  1WJF A;  3D5S C;  1K6O A;  2PN6 A;  4LIU A;  4XTJ A;  2Z0S A;  1TWH J;  1HR0 I;  2ESH A;  3K0L A;  3CUO A;  3EUH A;  2LG4 A;  2EA4 A;  3V8K A;  2R3S A;  4XKB A;  4FW6 A;  2NN6 C;  3C1D A;  2KHM A;  2K27 A;  2HKE A;  1R36 A;  3HSE A;  3LSR A;  3IP4 B;  3J81 Z;  2HQN A;  4XLE A;  2WV0 A;  1MG7 A;  3HRS A;  4IJA A;  1QHG A;  2L54 A;  2CTL A;  4RLF A;  1R5I D;  3PQK A;  3TDU C;  1XMO H;  5TRD A;  2AXL A;  2DT5 A;  2VBY A;  1DU6 A;  3ZMV A;  2PNZ A;  4D7M A;  3SHF A;  4GYI A;  2NRA C;  3G1O A;  4X64 I;  2GOX B;  4J00 A;  1JKQ C;  4PJJ A;  1PUF B;  1N33 E;  2DOF A;  1BR2 A;  3A1Y A;  2YQR A;  4M9S A;  3C2H A;  2HFS A;  1X1B A;  5GTH C;  2ZXH A;  3WHC A;  3OSF A;  4GQU A;  3I54 A;  2Z3Y A;  2L7Z A;  4M6V A;  4UVC A;  4KIF A;  1JI8 A;  1Z5B A;  3K4B A;  5J1R A;  1FC3 A;  3HOU J;  4DR4 H;  1IC8 A;  1UEK A;  2FX0 A;  1YTY A;  4XLF A;  1OQY A;  4V19 K;  3GTM J;  5FLX C;  1PJR A;  1D0Y A;  4B44 A;  4BQN A;  4FE7 A;  2X6W A;  2QQA A;  4YEJ A;  3UHM A;  3ZQH A;  3TDZ C;  3K1J A;  2X9D A;  2XAF A;  3VEP A;  3ZKB A;  1Z21 A;  4WK8 F;  2XKO A;  3CLO A;  1W36 D;  4JI2 H;  3TL4 X;  4BXX J;  1DPR A;  2X1D A;  4P9U A;  3ABM H;  2E60 A;  2Z33 A;  5KAI C;  1XMX A;  5GTI C;  5GAE J;  4NZR M;  4QMF B;  4HDV A;  3H1C A;  1N32 H;  1KU7 A;  2V7F A;  3WU2 C;  5KAF C;  1VQL I;  1GUU A;  2LRE A;  1I6U A;  2H6B A;  3GZ6 A;  1MMD A;  1T6S A;  2AO9 A;  4RAY A;  2L4A A;  1JT0 A;  5E79 C;  1WVN A;  1Q1H A;  4AQY H;  2Q8K A;  4II2 A;  2F6C A;  2F4I A;  3OY9 A;  3BTL A;  4OX9 E;  1LJ9 A;  5EZG A;  1R4M B;  1IRF A;  5JI6 A;  4LOM A;  4OMY A;  2XAG A;  3KLO A;  3VOD A;  5HLT A;  3J81 K;  1QZE A;  2Y9Z A;  1ZRF A;  2H8R A;  2DFI A;  3I71 A;  1SFU A;  3CMA I;  2WB1 N;  1XGS A;  3BG7 A;  3J81 Q;  3BG5 A;  4I98 B;  4LF6 E;  4V2G A;  2DJN A;  1ZG1 A;  4I3H A;  2O5R A;  4DV7 E;  3ZMS A;  2CTK A;  5E8I A;  2X85 A;  3PSI A;  4FIS A;  4I0B A;  4B47 A;  2WNR B;  3H5N A;  1EH6 A;  2O4C A;  3F3X A;  2D1H A;  4IHT A;  1NXU A;  1FYL A;  5LMN E;  2JSP A;  1D5V A;  4HLY A;  2R4G A;  1FYM A;  4D9J A;  1EI1 A;  2NN6 F;  2R5Y B;  3AG1 H;  2R7F A;  1LDJ A;  2ZKZ A;  1KIJ A;  5BNG A;  3LA3 A;  3OR2 C;  3KYD B;  2XF5 A;  5M5X J;  5HLI A;  3MZH A;  4FW3 A;  3LPS A;  2HNH A;  2XSJ C;  2M6Q A;  3VB2 A;  3RCO A;  3NZK A;  2LOO A;  4BAY A;  2JEA A;  4DR4 E;  1A5J A;  2HH2 A;  4DR3 E;  3H3U A;  4M3E A;  3SFZ A;  4Z7C A;  4A3K J;  3T1Y H;  2PQU A;  1FTT A;  1R58 A;  1SC7 A;  2O9L A;  3CUQ B;  4V2F A;  3OYG A;  2E1N A;  3R0A A;  2K02 A;  5A2Q W;  1WJA A;  5B1A H;  2M9H A;  1OYI A;  4U88 A;  1QA6 A;  1V3F A;  4ZDL A;  3VYT B;  1W7P D;  4ZYE A;  1HNZ I;  3DPU A;  4AIK A;  1RRJ A;  1W5S A;  2GWR A;  4RM3 A;  1XXE A;  5BR8 I;  3FF5 A;  5H6Q A;  4DZJ A;  3A01 B;  4I01 A;  5H2F C;  1TL8 A;  1V5F A;  3DTI A;  2L01 A;  3D5R C;  2E3U A;  1QPI A;  2CVE A;  3L1P A;  1Y8Q B;  4X64 H;  2R5Y A;  2EQR A;  2FBI A;  3B82 A;  1FI4 A;  4BA2 I;  3PNY A;  4M74 A;  4BBR J;  2Y0S A;  1Z0E A;  2O03 A;  3ZRG A;  2OPU A;  3KP3 A;  4PK4 A;  4WUC A;  3AFH A;  3OYK A;  1R22 A;  3PYG A;  5BQT A;  3FXQ A;  2COB A;  1BOB A;  2JPB A;  4YFX F;  4IO9 F;  3K4L A;  4A5M A;  1Y4U A;  1JGS A;  3IAM 2;  2E1O A;  1A04 A;  3I4M J;  4ZDO A;  1FKA E;  3L7W A;  1APL C;  4U87 A;  3I53 A;  2UU9 H;  3OYI A;  1A36 A;  1LFP A;  4XLP F;  4HRI A;  5FD5 A;  1U0J A;  4JI1 H;  3BJO A;  2PMH A;  1X1P A;  1HR0 H;  3Q9V A;  1XX5 A;  1FNN A;  3CC4 I;  1FZP B;  2ZB9 A;  1F9N A;  3HDD A;  3F23 A;  2OTL I;  1IRG A;  3QD7 X;  3KFW X;  2DCE A;  2E2J J;  4IFD G;  2FML A;  3HM5 A;  4ASN A;  2E7W A;  2EV6 A;  4GGG A;  1S72 I;  1E3O C;  2DFE A;  2XUB A;  1BI1 A;  2LY2 A;  2VAS A;  2XAS A;  3LNQ A;  1Y6Z A;  5A2Q C;  2DQR A;  4YHH I;  3RPU A;  4EJO A;  5JEA G;  4HX4 A;  9ANT A;  2J5P A;  1KTV A;  3RJP A;  2DLL A;  2HS5 A;  1BR1 A;  1Y60 A;  3KEQ A;  3HXL A;  5GMD A;  2EIK H;  2DU9 A;  2CTM A;  2W57 A;  3OOP A;  5JFR A;  2H1K A;  2X7I A;  4C2T A;  2H8W A;  4MTE A;  4EJU A;  3RQI A;  2CPM A;  1Y0N A;  2E36 A;  4D7N A;  1UJ8 A;  3D1N I;  3RDI A;  3HJC A;  4I0A A;  3JR9 A;  4IRI A;  2OPV A;  5JEA A;  2R7X A;  5K1Y A;  4N9H A;  1Y56 A;  5EYR A;  2P5L C;  1R5H A;  1RNL A;  2MC4 A;  2IJL A;  1W0U A;  2EB7 A;  4DV5 E;  3UOE A;  4S05 A;  4CCJ A;  1UZC A;  4MHG A;  3CTA A;  2BZT A;  3FZV A;  2NS8 A;  4RS8 A;  2JUC A;  3LST A;  1BA5 A;  3P7N A;  4TV7 A;  5J6X A;  2DMP A;  4FW4 A;  4DR5 E;  1XHK A;  3SFI A;  5D5V B;  4QLC U;  4XN0 A;  4H8A A;  1B9M A;  2I5U A;  2YPR A;  3DEU A;  3K2A A;  4PJN A;  3L2U A;  5DDG A;  3FM3 A;  2YS9 A;  4DYQ A;  4BA2 B;  3KP6 A;  4DJA A;  3A4C A;  3ZQL A;  4AQY I;  3QT5 A;  2JQ7 A;  1WUU A;  4B8C D;  4BS9 A;  4XRS A;  2HGC A;  1FX7 A;  1V4R A;  1MDM B;  3RYP A;  1MJA A;  4OO1 D;  4JG4 A;  1IBK I;  1ELO A;  2HZT A;  2M7A A;  3BPX A;  3GTG J;  3G6E I;  3HPG A;  4IQ4 A;  2LTL A;  3JTG A;  2FA5 A;  1XMQ I;  2IPQ X;  5FWK A;  2VQF H;  4RGU A;  4DU8 A;  4BU2 A;  3ECO A;  2PNL A;  3J7A Y;  3MFK A;  5CQE A;  2DPD A;  1M1E B;  3F0C A;  2PX9 A;  1X2M A;  3GKU A;  3DPL C;  3FIW A;  5ILS A;  3DEW A;  3FXR A;  3G1L A;  2FFM A;  4FE4 A;  2WAD A;  2A6E F;  2XPW A;  4JI7 I;  2FNP A;  5FLX W;  4ZZL A;  1Y5Y A;  2PO0 B;  5DD4 A;  1UB9 A;  1DUX C;  4NC8 A;  2C39 B;  2CG4 A;  1HW1 A;  2L5Q A;  5K5Q A;  3V42 A;  4HF2 A;  4II3 A;  1BJZ A;  2XVC A;  2CTF A;  2B0L A;  3PNV A;  2H1L A;  2VKC A;  3ABL H;  2DA1 A;  2HOS A;  3S17 J;  1Z0W A;  2ZFW A;  1KVK A;  1IDZ A;  5IT9 Z;  2ADU A;  3PIO F;  2BVL A;  5HDN A;  4LF8 E;  2JEA I;  1Z77 A;  2CS3 A;  4U7B A;  1D1C A;  2MFZ A;  3WGI A;  3LQQ A;  1Y4S A;  1V54 H;  3GWZ A;  3S1M J;  5C0X C;  1SEI A;  1PDN C;  4WUD A;  1XDS A;  2F4V H;  4JI4 I;  4HPQ A;  4UVB A;  4B3T H;  3JAM Q;  1LDK B;  4O6J A;  3BR0 A;  1YW7 A;  2W82 A;  1P2F A; 
#chains in the Genus database with same CATH homology
 2NN6 B;  5C0X D;  4IFD E;  3L7Z C;  1WVN A;  2PNZ B;  4NBQ A;  2NN6 E;  2ANR A;  5JEA G;  2BA0 G;  1DT4 A;  4AID A;  3M85 D;  5K36 C;  1VIH A;  1E3H A;  2PO1 A;  4OO1 E;  5JEA B;  1J4W A;  2C37 A;  2BA1 G;  4BA1 A;  1UDQ A;  2CPQ A;  2CTM A;  4IFD F;  1OYS A;  2PO1 B;  1X4M A;  2PY9 A;  2FMR A;  2HH3 A;  2CTE A;  1ZZK A;  1J5K A;  2BR2 A;  5K36 D;  2C38 A;  2JE6 I;  2CTK A;  2JEB I;  2OPV A;  4BA1 B;  2DGR A;  2WNR B;  5JEA D;  5JEA A;  1E3P A;  4AM3 A;  5K36 F;  1DTJ A;  2JZX A;  1WHU A;  3B4T A;  2JEB A;  1ZZI A;  2JEA B;  2NN6 F;  2WP8 B;  4OO1 A;  3M7N G;  2BA1 D;  3HKM A;  3CDI A;  3GCM A;  1WE8 A;  1K1G A;  4AIM A;  3M85 G;  2ANN A;  5C0X B;  4OO1 B;  2WNR A;  4IFD A;  1KHM A;  2Z0S A;  2JEA A;  4LIJ A;  2WP8 A;  2HH2 A;  2JA9 A;  5K36 B;  1OYP A;  2JEB B;  4B8T A;  3AEV B;  4JVH A;  2PQU A;  2NN6 C;  5C0X E;  5JEA C;  3H36 A;  4IFD C;  2BA0 A;  3V69 A;  4BA2 B;  2C37 B;  5C0X G;  2BR2 B;  2CTL A;  4IFD D;  4OO1 D;  3M7N D;  3L7Z B;  3KRN A;  1ZTG A;  5C0X F;  4OO1 F;  2PNZ A;  4BA2 A;  1EC6 A;  3GME A;  1UDO A;  2NN6 A;  1R6L A;  2JE6 A;  3DD6 A;  1UDN A;  4OO1 G;  2BL5 A;  2QND A;  2YQR A;  2E3U A;  3L7Z A;  4BA2 I;  3VKE A;  2NN6 D;  2OPU A;  4OO1 C;  2PO0 B;  4JVY A;  4WAN A;  2CTJ A;  3GLL A;  2PO2 B;  2C39 B;  3U1K A;  2P2R A;  5JEA F;  2C38 B;  5K36 A;  1UDS A;  2C39 A;  2CTF A;  4IFD B;  1R6M A;  2BA0 D;  2PO0 A;  5K36 E;  5K36 G;  2MJH A;  1X4N A;  3CDJ A;  2JEA I;  5JEA E;  4QMF B;  2AXY A;  5C0X C;  2NN6 G;  2PO2 A;  3H1C A;  5C0X A;  4WAL A;  1VIG A;  4IFD G;  1TUA A;  4BA1 I;  1ZZJ A;  2JE6 B;  1OYR A;  2JVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...