4AM3A

Crystal structure of c. crescentus pnpase bound to rna
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
622
structure length
622
Chain Sequence
GSMFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAVFAKSQKPGQDFFPLTVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVKGFKNEVQVVVTVLQHDLENDPDILGMVAASAALCLSGAPFMGPIGAARVGWVDGAYVLNPTLDEMKESKMDLVVAGTADAVMMVESEIQELSEEIVLGGVNFAHQQMQAVIDAIIDLAEHAAKEPFAFEPEDTDAIKAKMKDLVGADIAAAYKIQKKQDRYEAVGAAKKKAIAALGLSDENPTGYDPLKLGAIFKELEADVVRRGILDTGLRIDGRDVKTVRPILGEVGILPRTHGSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKESFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLAMMDAGVPLVRPVSGIAMGLILEQDGFAVLSDILGDEDHLGDMDFKVAGTSEGLTSLQMDIKIAGITPAIMEQALAQAKEGRAHILGEMNKAMDAPRADVGDFAPKIETINIPTDKIREVIGSGGKVIREIVATTGAKVDINDDGVVKVSASDGAKIKAAIDWIKSITDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Caulobacter Crescentus Polynucleotide Phosphorylase Reveals a Mechanism of RNA Substrate Channelling and RNA Degradosome Assembly.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase/rna
molecule keywords POLYRIBONUCLEOTIDE NUCLEOTIDYLTRANSFERASE
total genus 175
structure length 622
sequence length 622
chains with identical sequence B, C
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2012-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF00575 S1 S1 RNA binding domain
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 4am3A02
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4am3A03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4am3A01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4am3A04
3M85D 2OPUA 5JEAA 2PO0A 1TUAA 3GCMA 4OO1C 2BA1D 1ZZIA 2BR2B 5K36F 1E3HA 2JZXA 2JA9A 1J4WA 4BA2I 4OO1B 4OO1G 2WP8B 5K36D 3GMEA 4BA1A 4IFDE 2C37A 4OO1F 4WALA 1X4NA 2BA0A 3H36A 2JEBA 5K36B 2QNDA 5JEAC 2C37B 2BL5A 5C0XF 1DT4A 2NN6D 4BA2B 4LIJA 5JEAB 1KHMA 1K1GA 2WP8A 5K36G 1WE8A 4OO1D 2BR2A 3B4TA 2NN6G 2NN6F 4AIDA 4QMFB 2YQRA 2JEAI 3CDIA 2ANNA 3V69A 2FMRA 1EC6A 3H1CA 1UDQA 1UDNA 1OYPA 3DD6A 3L7ZC 2JE6I 4BA1B 2PY9A 2E3UA 4IFDB 2DGRA 3L7ZB 5C0XG 2JVZA 4IFDG 4JVHA 1ZZJA 2CTMA 2PO2B 2PQUA 2NN6B 2PO1B 5C0XC 1E3PA 2PNZA 5K36E 2Z0SA 4BA1I 2JEAA 5JEAG 2C39A 4AM3A 2WNRA 2PO2A 2CTKA 5JEAF 4WANA 2CPQA 1DTJA 2CTJA 2MJHA 1ZTGA 1WHUA 3L7ZA 4BA2A 2CTEA 2BA0D 2AXYA 1OYRA 1VIHA 5C0XA 2NN6E 4IFDF 3M7NG 2CTFA 2JE6A 2BA1G 4OO1A 4OO1E 1OYSA 3KRNA 5C0XB 2JEAB 2HH2A 1UDSA 2C38B 2JEBI 4B8TA 3CDJA 4IFDD 2PO1A 2NN6A 5C0XD 1UDOA 2PNZB 2CTLA 2WNRB 2P2RA 2PO0B 4NBQA 1VIGA 1WVNA 3U1KA 5JEAE 1R6MA 1R6LA 3HKMA 1ZZKA 4IFDA 1X4MA 2ANRA 5C0XE 2JEBB 4AIMA 5K36C 5K36A 2C38A 2BA0G 1J5KA 3AEVB 2JE6B 2OPVA 4JVYA 5JEAD 2C39B 2HH3A 3M7ND 4IFDC 3GLLA 3VKEA 2NN6C 3M85G
chains in the Genus database with same CATH superfamily
2YSRA 4DNCA 1R00A 2PO0A 4JI0E 2DQRA 1MMAA 5JI6A 2XVCA 3GWZA 1XCVA 4IVNA 2E5NA 3PFIA 2XRLA 4ZDOA 5DROA 5FLXC 2CUFA 3DTIA 2L7FP 3DU6A 4HX4A 4OAZA 2EFQA 4LB5A 5C4JJ 2X36A 2LTMA 1QVTA 4IOCF 2DI3A 4MTEA 1Z9CA 2DLLA 2N8GA 2DDAA 3KP3A 1Z1DA 1MD0A 2K9LA 4NQWA 2V1DA 3RTRA 1XCBA 1DU6A 3HGGA 1Y6IA 4LJZF 3ZQ7A 5C0XF 3DEWA 3KPHA 4J01A 4E7IA 3ZQGA 4BBSJ 5LMUH 2H6CA 4DV0E 4IZZA 3FXMA 4A0YA 3V4GA 2QQBA 4ETSA 1FNMA 3J80W 2CO5A 3SFIA 3OL4A 1SEIA 3HIFA 3OV8A 2M7AA 3I64A 1ULYA 3MKWB 2VESA 3ERMA 2I5UA 1IAWA 4JV5I 2ZXHA 4U3DA 2UUBH 2X51A 3L7WA 4ESJA 4MU1A 3DKYA 1HSJA 1YLFA 2DOAA 1IBMH 4XMYA 1W1WE 4LF7E 1Q1VA 4GKJH 4DR3I 2LF0A 1Z0WA 1XMQE 3I59A 4WXCA 5ICEA 4BE0A 4GXOA 1KU7A 3AG3H 4A3CJ 3JRHA 1IBLE 3FBNB 4P96A 3L7ZB 4FWDA 2A5WA 3BPVA 1KONA 1FIPA 4ENNA 2LNBA 4DV6I 4DGWB 1VQ5I 2PQUA 2QBYB 3WTVC 4USMA 4Z7YA 2I8DA 1ZM9A 3RI4A 2QSGX 3ZPLA 3KYCB 2JEAA 5HLHA 3ZR8X 1ZKGA 5JEAF 1YW7A 2QQ9A 2QQ8A 2WY7Q 5CVJA 2BM0A 4E4HA 2CW7A 2JPBA 1ZTGA 2HQAA 3MMYB 1J2XA 3RQIA 2WBMA 3J7YJ 3K2ZA 2CTEA 4UHTA 4X62E 1OYRA 3CP8A 4X6AJ 1DQUA 2RQQA 4BS9A 5HNFA 2STTA 5C3EJ 2LG4A 3WTXC 5K7FA 2OTLI 3CTAA 3C2BA 4MLOA 1VTNC 2G7UA 4OX9H 4Z7CA 2O7OA 3LAJA 1J0RA 2VLAA 1RR9A 1X1BA 5CJ9A 3M4OJ 1VQPI 4B8TA 3M07A 4HNVA 4LLLA 1DUXC 3H92A 2HYJA 4N9IA 3RIRA 2GBYA 4HF1A 2Z5BA 1RUNA 5DRRA 2M4KA 3ABLH 1KYWA 5EG0A 4GQUA 5F0FA 5H6QA 4MQYA 4P52A 1REPC 3CESA 1X19A 4HG2A 3ZRGA 1N34H 1EV7A 4B3RI 4IO9F 1MJAA 4AIMA 3JTHA 4JI6E 5FLVA 4C2TA 2ELHA 4IZKB 3CCSI 1KU3A 3L00A 1T08B 1TL8A 5JFRA 4JI3I 4LF7I 1Z6TA 2XASA 3UR3C 2PMZA 4WX9A 1IV6A 2M8GX 1EF4A 2HH3A 3M7ND 2UUCH 2DA2A 4HX7A 4M3EA 2V2VA 4IHYA 3WU2C 3ZN1A 2IT0A 5LMUE 3HPHA 4NXMI 5DUIA 3J80K 3BT9A 1JJ6C 3QT8A 4LFAE 5DTDA 5EYRA 3SQNA 4KT5C 1E3HA 4GKKH 1XD7A 3S17J 4KT6A 4CCJA 3J81Z 4OO1G 1ZLJA 2CJJA 1H89C 3OTOH 4RA2A 2P5LC 2W00A 4DV1E 4CGZA 4IFDE 3NCVA 4HOBA 2F5EA 4CICA 1FP2A 5EZGA 1Z0VA 2BA0A 1ZRFA 3PQKA 3PSFA 5LEJA 1JGGA 1UG8A 2MD5A 2XAJA 5HDNA 1I94I 1FTTA 3LA3A 1PUFA 2JN6A 2M7BA 3AG1H 4DR2I 4HQEA 1N78A 4BE1A 3J7AO 1IBLH 3AFHA 1K1GA 5J4VA 2DYRH 4CYCA 2VBWA 1SD7A 2ZFWA 1ZGWA 3JAMW 2BR2A 1MU5A 2R7SA 3TO6A 4Y33A 5KHDA 4GKJE 4F93B 3DU5A 4DV2I 1ZG3A 2Y30A 4JI5H 2ANNA 4G6QA 2FMRA 4UXNA 3ZCOA 3H1CA 1W5SA 5DM6F 3BZ6A 1VQ8I 2DBBA 3GEZA 1UDNA 4LF4H 4JI2I 4X64I 2JSPA 2QLZA 3S1RJ 2HOSA 3ROUA 3Q6MA 2PY9A 2CV2A 5CQGA 1TQIA 2DFFA 2O3FA 4DR6H 3BR5A 2WV0A 2XHKA 3E7LA 3BJAA 2DA7A 4Q4ZF 4IFDG 4Z2YA 4BY7J 1LQ1A 2Z9OA 4W97A 2X9DA 5F0CA 1D8JA 2W85A 4RDUA 3ISPA 1KU2A 4FN5A 1D1BA 4RAYA 1DDNA 3K4JA 4KYWA 1ETWA 3TO9A 2WB1A 2V34A 1XPXA 1TWFJ 1JTXA 1QA6A 1LDJA 3IH3A 4CCLA 1ETOA 1R1UA 3RKQA 3BOQA 4U7DA 3DLLF 4AUXA 1Z0GA 2IOQA 3BR3A 3N05A 4IFDF 4J00A 2V8PA 4NNJA 1QGPA 2V9VA 3A02A 3IV5A 3Q9VA 2W48A 2EZLA 1UDSA 2UXCE 2JEBI 1KZHA 1S6LA 1FSHA 2P5KA 2FNAA 3A0BC 1MZBA 4JI5I 4M73A 3H5RA 4DV2H 1HKSA 2WNRB 1I6UA 4I76A 4JX6A 1ELOA 1RR8C 3U1YA 4Y3OA 3S93A 4ITVA 2V26A 3CC7I 4X65E 3TQNA 1T8IA 2IVMA 3IWFA 3PYGA 3V5RA 1FWKA 3GX4X 4KISA 1S16A 3KETA 4GYGA 1W7PB 2ZBKB 4GKJI 3OYGA 3ZOBA 4HBLA 3LTOA 1BC7C 1BI0A 5LGTA 5FGMA 2H09A 4UB8C 2CVEA 5GAHJ 3F23A 2GO4A 1FBSA 2O1WA 1TNSA 3V8JA 1T33A 1KGSA 3CCLI 1ZREA 4B3MI 4A3DJ 5H2FC 3W3CA 1RUOA 3OR1C 3M85D 4G08A 2COMA 1YH8A 3QRFF 3QT7A 4CDGA 1FJGH 2XPVA 1VISA 3PRYA 2AXLA 2BVMA 3GTLJ 3KP7A 1J4WA 4X0GA 4LFUA 2DPUA 3ZMVA 2OTJI 1B4AA 1XDUA 4XK4A 3UKGA 1FYLA 4BBRJ 1HKTA 2HKJA 4BA1A 4B48A 1X3WB 2EV5A 1T0FC 1MNMC 1SANA 2R5YA 2AXTC 5FLXK 1UHMA 2LDUA 5DYMA 4JI3H 4A2UA 5AONA 1S8NA 2R7QA 2C37B 4OIPF 2KRCA 2XSDC 1K79A 1E3OC 2PJRA 2UXDE 3F6OA 5LMNH 1Y4UA 3DKXA 2RNGA 1U78A 1ERDA 1N34I 3BTCA 5K5QA 2UUCE 4WWCA 4B3SI 4OO1D 2EFOA 1TWCJ 3IKTA 1X9ZA 1OPCA 3CUQB 3B4TA 1IBME 5TRDA 2PNMA 4FW5A 4BXFA 5J1YA 4AIKA 3JR9A 2A07F 3ABUA 1U8RA 1ONVA 2YQRA 3FXLA 1M1EB 1FC3A 1MJ9A 4XKCA 1N75A 3NEUA 4RM3A 1XTAA 3CLQA 1R9TJ 2OJED 2JK3A 4LK1F 1XGOA 2X6WA 4BEHB 1O3QA 2YX7A 3K7AJ 4I2OA 1X2MA 3U9GA 4DR5E 2LOOA 3R6SA 2V4JC 3L2RA 2Z5CB 5JLXA 2XIGA 2R0QC 1ZG5A 4ABZA 2L9SA 2TRTA 3QT6A 2CTMA 3QD7X 4LOMA 4EGYA 1LB2A 2ESNA 2PO1B 2VQLA 3KIOA 4KA4A 1S20A 1USTA 1YITI 1ETQA 1ZLKA 3PFYA 2MG4A 3VOEA 3S2HJ 4FX4A 3A03A 1FJLA 2DQLA 3M6AA 2XKPA 5FLMJ 1S9HA 5DCMA 3CJQB 5EGOA 1TWGJ 1T95A 2K9MA 2KIMA 2KRHA 2WAQA 4L9VA 2RAEA 2CQ7A 4C3IJ 2VPRA 1NK3P 4N4NB 4MU3A 1B72A 2XB0X 3LSMA 3KRNA 1FX7A 1QVUA 4BJTA 2RGVA 3I9V2 2XF5A 2OBPA 1XX5A 2WADA 3HM5A 5HLIA 3OSFA 2CGPA 1MX0A 1QZYA 1R6RA 3FKJA 3MN2A 1UDOA 3LQRA 1IUYA 3EDPA 5LD2C 3JTGA 3BR0A 3TW7A 3QWLA 1MH4A 2PJRB 4DR5I 2GA2A 2G7HA 3CMMA 3GZNB 3HKMA 4IFDA 4K0KE 4L18B 4ZH4F 1I6XA 1UFMA 5K36A 2BA0G 3L2VA 2OCEA 1Y5YA 4JI7E 4IZJA 1ZGAA 1SAXA 3PUFA 3WU3A 3WODF 3GTPJ 1Z2IA 1IRFA 5E8IA 1MDMB 4NXME 3QAHA 4PJ0C 1RIOH 3ZMUA 2DOEA 1LEAA 2FBIA 4HZFA 4UUTA 2BEOA 1K47A 2PBIA 4DZPA 3HGYA 3Q0WA 1IZ1A 2DXIA 4UUSB 1ZXNA 2ZM6I 2PG4A 2PQ8A 2X1EA 5DCFA 2BA1D 4C3HJ 1BW6A 1WJEA 2KISA 2DMQA 4BXXJ 5GAGJ 4HY1A 1FY7A 4OKGA 2DMPA 4LG3A 1BJZA 3KYLA 2VT3A 4X66E 3HYIA 3HJEA 4YELA 2IXSA 3N4MA 2Z5CA 2BY1A 5IT9W 3WG7H 4K2EA 4BYYA 1FWLA 3P5JA 2K3PA 3P7NA 4DBQA 2A6HF 2LVSA 1DGRM 3DEUA 2ME0A 2IESA 1IJWC 2HWVA 4P5OA 5F1JA 4EM1A 4LIVA 5ERIA 4JP0A 5K36G 4LFCI 3H5NA 3OYLA 1Y56A 2IW5A 2EV6A 4LFAI 3O8HA 5EEAA 1ZYRF 3ZQFA 4BJ6C 4DV7H 2MD0A 4KMUX 2IA0A 4I99C 3KE2A 3M8EA 4BEHA 3ELKA 1XXEA 5FJ8J 2V9KA 4LPFA 4IHVA 2R7WA 1B72B 5TISC 2AS5F 2R7UA 4IQ4A 1UB9A 2F5DA 4QSHA 1S4EA 4NXNI 3CDHA 5FRMA 1WSUA 4II3A 4G6DA 4H8AA 2BYVE 4XSXF 2X06A 3DXJF 2MGQA 4TV7A 3RQ4A 2YR2A 5HLTA 4YFNF 2JVGA 4FJSA 1P7IA 3CUQA 1HSTA 4PZJA 4ZC3A 1B63A 2MC4A 4X65H 5LL6b 4EV0A 4A6EA 1J59A 2QF7A 3G71I 2NPFA 2D2WA 3DFGA 1VQKI 2VQGA 5C4XJ 1P92A 1U9NA 1DTJA 2HKXA 1DU0A 4G7OF 4AYBA 1L3LA 2GM4A 1STZA 3W2AA 2DEJA 3GR5A 4IHSA 3I58A 5CVIA 1BW5A 1Z7UA 4JI1E 4M3GA 3HOZJ 3HOVJ 4QNKA 5F6FA 2MABA 3AG2H 3QOPA 4XR6A 2ZBKA 2BXZA 3HBLA 2FMYA 2VUMJ 4DV5I 4PRXA 4ZZLA 4DV5H 2PO1A 4DYCA 2HQNA 3JW4A 4CZCA 4FHTA 1YHCA 2P2RA 4I98B 4XN0A 5FKOA 5IYDJ 4DPUA 5DD4A 2CSOA 3U1KA 3GTKJ 3A01B 4LLNA 2Z5EA 1P7JA 1UG2A 2BZTA 3KCCA 3VYRB 4A6DA 4D5FA 4DPYA 1O57A 2VQFE 3KP2A 1A6QA 1PP7U 1BOAA 1HOMA 4URLA 5LRSA 2M6QA 3V7RA 3TW6A 2G0EA 2YS9A 1D5YA 1RZ4A 2A3SA 1CQTA 2JTVA 3DF8A 1KU9A 4F52A 4DU7A 4RPFA 3GLLA 3KX2A 4ZYHA 1YTYA 3EETA 3F3XA 4DR1H 1AA7A 1BJAA 5A2QZ 4LF8I 2X48A 4BY1J 3OS1A 1YFHA 5D8LB 2CG9A 2V7FA 3R4KA 3ZM7A 3FAUA 3UNGC 1YW9A 4DR4E 4X62I 2OPTA 2M30A 3OR2C 2ZM6H 4AQYE 4C9YA 2UXDI 4NQWB 2ISYA 2WA0A 2DEIA 3R0AA 4BU2A 4DUZH 3H3ZA 2NVTJ 5BNGA 1XDSA 1R5GA 5HS8A 1IN7A 3K0LA 2KRFA 4DPWA 1HNWH 3QODA 4DOZA 1AU7A 4ESBA 2IS2A 2VKDA 5EG0B 3LNQA 1QU3A 4IEJA 4XLAA 1ETVA 2WP8A 2HOEA 3I71A 4USKA 2VONA 4HACB 1MBJA 2V1NA 4IJAA 4JBAA 3FMRA 2HFUA 2DYSH 2UXNA 2X0LA 4LF9I 1U6GA 3FMQA 3LSGA 1X2NA 5A2QK 4RAFA 2H8RA 4B43A 4B4CA 4ZYEA 2PMZN 3ZMSA 1PKPA 2O1TA 1WTJA 3QU3A 4LCHA 4LF5H 2BHZA 4I0AA 3QPLA 4JI1I 2VQCA 5EEGA 1R36A 1O3SA 3OETA 1N0UA 1TTYA 2DODA 1R5HA 1S5LC 3AKZA 2YX4A 3IRRA 2JRMA 4KICA 1IN4A 2XGXA 4L9NA 3H0DA 1E3PA 2IGOA 3ULQB 2QKLB 1ZR2A 1Y0UA 3FF5A 3W2WA 1K6YA 2IBDA 3G3ZA 1IXSB 3FXJA 2M5WA 3MKZA 1IDZA 1MIJA 3GTGJ 1U2WA 3DTKA 4IKFA 3T1HE 1TW3A 1ETYA 2JUGA 5AIPA 3MD2A 4QPOA 5EZHA 1OYIA 2QCOA 2Y0MA 1IBLI 3KP6A 3FXQA 2IGMA 2EIJH 1I94H 2ZJQF 1NTCA 1HKQA 1WGXA 5GMDA 3QP5A 2VKCA 3IUOA 4IXAA 3DKWA 1Z6RA 1U8BA 1OCZH 5D5UB 2F1DA 1V3FA 1IUFA 4DUYH 2OU2A 4M6YA 2JWTA 1R71A 1OCOH 2L4AA 4W1UA 4EMSA 4HV6A 4IPAA 1JKRC 2F4IA 3T1YE 4GKKI 4B09A 1F9NA 2R5ZA 4MU4A 2R5YB 3W2VA 1TT0A 4G6TB 1W5CC 2RN7A 2VC0A 3QOEA 4AIHA 4EJOA 5ILVA 4RBOA 1W0UA 5K36C 4EQQA 3K10A 1W5TA 2EQRA 4LFBH 3DCFA 1RKWA 3WTYC 4A3IJ 2AQFA 4M72A 5FLXZ 2CWHA 1GV5A 2KQRA 2D9IA 2RVCA 4LITA 4ZTFA 4JVYA 1X1DA 4YFKF 4ZDLA 1HW2A 3K9TA 1PUEE 2IS4A 2KKOA 3FHZA 2WAEA 1K7AA 3BG6A 3A2KA 3SZPA 2FQ3A 4KIGA 2TCTA 5IOZA 4LCGA 2GO3A 4LCFA 4OO1C 1GHCA 1UZCA 1G3TA 4HX8A 5JVTA 3FK7A 4V2GA 2G8YA 3VPRA 4EMDA 2EK5A 3B02A 2H1KA 3VWBA 2HQRA 1R7JA 4HNUA 1HNZE 3JSPA 2EA2A 4OO1F 3RZOJ 2DFIA 1GVDA 1VI7A 2R7DA 1FPQA 1A6IA 2AO9A 3WHBA 3E3VA 2VKHA 2FU4A 5KK1A 1JUSA 3PYEA 2CFXA 4NC6A 2NN6D 5E1ZB 2ZNZA 1CF7B 1U2RA 2DJNA 3BQYA 5JEAB 4KDPA 4HF2A 3J7AG 2CU7A 1Z0CA 2VXDA 3P3CA 4JI4E 2HVRA 4FASD 1I39A 1YJ9I 3V2UC 4BXUA 3K70C 1VQMI 2HYFA 3U1DA 2X1CA 4B47A 4XL9A 1MSZA 4JK1X 5D5XB 4YFXF 3NWTA 3J80Z 2KL4A 3V69A 4RB1A 1DPUA 1N77A 4DV3H 1FOXA 2P81A 2M9HA 3I53A 3G1OA 4CCKA 1YI2I 1R5ID 1HW1A 1RREA 2P7CB 1FJGI 1X4OA 1Z21A 3H9QA 3GO5A 5BPDA 5BR8E 3CMAI 4ZVIA 2O0YA 3HC7A 3PS3A 5FB2A 1WJ5A 2PO2B 4X1EA 3D1NI 2LJPA 2HHHI 3QU6A 3T1HH 3CCUI 2ADUA 4XLHA 3DTEA 4B8XA 2KZGA 2KJCA 1XMAA 1IRXA 3LPSA 1XNQI 2QWWA 5L3EA 3MZHA 1Z5CA 4M9SA 1Y39A 1WHUA 2IP2A 3BLYA 4Y15A 4FTHA 1ZM3A 1GLNA 4JI2E 1WWXA 2RDPA 4HSRA 3EQLF 5K7HA 4DV5E 1P4WA 2C6YA 4KFCA 4EJVA 1J5EE 1YW8A 4OIQF 4FW9A 2G9WA 2EA4A 1Y1VJ 3MVPA 5F64A 4CA0A 4IOAF 4DUZI 1I6HJ 2FXAA 4B3XA 2CYYA 3B82A 4PU9A 1WVRA 1G4DA 3WTTC 3QP6A 2YPRA 2B0LA 2XAUA 3P3GA 5F08A 2VODA 4U87A 4L0ZB 5EL9A 5A2QC 1YQAA 2XKOA 3CF5F 2RREA 4XQFA 4JI0I 2Z3YA 4DYQA 3R0JA 1FYKA 3KEQA 3CJRB 3HOYJ 2OPVA 4XLNF 3OS0A 1BN5A 3V8KA 1XNRH 1U0JA 4GGGA 1X3UA 5K5RA 3KEYA 2XC7A 3Q1QA 4DYRA 1MSEC 2M87A 1PP8F 2VI6A 1T0FA 4JG4A 3OIOA 2FNPA 1POGA 4DXLA 5DNXA 3GCMA 2OA4A 2EJRA 2FBKA 4I0BA 4LG0B 2KP6A 3HRMA 4HACA 5K36F 2ME6A 2HGCA 1B6AA 2XAQA 2LD5A 1TWAJ 4K0KI 1R4MB 2LBFB 2IRFG 1RHYA 1MNDA 3VSKA 1MJBA 2H1LA 2C37A 4ISAA 3ZKDA 4BNCA 4E70A 1RETA 4XRSA 2JEBA 4NDLA 5B66C 5B1BH 3CF2A 2FE3A 2FX0A 4KHPE 1BM9A 3FHNA 2NVUB 3BCAA 4HV5A 1F5TA 2B63J 2R3SA 5LLQA 3AL0C 4BA2B 4LIJA 3GTMJ 3DEEA 3K4MA 4LF8H 1OCRH 4E7LA 3GUDA 4ZYAA 2HEOA 4DR2H 2UXCH 1N32E 4B3ME 2AJ4A 4F91B 2EFWA 4LF4E 1KA8A 4XKBA 3PS2A 3AG4H 1BBYA 3FKIJ 4E9JA 3TP0A 1GVJA 4AQYI 4LF6H 1XHKA 1JE8A 1LVAA 4IF4A 5BOXA 2VJIA 2OZ6A 3FX3A 4IRHA 1OMIA 4PUSA 3CWVA 1VQNI 5IT3A 2LMDA 3DWLE 5LL6R 2EV0A 3OMYA 4HRIA 3LA7A 1A5JA 1SVOA 1LE8B 2M1BA 1LPQA 3CC4I 4OAYA 4WUDA 1H72C 1X1PA 3CCRI 3BTLA 1DARA 4PDBA 2TDXA 4HDUA 4A3LJ 3J80C 3OOUA 1ACIA 3WE3A 1XSVA 4HEA2 3V7CA 3PJRA 1K61A 2WB1N 4U0VA 5DRPA 1G3WA 4U7BA 4YEJA 2Y9YA 1NZ0A 1MBFA 4EJUA 3EUHC 1VQ9I 1HBXG 1QHGA 3ABMH 5E17F 3KZYA 5EKWA 1D3YA 1ENHA 1VNDA 1XB4A 1XSDA 4LFBE 2A1SA 3J7ZI 5DM7F 2A61A 4D7MA 4FQGA 4FW3A 2UXBE 4XRSG 2BA0D 1RI7A 1BKNA 4GCVA 4OINF 4CHUA 2JSCA 1A31A 3E97A 1EH7A 2BA1G 4DR3H 1N36I 2LF7A 1T6SA 4G9YA 4NB5A 4XLEA 4Q47A 2R93J 5D5VB 4EEFG 2F5VA 3BG5A 2Y9ZA 1AN7A 2L7ZA 2GIVA 4DV4E 3C18A 1K4SA 4JI6H 4NBQA 2XDVA 2FBHA 3V42A 3WGHA 2O9LA 1U5TA 2F48A 3KZZA 3REOA 3CO6C 3CCQI 1R6LA 2CUEA 1ZZKA 4M3FA 3HOUJ 3LFUA 2HR3A 3GZ6A 2R7TA 4IZJD 1J5KA 1S3JA 4JYKA 5TGTA 4OZEA 5DS9A 1HQCA 2K9SA 5GADJ 3O2PE 4FW7A 2DMTA 2HK3A 3OYAA 1XMOH 4LF5E 4LFAH 1BR4A 2A2DA 4KHPH 4LG0A 2EBIA 1EH6A 4OU0A 3Q5FA 1Z3XA 1UMQA 2GOXB 4R8HA 2VOPA 5JEAA 2L4MA 1HNZH 4XTJA 2KJBA 3I4NJ 2ZXJA 1PVGA 2JZXA 1N0VC 4JI4I 2O3ZA 4DV3E 1N32H 2E1RA 2VB6A 2CRGA 3GMEA 3JAMZ 4BGDA 5J1UA 2GAUA 4DV7E 2VC1A 1MGTA 2DTRA 2FA5A 2XAFA 2P6TA 4P7AA 2X85A 3CCEI 2QNDA 4JI4H 3CQZJ 4V19K 2LTPA 5LEKA 3HG9A 4CZZA 3JRIA 2ZJRF 1ZK8A 4B8CD 1R22A 2KIQA 4I6ZA 5L3BA 3MKYB 4G7HF 2W4SA 3FK6A 2ZITA 1Z05A 2GQ0A 1D6TA 2DFHA 1WE8A 3TDZC 2JA8J 4JI7I 2DK5A 5IP7J 2XAHA 5E3LA 1D5VA 1QNTA 4L5IA 4UUSA 2NN6F 3PYFA 2KT0A 1G3YA 3E0JB 2JEAI 2VL8A 2O4CA 4BL0B 5F27A 1R49A 2MBFA 3B8HA 2Z2SB 4GFBA 2OI2A 3GONA 6PAXA 3BROA 1FLIA 1DP3A 2L9RA 3M3YJ 3HB9A 3F22A 1S03G 4U0YA 5JVGF 1YE9A 5F0HA 4H0EA 2ZQEA 2DDBA 4BDZA 1QPMA 3CCVI 3K69A 1ZAOA 2CQKA 3MEXA 2LTLA 4LGWA 3S1QJ 2K85A 2OZUA 3NQOA 3IAM2 4CXFA 1LVKA 3PO2J 5GMEA 4A0XA 1N36H 3BWGA 4JI5E 2DFEA 3IRQA 3WU5A 1J5EI 2CG4A 1Z59A 5D4RA 2CPQA 2EFNA 4JQFA 4IX7A 1P2FA 3MQ0A 4B3SH 3L7ZA 4OMZA 1CF7A 4M74A 2WW4A 3A1YA 4QIWN 1T56A 1F36A 1X3ZB 1ZGJA 2AXYA 4DR7E 1K83J 3MZYA 4LFCE 2XV4S 3IC7A 3M7NG 3RZDJ 2F4VI 4HPQA 2JE6A 4MEYF 4RB0A 2VJ4A 2FRHA 4D9JA 4Y17A 3G1MA 5C0XB 2UUAE 2BVLA 4CH7A 2K4JA 4MFEA 1H74A 4QWQA 4WXDA 5CVRA 2ZJ2A 3L1PA 1TZLA 1I3QJ 4F7ZA 1VQ6I 4DPXA 1V9NA 2CTLA 4JI8I 5LMNE 5J6XA 4K0KH 1ETKA 3MCZA 1FMWA 2OQGA 2E1CA 2Z99A 2X1DA 2L01A 4A5MA 1TW2A 1WVNA 3K85A 4NZTM 4JI7H 3J81Q 1YS7A 3S3MA 1D0XA 3CUQC 1Y60A 5E8GA 4IHTA 3LAPA 2PJPA 1H73A 1RC9A 4S0HB 3P3EA 2WAFA 4OD6A 4DR4H 3KDKA 1R1TA 4A0ZA 4HNTA 1USUA 2MH2A 2YU9J 2JE6B 3TP3A 3PSIA 2STWA 4LF8E 4RB3C 2RV8A 1WH7A 2P8TA 1B8IB 2C39B 1QZZA 3ABTA 4OMYA 2JZYA 2F4MB 4MYUA 1WJDA 4N0BA 2NN6C 3DBHB 2VIXA 5E3NA 4A5NA 2K3FA 2E35A 3HUGB 1TUAA 1N32I 4G12A 3L2CA 2V6CA 1Y8QB 1YIJI 4E7KA 2ZCWA 4R1FA 3K70D 2V2QA 1MH3A 1TP4A 1A35A 2E1OA 4PK4A 4HLYA 3M1EA 1OFCX 2MH9A 4CCNA 2V6EA 4KHPI 1IBKH 3J81K 2ZB9A 1X4NA 3M8FA 2DT7B 4BKXA 4C2MJ 4BACA 1D1AA 2UZKA 4CCOA 2CUJA 1ZARA 2NXNB 3GFLA 4C3JJ 3ERED 1BI2A 1TBXA 2HK2A 1H88C 3F21A 1KTVA 1LUJB 1ON2A 4RLFA 2L0KA 2X7IA 4IZKA 2RKHA 2O1VA 3OYNA 2Y0SA 4B1RA 1X1CA 2BW3A 4V2FA 2CWEA 3CCMI 3FWEA 2PMHA 1IN5A 2Q2EB 1E0EA 3WU6A 3E5QA 1F1ZA 1YOVB 4IRGA 3VODA 4XICA 1FEXA 4DR5H 2LYCA 2K5CA 2MSYA 1XNRI 2NS7A 3WGIA 1XGNA 1H9GA 2XGCA 2JA7J 4ED4A 3BDDA 2A68F 3HUGA 3MWMA 2CFOA 1FIAA 2W25A 3BR1A 3GLXA 4RM2A 1PUFB 2M3AA 5DT9A 1Z67A 4FJUA 3L7ZC 3PM1A 2JA6J 2NS8A 3WTZA 1OJ4A 1IW7F 1SAUA 3RYRA 2RNJA 1IDYA 2CV0A 2VBZA 3WHCA 1O4XA 2UUAI 2V1XA 2KLOA 3DPUA 1JUMA 2GZWA 2LY2A 4DJAA 1H7UA 5K36E 3PYDA 3ASOH 5ELWA 1GT0C 4X66I 1XMKA 1K78B 1B8IA 2C39A 4AIJA 2PO2A 2Q2EA 2V9PA 1W7PD 5DEQA 2Z33A 2HPMA 2JA2A 2HTSA 3OSGA 4OIOF 3NRVA 3S14J 4MIMA 3U21A 3DP7A 3LSTA 1S7OA 2PN6A 4BA2A 1VQLI 5JHFA 4HW0A 2O03A 2ZM6E 4DR3E 5C0XA 1N36E 1OR7A 3RPUD 2HZTA 2HKOA 4A93J 2CPMA 5FFXA 2CW8A 2LLKA 1IV8A 4OO1A 4LB6B 4L0YB 4DZJA 4OO1E 2E5LI 5DUKA 2PX9A 3S3NA 3NZKA 1AWCA 4MU0A 2YU3A 4JYAE 4S04A 3CDJA 3BR2A 1J7KA 4PSWA 3T1YI 2CUZA 1ZG1A 2BY0A 2EILH 5ICCA 3I55I 3SEQA 3TBIA 3ZMTA 4BHBA 2M2EA 2P5VA 3F6VA 3MFKA 4DR6I 5B3SH 5IT9C 3CMEI 3F0CA 4BH9A 2VN2A 3I0PA 1PVEA 1R6MA 5K5OA 4HA8A 3ABKH 1VFCA 5C0XE 2MYSA 3H3UA 3M7GA 5J4YA 2A2CA 4M9XA 1OR7C 2KZVA 5J40A 3HOSA 1U3EM 3COAC 2NOGA 4XNFA 5FD5A 1BI3A 1T38A 4LLGF 5CYVA 1QHHD 2L7KA 1VQ4I 2P4WA 3DBRB 3JAMC 4Z6YA 2LK2A 1JT6A 4XORA 5LHIA 4B44A 1WH5A 1ZM2A 1YX3A 1HA8A 1QO0D 3J7AY 1TLHB 1O3RA 4XOTA 1EH8A 5D4SA 4BA2I 4GDFA 1SVLA 2GWRA 4AC0A 1XGSA 2EWNA 4M3DA 3GYHX 2PFBA 2ZFUA 2R7RA 2IAIA 1S72I 4B3MH 3FM3A 3WE2A 1WUUA 2HVQA 1GUUA 3CCJI 4BQQA 2K1HA 2Y0SN 1V8CA 3GZ5A 2LBFA 3H4LA 1LE8A 1B1BA 1Z0TA 2JPCA 3JSOA 2A5YB 2UV1A 3LNUA 2JRTA 1Z0BA 4JI0H 4QNJA 4ZYDA 2LY9A 5IWAH 2A05A 4N9HA 1AOYA 3DLAA 2Y75A 3IP4B 1SFKA 3K6GA 5CQEA 4ANJA 1NHIA 4AVZA 4NXNE 2QM3A 2CS3A 2H8WA 3T8RA 3GF2A 4QMFB 2DCEA 1MDMA 2OF7A 3HPGA 2UU9I 4RB2C 1LFPA 2DO7A 2GLOA 2UXXA 2CGEA 2QENA 1EKEA 3L9FA 1UDQA 5DNLA 3ZP5A 1ZHFA 3KDGA 1OYPA 3DD6A 4MHGA 2IJLA 2CQNA 3FZVA 3F72A 2R3VA 4ZZDA 3ZZUA 1TNTA 1ETXA 2O1UA 1LFUP 3LOCA 1ZXMA 4NC7A 5FKLA 3JRCA 4BUPA 3FISA 1KIJA 2MW8A 4M6VA 1SFUA 2QZ8A 3GBGA 2E5LH 4JOMA 1SVMA 5HLGA 1QBJA 5IT9Q 1G6NA 1OYWA 4DR7H 1H9TA 3BZCA 1P9QC 3RSNA 2HKEA 2ZXIA 4DV2E 2CTJA 2XSJC 3BG9A 1UAAA 3K4BA 3N97A 2NNNA 3LL7A 1SC7A 1HDDC 1ZTRA 4YIIA 3ECOA 1FKAE 1BI1A 2R5ZB 3K4NA 1IGNA 5EJCA 2HH2A 4X64H 3G1LA 2GQQA 4JV5E 1U5TC 1R1VA 5EEHA 2W7NA 3G73A 4IFDD 2P7VB 2XAGA 3K1PA 3J7AK 1RPWA 5IP6A 3JREA 3EYIA 2UUAH 3F8NA 4JX4A 2EH3A 4C2UA 4QLCU 3OIPA 2W84A 4FE4A 3Q6NA 1WJCA 2HHHE 4X62H 2QSHX 3KZIC 4DW6A 2OC6A 1HR0H 5BR8I 2HDCA 3H5AA 4R1HA 4DR1I 3S1NJ 1T98A 2I10A 3AEVB 5FLXW 2KDOA 5E1XA 2UUBI 1J09A 3WU4A 1EJ9A 3K4KA 5IT9Z 3CO7C 2QSFX 3QT5A 4B3TI 5B1AH 2ZSHB 1MMNA 2F6CA 5EDNA 4XONA 4XN3A 1ZRDA 2W24A 2ELJA 1IN8A 4DIQA 1LDDA 4UVBA 5GP9A 2JA5J 3G6EI 5L3FA 1ODDA 1ON1A 1IRZA 4DUZE 2JJ7A 1OJLA 1J5YA 2HVSA 2ZMEB 2GIZA 4O6JA 3JRFA 2VF3A 2WP8B 5K36D 3CP2A 3FXUA 3S1MJ 2O61A 2UUBE 4D1QA 5E3OA 4WALA 2UUCI 1K4TA 2JQ7A 1HLVA 5K36B 2L2OA 4DR1E 2F5CA 1Z0XA 2VE8A 4DBRA 1XSXA 2QVOA 1BIBA 1D8KA 1ZN2A 1EA3A 1OCPA 2VJJA 1VZ0A 3HSFA 2F5FA 4D7NA 5CLSA 1IO2A 2HTJA 2DTZA 2J5PA 2A69F 4RAZA 1HC8A 3KP5A 2MC3A 4CCMA 1WKMA 5BPIA 1YYVA 3D5LA 1IBKE 3LSKA 1KQ8A 2HXOA 5KVRA 3CD6I 1DP7P 3T1YH 1EC6A 1Q1HA 3IL2A 4KN4X 1H0MA 2QA4I 2FJ1A 3T0YA 1GXPA 2CQQA 4OX9I 2JE6I 2ZNYA 4DV0H 4BA1B 3OYCA 3BJOA 2EFGA 2DA4A 3SJMA 2EB7A 3BY6A 5HS7A 2E3UA 4EVIA 3ZQLA 4XKVA 2HU9A 4JX5A 4JI8H 4WF2A 5GPAA 2DMUA 3ZQQA 5BQTA 5M5XJ 1HNXI 2PNZA 4B3SE 1G59A 4AWXB 5CVVA 1G2HA 5E1WA 2Z0SA 3HULA 4LF7H 1KYZA 1MMDA 2CQXA 3HZJA 4I02A 4PSXA 5JEAG 4X66H 2ECBA 4AM3A 4DV7I 2DN0A 2EIKH 3CDLA 2FFMA 4PRVA 4Q5SF 2JUCA 2NOJB 2BHYA 3D0SA 3WTSC 4PJNA 1VF9A 4RGSA 1MG7A 3RF2A 3S2WA 1TC3C 3FXRA 3P9CA 1VIHA 3HOWJ 1V5GA 4Y4RA 1V5EA 4R79A 5L3DA 3FDYA 1KQ9A 2IOPA 1AHDP 1ZM4A 3KP4A 2PI0A 1OYSA 3LMMA 3Q0UA 2NNYA 1DGWY 1P4AA 1EI1A 2QGUA 4BHCA 5C0XD 3QYBA 5IOYA 5L3CA 2PNZB 3GKUA 1SFXA 3QPTA 3P06A 4UV8A 3TL4X 5BS6A 2Z5UA 4ENJA 2VOOA 2UXBI 4LF9H 5H6RA 4RGUA 3SB1A 1Y1WJ 1VIGA 3VB2A 4F55A 4NXNH 3B6AA 3F8FA 1VQ7I 2L5QA 2NS0A 2BBYA 2ZO4A 3OWTA 3ZQHA 3GVAA 2ACJA 1R23A 1NH3A 1AKHA 1J9IA 1HK7A 4XLPF 4A3GJ 1G3SA 3OYKA 4DV4I 3OYEA 4NHJA 2B9SA 3C2GA 3WGGA 4YHHE 1Z5AA 4UUVA 5EGOB 3C2HA 4L5EA 2BY2A 4Y7NJ 1YHQI 1BC8C 2YUSA 2ESHA 4YIRX 2NAZA 1IF1A 1NK2P 1FZPB 3EUAA 1P4XA 2EZHA 4HXZA 1ITYA 4EM2A 4X64E 2OPUA 4LK0F 1R4NB 2E60A 4E7ZA 1EA6A 3BTJA 4KUMA 4PJLA 4S05A 2VQHA 3Q0VA 2GS8A 3SYTA 4OO1B 2FF4A 3SZTA 1ORKA 1JKOC 1YS6A 4M9ZA 3R61A 4E7SA 3DQVC 4XRFA 2R7OA 4OX9E 3IKVA 2PT7G 4BE2A 1KVKA 4PDKA 2OV7A 3LA2A 4MYTA 1MBHA 1NHAA 1DPRA 1K78A 3K4CA 3CC2I 5IP9J 2E7WA 3BP8A 5KAFC 3P9KA 5LHHA 3L09A 2JMWA 2HS5A 4LD5A 2NN6G 3CCYA 4H4KC 1FBUA 5J8FA 4FWGA 4DV1I 4FW4A 4AIDA 3FM5A 1ZELA 4A3KJ 3I4MJ 2L3DA 2FPHX 4DV4H 4HYEA 4E7HA 1PIEA 1JHHA 1HNXH 1U9OA 2QKMB 1XNQE 2GXAA 4HAMA 4BQOA 1O7LA 2PEXA 5ICFA 3I4PA 2DA6A 5FO5A 5FROA 4BJ5C 3E5UA 5LGNA 4JI6I 2DGRA 3K1NA 3PNTA 4UV9A 1XMQH 3ZXSA 5IY5H 3JAMQ 1U5TB 1XMOE 1I94E 1V5FA 2IEKA 1J5EH 2CV1A 2LRRA 3TDUC 3GTQJ 3NWSA 4PFOA 4A3FJ 2E19A 2DK8A 3G4SI 1TQPA 3OYHA 3VSLA 2KIUA 1MKMA 4MEXF 1D0YA 2DJIA 4JV5H 1BIAA 2NN6E 1V4RA 3E1SA 3V7SA 3FBIB 3K1JA 4ASNA 4L9JA 1LJ9A 2LKPA 2L54A 2JEAB 2QUFA 3VYTB 2H6BA 1LKXA 3CJNA 3RCOA 3HL2A 5LRRA 2XROA 1GDTA 4CYDA 2DT5A 2FSWA 2H94A 1JHFA 3QYEA 1QZRA 1UEKA 5M3FJ 2R92J 4ENKA 3LSIA 1MW7A 4I01A 3O8GA 1LFBA 4YIFA 2ANRA 3OOPA 2Q1ZB 1GV2A 4M3BA 1CGPA 4QPQA 4LF6I 4AQYH 4I3HA 3P76A 3SZGA 4BAYA 3GFIA 3GFMA 4IRIA 1LEBA 2ZSIB 1H8AC 1L0OC 5HOOA 2QYOA 4IQJA 1SD5A 1ZH5A 4DPTA 2KDZA 2VJ5A 3SDGA 4FE7A 5L3JA 3VKEA 3TOAA 2AHQA 1FWZA 2LRDA 2XRNA 3K1MA 1XMQI 4PGHA 4Q48A 5BR8H 4RAGA 3D5RC 4AU7A 2Q0OA 4EM0B 4ZTJA 4ESFA 1RRJA 2HFSA 2VQEH 1WZ2A 1ZZIA 3ZN0A 3LQQA 3DBLB 3MZ8A 2E1MB 2JA9A 3RJPA 1SMYF 3C3WA 1S7EA 2HPIA 4KMFA 1OYYA 2AE8A 3I59B 1XN7A 3OYMA 1H7SA 3LSHA 3BG7A 3GTOJ 1JXSA 3HXLA 2EIMH 3I56I 1WJAA 1SMTA 4AYBN 4L5JA 5JEAC 4XRMA 4QTRA 2E2HJ 1P42A 1FMVA 4FX0A 3RDIA 1LDKB 2ZC2A 2NYXA 2X6OA 3TEDA 2BV6A 1DT4A 1IN6A 3J81C 4ZJZA 4LFCH 3KLNA 4WUBA 4YHHH 4FETA 2FD5A 2ZMEC 2K86A 1LNWA 4UNOA 3I5UA 2V79A 1HW5A 2A6TA 1VI0A 3FIWA 2DW4A 4MQ9F 2HYGD 4DV6E 4B3TH 2UXBH 1XNQH 1Y6ZA 2JT2A 3OS2A 2XF6A 4WCGA 3TOBA 2NVXJ 3CDIA 3T1HI 3KEOA 4XIDA 1C0WA 2HHHH 3BQZA 2L9VA 4II2A 4EJTA 2K9QA 2HOTA 1WQ2A 1UELB 2ISZA 2CZ9A 1WHRA 2P0WA 1X4PA 2ECCA 4OIRF 2ID3A 2IS6A 4IFDB 5LGUA 2EPFA 1OISA 1JUPA 4KN7X 3LWFA 3TO7A 4JI2H 4MGRA 1G8XA 3P9IA 1XNRE 2WWYA 3F0NA 3J80Q 4BQNA 4XKWA 2DT6A 3BC8A 3LFKA 2NRAC 2WNRA 4EJWA 2CTKA 1XS9A 3IAS2 4AVPA 5B5EC 3E6CC 3H3VK 1X58A 2UU9E 2IA2A 3NAUA 5F04A 2IGNA 4Y13A 1YJWI 1WI3A 3ML6A 1N33I 3K4LA 3KYDB 3HOXJ 2ZKZA 1OCCH 4MO7A 5IWAI 2FEZA 3H9JA 3V8LA 3RKXA 2PLYA 5FFZA 3T5XA 2R7FA 3VDXA 1JTYA 1XC5A 3A01A 3OL3A 3SEZA 4PGGA 2M0CA 3R60A 3H9GA 1AKHB 2IERA 2ICWG 2M34A 2RC4A 2K9NA 3KLOA 4LIUA 2L9NA 2ZMEA 1A6FA 1Z5BA 2E1MC 1VQOI 3A0HC 1N33E 4RMNA 4CUGA 5JEAE 3TKYA 2WTEA 1ODHA 1BR2A 1XGMA 1QPIA 2D1HA 3UOEA 4IHXA 5M5WJ 1SEUA 4LF4I 4LOCA 4DV3I 3I54A 3HOTA 5IYCJ 3DPLC 3LSPA 3ZGKA 9ANTA 4U88A 5JR3A 1MBEA 1W36D 1YRNB 4DUYE 2IA1A 5E18F 2DPDA 1I27A 3OIQA 1PJRA 4XLFA 2IS1A 4WXHA 2V1UA 1QZEA 1WPKA 2OQRA 3M85G 4JI3E 5FRNA 1RR7A 4B3RH 2XF7A 1VBIA 3S3OA 2XPUA 2UUZA 1TT5B 3B6CA 3F9KA 3QYFA 4ZDPA 3ZMDA 4P1WA 3S15J 2O5RA 5J1RA 1X1AA 4DR2E 5C44J 3WU1B 4G8XA 5AIQA 2K7LA 5M5YJ 3HHHA 1YJNI 5BMZA 2OCCH 2DU9A 2VKVA 4A3JJ 3OTOI 3IWZA 5GTIC 1SFEA 1JI8A 3OYFA 1FSEA 1TWHJ 4YG2F 4YY3H 1I5ZA 2BL5A 1JT0A 4MTDA 3EUKL 4FWHA 1YX5A 3VEPA 3OYBA 1V55H 5FD6A 4NXMH 1KHMA 2M8WA 1BR1A 4NC8A 2V2ZA 2MLGA 1HNXE 1SFOJ 2HQ5A 5F1RA 2E71A 3PNYA 3L2UA 3S32A 2IPQX 3QPHA 3E6BA 4GRIA 3CZ6A 4LFBI 1FI4A 5DRQA 2KIFA 4B3TE 4DV6H 3WG9A 4P55A 5FKMA 2BV3A 4BDYA 1NG7A 2Y48A 4EATA 3O6BB 1V54H 1BL0A 2VT2A 1X0AA 1MMGA 1Z3YA 3HTUA 3OY9A 4WUCA 2L02A 2VQFI 2VASA 4FT8A 5HDGA 1BA5A 4MDTA 5C0XG 1O3TA 2XEXA 3B78A 1IXRC 4U3BA 1UHWA 1QQIA 2D1VA 3S8PA 4DUYI 1USVA 2H27A 5C0XC 4DR7I 4YRVA 1P6RA 4BA1I 2EFPA 2M8EA 1J75A 4CYCB 2MFZA 3TMOA 4HYMA 3FXOA 5FKKA 2M45A 4OOIA 4I09A 2PNLA 4WANA 5K1YA 2FQ4A 4FISA 2HNHA 2M0MA 4AD9A 1HF0A 3HKZN 1HR0I 1PQXA 3D4JA 2Z16A 3J7AM 1FOYA 4ENMA 1OLTA 2E36A 5IPAA 3ZKBA 2W82A 2E34A 2BY3A 1B9NA 4GO1A 1FTZA 1XRHA 2BXYA 3ESWB 1FNNA 3OYJA 3HDDA 3J81W 5J8CA 1WCMJ 3M1CA 1IBKI 1MMSA 4KITB 3CMYA 4L9TA 2JT1A 1OCTC 4LF6E 4LMYA 3PL8A 3WTUC 4XSZF 3QQAA 2FOKA 3PIOF 4M1KA 1HDPA 4JI1H 2HXIA 5CVUA 3TGNA 1I1GA 4J19A 5HNHA 1JGSA 3HRSA 2DMNA 4UY8I 4BHPA 3E6DA 2C38A 2R7VA 3HRUA 1IBMI 2LR8A 4YY3I 4CO8A 5HDKA 4UVAA 1UJ8A 2HFHA 1YO5C 3ECHA 1WFXA 3MKLA 2JVHA 4ZYGA 5TJJA 4G7ZF 2DA5A 2RQPA 2CWFA 2X6YA 3EYYA 1B9MA 2VQFH 5IYBJ 3U2RA 2Z5BB 5H20A 3PIPF 3EUHA 2CH0A 2KFDA 1HNWI 5DDGA 4Y52J 1F4KA 4B3AA 2XGEA 5E20A 4A3EJ 2DA3A 3ONQA 3HTSB 1PYVA 1WJFA 3I3LA 2CMPA 2ETHA 3RPUA 2K27A 4PCQA 1MNEA 3VFZA 2UU9H 5ILSA 3H36A 3CJTB 5GPCA 5D6EA 2B7EA 2O8KA 2K02A 4KQVA 1Y0NA 2FOWA 2LSOA 4XM3A 2F4VH 1W7PA 1MSFC 4F3QA 3M8JA 4EGZA 3UHMA 2LC2A 1APLC 3FXKA 1JKPC 2VXZA 4RS8A 4DR6E 4P9FA 2R7ZJ 4HQMA 2LKXA 2XUBA 2K4BA 3IH4A 3KFWX 1HNWE 5IT9K 3T1BA 4U0WA 2LREA 4FW6A 1HXDA 3D5SC 3OYDA 3S16J 3HJCA 2VE9A 5J47A 1I3AA 1ZQ3P 1X4MA 4HDVA 1N34E 2BGCA 2ZJPF 2Y31A 1JKQC 3PUBA 3I0TA 3RKWA 3DV8A 2A6EF 5D6FA 4DR4I 2FUG2 3EZJA 4XLCA 3HSEA 4MFDA 2BM1A 4J3DA 2MLKA 3S2DJ 3SFZA 1ZRCA 1A36A 1GXQA 3HSRA 3T8TA 4F92B 5HS9A 3QPSA 2UWMA 3WTWC 5E79C 2GXGA 1IRGA 4RGRA 2BOLA 1T2KA 4YY3E 2XB5A 4KIFA 4OWRB 1KQ0A 2X6XA 4M71A 2NVQJ 3W6JB 2NN6B 2GA1A 2HZDA 1XMXA 3FMSA 1NHHA 2ZXWH 1KKHA 3HKZA 3MAJA 4MNUA 5HVQC 5L3GA 1UHSA 4A12A 2BE5F 3C1DA 1IC8A 2QEXI 3BR6A 3F8MA 2MJHA 1S29A 4JYAI 4LF9E 2BW3B 3E6MA 1WI9A 3HRTA 5E3MA 3GTJJ 3W6VA 4UTGA 3CLOA 5D8KB 3ZZTA 3PNVA 3VYSB 1F43A 3GFJA 2KMUA 4C30A 4IZJB 3WU0A 2CTFA 4M6XA 2LH9A 4NUBA 5EF6A 4O5VA 3HEFA 1B59A 4KIBA 2ID6A 5FWKA 5KNLA 3ZZ0A 1R58A 3ZQIA 3JAMK 3AAFA 4IHWA 4FCYA 3GW2A 2PO0B 2Y69H 4PJJA 1I1SA 1Z91A 3H35A 5ICGA 2MA3A 3F8CA 1NG6A 2HI3A 2J7KA 2Y2ZA 4GYIA 3B73A 3PQJA 5J3LA 5KCMA 4I7HA 4ON0A 4WK8F 3EPZA 2JEBB 3PS1A 2VQEE 1N33H 3OTOE 1Z7LA 3JRBA 2E2JJ 1XMOI 4B3RE 1T39A 2GXBA 2Q8KA 5DCMB 4HLXA 5JEAD 3DPTA 3BPXA 1RKTA 5HODA 4IFDC 4KJZA 3SXYA 1B62A 1Z0EA 3AL0B 2Z1DA 1QRYA 3VYUB 2UXDH 2E2IJ 2DAOA 1A04A 2VKEA 2PMUA 2LFBA 3BTIA 1IG7A 1O7FA 1MBGA 3LSJA 2D5VA 5M3MJ 2BR2B 3ASNH 4LF5I 2F2EA 2IGKA 2KHMA 2R42A 2E5LE 5CKTA 2LF8A 2LP0A 3F8BA 3IH2A 1OQYA 4G94A 4RLQA 4E7JA 2O6GE 2R4GA 3BCBA 1Z77A 2AQEA 2P6SA 4GKKE 5DV5A 2WV1A 2R7XA 1TQMA 1RNLA 4DQ2A 1JJ8C 5D5WB 4KNYA 1OKRA 4O3MA 3A4CA 1UG0A 1IXCA 5K7ZA 1MBKA 2HDDA 2WAQN 1HNZI 1FKAH 2D45A 1K6OA 3JRGA 1NHJA 5ILUA 4YHHI 3CUOA 3Q9SA 4XOPA 4N4OB 4EC5A 2O8XA 1N25A 1E17A 5LMUI 3L2QA 4JYAH 3BJ6A 2VBYA 4DU8A 4UVCA 4UB6C 2EZIA 1FP1D 5FLXQ 1YG2A 3O3KA 2W1OA 5JLWA 4XBFA 2E7XA 3OYIA 3RYPA 2WC2A 5DD8A 3OSSD 1HCRA 3M9AA 3LSRA 1NXUA 2EZKA 5IWAE 1ZR4A 2XPWA 4OCHA 5FKNA 2FMLA 2VQEI 3ZQCA 5CPRB 5GAEJ 2X4HA 1RESA 2LY1A 2J5OA 5LHGA 5A2QQ 2JVZA 3BG3A 4JVHA 4D5CA 1ZZJA 2K40A 3GXOA 3E5XA 3IHUA 3SDBA 3W6KB 1FT9A 3PO3J 1Y4SA 3JCUC 1D0ZA 2HDWA 2E5ZA 2EINH 1HR0E 2HOAA 1BOBA 4A3BJ 2E1NA 2VPLA 4X65I 3ZMZA 4IL6C 4P9UA 4E6KG 4PJMA 2KPMA 1YRNA 4D0PA 3RPQA 4UT4A 3RKYA 4A3MJ 2WY8Q 4JI8E 5LMNI 3Q3SA 2DA1A 2ELKA 1W36C 1FOWA 2XGDA 2F4OB 4HF0A 2M4GA 4BQAA 2C38B 3H0GJ 3G2BA 4IS9A 4RGXA 3L2WA 2LKSA 1FBQA 1F0XA 1UCRA 5A2QW 1PDNC 2NN6A 2VBXA 2F4VE 1S7AA 1SD6A 5LBQA 5GTHC 3BZKA 1D1CA 2OAZA 5JHUA 1WJBA 2OUMA 3K2AA 4DV1H 2DOFA 3JRAA 1SD4A 2COBA 1E2XA 1Y8RB 2CW0F 4HSTA 5LFAA 1FOKA 1WRJA 2QBYA 1FJGE 3HHGA 1W4MA 4NZRM 5KAIC 4DV0I 4N3OA 3SHFA 2QQAA 3X2QH 1USSA 1FYMA 3NARA 1I50J 1W0TA 2NVYJ 3K17A 4CSWA 2L7MP 2J65A 2GOMA 1YIOA 4PFPA 3C7JA 4A69C 5ED4A 4MQVA 1XG1A 2Y3MA 2W57A 2OD5A 3JRDA 2UXCI 3GABA
chains in the Genus database with same CATH topology
3M85D 2OPUA 5JEAA 2PO0A 1TUAA 3GCMA 4OO1C 2BA1D 1ZZIA 2BR2B 5K36F 1E3HA 2JZXA 2JA9A 1J4WA 4BA2I 4OO1B 4OO1G 2WP8B 5K36D 3GMEA 4BA1A 4IFDE 2C37A 4OO1F 4WALA 1X4NA 2BA0A 3H36A 2JEBA 5K36B 2QNDA 5JEAC 2C37B 2BL5A 5C0XF 1DT4A 2NN6D 4BA2B 4LIJA 5JEAB 1KHMA 1K1GA 2WP8A 5K36G 1WE8A 4OO1D 2BR2A 3B4TA 2NN6G 2NN6F 4AIDA 4QMFB 2YQRA 2JEAI 3CDIA 2ANNA 3V69A 2FMRA 1EC6A 3H1CA 1UDQA 1UDNA 1OYPA 3DD6A 3L7ZC 2JE6I 4BA1B 2PY9A 2E3UA 4IFDB 2DGRA 3L7ZB 5C0XG 2JVZA 4IFDG 4JVHA 1ZZJA 2CTMA 2PO2B 2PQUA 2NN6B 2PO1B 5C0XC 1E3PA 2PNZA 5K36E 2Z0SA 4BA1I 2JEAA 5JEAG 2C39A 4AM3A 2WNRA 2PO2A 2CTKA 5JEAF 4WANA 2CPQA 1DTJA 2CTJA 2MJHA 1ZTGA 1WHUA 3L7ZA 4BA2A 2CTEA 2BA0D 2AXYA 1OYRA 1VIHA 5C0XA 2NN6E 4IFDF 3M7NG 2CTFA 2JE6A 2BA1G 4OO1A 4OO1E 1OYSA 3KRNA 5C0XB 2JEAB 2HH2A 1UDSA 2C38B 2JEBI 4B8TA 3CDJA 4IFDD 2PO1A 2NN6A 5C0XD 1UDOA 2PNZB 2CTLA 2WNRB 2P2RA 2PO0B 4NBQA 1VIGA 1WVNA 3U1KA 5JEAE 1R6MA 1R6LA 3HKMA 1ZZKA 4IFDA 1X4MA 2ANRA 5C0XE 2JEBB 4AIMA 5K36C 5K36A 2C38A 2BA0G 1J5KA 3AEVB 2JE6B 2OPVA 4JVYA 5JEAD 2C39B 2HH3A 3M7ND 4IFDC 3GLLA 3VKEA 2NN6C 3M85G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M85 D;  2OPU A;  5JEA A;  2PO0 A;  1TUA A;  3GCM A;  4OO1 C;  2BA1 D;  1ZZI A;  2BR2 B;  5K36 F;  1E3H A;  2JZX A;  2JA9 A;  1J4W A;  4BA2 I;  4OO1 B;  4OO1 G;  2WP8 B;  5K36 D;  3GME A;  4BA1 A;  4IFD E;  2C37 A;  4OO1 F;  4WAL A;  1X4N A;  2BA0 A;  3H36 A;  2JEB A;  5K36 B;  2QND A;  5JEA C;  2C37 B;  2BL5 A;  5C0X F;  1DT4 A;  2NN6 D;  4BA2 B;  4LIJ A;  5JEA B;  1KHM A;  1K1G A;  2WP8 A;  5K36 G;  1WE8 A;  4OO1 D;  2BR2 A;  3B4T A;  2NN6 G;  2NN6 F;  4AID A;  4QMF B;  2YQR A;  2JEA I;  3CDI A;  2ANN A;  3V69 A;  2FMR A;  1EC6 A;  3H1C A;  1UDQ A;  1UDN A;  1OYP A;  3DD6 A;  3L7Z C;  2JE6 I;  4BA1 B;  2PY9 A;  2E3U A;  4IFD B;  2DGR A;  3L7Z B;  5C0X G;  2JVZ A;  4IFD G;  4JVH A;  1ZZJ A;  2CTM A;  2PO2 B;  2PQU A;  2NN6 B;  2PO1 B;  5C0X C;  1E3P A;  2PNZ A;  5K36 E;  2Z0S A;  4BA1 I;  2JEA A;  5JEA G;  2C39 A;  4AM3 A;  2WNR A;  2PO2 A;  2CTK A;  5JEA F;  4WAN A;  2CPQ A;  1DTJ A;  2CTJ A;  2MJH A;  1ZTG A;  1WHU A;  3L7Z A;  4BA2 A;  2CTE A;  2BA0 D;  2AXY A;  1OYR A;  1VIH A;  5C0X A;  2NN6 E;  4IFD F;  3M7N G;  2CTF A;  2JE6 A;  2BA1 G;  4OO1 A;  4OO1 E;  1OYS A;  3KRN A;  5C0X B;  2JEA B;  2HH2 A;  1UDS A;  2C38 B;  2JEB I;  4B8T A;  3CDJ A;  4IFD D;  2PO1 A;  2NN6 A;  5C0X D;  1UDO A;  2PNZ B;  2CTL A;  2WNR B;  2P2R A;  2PO0 B;  4NBQ A;  1VIG A;  1WVN A;  3U1K A;  5JEA E;  1R6M A;  1R6L A;  3HKM A;  1ZZK A;  4IFD A;  1X4M A;  2ANR A;  5C0X E;  2JEB B;  4AIM A;  5K36 C;  5K36 A;  2C38 A;  2BA0 G;  1J5K A;  3AEV B;  2JE6 B;  2OPV A;  4JVY A;  5JEA D;  2C39 B;  2HH3 A;  3M7N D;  4IFD C;  3GLL A;  3VKE A;  2NN6 C;  3M85 G; 
#chains in the Genus database with same CATH topology
 2YSR A;  4DNC A;  1R00 A;  2PO0 A;  4JI0 E;  2DQR A;  1MMA A;  5JI6 A;  2XVC A;  3GWZ A;  1XCV A;  4IVN A;  2E5N A;  3PFI A;  2XRL A;  4ZDO A;  5DRO A;  5FLX C;  2CUF A;  3DTI A;  2L7F P;  3DU6 A;  4HX4 A;  4OAZ A;  2EFQ A;  4LB5 A;  5C4J J;  2X36 A;  2LTM A;  1QVT A;  4IOC F;  2DI3 A;  4MTE A;  1Z9C A;  2DLL A;  2N8G A;  2DDA A;  3KP3 A;  1Z1D A;  1MD0 A;  2K9L A;  4NQW A;  2V1D A;  3RTR A;  1XCB A;  1DU6 A;  3HGG A;  1Y6I A;  4LJZ F;  3ZQ7 A;  5C0X F;  3DEW A;  3KPH A;  4J01 A;  4E7I A;  3ZQG A;  4BBS J;  5LMU H;  2H6C A;  4DV0 E;  4IZZ A;  3FXM A;  4A0Y A;  3V4G A;  2QQB A;  4ETS A;  1FNM A;  3J80 W;  2CO5 A;  3SFI A;  3OL4 A;  1SEI A;  3HIF A;  3OV8 A;  2M7A A;  3I64 A;  1ULY A;  3MKW B;  2VES A;  3ERM A;  2I5U A;  1IAW A;  4JV5 I;  2ZXH A;  4U3D A;  2UUB H;  2X51 A;  3L7W A;  4ESJ A;  4MU1 A;  3DKY A;  1HSJ A;  1YLF A;  2DOA A;  1IBM H;  4XMY A;  1W1W E;  4LF7 E;  1Q1V A;  4GKJ H;  4DR3 I;  2LF0 A;  1Z0W A;  1XMQ E;  3I59 A;  4WXC A;  5ICE A;  4BE0 A;  4GXO A;  1KU7 A;  3AG3 H;  4A3C J;  3JRH A;  1IBL E;  3FBN B;  4P96 A;  3L7Z B;  4FWD A;  2A5W A;  3BPV A;  1KON A;  1FIP A;  4ENN A;  2LNB A;  4DV6 I;  4DGW B;  1VQ5 I;  2PQU A;  2QBY B;  3WTV C;  4USM A;  4Z7Y A;  2I8D A;  1ZM9 A;  3RI4 A;  2QSG X;  3ZPL A;  3KYC B;  2JEA A;  5HLH A;  3ZR8 X;  1ZKG A;  5JEA F;  1YW7 A;  2QQ9 A;  2QQ8 A;  2WY7 Q;  5CVJ A;  2BM0 A;  4E4H A;  2CW7 A;  2JPB A;  1ZTG A;  2HQA A;  3MMY B;  1J2X A;  3RQI A;  2WBM A;  3J7Y J;  3K2Z A;  2CTE A;  4UHT A;  4X62 E;  1OYR A;  3CP8 A;  4X6A J;  1DQU A;  2RQQ A;  4BS9 A;  5HNF A;  2STT A;  5C3E J;  2LG4 A;  3WTX C;  5K7F A;  2OTL I;  3CTA A;  3C2B A;  4MLO A;  1VTN C;  2G7U A;  4OX9 H;  4Z7C A;  2O7O A;  3LAJ A;  1J0R A;  2VLA A;  1RR9 A;  1X1B A;  5CJ9 A;  3M4O J;  1VQP I;  4B8T A;  3M07 A;  4HNV A;  4LLL A;  1DUX C;  3H92 A;  2HYJ A;  4N9I A;  3RIR A;  2GBY A;  4HF1 A;  2Z5B A;  1RUN A;  5DRR A;  2M4K A;  3ABL H;  1KYW A;  5EG0 A;  4GQU A;  5F0F A;  5H6Q A;  4MQY A;  4P52 A;  1REP C;  3CES A;  1X19 A;  4HG2 A;  3ZRG A;  1N34 H;  1EV7 A;  4B3R I;  4IO9 F;  1MJA A;  4AIM A;  3JTH A;  4JI6 E;  5FLV A;  4C2T A;  2ELH A;  4IZK B;  3CCS I;  1KU3 A;  3L00 A;  1T08 B;  1TL8 A;  5JFR A;  4JI3 I;  4LF7 I;  1Z6T A;  2XAS A;  3UR3 C;  2PMZ A;  4WX9 A;  1IV6 A;  2M8G X;  1EF4 A;  2HH3 A;  3M7N D;  2UUC H;  2DA2 A;  4HX7 A;  4M3E A;  2V2V A;  4IHY A;  3WU2 C;  3ZN1 A;  2IT0 A;  5LMU E;  3HPH A;  4NXM I;  5DUI A;  3J80 K;  3BT9 A;  1JJ6 C;  3QT8 A;  4LFA E;  5DTD A;  5EYR A;  3SQN A;  4KT5 C;  1E3H A;  4GKK H;  1XD7 A;  3S17 J;  4KT6 A;  4CCJ A;  3J81 Z;  4OO1 G;  1ZLJ A;  2CJJ A;  1H89 C;  3OTO H;  4RA2 A;  2P5L C;  2W00 A;  4DV1 E;  4CGZ A;  4IFD E;  3NCV A;  4HOB A;  2F5E A;  4CIC A;  1FP2 A;  5EZG A;  1Z0V A;  2BA0 A;  1ZRF A;  3PQK A;  3PSF A;  5LEJ A;  1JGG A;  1UG8 A;  2MD5 A;  2XAJ A;  5HDN A;  1I94 I;  1FTT A;  3LA3 A;  1PUF A;  2JN6 A;  2M7B A;  3AG1 H;  4DR2 I;  4HQE A;  1N78 A;  4BE1 A;  3J7A O;  1IBL H;  3AFH A;  1K1G A;  5J4V A;  2DYR H;  4CYC A;  2VBW A;  1SD7 A;  2ZFW A;  1ZGW A;  3JAM W;  2BR2 A;  1MU5 A;  2R7S A;  3TO6 A;  4Y33 A;  5KHD A;  4GKJ E;  4F93 B;  3DU5 A;  4DV2 I;  1ZG3 A;  2Y30 A;  4JI5 H;  2ANN A;  4G6Q A;  2FMR A;  4UXN A;  3ZCO A;  3H1C A;  1W5S A;  5DM6 F;  3BZ6 A;  1VQ8 I;  2DBB A;  3GEZ A;  1UDN A;  4LF4 H;  4JI2 I;  4X64 I;  2JSP A;  2QLZ A;  3S1R J;  2HOS A;  3ROU A;  3Q6M A;  2PY9 A;  2CV2 A;  5CQG A;  1TQI A;  2DFF A;  2O3F A;  4DR6 H;  3BR5 A;  2WV0 A;  2XHK A;  3E7L A;  3BJA A;  2DA7 A;  4Q4Z F;  4IFD G;  4Z2Y A;  4BY7 J;  1LQ1 A;  2Z9O A;  4W97 A;  2X9D A;  5F0C A;  1D8J A;  2W85 A;  4RDU A;  3ISP A;  1KU2 A;  4FN5 A;  1D1B A;  4RAY A;  1DDN A;  3K4J A;  4KYW A;  1ETW A;  3TO9 A;  2WB1 A;  2V34 A;  1XPX A;  1TWF J;  1JTX A;  1QA6 A;  1LDJ A;  3IH3 A;  4CCL A;  1ETO A;  1R1U A;  3RKQ A;  3BOQ A;  4U7D A;  3DLL F;  4AUX A;  1Z0G A;  2IOQ A;  3BR3 A;  3N05 A;  4IFD F;  4J00 A;  2V8P A;  4NNJ A;  1QGP A;  2V9V A;  3A02 A;  3IV5 A;  3Q9V A;  2W48 A;  2EZL A;  1UDS A;  2UXC E;  2JEB I;  1KZH A;  1S6L A;  1FSH A;  2P5K A;  2FNA A;  3A0B C;  1MZB A;  4JI5 I;  4M73 A;  3H5R A;  4DV2 H;  1HKS A;  2WNR B;  1I6U A;  4I76 A;  4JX6 A;  1ELO A;  1RR8 C;  3U1Y A;  4Y3O A;  3S93 A;  4ITV A;  2V26 A;  3CC7 I;  4X65 E;  3TQN A;  1T8I A;  2IVM A;  3IWF A;  3PYG A;  3V5R A;  1FWK A;  3GX4 X;  4KIS A;  1S16 A;  3KET A;  4GYG A;  1W7P B;  2ZBK B;  4GKJ I;  3OYG A;  3ZOB A;  4HBL A;  3LTO A;  1BC7 C;  1BI0 A;  5LGT A;  5FGM A;  2H09 A;  4UB8 C;  2CVE A;  5GAH J;  3F23 A;  2GO4 A;  1FBS A;  2O1W A;  1TNS A;  3V8J A;  1T33 A;  1KGS A;  3CCL I;  1ZRE A;  4B3M I;  4A3D J;  5H2F C;  3W3C A;  1RUO A;  3OR1 C;  3M85 D;  4G08 A;  2COM A;  1YH8 A;  3QRF F;  3QT7 A;  4CDG A;  1FJG H;  2XPV A;  1VIS A;  3PRY A;  2AXL A;  2BVM A;  3GTL J;  3KP7 A;  1J4W A;  4X0G A;  4LFU A;  2DPU A;  3ZMV A;  2OTJ I;  1B4A A;  1XDU A;  4XK4 A;  3UKG A;  1FYL A;  4BBR J;  1HKT A;  2HKJ A;  4BA1 A;  4B48 A;  1X3W B;  2EV5 A;  1T0F C;  1MNM C;  1SAN A;  2R5Y A;  2AXT C;  5FLX K;  1UHM A;  2LDU A;  5DYM A;  4JI3 H;  4A2U A;  5AON A;  1S8N A;  2R7Q A;  2C37 B;  4OIP F;  2KRC A;  2XSD C;  1K79 A;  1E3O C;  2PJR A;  2UXD E;  3F6O A;  5LMN H;  1Y4U A;  3DKX A;  2RNG A;  1U78 A;  1ERD A;  1N34 I;  3BTC A;  5K5Q A;  2UUC E;  4WWC A;  4B3S I;  4OO1 D;  2EFO A;  1TWC J;  3IKT A;  1X9Z A;  1OPC A;  3CUQ B;  3B4T A;  1IBM E;  5TRD A;  2PNM A;  4FW5 A;  4BXF A;  5J1Y A;  4AIK A;  3JR9 A;  2A07 F;  3ABU A;  1U8R A;  1ONV A;  2YQR A;  3FXL A;  1M1E B;  1FC3 A;  1MJ9 A;  4XKC A;  1N75 A;  3NEU A;  4RM3 A;  1XTA A;  3CLQ A;  1R9T J;  2OJE D;  2JK3 A;  4LK1 F;  1XGO A;  2X6W A;  4BEH B;  1O3Q A;  2YX7 A;  3K7A J;  4I2O A;  1X2M A;  3U9G A;  4DR5 E;  2LOO A;  3R6S A;  2V4J C;  3L2R A;  2Z5C B;  5JLX A;  2XIG A;  2R0Q C;  1ZG5 A;  4ABZ A;  2L9S A;  2TRT A;  3QT6 A;  2CTM A;  3QD7 X;  4LOM A;  4EGY A;  1LB2 A;  2ESN A;  2PO1 B;  2VQL A;  3KIO A;  4KA4 A;  1S20 A;  1UST A;  1YIT I;  1ETQ A;  1ZLK A;  3PFY A;  2MG4 A;  3VOE A;  3S2H J;  4FX4 A;  3A03 A;  1FJL A;  2DQL A;  3M6A A;  2XKP A;  5FLM J;  1S9H A;  5DCM A;  3CJQ B;  5EGO A;  1TWG J;  1T95 A;  2K9M A;  2KIM A;  2KRH A;  2WAQ A;  4L9V A;  2RAE A;  2CQ7 A;  4C3I J;  2VPR A;  1NK3 P;  4N4N B;  4MU3 A;  1B72 A;  2XB0 X;  3LSM A;  3KRN A;  1FX7 A;  1QVU A;  4BJT A;  2RGV A;  3I9V 2;  2XF5 A;  2OBP A;  1XX5 A;  2WAD A;  3HM5 A;  5HLI A;  3OSF A;  2CGP A;  1MX0 A;  1QZY A;  1R6R A;  3FKJ A;  3MN2 A;  1UDO A;  3LQR A;  1IUY A;  3EDP A;  5LD2 C;  3JTG A;  3BR0 A;  3TW7 A;  3QWL A;  1MH4 A;  2PJR B;  4DR5 I;  2GA2 A;  2G7H A;  3CMM A;  3GZN B;  3HKM A;  4IFD A;  4K0K E;  4L18 B;  4ZH4 F;  1I6X A;  1UFM A;  5K36 A;  2BA0 G;  3L2V A;  2OCE A;  1Y5Y A;  4JI7 E;  4IZJ A;  1ZGA A;  1SAX A;  3PUF A;  3WU3 A;  3WOD F;  3GTP J;  1Z2I A;  1IRF A;  5E8I A;  1MDM B;  4NXM E;  3QAH A;  4PJ0 C;  1RIO H;  3ZMU A;  2DOE A;  1LEA A;  2FBI A;  4HZF A;  4UUT A;  2BEO A;  1K47 A;  2PBI A;  4DZP A;  3HGY A;  3Q0W A;  1IZ1 A;  2DXI A;  4UUS B;  1ZXN A;  2ZM6 I;  2PG4 A;  2PQ8 A;  2X1E A;  5DCF A;  2BA1 D;  4C3H J;  1BW6 A;  1WJE A;  2KIS A;  2DMQ A;  4BXX J;  5GAG J;  4HY1 A;  1FY7 A;  4OKG A;  2DMP A;  4LG3 A;  1BJZ A;  3KYL A;  2VT3 A;  4X66 E;  3HYI A;  3HJE A;  4YEL A;  2IXS A;  3N4M A;  2Z5C A;  2BY1 A;  5IT9 W;  3WG7 H;  4K2E A;  4BYY A;  1FWL A;  3P5J A;  2K3P A;  3P7N A;  4DBQ A;  2A6H F;  2LVS A;  1DGR M;  3DEU A;  2ME0 A;  2IES A;  1IJW C;  2HWV A;  4P5O A;  5F1J A;  4EM1 A;  4LIV A;  5ERI A;  4JP0 A;  5K36 G;  4LFC I;  3H5N A;  3OYL A;  1Y56 A;  2IW5 A;  2EV6 A;  4LFA I;  3O8H A;  5EEA A;  1ZYR F;  3ZQF A;  4BJ6 C;  4DV7 H;  2MD0 A;  4KMU X;  2IA0 A;  4I99 C;  3KE2 A;  3M8E A;  4BEH A;  3ELK A;  1XXE A;  5FJ8 J;  2V9K A;  4LPF A;  4IHV A;  2R7W A;  1B72 B;  5TIS C;  2AS5 F;  2R7U A;  4IQ4 A;  1UB9 A;  2F5D A;  4QSH A;  1S4E A;  4NXN I;  3CDH A;  5FRM A;  1WSU A;  4II3 A;  4G6D A;  4H8A A;  2BYV E;  4XSX F;  2X06 A;  3DXJ F;  2MGQ A;  4TV7 A;  3RQ4 A;  2YR2 A;  5HLT A;  4YFN F;  2JVG A;  4FJS A;  1P7I A;  3CUQ A;  1HST A;  4PZJ A;  4ZC3 A;  1B63 A;  2MC4 A;  4X65 H;  5LL6 b;  4EV0 A;  4A6E A;  1J59 A;  2QF7 A;  3G71 I;  2NPF A;  2D2W A;  3DFG A;  1VQK I;  2VQG A;  5C4X J;  1P92 A;  1U9N A;  1DTJ A;  2HKX A;  1DU0 A;  4G7O F;  4AYB A;  1L3L A;  2GM4 A;  1STZ A;  3W2A A;  2DEJ A;  3GR5 A;  4IHS A;  3I58 A;  5CVI A;  1BW5 A;  1Z7U A;  4JI1 E;  4M3G A;  3HOZ J;  3HOV J;  4QNK A;  5F6F A;  2MAB A;  3AG2 H;  3QOP A;  4XR6 A;  2ZBK A;  2BXZ A;  3HBL A;  2FMY A;  2VUM J;  4DV5 I;  4PRX A;  4ZZL A;  4DV5 H;  2PO1 A;  4DYC A;  2HQN A;  3JW4 A;  4CZC A;  4FHT A;  1YHC A;  2P2R A;  4I98 B;  4XN0 A;  5FKO A;  5IYD J;  4DPU A;  5DD4 A;  2CSO A;  3U1K A;  3GTK J;  3A01 B;  4LLN A;  2Z5E A;  1P7J A;  1UG2 A;  2BZT A;  3KCC A;  3VYR B;  4A6D A;  4D5F A;  4DPY A;  1O57 A;  2VQF E;  3KP2 A;  1A6Q A;  1PP7 U;  1BOA A;  1HOM A;  4URL A;  5LRS A;  2M6Q A;  3V7R A;  3TW6 A;  2G0E A;  2YS9 A;  1D5Y A;  1RZ4 A;  2A3S A;  1CQT A;  2JTV A;  3DF8 A;  1KU9 A;  4F52 A;  4DU7 A;  4RPF A;  3GLL A;  3KX2 A;  4ZYH A;  1YTY A;  3EET A;  3F3X A;  4DR1 H;  1AA7 A;  1BJA A;  5A2Q Z;  4LF8 I;  2X48 A;  4BY1 J;  3OS1 A;  1YFH A;  5D8L B;  2CG9 A;  2V7F A;  3R4K A;  3ZM7 A;  3FAU A;  3UNG C;  1YW9 A;  4DR4 E;  4X62 I;  2OPT A;  2M30 A;  3OR2 C;  2ZM6 H;  4AQY E;  4C9Y A;  2UXD I;  4NQW B;  2ISY A;  2WA0 A;  2DEI A;  3R0A A;  4BU2 A;  4DUZ H;  3H3Z A;  2NVT J;  5BNG A;  1XDS A;  1R5G A;  5HS8 A;  1IN7 A;  3K0L A;  2KRF A;  4DPW A;  1HNW H;  3QOD A;  4DOZ A;  1AU7 A;  4ESB A;  2IS2 A;  2VKD A;  5EG0 B;  3LNQ A;  1QU3 A;  4IEJ A;  4XLA A;  1ETV A;  2WP8 A;  2HOE A;  3I71 A;  4USK A;  2VON A;  4HAC B;  1MBJ A;  2V1N A;  4IJA A;  4JBA A;  3FMR A;  2HFU A;  2DYS H;  2UXN A;  2X0L A;  4LF9 I;  1U6G A;  3FMQ A;  3LSG A;  1X2N A;  5A2Q K;  4RAF A;  2H8R A;  4B43 A;  4B4C A;  4ZYE A;  2PMZ N;  3ZMS A;  1PKP A;  2O1T A;  1WTJ A;  3QU3 A;  4LCH A;  4LF5 H;  2BHZ A;  4I0A A;  3QPL A;  4JI1 I;  2VQC A;  5EEG A;  1R36 A;  1O3S A;  3OET A;  1N0U A;  1TTY A;  2DOD A;  1R5H A;  1S5L C;  3AKZ A;  2YX4 A;  3IRR A;  2JRM A;  4KIC A;  1IN4 A;  2XGX A;  4L9N A;  3H0D A;  1E3P A;  2IGO A;  3ULQ B;  2QKL B;  1ZR2 A;  1Y0U A;  3FF5 A;  3W2W A;  1K6Y A;  2IBD A;  3G3Z A;  1IXS B;  3FXJ A;  2M5W A;  3MKZ A;  1IDZ A;  1MIJ A;  3GTG J;  1U2W A;  3DTK A;  4IKF A;  3T1H E;  1TW3 A;  1ETY A;  2JUG A;  5AIP A;  3MD2 A;  4QPO A;  5EZH A;  1OYI A;  2QCO A;  2Y0M A;  1IBL I;  3KP6 A;  3FXQ A;  2IGM A;  2EIJ H;  1I94 H;  2ZJQ F;  1NTC A;  1HKQ A;  1WGX A;  5GMD A;  3QP5 A;  2VKC A;  3IUO A;  4IXA A;  3DKW A;  1Z6R A;  1U8B A;  1OCZ H;  5D5U B;  2F1D A;  1V3F A;  1IUF A;  4DUY H;  2OU2 A;  4M6Y A;  2JWT A;  1R71 A;  1OCO H;  2L4A A;  4W1U A;  4EMS A;  4HV6 A;  4IPA A;  1JKR C;  2F4I A;  3T1Y E;  4GKK I;  4B09 A;  1F9N A;  2R5Z A;  4MU4 A;  2R5Y B;  3W2V A;  1TT0 A;  4G6T B;  1W5C C;  2RN7 A;  2VC0 A;  3QOE A;  4AIH A;  4EJO A;  5ILV A;  4RBO A;  1W0U A;  5K36 C;  4EQQ A;  3K10 A;  1W5T A;  2EQR A;  4LFB H;  3DCF A;  1RKW A;  3WTY C;  4A3I J;  2AQF A;  4M72 A;  5FLX Z;  2CWH A;  1GV5 A;  2KQR A;  2D9I A;  2RVC A;  4LIT A;  4ZTF A;  4JVY A;  1X1D A;  4YFK F;  4ZDL A;  1HW2 A;  3K9T A;  1PUE E;  2IS4 A;  2KKO A;  3FHZ A;  2WAE A;  1K7A A;  3BG6 A;  3A2K A;  3SZP A;  2FQ3 A;  4KIG A;  2TCT A;  5IOZ A;  4LCG A;  2GO3 A;  4LCF A;  4OO1 C;  1GHC A;  1UZC A;  1G3T A;  4HX8 A;  5JVT A;  3FK7 A;  4V2G A;  2G8Y A;  3VPR A;  4EMD A;  2EK5 A;  3B02 A;  2H1K A;  3VWB A;  2HQR A;  1R7J A;  4HNU A;  1HNZ E;  3JSP A;  2EA2 A;  4OO1 F;  3RZO J;  2DFI A;  1GVD A;  1VI7 A;  2R7D A;  1FPQ A;  1A6I A;  2AO9 A;  3WHB A;  3E3V A;  2VKH A;  2FU4 A;  5KK1 A;  1JUS A;  3PYE A;  2CFX A;  4NC6 A;  2NN6 D;  5E1Z B;  2ZNZ A;  1CF7 B;  1U2R A;  2DJN A;  3BQY A;  5JEA B;  4KDP A;  4HF2 A;  3J7A G;  2CU7 A;  1Z0C A;  2VXD A;  3P3C A;  4JI4 E;  2HVR A;  4FAS D;  1I39 A;  1YJ9 I;  3V2U C;  4BXU A;  3K70 C;  1VQM I;  2HYF A;  3U1D A;  2X1C A;  4B47 A;  4XL9 A;  1MSZ A;  4JK1 X;  5D5X B;  4YFX F;  3NWT A;  3J80 Z;  2KL4 A;  3V69 A;  4RB1 A;  1DPU A;  1N77 A;  4DV3 H;  1FOX A;  2P81 A;  2M9H A;  3I53 A;  3G1O A;  4CCK A;  1YI2 I;  1R5I D;  1HW1 A;  1RRE A;  2P7C B;  1FJG I;  1X4O A;  1Z21 A;  3H9Q A;  3GO5 A;  5BPD A;  5BR8 E;  3CMA I;  4ZVI A;  2O0Y A;  3HC7 A;  3PS3 A;  5FB2 A;  1WJ5 A;  2PO2 B;  4X1E A;  3D1N I;  2LJP A;  2HHH I;  3QU6 A;  3T1H H;  3CCU I;  2ADU A;  4XLH A;  3DTE A;  4B8X A;  2KZG A;  2KJC A;  1XMA A;  1IRX A;  3LPS A;  1XNQ I;  2QWW A;  5L3E A;  3MZH A;  1Z5C A;  4M9S A;  1Y39 A;  1WHU A;  2IP2 A;  3BLY A;  4Y15 A;  4FTH A;  1ZM3 A;  1GLN A;  4JI2 E;  1WWX A;  2RDP A;  4HSR A;  3EQL F;  5K7H A;  4DV5 E;  1P4W A;  2C6Y A;  4KFC A;  4EJV A;  1J5E E;  1YW8 A;  4OIQ F;  4FW9 A;  2G9W A;  2EA4 A;  1Y1V J;  3MVP A;  5F64 A;  4CA0 A;  4IOA F;  4DUZ I;  1I6H J;  2FXA A;  4B3X A;  2CYY A;  3B82 A;  4PU9 A;  1WVR A;  1G4D A;  3WTT C;  3QP6 A;  2YPR A;  2B0L A;  2XAU A;  3P3G A;  5F08 A;  2VOD A;  4U87 A;  4L0Z B;  5EL9 A;  5A2Q C;  1YQA A;  2XKO A;  3CF5 F;  2RRE A;  4XQF A;  4JI0 I;  2Z3Y A;  4DYQ A;  3R0J A;  1FYK A;  3KEQ A;  3CJR B;  3HOY J;  2OPV A;  4XLN F;  3OS0 A;  1BN5 A;  3V8K A;  1XNR H;  1U0J A;  4GGG A;  1X3U A;  5K5R A;  3KEY A;  2XC7 A;  3Q1Q A;  4DYR A;  1MSE C;  2M87 A;  1PP8 F;  2VI6 A;  1T0F A;  4JG4 A;  3OIO A;  2FNP A;  1POG A;  4DXL A;  5DNX A;  3GCM A;  2OA4 A;  2EJR A;  2FBK A;  4I0B A;  4LG0 B;  2KP6 A;  3HRM A;  4HAC A;  5K36 F;  2ME6 A;  2HGC A;  1B6A A;  2XAQ A;  2LD5 A;  1TWA J;  4K0K I;  1R4M B;  2LBF B;  2IRF G;  1RHY A;  1MND A;  3VSK A;  1MJB A;  2H1L A;  2C37 A;  4ISA A;  3ZKD A;  4BNC A;  4E70 A;  1RET A;  4XRS A;  2JEB A;  4NDL A;  5B66 C;  5B1B H;  3CF2 A;  2FE3 A;  2FX0 A;  4KHP E;  1BM9 A;  3FHN A;  2NVU B;  3BCA A;  4HV5 A;  1F5T A;  2B63 J;  2R3S A;  5LLQ A;  3AL0 C;  4BA2 B;  4LIJ A;  3GTM J;  3DEE A;  3K4M A;  4LF8 H;  1OCR H;  4E7L A;  3GUD A;  4ZYA A;  2HEO A;  4DR2 H;  2UXC H;  1N32 E;  4B3M E;  2AJ4 A;  4F91 B;  2EFW A;  4LF4 E;  1KA8 A;  4XKB A;  3PS2 A;  3AG4 H;  1BBY A;  3FKI J;  4E9J A;  3TP0 A;  1GVJ A;  4AQY I;  4LF6 H;  1XHK A;  1JE8 A;  1LVA A;  4IF4 A;  5BOX A;  2VJI A;  2OZ6 A;  3FX3 A;  4IRH A;  1OMI A;  4PUS A;  3CWV A;  1VQN I;  5IT3 A;  2LMD A;  3DWL E;  5LL6 R;  2EV0 A;  3OMY A;  4HRI A;  3LA7 A;  1A5J A;  1SVO A;  1LE8 B;  2M1B A;  1LPQ A;  3CC4 I;  4OAY A;  4WUD A;  1H72 C;  1X1P A;  3CCR I;  3BTL A;  1DAR A;  4PDB A;  2TDX A;  4HDU A;  4A3L J;  3J80 C;  3OOU A;  1ACI A;  3WE3 A;  1XSV A;  4HEA 2;  3V7C A;  3PJR A;  1K61 A;  2WB1 N;  4U0V A;  5DRP A;  1G3W A;  4U7B A;  4YEJ A;  2Y9Y A;  1NZ0 A;  1MBF A;  4EJU A;  3EUH C;  1VQ9 I;  1HBX G;  1QHG A;  3ABM H;  5E17 F;  3KZY A;  5EKW A;  1D3Y A;  1ENH A;  1VND A;  1XB4 A;  1XSD A;  4LFB E;  2A1S A;  3J7Z I;  5DM7 F;  2A61 A;  4D7M A;  4FQG A;  4FW3 A;  2UXB E;  4XRS G;  2BA0 D;  1RI7 A;  1BKN A;  4GCV A;  4OIN F;  4CHU A;  2JSC A;  1A31 A;  3E97 A;  1EH7 A;  2BA1 G;  4DR3 H;  1N36 I;  2LF7 A;  1T6S A;  4G9Y A;  4NB5 A;  4XLE A;  4Q47 A;  2R93 J;  5D5V B;  4EEF G;  2F5V A;  3BG5 A;  2Y9Z A;  1AN7 A;  2L7Z A;  2GIV A;  4DV4 E;  3C18 A;  1K4S A;  4JI6 H;  4NBQ A;  2XDV A;  2FBH A;  3V42 A;  3WGH A;  2O9L A;  1U5T A;  2F48 A;  3KZZ A;  3REO A;  3CO6 C;  3CCQ I;  1R6L A;  2CUE A;  1ZZK A;  4M3F A;  3HOU J;  3LFU A;  2HR3 A;  3GZ6 A;  2R7T A;  4IZJ D;  1J5K A;  1S3J A;  4JYK A;  5TGT A;  4OZE A;  5DS9 A;  1HQC A;  2K9S A;  5GAD J;  3O2P E;  4FW7 A;  2DMT A;  2HK3 A;  3OYA A;  1XMO H;  4LF5 E;  4LFA H;  1BR4 A;  2A2D A;  4KHP H;  4LG0 A;  2EBI A;  1EH6 A;  4OU0 A;  3Q5F A;  1Z3X A;  1UMQ A;  2GOX B;  4R8H A;  2VOP A;  5JEA A;  2L4M A;  1HNZ H;  4XTJ A;  2KJB A;  3I4N J;  2ZXJ A;  1PVG A;  2JZX A;  1N0V C;  4JI4 I;  2O3Z A;  4DV3 E;  1N32 H;  2E1R A;  2VB6 A;  2CRG A;  3GME A;  3JAM Z;  4BGD A;  5J1U A;  2GAU A;  4DV7 E;  2VC1 A;  1MGT A;  2DTR A;  2FA5 A;  2XAF A;  2P6T A;  4P7A A;  2X85 A;  3CCE I;  2QND A;  4JI4 H;  3CQZ J;  4V19 K;  2LTP A;  5LEK A;  3HG9 A;  4CZZ A;  3JRI A;  2ZJR F;  1ZK8 A;  4B8C D;  1R22 A;  2KIQ A;  4I6Z A;  5L3B A;  3MKY B;  4G7H F;  2W4S A;  3FK6 A;  2ZIT A;  1Z05 A;  2GQ0 A;  1D6T A;  2DFH A;  1WE8 A;  3TDZ C;  2JA8 J;  4JI7 I;  2DK5 A;  5IP7 J;  2XAH A;  5E3L A;  1D5V A;  1QNT A;  4L5I A;  4UUS A;  2NN6 F;  3PYF A;  2KT0 A;  1G3Y A;  3E0J B;  2JEA I;  2VL8 A;  2O4C A;  4BL0 B;  5F27 A;  1R49 A;  2MBF A;  3B8H A;  2Z2S B;  4GFB A;  2OI2 A;  3GON A;  6PAX A;  3BRO A;  1FLI A;  1DP3 A;  2L9R A;  3M3Y J;  3HB9 A;  3F22 A;  1S03 G;  4U0Y A;  5JVG F;  1YE9 A;  5F0H A;  4H0E A;  2ZQE A;  2DDB A;  4BDZ A;  1QPM A;  3CCV I;  3K69 A;  1ZAO A;  2CQK A;  3MEX A;  2LTL A;  4LGW A;  3S1Q J;  2K85 A;  2OZU A;  3NQO A;  3IAM 2;  4CXF A;  1LVK A;  3PO2 J;  5GME A;  4A0X A;  1N36 H;  3BWG A;  4JI5 E;  2DFE A;  3IRQ A;  3WU5 A;  1J5E I;  2CG4 A;  1Z59 A;  5D4R A;  2CPQ A;  2EFN A;  4JQF A;  4IX7 A;  1P2F A;  3MQ0 A;  4B3S H;  3L7Z A;  4OMZ A;  1CF7 A;  4M74 A;  2WW4 A;  3A1Y A;  4QIW N;  1T56 A;  1F36 A;  1X3Z B;  1ZGJ A;  2AXY A;  4DR7 E;  1K83 J;  3MZY A;  4LFC E;  2XV4 S;  3IC7 A;  3M7N G;  3RZD J;  2F4V I;  4HPQ A;  2JE6 A;  4MEY F;  4RB0 A;  2VJ4 A;  2FRH A;  4D9J A;  4Y17 A;  3G1M A;  5C0X B;  2UUA E;  2BVL A;  4CH7 A;  2K4J A;  4MFE A;  1H74 A;  4QWQ A;  4WXD A;  5CVR A;  2ZJ2 A;  3L1P A;  1TZL A;  1I3Q J;  4F7Z A;  1VQ6 I;  4DPX A;  1V9N A;  2CTL A;  4JI8 I;  5LMN E;  5J6X A;  4K0K H;  1ETK A;  3MCZ A;  1FMW A;  2OQG A;  2E1C A;  2Z99 A;  2X1D A;  2L01 A;  4A5M A;  1TW2 A;  1WVN A;  3K85 A;  4NZT M;  4JI7 H;  3J81 Q;  1YS7 A;  3S3M A;  1D0X A;  3CUQ C;  1Y60 A;  5E8G A;  4IHT A;  3LAP A;  2PJP A;  1H73 A;  1RC9 A;  4S0H B;  3P3E A;  2WAF A;  4OD6 A;  4DR4 H;  3KDK A;  1R1T A;  4A0Z A;  4HNT A;  1USU A;  2MH2 A;  2YU9 J;  2JE6 B;  3TP3 A;  3PSI A;  2STW A;  4LF8 E;  4RB3 C;  2RV8 A;  1WH7 A;  2P8T A;  1B8I B;  2C39 B;  1QZZ A;  3ABT A;  4OMY A;  2JZY A;  2F4M B;  4MYU A;  1WJD A;  4N0B A;  2NN6 C;  3DBH B;  2VIX A;  5E3N A;  4A5N A;  2K3F A;  2E35 A;  3HUG B;  1TUA A;  1N32 I;  4G12 A;  3L2C A;  2V6C A;  1Y8Q B;  1YIJ I;  4E7K A;  2ZCW A;  4R1F A;  3K70 D;  2V2Q A;  1MH3 A;  1TP4 A;  1A35 A;  2E1O A;  4PK4 A;  4HLY A;  3M1E A;  1OFC X;  2MH9 A;  4CCN A;  2V6E A;  4KHP I;  1IBK H;  3J81 K;  2ZB9 A;  1X4N A;  3M8F A;  2DT7 B;  4BKX A;  4C2M J;  4BAC A;  1D1A A;  2UZK A;  4CCO A;  2CUJ A;  1ZAR A;  2NXN B;  3GFL A;  4C3J J;  3ERE D;  1BI2 A;  1TBX A;  2HK2 A;  1H88 C;  3F21 A;  1KTV A;  1LUJ B;  1ON2 A;  4RLF A;  2L0K A;  2X7I A;  4IZK A;  2RKH A;  2O1V A;  3OYN A;  2Y0S A;  4B1R A;  1X1C A;  2BW3 A;  4V2F A;  2CWE A;  3CCM I;  3FWE A;  2PMH A;  1IN5 A;  2Q2E B;  1E0E A;  3WU6 A;  3E5Q A;  1F1Z A;  1YOV B;  4IRG A;  3VOD A;  4XIC A;  1FEX A;  4DR5 H;  2LYC A;  2K5C A;  2MSY A;  1XNR I;  2NS7 A;  3WGI A;  1XGN A;  1H9G A;  2XGC A;  2JA7 J;  4ED4 A;  3BDD A;  2A68 F;  3HUG A;  3MWM A;  2CFO A;  1FIA A;  2W25 A;  3BR1 A;  3GLX A;  4RM2 A;  1PUF B;  2M3A A;  5DT9 A;  1Z67 A;  4FJU A;  3L7Z C;  3PM1 A;  2JA6 J;  2NS8 A;  3WTZ A;  1OJ4 A;  1IW7 F;  1SAU A;  3RYR A;  2RNJ A;  1IDY A;  2CV0 A;  2VBZ A;  3WHC A;  1O4X A;  2UUA I;  2V1X A;  2KLO A;  3DPU A;  1JUM A;  2GZW A;  2LY2 A;  4DJA A;  1H7U A;  5K36 E;  3PYD A;  3ASO H;  5ELW A;  1GT0 C;  4X66 I;  1XMK A;  1K78 B;  1B8I A;  2C39 A;  4AIJ A;  2PO2 A;  2Q2E A;  2V9P A;  1W7P D;  5DEQ A;  2Z33 A;  2HPM A;  2JA2 A;  2HTS A;  3OSG A;  4OIO F;  3NRV A;  3S14 J;  4MIM A;  3U21 A;  3DP7 A;  3LST A;  1S7O A;  2PN6 A;  4BA2 A;  1VQL I;  5JHF A;  4HW0 A;  2O03 A;  2ZM6 E;  4DR3 E;  5C0X A;  1N36 E;  1OR7 A;  3RPU D;  2HZT A;  2HKO A;  4A93 J;  2CPM A;  5FFX A;  2CW8 A;  2LLK A;  1IV8 A;  4OO1 A;  4LB6 B;  4L0Y B;  4DZJ A;  4OO1 E;  2E5L I;  5DUK A;  2PX9 A;  3S3N A;  3NZK A;  1AWC A;  4MU0 A;  2YU3 A;  4JYA E;  4S04 A;  3CDJ A;  3BR2 A;  1J7K A;  4PSW A;  3T1Y I;  2CUZ A;  1ZG1 A;  2BY0 A;  2EIL H;  5ICC A;  3I55 I;  3SEQ A;  3TBI A;  3ZMT A;  4BHB A;  2M2E A;  2P5V A;  3F6V A;  3MFK A;  4DR6 I;  5B3S H;  5IT9 C;  3CME I;  3F0C A;  4BH9 A;  2VN2 A;  3I0P A;  1PVE A;  1R6M A;  5K5O A;  4HA8 A;  3ABK H;  1VFC A;  5C0X E;  2MYS A;  3H3U A;  3M7G A;  5J4Y A;  2A2C A;  4M9X A;  1OR7 C;  2KZV A;  5J40 A;  3HOS A;  1U3E M;  3COA C;  2NOG A;  4XNF A;  5FD5 A;  1BI3 A;  1T38 A;  4LLG F;  5CYV A;  1QHH D;  2L7K A;  1VQ4 I;  2P4W A;  3DBR B;  3JAM C;  4Z6Y A;  2LK2 A;  1JT6 A;  4XOR A;  5LHI A;  4B44 A;  1WH5 A;  1ZM2 A;  1YX3 A;  1HA8 A;  1QO0 D;  3J7A Y;  1TLH B;  1O3R A;  4XOT A;  1EH8 A;  5D4S A;  4BA2 I;  4GDF A;  1SVL A;  2GWR A;  4AC0 A;  1XGS A;  2EWN A;  4M3D A;  3GYH X;  2PFB A;  2ZFU A;  2R7R A;  2IAI A;  1S72 I;  4B3M H;  3FM3 A;  3WE2 A;  1WUU A;  2HVQ A;  1GUU A;  3CCJ I;  4BQQ A;  2K1H A;  2Y0S N;  1V8C A;  3GZ5 A;  2LBF A;  3H4L A;  1LE8 A;  1B1B A;  1Z0T A;  2JPC A;  3JSO A;  2A5Y B;  2UV1 A;  3LNU A;  2JRT A;  1Z0B A;  4JI0 H;  4QNJ A;  4ZYD A;  2LY9 A;  5IWA H;  2A05 A;  4N9H A;  1AOY A;  3DLA A;  2Y75 A;  3IP4 B;  1SFK A;  3K6G A;  5CQE A;  4ANJ A;  1NHI A;  4AVZ A;  4NXN E;  2QM3 A;  2CS3 A;  2H8W A;  3T8R A;  3GF2 A;  4QMF B;  2DCE A;  1MDM A;  2OF7 A;  3HPG A;  2UU9 I;  4RB2 C;  1LFP A;  2DO7 A;  2GLO A;  2UXX A;  2CGE A;  2QEN A;  1EKE A;  3L9F A;  1UDQ A;  5DNL A;  3ZP5 A;  1ZHF A;  3KDG A;  1OYP A;  3DD6 A;  4MHG A;  2IJL A;  2CQN A;  3FZV A;  3F72 A;  2R3V A;  4ZZD A;  3ZZU A;  1TNT A;  1ETX A;  2O1U A;  1LFU P;  3LOC A;  1ZXM A;  4NC7 A;  5FKL A;  3JRC A;  4BUP A;  3FIS A;  1KIJ A;  2MW8 A;  4M6V A;  1SFU A;  2QZ8 A;  3GBG A;  2E5L H;  4JOM A;  1SVM A;  5HLG A;  1QBJ A;  5IT9 Q;  1G6N A;  1OYW A;  4DR7 H;  1H9T A;  3BZC A;  1P9Q C;  3RSN A;  2HKE A;  2ZXI A;  4DV2 E;  2CTJ A;  2XSJ C;  3BG9 A;  1UAA A;  3K4B A;  3N97 A;  2NNN A;  3LL7 A;  1SC7 A;  1HDD C;  1ZTR A;  4YII A;  3ECO A;  1FKA E;  1BI1 A;  2R5Z B;  3K4N A;  1IGN A;  5EJC A;  2HH2 A;  4X64 H;  3G1L A;  2GQQ A;  4JV5 E;  1U5T C;  1R1V A;  5EEH A;  2W7N A;  3G73 A;  4IFD D;  2P7V B;  2XAG A;  3K1P A;  3J7A K;  1RPW A;  5IP6 A;  3JRE A;  3EYI A;  2UUA H;  3F8N A;  4JX4 A;  2EH3 A;  4C2U A;  4QLC U;  3OIP A;  2W84 A;  4FE4 A;  3Q6N A;  1WJC A;  2HHH E;  4X62 H;  2QSH X;  3KZI C;  4DW6 A;  2OC6 A;  1HR0 H;  5BR8 I;  2HDC A;  3H5A A;  4R1H A;  4DR1 I;  3S1N J;  1T98 A;  2I10 A;  3AEV B;  5FLX W;  2KDO A;  5E1X A;  2UUB I;  1J09 A;  3WU4 A;  1EJ9 A;  3K4K A;  5IT9 Z;  3CO7 C;  2QSF X;  3QT5 A;  4B3T I;  5B1A H;  2ZSH B;  1MMN A;  2F6C A;  5EDN A;  4XON A;  4XN3 A;  1ZRD A;  2W24 A;  2ELJ A;  1IN8 A;  4DIQ A;  1LDD A;  4UVB A;  5GP9 A;  2JA5 J;  3G6E I;  5L3F A;  1ODD A;  1ON1 A;  1IRZ A;  4DUZ E;  2JJ7 A;  1OJL A;  1J5Y A;  2HVS A;  2ZME B;  2GIZ A;  4O6J A;  3JRF A;  2VF3 A;  2WP8 B;  5K36 D;  3CP2 A;  3FXU A;  3S1M J;  2O61 A;  2UUB E;  4D1Q A;  5E3O A;  4WAL A;  2UUC I;  1K4T A;  2JQ7 A;  1HLV A;  5K36 B;  2L2O A;  4DR1 E;  2F5C A;  1Z0X A;  2VE8 A;  4DBR A;  1XSX A;  2QVO A;  1BIB A;  1D8K A;  1ZN2 A;  1EA3 A;  1OCP A;  2VJJ A;  1VZ0 A;  3HSF A;  2F5F A;  4D7N A;  5CLS A;  1IO2 A;  2HTJ A;  2DTZ A;  2J5P A;  2A69 F;  4RAZ A;  1HC8 A;  3KP5 A;  2MC3 A;  4CCM A;  1WKM A;  5BPI A;  1YYV A;  3D5L A;  1IBK E;  3LSK A;  1KQ8 A;  2HXO A;  5KVR A;  3CD6 I;  1DP7 P;  3T1Y H;  1EC6 A;  1Q1H A;  3IL2 A;  4KN4 X;  1H0M A;  2QA4 I;  2FJ1 A;  3T0Y A;  1GXP A;  2CQQ A;  4OX9 I;  2JE6 I;  2ZNY A;  4DV0 H;  4BA1 B;  3OYC A;  3BJO A;  2EFG A;  2DA4 A;  3SJM A;  2EB7 A;  3BY6 A;  5HS7 A;  2E3U A;  4EVI A;  3ZQL A;  4XKV A;  2HU9 A;  4JX5 A;  4JI8 H;  4WF2 A;  5GPA A;  2DMU A;  3ZQQ A;  5BQT A;  5M5X J;  1HNX I;  2PNZ A;  4B3S E;  1G59 A;  4AWX B;  5CVV A;  1G2H A;  5E1W A;  2Z0S A;  3HUL A;  4LF7 H;  1KYZ A;  1MMD A;  2CQX A;  3HZJ A;  4I02 A;  4PSX A;  5JEA G;  4X66 H;  2ECB A;  4AM3 A;  4DV7 I;  2DN0 A;  2EIK H;  3CDL A;  2FFM A;  4PRV A;  4Q5S F;  2JUC A;  2NOJ B;  2BHY A;  3D0S A;  3WTS C;  4PJN A;  1VF9 A;  4RGS A;  1MG7 A;  3RF2 A;  3S2W A;  1TC3 C;  3FXR A;  3P9C A;  1VIH A;  3HOW J;  1V5G A;  4Y4R A;  1V5E A;  4R79 A;  5L3D A;  3FDY A;  1KQ9 A;  2IOP A;  1AHD P;  1ZM4 A;  3KP4 A;  2PI0 A;  1OYS A;  3LMM A;  3Q0U A;  2NNY A;  1DGW Y;  1P4A A;  1EI1 A;  2QGU A;  4BHC A;  5C0X D;  3QYB A;  5IOY A;  5L3C A;  2PNZ B;  3GKU A;  1SFX A;  3QPT A;  3P06 A;  4UV8 A;  3TL4 X;  5BS6 A;  2Z5U A;  4ENJ A;  2VOO A;  2UXB I;  4LF9 H;  5H6R A;  4RGU A;  3SB1 A;  1Y1W J;  1VIG A;  3VB2 A;  4F55 A;  4NXN H;  3B6A A;  3F8F A;  1VQ7 I;  2L5Q A;  2NS0 A;  2BBY A;  2ZO4 A;  3OWT A;  3ZQH A;  3GVA A;  2ACJ A;  1R23 A;  1NH3 A;  1AKH A;  1J9I A;  1HK7 A;  4XLP F;  4A3G J;  1G3S A;  3OYK A;  4DV4 I;  3OYE A;  4NHJ A;  2B9S A;  3C2G A;  3WGG A;  4YHH E;  1Z5A A;  4UUV A;  5EGO B;  3C2H A;  4L5E A;  2BY2 A;  4Y7N J;  1YHQ I;  1BC8 C;  2YUS A;  2ESH A;  4YIR X;  2NAZ A;  1IF1 A;  1NK2 P;  1FZP B;  3EUA A;  1P4X A;  2EZH A;  4HXZ A;  1ITY A;  4EM2 A;  4X64 E;  2OPU A;  4LK0 F;  1R4N B;  2E60 A;  4E7Z A;  1EA6 A;  3BTJ A;  4KUM A;  4PJL A;  4S05 A;  2VQH A;  3Q0V A;  2GS8 A;  3SYT A;  4OO1 B;  2FF4 A;  3SZT A;  1ORK A;  1JKO C;  1YS6 A;  4M9Z A;  3R61 A;  4E7S A;  3DQV C;  4XRF A;  2R7O A;  4OX9 E;  3IKV A;  2PT7 G;  4BE2 A;  1KVK A;  4PDK A;  2OV7 A;  3LA2 A;  4MYT A;  1MBH A;  1NHA A;  1DPR A;  1K78 A;  3K4C A;  3CC2 I;  5IP9 J;  2E7W A;  3BP8 A;  5KAF C;  3P9K A;  5LHH A;  3L09 A;  2JMW A;  2HS5 A;  4LD5 A;  2NN6 G;  3CCY A;  4H4K C;  1FBU A;  5J8F A;  4FWG A;  4DV1 I;  4FW4 A;  4AID A;  3FM5 A;  1ZEL A;  4A3K J;  3I4M J;  2L3D A;  2FPH X;  4DV4 H;  4HYE A;  4E7H A;  1PIE A;  1JHH A;  1HNX H;  1U9O A;  2QKM B;  1XNQ E;  2GXA A;  4HAM A;  4BQO A;  1O7L A;  2PEX A;  5ICF A;  3I4P A;  2DA6 A;  5FO5 A;  5FRO A;  4BJ5 C;  3E5U A;  5LGN A;  4JI6 I;  2DGR A;  3K1N A;  3PNT A;  4UV9 A;  1XMQ H;  3ZXS A;  5IY5 H;  3JAM Q;  1U5T B;  1XMO E;  1I94 E;  1V5F A;  2IEK A;  1J5E H;  2CV1 A;  2LRR A;  3TDU C;  3GTQ J;  3NWS A;  4PFO A;  4A3F J;  2E19 A;  2DK8 A;  3G4S I;  1TQP A;  3OYH A;  3VSL A;  2KIU A;  1MKM A;  4MEX F;  1D0Y A;  2DJI A;  4JV5 H;  1BIA A;  2NN6 E;  1V4R A;  3E1S A;  3V7S A;  3FBI B;  3K1J A;  4ASN A;  4L9J A;  1LJ9 A;  2LKP A;  2L54 A;  2JEA B;  2QUF A;  3VYT B;  2H6B A;  1LKX A;  3CJN A;  3RCO A;  3HL2 A;  5LRR A;  2XRO A;  1GDT A;  4CYD A;  2DT5 A;  2FSW A;  2H94 A;  1JHF A;  3QYE A;  1QZR A;  1UEK A;  5M3F J;  2R92 J;  4ENK A;  3LSI A;  1MW7 A;  4I01 A;  3O8G A;  1LFB A;  4YIF A;  2ANR A;  3OOP A;  2Q1Z B;  1GV2 A;  4M3B A;  1CGP A;  4QPQ A;  4LF6 I;  4AQY H;  4I3H A;  3P76 A;  3SZG A;  4BAY A;  3GFI A;  3GFM A;  4IRI A;  1LEB A;  2ZSI B;  1H8A C;  1L0O C;  5HOO A;  2QYO A;  4IQJ A;  1SD5 A;  1ZH5 A;  4DPT A;  2KDZ A;  2VJ5 A;  3SDG A;  4FE7 A;  5L3J A;  3VKE A;  3TOA A;  2AHQ A;  1FWZ A;  2LRD A;  2XRN A;  3K1M A;  1XMQ I;  4PGH A;  4Q48 A;  5BR8 H;  4RAG A;  3D5R C;  4AU7 A;  2Q0O A;  4EM0 B;  4ZTJ A;  4ESF A;  1RRJ A;  2HFS A;  2VQE H;  1WZ2 A;  1ZZI A;  3ZN0 A;  3LQQ A;  3DBL B;  3MZ8 A;  2E1M B;  2JA9 A;  3RJP A;  1SMY F;  3C3W A;  1S7E A;  2HPI A;  4KMF A;  1OYY A;  2AE8 A;  3I59 B;  1XN7 A;  3OYM A;  1H7S A;  3LSH A;  3BG7 A;  3GTO J;  1JXS A;  3HXL A;  2EIM H;  3I56 I;  1WJA A;  1SMT A;  4AYB N;  4L5J A;  5JEA C;  4XRM A;  4QTR A;  2E2H J;  1P42 A;  1FMV A;  4FX0 A;  3RDI A;  1LDK B;  2ZC2 A;  2NYX A;  2X6O A;  3TED A;  2BV6 A;  1DT4 A;  1IN6 A;  3J81 C;  4ZJZ A;  4LFC H;  3KLN A;  4WUB A;  4YHH H;  4FET A;  2FD5 A;  2ZME C;  2K86 A;  1LNW A;  4UNO A;  3I5U A;  2V79 A;  1HW5 A;  2A6T A;  1VI0 A;  3FIW A;  2DW4 A;  4MQ9 F;  2HYG D;  4DV6 E;  4B3T H;  2UXB H;  1XNQ H;  1Y6Z A;  2JT2 A;  3OS2 A;  2XF6 A;  4WCG A;  3TOB A;  2NVX J;  3CDI A;  3T1H I;  3KEO A;  4XID A;  1C0W A;  2HHH H;  3BQZ A;  2L9V A;  4II2 A;  4EJT A;  2K9Q A;  2HOT A;  1WQ2 A;  1UEL B;  2ISZ A;  2CZ9 A;  1WHR A;  2P0W A;  1X4P A;  2ECC A;  4OIR F;  2ID3 A;  2IS6 A;  4IFD B;  5LGU A;  2EPF A;  1OIS A;  1JUP A;  4KN7 X;  3LWF A;  3TO7 A;  4JI2 H;  4MGR A;  1G8X A;  3P9I A;  1XNR E;  2WWY A;  3F0N A;  3J80 Q;  4BQN A;  4XKW A;  2DT6 A;  3BC8 A;  3LFK A;  2NRA C;  2WNR A;  4EJW A;  2CTK A;  1XS9 A;  3IAS 2;  4AVP A;  5B5E C;  3E6C C;  3H3V K;  1X58 A;  2UU9 E;  2IA2 A;  3NAU A;  5F04 A;  2IGN A;  4Y13 A;  1YJW I;  1WI3 A;  3ML6 A;  1N33 I;  3K4L A;  3KYD B;  3HOX J;  2ZKZ A;  1OCC H;  4MO7 A;  5IWA I;  2FEZ A;  3H9J A;  3V8L A;  3RKX A;  2PLY A;  5FFZ A;  3T5X A;  2R7F A;  3VDX A;  1JTY A;  1XC5 A;  3A01 A;  3OL3 A;  3SEZ A;  4PGG A;  2M0C A;  3R60 A;  3H9G A;  1AKH B;  2IER A;  2ICW G;  2M34 A;  2RC4 A;  2K9N A;  3KLO A;  4LIU A;  2L9N A;  2ZME A;  1A6F A;  1Z5B A;  2E1M C;  1VQO I;  3A0H C;  1N33 E;  4RMN A;  4CUG A;  5JEA E;  3TKY A;  2WTE A;  1ODH A;  1BR2 A;  1XGM A;  1QPI A;  2D1H A;  3UOE A;  4IHX A;  5M5W J;  1SEU A;  4LF4 I;  4LOC A;  4DV3 I;  3I54 A;  3HOT A;  5IYC J;  3DPL C;  3LSP A;  3ZGK A;  9ANT A;  4U88 A;  5JR3 A;  1MBE A;  1W36 D;  1YRN B;  4DUY E;  2IA1 A;  5E18 F;  2DPD A;  1I27 A;  3OIQ A;  1PJR A;  4XLF A;  2IS1 A;  4WXH A;  2V1U A;  1QZE A;  1WPK A;  2OQR A;  3M85 G;  4JI3 E;  5FRN A;  1RR7 A;  4B3R H;  2XF7 A;  1VBI A;  3S3O A;  2XPU A;  2UUZ A;  1TT5 B;  3B6C A;  3F9K A;  3QYF A;  4ZDP A;  3ZMD A;  4P1W A;  3S15 J;  2O5R A;  5J1R A;  1X1A A;  4DR2 E;  5C44 J;  3WU1 B;  4G8X A;  5AIQ A;  2K7L A;  5M5Y J;  3HHH A;  1YJN I;  5BMZ A;  2OCC H;  2DU9 A;  2VKV A;  4A3J J;  3OTO I;  3IWZ A;  5GTI C;  1SFE A;  1JI8 A;  3OYF A;  1FSE A;  1TWH J;  4YG2 F;  4YY3 H;  1I5Z A;  2BL5 A;  1JT0 A;  4MTD A;  3EUK L;  4FWH A;  1YX5 A;  3VEP A;  3OYB A;  1V55 H;  5FD6 A;  4NXM H;  1KHM A;  2M8W A;  1BR1 A;  4NC8 A;  2V2Z A;  2MLG A;  1HNX E;  1SFO J;  2HQ5 A;  5F1R A;  2E71 A;  3PNY A;  3L2U A;  3S32 A;  2IPQ X;  3QPH A;  3E6B A;  4GRI A;  3CZ6 A;  4LFB I;  1FI4 A;  5DRQ A;  2KIF A;  4B3T E;  4DV6 H;  3WG9 A;  4P55 A;  5FKM A;  2BV3 A;  4BDY A;  1NG7 A;  2Y48 A;  4EAT A;  3O6B B;  1V54 H;  1BL0 A;  2VT2 A;  1X0A A;  1MMG A;  1Z3Y A;  3HTU A;  3OY9 A;  4WUC A;  2L02 A;  2VQF I;  2VAS A;  4FT8 A;  5HDG A;  1BA5 A;  4MDT A;  5C0X G;  1O3T A;  2XEX A;  3B78 A;  1IXR C;  4U3B A;  1UHW A;  1QQI A;  2D1V A;  3S8P A;  4DUY I;  1USV A;  2H27 A;  5C0X C;  4DR7 I;  4YRV A;  1P6R A;  4BA1 I;  2EFP A;  2M8E A;  1J75 A;  4CYC B;  2MFZ A;  3TMO A;  4HYM A;  3FXO A;  5FKK A;  2M45 A;  4OOI A;  4I09 A;  2PNL A;  4WAN A;  5K1Y A;  2FQ4 A;  4FIS A;  2HNH A;  2M0M A;  4AD9 A;  1HF0 A;  3HKZ N;  1HR0 I;  1PQX A;  3D4J A;  2Z16 A;  3J7A M;  1FOY A;  4ENM A;  1OLT A;  2E36 A;  5IPA A;  3ZKB A;  2W82 A;  2E34 A;  2BY3 A;  1B9N A;  4GO1 A;  1FTZ A;  1XRH A;  2BXY A;  3ESW B;  1FNN A;  3OYJ A;  3HDD A;  3J81 W;  5J8C A;  1WCM J;  3M1C A;  1IBK I;  1MMS A;  4KIT B;  3CMY A;  4L9T A;  2JT1 A;  1OCT C;  4LF6 E;  4LMY A;  3PL8 A;  3WTU C;  4XSZ F;  3QQA A;  2FOK A;  3PIO F;  4M1K A;  1HDP A;  4JI1 H;  2HXI A;  5CVU A;  3TGN A;  1I1G A;  4J19 A;  5HNH A;  1JGS A;  3HRS A;  2DMN A;  4UY8 I;  4BHP A;  3E6D A;  2C38 A;  2R7V A;  3HRU A;  1IBM I;  2LR8 A;  4YY3 I;  4CO8 A;  5HDK A;  4UVA A;  1UJ8 A;  2HFH A;  1YO5 C;  3ECH A;  1WFX A;  3MKL A;  2JVH A;  4ZYG A;  5TJJ A;  4G7Z F;  2DA5 A;  2RQP A;  2CWF A;  2X6Y A;  3EYY A;  1B9M A;  2VQF H;  5IYB J;  3U2R A;  2Z5B B;  5H20 A;  3PIP F;  3EUH A;  2CH0 A;  2KFD A;  1HNW I;  5DDG A;  4Y52 J;  1F4K A;  4B3A A;  2XGE A;  5E20 A;  4A3E J;  2DA3 A;  3ONQ A;  3HTS B;  1PYV A;  1WJF A;  3I3L A;  2CMP A;  2ETH A;  3RPU A;  2K27 A;  4PCQ A;  1MNE A;  3VFZ A;  2UU9 H;  5ILS A;  3H36 A;  3CJT B;  5GPC A;  5D6E A;  2B7E A;  2O8K A;  2K02 A;  4KQV A;  1Y0N A;  2FOW A;  2LSO A;  4XM3 A;  2F4V H;  1W7P A;  1MSF C;  4F3Q A;  3M8J A;  4EGZ A;  3UHM A;  2LC2 A;  1APL C;  3FXK A;  1JKP C;  2VXZ A;  4RS8 A;  4DR6 E;  4P9F A;  2R7Z J;  4HQM A;  2LKX A;  2XUB A;  2K4B A;  3IH4 A;  3KFW X;  1HNW E;  5IT9 K;  3T1B A;  4U0W A;  2LRE A;  4FW6 A;  1HXD A;  3D5S C;  3OYD A;  3S16 J;  3HJC A;  2VE9 A;  5J47 A;  1I3A A;  1ZQ3 P;  1X4M A;  4HDV A;  1N34 E;  2BGC A;  2ZJP F;  2Y31 A;  1JKQ C;  3PUB A;  3I0T A;  3RKW A;  3DV8 A;  2A6E F;  5D6F A;  4DR4 I;  2FUG 2;  3EZJ A;  4XLC A;  3HSE A;  4MFD A;  2BM1 A;  4J3D A;  2MLK A;  3S2D J;  3SFZ A;  1ZRC A;  1A36 A;  1GXQ A;  3HSR A;  3T8T A;  4F92 B;  5HS9 A;  3QPS A;  2UWM A;  3WTW C;  5E79 C;  2GXG A;  1IRG A;  4RGR A;  2BOL A;  1T2K A;  4YY3 E;  2XB5 A;  4KIF A;  4OWR B;  1KQ0 A;  2X6X A;  4M71 A;  2NVQ J;  3W6J B;  2NN6 B;  2GA1 A;  2HZD A;  1XMX A;  3FMS A;  1NHH A;  2ZXW H;  1KKH A;  3HKZ A;  3MAJ A;  4MNU A;  5HVQ C;  5L3G A;  1UHS A;  4A12 A;  2BE5 F;  3C1D A;  1IC8 A;  2QEX I;  3BR6 A;  3F8M A;  2MJH A;  1S29 A;  4JYA I;  4LF9 E;  2BW3 B;  3E6M A;  1WI9 A;  3HRT A;  5E3M A;  3GTJ J;  3W6V A;  4UTG A;  3CLO A;  5D8K B;  3ZZT A;  3PNV A;  3VYS B;  1F43 A;  3GFJ A;  2KMU A;  4C30 A;  4IZJ B;  3WU0 A;  2CTF A;  4M6X A;  2LH9 A;  4NUB A;  5EF6 A;  4O5V A;  3HEF A;  1B59 A;  4KIB A;  2ID6 A;  5FWK A;  5KNL A;  3ZZ0 A;  1R58 A;  3ZQI A;  3JAM K;  3AAF A;  4IHW A;  4FCY A;  3GW2 A;  2PO0 B;  2Y69 H;  4PJJ A;  1I1S A;  1Z91 A;  3H35 A;  5ICG A;  2MA3 A;  3F8C A;  1NG6 A;  2HI3 A;  2J7K A;  2Y2Z A;  4GYI A;  3B73 A;  3PQJ A;  5J3L A;  5KCM A;  4I7H A;  4ON0 A;  4WK8 F;  3EPZ A;  2JEB B;  3PS1 A;  2VQE E;  1N33 H;  3OTO E;  1Z7L A;  3JRB A;  2E2J J;  1XMO I;  4B3R E;  1T39 A;  2GXB A;  2Q8K A;  5DCM B;  4HLX A;  5JEA D;  3DPT A;  3BPX A;  1RKT A;  5HOD A;  4IFD C;  4KJZ A;  3SXY A;  1B62 A;  1Z0E A;  3AL0 B;  2Z1D A;  1QRY A;  3VYU B;  2UXD H;  2E2I J;  2DAO A;  1A04 A;  2VKE A;  2PMU A;  2LFB A;  3BTI A;  1IG7 A;  1O7F A;  1MBG A;  3LSJ A;  2D5V A;  5M3M J;  2BR2 B;  3ASN H;  4LF5 I;  2F2E A;  2IGK A;  2KHM A;  2R42 A;  2E5L E;  5CKT A;  2LF8 A;  2LP0 A;  3F8B A;  3IH2 A;  1OQY A;  4G94 A;  4RLQ A;  4E7J A;  2O6G E;  2R4G A;  3BCB A;  1Z77 A;  2AQE A;  2P6S A;  4GKK E;  5DV5 A;  2WV1 A;  2R7X A;  1TQM A;  1RNL A;  4DQ2 A;  1JJ8 C;  5D5W B;  4KNY A;  1OKR A;  4O3M A;  3A4C A;  1UG0 A;  1IXC A;  5K7Z A;  1MBK A;  2HDD A;  2WAQ N;  1HNZ I;  1FKA H;  2D45 A;  1K6O A;  3JRG A;  1NHJ A;  5ILU A;  4YHH I;  3CUO A;  3Q9S A;  4XOP A;  4N4O B;  4EC5 A;  2O8X A;  1N25 A;  1E17 A;  5LMU I;  3L2Q A;  4JYA H;  3BJ6 A;  2VBY A;  4DU8 A;  4UVC A;  4UB6 C;  2EZI A;  1FP1 D;  5FLX Q;  1YG2 A;  3O3K A;  2W1O A;  5JLW A;  4XBF A;  2E7X A;  3OYI A;  3RYP A;  2WC2 A;  5DD8 A;  3OSS D;  1HCR A;  3M9A A;  3LSR A;  1NXU A;  2EZK A;  5IWA E;  1ZR4 A;  2XPW A;  4OCH A;  5FKN A;  2FML A;  2VQE I;  3ZQC A;  5CPR B;  5GAE J;  2X4H A;  1RES A;  2LY1 A;  2J5O A;  5LHG A;  5A2Q Q;  2JVZ A;  3BG3 A;  4JVH A;  4D5C A;  1ZZJ A;  2K40 A;  3GXO A;  3E5X A;  3IHU A;  3SDB A;  3W6K B;  1FT9 A;  3PO3 J;  1Y4S A;  3JCU C;  1D0Z A;  2HDW A;  2E5Z A;  2EIN H;  1HR0 E;  2HOA A;  1BOB A;  4A3B J;  2E1N A;  2VPL A;  4X65 I;  3ZMZ A;  4IL6 C;  4P9U A;  4E6K G;  4PJM A;  2KPM A;  1YRN A;  4D0P A;  3RPQ A;  4UT4 A;  3RKY A;  4A3M J;  2WY8 Q;  4JI8 E;  5LMN I;  3Q3S A;  2DA1 A;  2ELK A;  1W36 C;  1FOW A;  2XGD A;  2F4O B;  4HF0 A;  2M4G A;  4BQA A;  2C38 B;  3H0G J;  3G2B A;  4IS9 A;  4RGX A;  3L2W A;  2LKS A;  1FBQ A;  1F0X A;  1UCR A;  5A2Q W;  1PDN C;  2NN6 A;  2VBX A;  2F4V E;  1S7A A;  1SD6 A;  5LBQ A;  5GTH C;  3BZK A;  1D1C A;  2OAZ A;  5JHU A;  1WJB A;  2OUM A;  3K2A A;  4DV1 H;  2DOF A;  3JRA A;  1SD4 A;  2COB A;  1E2X A;  1Y8R B;  2CW0 F;  4HST A;  5LFA A;  1FOK A;  1WRJ A;  2QBY A;  1FJG E;  3HHG A;  1W4M A;  4NZR M;  5KAI C;  4DV0 I;  4N3O A;  3SHF A;  2QQA A;  3X2Q H;  1USS A;  1FYM A;  3NAR A;  1I50 J;  1W0T A;  2NVY J;  3K17 A;  4CSW A;  2L7M P;  2J65 A;  2GOM A;  1YIO A;  4PFP A;  3C7J A;  4A69 C;  5ED4 A;  4MQV A;  1XG1 A;  2Y3M A;  2W57 A;  2OD5 A;  3JRD A;  2UXC I;  3GAB A; 
#chains in the Genus database with same CATH homology
 3M85 D;  2OPU A;  5JEA A;  2PO0 A;  1TUA A;  3GCM A;  4OO1 C;  2BA1 D;  1ZZI A;  2BR2 B;  5K36 F;  1E3H A;  2JZX A;  2JA9 A;  1J4W A;  4BA2 I;  4OO1 B;  4OO1 G;  2WP8 B;  5K36 D;  3GME A;  4BA1 A;  4IFD E;  2C37 A;  4OO1 F;  4WAL A;  1X4N A;  2BA0 A;  3H36 A;  2JEB A;  5K36 B;  2QND A;  5JEA C;  2C37 B;  2BL5 A;  5C0X F;  1DT4 A;  2NN6 D;  4BA2 B;  4LIJ A;  5JEA B;  1KHM A;  1K1G A;  2WP8 A;  5K36 G;  1WE8 A;  4OO1 D;  2BR2 A;  3B4T A;  2NN6 G;  2NN6 F;  4AID A;  4QMF B;  2YQR A;  2JEA I;  3CDI A;  2ANN A;  3V69 A;  2FMR A;  1EC6 A;  3H1C A;  1UDQ A;  1UDN A;  1OYP A;  3DD6 A;  3L7Z C;  2JE6 I;  4BA1 B;  2PY9 A;  2E3U A;  4IFD B;  2DGR A;  3L7Z B;  5C0X G;  2JVZ A;  4IFD G;  4JVH A;  1ZZJ A;  2CTM A;  2PO2 B;  2PQU A;  2NN6 B;  2PO1 B;  5C0X C;  1E3P A;  2PNZ A;  5K36 E;  2Z0S A;  4BA1 I;  2JEA A;  5JEA G;  2C39 A;  4AM3 A;  2WNR A;  2PO2 A;  2CTK A;  5JEA F;  4WAN A;  2CPQ A;  1DTJ A;  2CTJ A;  2MJH A;  1ZTG A;  1WHU A;  3L7Z A;  4BA2 A;  2CTE A;  2BA0 D;  2AXY A;  1OYR A;  1VIH A;  5C0X A;  2NN6 E;  4IFD F;  3M7N G;  2CTF A;  2JE6 A;  2BA1 G;  4OO1 A;  4OO1 E;  1OYS A;  3KRN A;  5C0X B;  2JEA B;  2HH2 A;  1UDS A;  2C38 B;  2JEB I;  4B8T A;  3CDJ A;  4IFD D;  2PO1 A;  2NN6 A;  5C0X D;  1UDO A;  2PNZ B;  2CTL A;  2WNR B;  2P2R A;  2PO0 B;  4NBQ A;  1VIG A;  1WVN A;  3U1K A;  5JEA E;  1R6M A;  1R6L A;  3HKM A;  1ZZK A;  4IFD A;  1X4M A;  2ANR A;  5C0X E;  2JEB B;  4AIM A;  5K36 C;  5K36 A;  2C38 A;  2BA0 G;  1J5K A;  3AEV B;  2JE6 B;  2OPV A;  4JVY A;  5JEA D;  2C39 B;  2HH3 A;  3M7N D;  4IFD C;  3GLL A;  3VKE A;  2NN6 C;  3M85 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...