4AM3A

Crystal structure of c. crescentus pnpase bound to rna
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
622
structure length
622
Chain Sequence
GSMFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAVFAKSQKPGQDFFPLTVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVKGFKNEVQVVVTVLQHDLENDPDILGMVAASAALCLSGAPFMGPIGAARVGWVDGAYVLNPTLDEMKESKMDLVVAGTADAVMMVESEIQELSEEIVLGGVNFAHQQMQAVIDAIIDLAEHAAKEPFAFEPEDTDAIKAKMKDLVGADIAAAYKIQKKQDRYEAVGAAKKKAIAALGLSDENPTGYDPLKLGAIFKELEADVVRRGILDTGLRIDGRDVKTVRPILGEVGILPRTHGSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKESFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLAMMDAGVPLVRPVSGIAMGLILEQDGFAVLSDILGDEDHLGDMDFKVAGTSEGLTSLQMDIKIAGITPAIMEQALAQAKEGRAHILGEMNKAMDAPRADVGDFAPKIETINIPTDKIREVIGSGGKVIREIVATTGAKVDINDDGVVKVSASDGAKIKAAIDWIKSITDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/rna
molecule keywords POLYRIBONUCLEOTIDE NUCLEOTIDYLTRANSFERASE
publication title Crystal Structure of Caulobacter Crescentus Polynucleotide Phosphorylase Reveals a Mechanism of RNA Substrate Channelling and RNA Degradosome Assembly.
pubmed doi rcsb
source organism Caulobacter vibrioides
total genus 175
structure length 622
sequence length 622
chains with identical sequence B, C
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2012-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF00575 S1 S1 RNA binding domain
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 4am3A02
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4am3A03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4am3A01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4am3A04
3V69A 1R6MA 1WVNA 3M7NG 4NBQA 1UDSA 5C0XF 3KRNA 2HH2A 4OO1A 1K1GA 5JEAB 2BR2B 1DT4A 2JVZA 2C37B 2PY9A 3GCMA 3L7ZB 5JEAC 1UDQA 1OYPA 2JE6B 2PO2B 3H36A 1X4MA 4OO1B 5JEAE 5JEAA 3L7ZC 2CTFA 3DD6A 4OO1D 2BR2A 3M85G 1E3PA 4WANA 4AM3A 4IFDG 2WP8B 1DTJA 4BA1A 2JEAA 4OO1C 3L7ZA 2PO0B 1UDOA 2JE6A 2PO2A 1KHMA 4JVYA 2BA1G 2CTMA 3AEVB 3VKEA 1UDNA 4OO1E 3U1KA 2DGRA 4IFDF 2OPUA 1ZZIA 4AIDA 2C38B 5JEAD 1VIGA 5C0XB 2JA9A 2WP8A 4BA1B 2JEAB 3GMEA 1R6LA 2ANRA 2P2RA 5K36G 2PO0A 2NN6G 4BA2B 2MJHA 3CDJA 3CDIA 5C0XC 2PQUA 2CTKA 2JZXA 2CTEA 2BA0G 2JEBA 3B4TA 2QNDA 2C38A 5K36F 4WALA 1OYRA 2NN6F 5C0XE 5C0XA 2HH3A 2WNRB 4BA2A 2Z0SA 2ANNA 1ZZJA 3GLLA 4BA1I 2JEAI 2C39B 2JEBB 1E3HA 4LIJA 4BA2I 2JE6I 5JEAG 1X4NA 2WNRA 4IFDB 2PO1A 5C0XD 1VIHA 1TUAA 2NN6A 4IFDD 4AIMA 1J5KA 2C39A 5JEAF 4IFDC 2CTJA 2FMRA 1EC6A 1WHUA 2BA0A 2BA1D 4OO1G 3M7ND 2OPVA 4IFDA 2PO1B 4IFDE 1J4WA 3HKMA 2PNZB 2BL5A 2AXYA 1ZTGA 5K36B 1ZZKA 2JEBI 2NN6B 1WE8A 2YQRA 3H1CA 1OYSA 5K36D 2CPQA 4OO1F 4B8TA 2NN6D 5K36C 2NN6C 4QMFB 2E3UA 2BA0D 2PNZA 5C0XG 5K36E 5K36A 3M85D 2NN6E 2CTLA 4JVHA 2C37A
chains in the Genus database with same CATH superfamily
1XCVA 4XMYA 3K70D 4G94A 3GABA 3MAJA 1J5EI 2K1HA 4F92B 1R4NB 1WVNA 1R5ID 1FBUA 4CHUA 4FE7A 3ZMTA 2QUFA 1JKQC 5A2QW 4MO7A 2BYVE 4Y4RA 3HKZA 2EBIA 1FI4A 3GF2A 5AIQA 4KN7X 3RPUD 1KU2A 5F0FA 1N34I 2H8RA 2WY8Q 4U0VA 3CMEI 1YJWI 5LLQA 1EI1A 4I76A 2DT7B 4JYAI 3JW4A 3I59A 2Z5BB 4DUYE 5FJ8J 5H20A 2K7LA 4XOTA 5DUKA 4BKXA 5JEAE 1RUNA 3LWFA 1BN5A 3MEXA 5DEQA 2WP8B 5HLIA 3OYEA 2E5LH 1WRJA 4IFDG 4XKWA 4OO1C 2BW3B 2EH3A 2J7KA 3L7ZA 2AS5F 4A6EA 3IWFA 4B44A 4IX7A 3RYPA 1Z5AA 4DV3H 3TW7A 3BQYA 3EYYA 3OL4A 5E8GA 3WG9A 3KYDB 3AG2H 4DZPA 2CU7A 2VBWA 3UKGA 1SEUA 4BU2A 2ANRA 2I10A 1YHCA 1SVMA 4B47A 5FLXW 1HKQA 3K6GA 3GTGJ 1W4MA 4X6AJ 4DR1E 4JI5H 3HJEA 1BC8C 1XDSA 3HYIA 4BUPA 1TW2A 4NC6A 4FTHA 2M87A 2CVEA 1GVDA 3TOBA 3B4TA 1YIJI 5BPDA 5D5VB 5H2FC 1TWGJ 4JBAA 5J4VA 1MSEC 4IHWA 3HB9A 4B3AA 4G7ZF 1T98A 2AXLA 1RC9A 4ZJZA 3AL0B 3IKVA 1OCRH 2BY2A 2V9VA 4MHGA 3RCOA 1SC7A 1IXCA 3H3UA 2IOPA 4DOZA 3L7WA 1S4EA 2B63J 2BEOA 4U87A 5E20A 1RNLA 4KIGA 3DEWA 3FZVA 5LBQA 2A6HF 4DR6E 2HZDA 2DA3A 2F2EA 2P5KA 3ML6A 4OOIA 4C30A 2JE6I 4FJUA 5J6XA 3WTUC 4BYYA 1U5TC 3CCEI 4M6XA 4DR4E 1TUAA 2DI3A 3C2HA 1VIHA 4PK4A 2BV6A 4EGYA 3T1BA 4IFDD 4CYCB 3T1HI 5LMUH 5JVTA 1OPCA 2VC0A 2FUG2 4AIHA 3MN2A 2EFWA 3V7CA 4RAZA 5J1UA 1D0YA 5FD5A 2QM3A 2YR2A 1VQ9I 2DCEA 4ED4A 2NVUB 4HQEA 2J65A 1BI1A 1V9NA 3KP6A 5LL6R 3FK6A 2ZITA 4N3OA 1FOKA 3J7AY 2EILH 1S6LA 1VQ7I 2Q0OA 2A2DA 4LJZF 3VODA 5IYCJ 2HDDA 3MMYB 1S29A 2Q2EA 1H72C 1Z0WA 2UXDH 2LMDA 4GKJH 4MFEA 3I54A 1UJ8A 2XPVA 2UUAH 4NXNI 5JR3A 2K9SA 1BW6A 3TDZC 1VI0A 5GADJ 3J81Q 4B3RH 1Z7LA 5K36A 2OCEA 1YHQI 2KRFA 3DPTA 4B3XA 2E1NA 3WG7H 4U3DA 2BVLA 2ZFUA 3DTIA 1WSUA 4H4KC 1LDJA 3IL2A 1A35A 2RNJA 4EJOA 2L0KA 3Q0VA 4AIKA 1XNQH 2K9NA 2EB7A 1XGSA 3ZMZA 1HXDA 3HGGA 3S16J 4URLA 1V5GA 2IA1A 3KEQA 4LCHA 2LKPA 1K7AA 3BLYA 3R0AA 2CSOA 2O3FA 5HS7A 1UELB 2EFPA 2KKOA 3EUHC 1EA6A 2DXIA 3GWZA 4PRVA 2D45A 1F9NA 2CH0A 1RR9A 1X4MA 1MX0A 3QWLA 4X62E 4IPAA 1LFBA 4DZJA 5IWAI 2ZMEB 1D0XA 2IP2A 3KCCA 5FD6A 2JA7J 4JI3I 4MGRA 1XC5A 1E3PA 2N8GA 4LMYA 3HOTA 2DMPA 1SEIA 4NZTM 3BC8A 2Y0SN 1HR0I 1BM9A 1VQPI 1QVUA 2B7EA 1F4KA 2JE6A 3BG3A 2ZJQF 3ASOH 1KHMA 2GIVA 1J2XA 1ZLJA 2WBMA 2GXAA 5KHDA 3FM5A 2RKHA 1S20A 4BJ5C 3JRGA 4MNUA 4NC7A 2DPUA 3PYGA 1FJGI 4XM3A 2JUCA 3F0NA 1TQPA 1S5LC 4Z7CA 2OQRA 1T39A 2VODA 2CWFA 4EV0A 1Q1VA 4F55A 1HNXE 2CTKA 4CICA 4B3SE 1VQ6I 2CQKA 4N0BA 2R7WA 2EA2A 1F0XA 4DUYH 2NN6F 3I4PA 4GGGA 2VKEA 4G7HF 1JJ8C 1N32E 2FMLA 3FIWA 1OCTC 1O3QA 5DM7F 4JI4E 3PSFA 4HOBA 4L0YB 2BXZA 4LF5I 3V7SA 5HLHA 4WCGA 1OR7A 4XNFA 2CV0A 4GKKI 4EGZA 1YE9A 1LJ9A 4BS9A 5M5XJ 5M5WJ 5CKTA 2JQ7A 3F3XA 3LL7A 2HPMA 1FJLA 3ZMDA 2CV2A 2DQLA 2A69F 2HQAA 4RM2A 1B4AA 1I3AA 3U21A 4DQ2A 2GM4A 2UUBH 1I94H 1GV5A 1R1VA 4DUZI 5GAHJ 4RPFA 3I0PA 2HXOA 4GFBA 2MA3A 1ZRCA 3P06A 4HEA2 1BC7C 4XLNF 3M7ND 5GAGJ 4DR1H 1LUJB 3QP5A 5HNHA 1WTJA 5FLMJ 4XRMA 1USVA 4JI1E 5E3MA 1R5HA 4E7ZA 5HDNA 1ETVA 2K85A 2NRAC 1WKMA 2VQLA 3GUDA 4I09A 3FHNA 1ZM3A 4BQAA 4J3DA 2RREA 1I1SA 4MU1A 4JI8E 4DYCA 3NWSA 1MMGA 4ZZLA 4CCNA 2NN6C 1WPKA 2LK2A 4C3HJ 2QBYA 4YIFA 5LMNI 1WJAA 1IBME 4PSXA 2V6EA 3F0CA 5D6FA 3S15J 4XLEA 3F23A 2LH9A 2Y69H 5F1JA 2DFHA 1HCRA 3M85D 4KHPI 3J7YJ 3GFIA 5HLGA 1HA8A 3WU4A 1U2WA 4EQQA 3LQRA 2R7ZJ 2E5LI 2ADUA 1ETKA 1IDYA 1X1PA 4DR4H 1R6MA 3FX3A 4NBQA 3RI4A 4DV3I 1UG8A 1P42A 2B9SA 4X66H 2QENA 1RESA 3I58A 2A2CA 1LVAA 3AG3H 1OFCX 2DODA 1MSFC 4WXDA 5F04A 4B8XA 2COMA 4LF9H 2VQFH 2DMUA 3CMAI 2R93J 1WH7A 2M4KA 2ZSHB 1AWCA 4HYMA 2K5CA 4Q4ZF 4OIQF 4EEFG 2DEJA 1QPIA 4JI5I 4ZTFA 4XONA 1BI3A 1G8XA 3PYFA 2BBYA 2K02A 3FXLA 5BR8E 3OOUA 1HKTA 1OYIA 4QPQA 3O2PE 1AU7A 3OWTA 3MVPA 5DYMA 2WB1A 2AHQA 1KQ8A 1X0AA 2ISYA 3KLOA 3S93A 1USSA 2OQGA 2W82A 1PP8F 1R4MB 2CUEA 3VFZA 3ASNH 2DT6A 4CXFA 4HZFA 1ZR2A 1WJCA 4BJTA 2JA9A 1ITYA 4BA1B 5ILVA 1B1BA 1P4XA 3GMEA 2P2RA 1WWXA 1NHAA 1X19A 2DK5A 4Y7NJ 5E1ZB 4BA2B 4DYQA 3GW2A 2X51A 4B43A 1FEXA 5ICCA 2PLYA 4FCYA 3H0GJ 2CGPA 2R42A 3S3OA 2MH9A 4Z6YA 2NVTJ 5LMUI 3S3MA 3HKZN 1J7KA 4EM2A 5IT9C 2DT5A 5J4YA 5C0XA 1E17A 2ZCWA 1TWAJ 3RYRA 2HH3A 1TT5B 1XS9A 4GCVA 1KU7A 5LRRA 1ZRDA 3ELKA 1R00A 4X62H 1E0EA 3F6VA 2GO3A 4LF8E 5TISC 2J5OA 3WU1B 2Z9OA 3GEZA 4PJMA 1JJ6C 4HF1A 2VQEE 4BA1I 3WODF 2JEBB 1MD0A 1X1DA 4GXOA 4BA2I 1Z0GA 2UUZA 4DV5E 4GKJI 1YG2A 1VI7A 1QO0D 1W36C 5C0XD 3ZXSA 3LA3A 1GVJA 1B8IB 2KMUA 2L4MA 5L3CA 3A01B 4EJUA 3GKUA 3V2UC 1YJ9I 1IDZA 2D1HA 4KMFA 3WTWC 1D5VA 4IXAA 3PIPF 2YPRA 2ZXHA 2OF7A 1W0TA 1XNQI 2CPMA 2KIMA 4LFCH 2BL5A 2X7IA 1TWFJ 4B3SH 2JEBI 5DM6F 4OCHA 3FXQA 1D8JA 2W84A 2Z16A 3CCJI 2PJPA 3CCUI 3WHCA 3HRMA 4CZCA 3PRYA 3NWTA 4FHTA 1R6RA 3F8MA 1CQTA 3ZM7A 2Q1ZB 3JREA 1BJZA 2R7TA 2R5ZA 1Z21A 4X0GA 5A2QZ 3WGIA 3QPTA 2K27A 1KKHA 4IJAA 4LF7H 4B3ME 4PFPA 1SFKA 4M3FA 2CFXA 3I3LA 4ZZDA 2ZBKB 3I4MJ 1O57A 5JEAB 3ZPLA 4LGWA 4Z7YA 1LQ1A 3QODA 4FW9A 1G3TA 4OAZA 2MG4A 5F0HA 4MQVA 4A69C 1ZQ3P 5IP9J 1QHGA 4I02A 3GO5A 1I6HJ 3P3EA 1LDDA 5CVUA 2V9PA 3CUQA 5H6RA 4JI8H 3GZ5A 1XGNA 3DEEA 1H9GA 2FQ4A 3MKWB 1D6TA 4L18B 4D5FA 3EPZA 1DTJA 4XKCA 4BA1A 4DUYI 3R0JA 1Z91A 2L01A 5KK1A 5K5RA 1JKOC 3OYGA 2A5YB 3S3NA 1S8NA 3R6SA 4B48A 3GTMJ 3VKEA 1TQMA 3V8JA 5FLXZ 5FROA 4OO1E 2CZ9A 3NAUA 5FKNA 1Z7UA 3HOVJ 4XQFA 3FKIJ 3M8FA 2ZJRF 2BZTA 4I6ZA 4V19K 1T0FC 3MKLA 4ZDLA 4HF2A 9ANTA 1SVOA 2M45A 2ICWG 3CDJA 5KVRA 5F08A 3RZDJ 3OYLA 3PS3A 2UUBI 2RN7A 3UHMA 4AD9A 1YX5A 1UHWA 2QZ8A 1BJAA 2P0WA 2RC4A 2XKOA 2LF7A 1T38A 3H3VK 3H5NA 2JEBA 3LTOA 4YY3H 2C38A 1NK2P 4U3BA 4JV5E 4G12A 1A31A 1KQ9A 1TTYA 2D2WA 4DR1I 3R60A 3N4MA 4FW6A 2H6BA 3L2VA 2CG4A 2JRTA 3IHUA 1IF1A 1YO5C 2W57A 2E34A 2Y2ZA 3ZGKA 1MDMB 2PJRB 1CF7A 1TW3A 4LF4E 1N34H 1XB4A 5JEAG 4NQWA 3OS2A 4JYAH 4M9XA 3Q6MA 4JI0E 2UUCE 1S72I 2EWNA 2HK3A 2V26A 4BACA 3CCLI 1OCCH 4DR6I 2FFMA 3ZQGA 4LCFA 3HOXJ 1B72A 2ME0A 3JRCA 2RQPA 3LSJA 4WWCA 3OYCA 5EGOA 2M3AA 1SD7A 4DR4I 1WVRA 1K78A 5D5XB 3DU6A 2PFBA 3TOAA 1B9MA 1IBLE 2PNZB 3OTOE 1ZTGA 1IRGA 3P3CA 3RDIA 1R5GA 3VPRA 4KFCA 2O9LA 3OYAA 4IQJA 4IRGA 3V7RA 2RNGA 1DGRM 1EJ9A 1OCPA 4FW5A 3DKWA 1D5YA 2VKVA 4CA0A 2ZBKA 3V5RA 2PQ8A 1Z0EA 2HKOA 2Z5CA 2O1UA 3NRVA 4WK8F 4G08A 2E1MC 4Y52J 3Q1QA 2EJRA 3FWEA 2MC3A 3LSMA 2R7XA 3GTJJ 4I98B 5D8LB 2O1VA 2L7FP 1ZYRF 3H4LA 3KRNA 2X6YA 2BV3A 1HW5A 2IERA 4DR7E 1NTCA 4ITVA 2M6QA 5IT9Q 1QQIA 2DFIA 3ABUA 3ZQCA 2IW5A 2IGOA 4P7AA 1V54H 2OZ6A 2HVRA 1OQYA 3P9KA 4BEHB 3WU5A 1H7SA 2AJ4A 2XF6A 4HSTA 3HC7A 3L7ZC 2E1OA 3OIPA 2CTFA 1NH3A 2V8PA 1HNZE 3FXKA 3FXRA 1FZPB 3SFIA 4X62I 1TWHJ 5EYRA 3N97A 1HC8A 2NXNB 2BA1G 2E5NA 4F7ZA 1UDNA 1LVKA 4HY1A 5GMEA 3CLQA 5JFRA 5JI6A 2DGRA 3LSIA 4OIOF 4B3MH 1RPWA 2E35A 3D5LA 2LF0A 3IP4B 1QBJA 4ASNA 3FKJA 4WX9A 2LBFA 4L5JA 4LG0A 3QRFF 1FKAH 1YW7A 4NXNH 3LSTA 4ZYAA 3E5XA 3IWZA 3BCAA 1KZHA 4DV2E 3G2BA 4Q47A 5EL9A 3LQQA 1MDMA 3C2BA 1V4RA 1VZ0A 3BT9A 2E2HJ 2VF3A 5GPAA 4CGZA 5K36F 1HQCA 2F5VA 4R79A 1X2MA 2A1SA 4LIUA 3RQ4A 3JRAA 5IYBJ 4QNJA 4UUSA 4Y33A 5DCFA 3MD2A 2X6XA 4MQYA 2ID3A 1Z77A 4ZYHA 4B3SI 4DGWB 1ZM2A 2UXBE 4OWRB 3T0YA 1T56A 1Z1DA 1YITI 3CD6I 3ZZ0A 3H9QA 4UB6C 3J81C 3QT6A 5J8FA 4MFDA 3HL2A 3KFWX 3SZGA 2E1MB 2K4BA 2VPLA 2KZVA 1H73A 3EZJA 4M74A 4BDYA 1XNRE 2HDWA 2WB1N 1M1EB 3K1PA 4AIMA 4G6DA 4YEJA 1D3YA 3CDHA 4EMSA 5FRMA 1JI8A 1D8KA 1MU5A 2CTJA 3BR6A 2ZC2A 2ELJA 1IN6A 2BA1D 5DRQA 1FLIA 4A3CJ 1HR0H 4OMYA 1VQLI 1IN5A 4RLFA 1WJEA 4RLQA 2K9QA 1LDKB 4AQYH 4V2GA 3T1YE 5FFZA 3KETA 3HRUA 5LEJA 3A0HC 4M71A 1J75A 2V1NA 2CPQA 2W24A 2JA6J 1N25A 2XAUA 3B73A 1N36H 2HOEA 5K36C 4JI1I 4L5IA 2V1XA 1XSDA 4DPXA 1G6NA 4XRSA 4JI8I 4ABZA 4OX9E 5DV5A 4LF4H 2NN6E 2Y31A 4XRFA 5ILUA 2ZM6E 2G8YA 1JT6A 1X1CA 3BR3A 1P92A 3HEFA 4A3GJ 2UUCH 5IP6A 3BROA 1IUFA 3MZ8A 5CQGA 3COAC 3TEDA 1ZN2A 3VYTB 2EZIA 3DTKA 1IO2A 3H9GA 2M34A 5AIPA 4A0XA 2HVSA 3HJCA 1ZXMA 2CQQA 1SANA 1MJ9A 5JHFA 4GKKH 5CJ9A 1BKNA 4F52A 2C6YA 1ONVA 3H5AA 2HKXA 1AKHA 2V9KA 3CTAA 2Y0MA 5DT9A 4E7JA 1OYPA 1J09A 4DV0E 1TLHB 4BQNA 3JTGA 2XHKA 2UWMA 2EINH 2J5PA 1JUPA 3FMQA 3G1OA 4G6QA 2IAIA 1PVEA 1Z5CA 1R36A 2CYYA 2DMQA 3WU0A 4AM3A 4DUZH 5E79C 2Q8KA 3V8KA 1XX5A 1I1GA 4PZJA 1HOMA 1KONA 3P9IA 5CQEA 1UG2A 4OAYA 1PUEE 1J59A 2WV0A 1Y5YA 2O4CA 3GR5A 1SMYF 2HR3A 2CTMA 1P4AA 3L2WA 2LD5A 4E70A 5BR8I 4YIIA 3UR3C 1XRHA 2P8TA 2VJ4A 5L3GA 4X64E 4RBOA 4DNCA 1XPXA 3VYSB 3PIOF 1JHFA 3G4SI 1FIAA 3WTTC 1S9HA 2YS9A 4DR7H 1Y0NA 4UVCA 5E8IA 2L2OA 3PYDA 5LMNH 3ABMH 3TO7A 2FBHA 3LSGA 3M1CA 4O5VA 4S05A 3CC4I 4RGRA 4Q48A 2I5UA 4KHPH 2DJNA 3ZZTA 2QSFX 2VL8A 2XRNA 3A4CA 2EPFA 4B09A 3WGGA 1PUFB 1Y60A 3JRHA 1USUA 1KVKA 4LFUA 2Z0SA 3C1DA 1I6UA 1KQ0A 2XSJC 3HRTA 4G7OF 1Y56A 5HS8A 3VYUB 3FHZA 1ZARA 3ABKH 4HV6A 2GO4A 1MZBA 4E4HA 3SQNA 5K7ZA 2ISZA 1P2FA 4EATA 4YFXF 4HDUA 4LF8I 4QIWN 1FSEA 2WAEA 5K7FA 2VQEI 5DRRA 1GDTA 3PO3J 2BE5F 4YFNF 3QYFA 1YFHA 3FAUA 4DV5I 2A3SA 3KIOA 2MLGA 2GS8A 1WHUA 4A0YA 3W6VA 4LLGF 4LD5A 2QCOA 4HAMA 2ZO4A 3U9GA 2HU9A 2UV1A 4ANJA 4DV2H 4IFDA 2EFOA 1R23A 2WW4A 2JT2A 4KISA 1FPQA 1MH3A 3A03A 2GQ0A 5D8KB 2STWA 4LCGA 2EZKA 4D7MA 2O1TA 3M07A 2M4GA 2IRFG 1N78A 3ZKBA 1N33E 3OV8A 2JMWA 1NK3P 3KZZA 1H89C 3CCRI 2L7KA 1FMWA 4LPFA 4II2A 3LOCA 1ZRFA 4H0EA 3I56I 1R49A 5B1AH 4LB5A 1QRYA 2OI2A 4DPWA 2YU3A 3RQIA 3GLXA 2E2JJ 1VFCA 3BOQA 1XGMA 1WGXA 4CUGA 1DPRA 4I01A 3RZOJ 5C0XF 4B3TE 1WI9A 3G73A 1QZYA 4N9HA 3J80C 4BQOA 1ZM9A 1O7LA 3E6BA 2CW8A 4B3MI 2BHZA 3HOZJ 3ZQQA 1HW2A 3PNYA 3IH2A 2UXCE 4UY8I 2EFQA 1B59A 2Y75A 3L2QA 4ZDPA 1IN4A 3KDKA 3CJRB 2QSHX 5DCMB 2A6TA 2DOAA 3D0SA 4OO1B 3QOEA 1IAWA 2HWVA 3WTSC 2KQRA 2CG9A 1H9TA 2XVCA 2L5QA 2DA2A 4HX8A 1S7OA 3QT5A 3BP8A 5EEAA 1FBSA 3M3YJ 2IT0A 1Z67A 1A6QA 4K0KE 2HK2A 4ZDOA 2Z5BA 2JUGA 4DV4E 1Z3XA 2DAOA 4OX9H 1K4TA 1BW5A 2MH2A 4A12A 4X65E 4ZYDA 1BR2A 1QHHD 1IGNA 5A2QC 1DP3A 2FOWA 1TNSA 2NOGA 4P52A 5HLTA 3OR2C 2PT7G 2XF5A 3PFYA 3SDBA 2CV1A 3QT7A 5J8CA 2D1VA 2WP8A 3Q6NA 2K40A 1R58A 2BW3A 5LGUA 2M7BA 2YUSA 4HLXA 2E7WA 3IRQA 2PMZA 1LNWA 3E6DA 3I9V2 1QZZA 5KAFC 3OYNA 5JHUA 1R9TJ 1VQKI 5C0XC 4LOMA 3AAFA 4DR5E 2BA0G 2IEKA 2CUJA 3CCQI 2WWYA 3DQVC 3KZIC 2HKJA 3HPGA 2QKMB 1OYRA 3HPHA 3OSGA 1B9NA 2QQBA 3S1MJ 2O3ZA 1V5FA 2W4SA 4PJJA 1NZ0A 4AQYI 1STZA 2LP0A 1ZZJA 1U5TB 3GTKJ 2DU9A 4JV5I 4ENNA 3VYRB 3DCFA 3K85A 4KT5C 1N36I 2E71A 2CWEA 3S1NJ 3SZPA 1IRXA 4JI7E 3F8FA 5E18F 4B1RA 5FLXC 3ZZUA 2VASA 4C3JJ 4LF4I 2M8GX 4PCQA 1V5EA 1H74A 1ETXA 5E3OA 3WE2A 3QOPA 4HXZA 4A5NA 4DR2E 3A2KA 4PJNA 4I0BA 2BA0A 4OO1G 3DBRB 4NHJA 2LKXA 2UUCI 1LFUP 4FW4A 2PNLA 2PO1B 1JKRC 2HFUA 3SDGA 4CYCA 2F4IA 2XB0X 1OYSA 3H35A 3D5SC 4A6DA 3KX2A 4HPQA 4XOPA 4IOAF 5BOXA 1GT0C 2FSWA 1IBLI 3OTOI 3QU3A 2H6CA 5E3NA 3ZQLA 2JVZA 1LKXA 3LAPA 4HF0A 1YX3A 3DKXA 3BJ6A 2R7DA 2BA0D 3J81K 4A3JJ 1UAAA 4A93J 2X1DA 4EJVA 1R71A 1IXSB 2ZB9A 2CTLA 2E36A 2QGUA 4XLFA 1QU3A 1TWCJ 3UOEA 1YIOA 4IHSA 1BA5A 2HFHA 1X1AA 4JYKA 2MLKA 5JLWA 2DJIA 3JCUC 3X2QH 1SFXA 4OO1A 4DIQA 1TQIA 3G6EI 4AWXB 3OSSD 2TRTA 5FWKA 3EYIA 5D4RA 2QSGX 4S0HB 4D1QA 3CUQC 3KP2A 4BY7J 3GTOJ 4O6JA 1ERDA 4DV6E 2NS8A 1I39A 3OYDA 2L9SA 2P6TA 1Z0VA 3BTCA 1ZR4A 2HOSA 1ZM4A 4DR7I 1S16A 1K61A 3B02A 1S03G 1XSVA 2R7QA 4Y17A 2V2VA 4OO1D 4PGHA 4DR6H 2VQGA 3DU5A 5KCMA 2V4JC 4U88A 3VB2A 2DYRH 3ZQFA 3IH3A 3RTRA 1N33H 4LFBE 2DFEA 1FP2A 3V8LA 2HGCA 3IC7A 2KRCA 1RRJA 3CF5F 3BY6A 1FYLA 5HDGA 4RAGA 2UXXA 1ZELA 2CQ7A 2ECCA 3A0BC 1HNZI 2ZMEA 2OAZA 3TBIA 1SD4A 4AIDA 2L54A 1Q1HA 2L9RA 2COBA 3FXOA 3OOPA 4HYEA 4LIVA 1F5TA 3J7AG 4NZRM 3Q0WA 1K6YA 1ZTRA 3KPHA 3BG6A 4R1FA 2XF7A 1DARA 3ZN0A 5HDKA 3CCVI 2PQUA 1QA6A 4N4OB 3M1EA 1U5TA 4FASD 3K4BA 2BM0A 3K69A 5FKOA 5F1RA 2X1CA 1GXQA 5M3MJ 4OKGA 3CO7C 4XLAA 2WNRB 1PQXA 4DV2I 1ORKA 1N77A 2LVSA 2O8XA 4FW3A 3MCZA 3ZN1A 3CCSI 4BDZA 2P5VA 2ANNA 2Y30A 1P4WA 1VQ8I 1Z59A 1XMXA 4I2OA 2QKLB 4A3MJ 2F4VE 4K0KH 3KLNA 1U2RA 3N05A 3EUAA 3PJRA 4XLPF 2AO9A 4R8HA 4YIRX 3D1NI 3M7GA 2HOAA 2UXBI 2PO1A 1YS6A 3CF2A 2R4GA 1K79A 3HM5A 1LE8B 3J80Q 1U9NA 2E1RA 3BQZA 1MBFA 3L9FA 1VTNC 1JUSA 3CMYA 4UUVA 5K1YA 2HFSA 3H9JA 1O3SA 1U3EM 2CQXA 2F48A 2RV8A 4BXXJ 1XNRI 2OPVA 2QQ9A 4KMUX 3L2CA 3HDDA 1YTYA 3HKMA 4WXHA 3JAMC 1VISA 2LREA 1H0MA 1G3WA 2NN6B 3ONQA 3ERED 4BBSJ 4OMZA 4KJZA 3S1QJ 3ZMSA 4ENJA 4AU7A 3OETA 3OY9A 3SYTA 4A3FJ 4A3EJ 3ZOBA 4EMDA 2CS3A 4N4NB 4UNOA 4DJAA 4IZKB 2E1CA 1X9ZA 2LF8A 4CCMA 5A2QQ 2JN6A 2CW7A 4HW0A 3BCBA 5K36E 3EDPA 3QYBA 4M3GA 2V7FA 4KT6A 5J47A 4JI6E 4DV1E 4RAFA 3D4JA 5HOOA 1MW7A 2XDVA 4F93B 2EIKH 1DP7P 4EC5A 4FETA 1PVGA 4OX9I 5LL6b 4R1HA 3OYKA 4IVNA 1BL0A 2AE8A 3IUOA 1OCOH 2W1OA 4AYBA 3RKQA 1HNXH 4KNYA 1ZH5A 3L2UA 4DR2H 2Z5UA 4M6YA 2BR2B 5D6EA 1TL8A 2G9WA 2C37B 2PY9A 1YRNB 1HKSA 1N32H 4HA8A 4JI4H 2PO2B 5B5EC 3CCYA 4EJTA 1ULYA 1W5SA 4L9TA 2VJJA 5EG0B 3E5UA 3E5QA 4ETSA 3KP4A 1FY7A 2RGVA 2O6GE 2HQNA 4HX4A 1TZLA 2TCTA 5FLXQ 2LY1A 3B82A 4EM1A 1EH6A 2IA2A 2HYGD 2VE9A 2DMNA 2H94A 2A07F 4CCKA 4LK1F 4MTEA 3I4NJ 3RF2A 3DWLE 1ZZIA 1T8IA 4FQGA 3SEZA 1R6LA 1U9OA 2OZUA 2KPMA 3DV8A 2NN6G 4JI1H 4E7KA 1KGSA 2NVYJ 3PM1A 3I0TA 5GPCA 5EKWA 4X64I 1FBQA 1I3QJ 3C7JA 2V1UA 2OJED 1IRZA 2CTEA 3J7AK 3B78A 4E7IA 2HOTA 1F43A 2QNDA 5IPAA 4MQ9F 5K5QA 4NDLA 1XDUA 3M8EA 3HOWJ 2L3DA 3BZKA 1IBMH 3HSRA 3TO6A 3KP5A 4BA2A 1TP4A 2R7OA 1LE8A 3OS0A 4RGXA 2IESA 1RI7A 1U0JA 2IGKA 2DOEA 4LFBH 3GFJA 1FYMA 2DEIA 3W2VA 3CWVA 1EA3A 2OA4A 2IS6A 3KYLA 3GFLA 1I50J 2PX9A 1RZ4A 3OS1A 4A0ZA 3HTSB 4QSHA 2KDOA 1ON1A 3LA7A 2O1WA 3BR1A 2EK5A 4CCJA 2NN6A 3GTLJ 1LEBA 4WF2A 4UV9A 2VE8A 4XL9A 2JVHA 5DD8A 2IS2A 4D7NA 3NCVA 2HVQA 4KDPA 3JSOA 4FW7A 1P7IA 1JTYA 3SHFA 1J4WA 2QF7A 5FFXA 2A68F 2HYJA 2WV1A 2M1BA 5FB2A 1MG7A 2M8WA 4KIFA 5BR8H 1B8IA 3WU2C 2P5LC 2PMZN 1XGOA 3AFHA 3V4GA 4JI3E 3A01A 4B8TA 2NN6D 1TBXA 2RAEA 2QA4I 3ZMUA 5IT3A 1HSJA 2EV0A 4H8AA 1GLNA 3LAJA 2UXNA 4RM3A 1RKTA 5FGMA 1FSHA 4C2UA 3S2WA 1AN7A 1MSZA 1O7FA 2GZWA 4D9JA 1RR8C 3ISPA 1DU6A 3CP2A 2C37A 2JSPA 1YRNA 3PSIA 3UNGC 4BY1J 4A3BJ 1PDNC 3WU3A 1DQUA 1N33I 1WJDA 4XR6A 3K70C 3K4LA 5IY5H 4M9ZA 3MKZA 3RPQA 1HW1A 3KP3A 3J81W 2ESHA 3VDXA 3OR1C 5EG0A 1YI2I 1MMNA 3PYEA 3IAM2 2VPRA 3K2AA 1TC3C 4B3TI 2GQQA 3QYEA 4DR3E 2HNHA 1UDQA 2FRHA 2BOLA 2IA0A 2VJ5A 3C2GA 4XLCA 4CCOA 2F4OB 4FWDA 1WJFA 1HNWE 4LF8H 2ZFWA 4X1EA 4ZC3A 4M3EA 4A2UA 5JEAA 4D5CA 2VQEH 1S7EA 1LPQA 2HDCA 2UXCI 2OUMA 2OU2A 5EDNA 2R3SA 3PNVA 1WFXA 4I99C 3WTZA 2W7NA 4DV5H 2IS4A 4U0YA 2PO0B 1IN7A 4I0AA 4AVPA 1UDOA 2XEXA 1IV6A 1PIEA 2DLLA 4LLNA 2M5WA 2NPFA 2KDZA 4P1WA 4LOCA 2ZKZA 3U1KA 1Z2IA 4FX4A 1AHDP 4LFAE 4IFDF 4IHYA 4AVZA 4LF6E 4K0KI 1IC8A 3L09A 5JEAD 4MU3A 1BOBA 1ZKGA 1FTZA 2XUBA 4YELA 5TGTA 1VQOI 4X65I 2VQHA 2R5YB 3JAMQ 1UG0A 2HI3A 3JR9A 4ZVIA 3BJAA 3CDIA 2CFOA 3QU6A 4UVAA 4RAYA 2XAQA 5HVQC 2JWTA 2UU9E 5C0XE 3HTUA 5L3DA 5D5WB 4NUBA 3LSRA 3H3ZA 1X3ZB 3U2RA 3FXMA 2MYSA 5KNLA 5TRDA 4BQQA 3DBHB 2JA5J 1MMSA 4DR5I 3DPUA 1ZGJA 4GRIA 4JG4A 3WGHA 2PBIA 2C39B 2R7VA 4M3DA 1FT9A 4IRHA 2LR8A 5FKLA 1W36D 1ZGAA 5DTDA 1HDDC 2E5LE 1IUYA 4F3QA 4IEJA 2XAGA 1K6OA 1WCMJ 2H09A 4HNVA 1X3UA 3MKYB 3MFKA 1K47A 2FXAA 2KIFA 4CSWA 1JGSA 5LFAA 4IHTA 1WHRA 1EH8A 4CZZA 3C18A 4IFDC 2PJRA 2VXDA 4PDKA 1TNTA 5LD2C 3DPLC 4JI7I 2QVOA 2TDXA 3CO6C 3OYJA 2K9MA 1HNXI 4II3A 5CPRB 2K86A 5C4JJ 4KA4A 4BXFA 3J7AO 1I6XA 4CO8A 4DR2I 2L7MP 4C2MJ 2FD5A 2GWRA 4IF4A 3CLOA 4LITA 5E17F 5IT9Z 1DUXC 2ME6A 1S7AA 3B6AA 3Q0UA 4HQMA 3TKYA 1N32I 1MJBA 4JI4I 4XK4A 1LFPA 4PSWA 4RGUA 3K1MA 4J00A 2FNPA 2E3UA 3L1PA 2CO5A 2KRHA 4RS8A 2PNZA 1PKPA 1KYWA 1XN7A 3KYCB 2DA6A 3AG1H 3K4JA 3I64A 2CUFA 3PUBA 3I59B 3L2RA 3E6MA 1JGGA 1VBIA 2W25A 4DPTA 2VESA 2Z5EA 1IV8A 4DU7A 4IKFA 2HTSA 1Z0TA 1U78A 3JRFA 1DU0A 5IT9K 2P4WA 2QLZA 1DT4A 1BBYA 4JV5H 2V79A 3L7ZB 2XGDA 3JAMK 2ZNZA 2ZJPF 2IJLA 2Y9YA 3K4KA 2OC6A 1UCRA 1VF9A 1S3JA 3RKWA 1VQ4I 2R7SA 5J1YA 1A5JA 4DV6I 5E1XA 2GBYA 5LHIA 2Z99A 2LY9A 1R7JA 3O6BB 1RREA 2DOFA 2P7CB 3EUKL 3P9CA 1IBMI 2HEOA 2R5YA 4JI0H 4HG2A 2Y9ZA 4GO1A 1HF0A 2UXDE 1MBJA 4U7DA 1NHJA 1OJ4A 4BEHA 4GKJE 4BE1A 2UUAE 2AQEA 1R1TA 2QQAA 4B3RE 2YU9J 1MMAA 3P76A 4LFBI 1UMQA 4XSZF 3K0LA 2M0MA 2KHMA 4BH9A 3KZYA 5GTHC 5JLXA 4MTDA 3BR5A 5GP9A 4A5MA 1IBLH 1NG6A 1Y39A 4OINF 2CGEA 3OTOH 1OLTA 1L0OC 1KTVA 4G6TB 4UV8A 5GTIC 3EETA 2P7VB 2XPUA 1ZAOA 4DR3H 4M1KA 4AYBN 2XC7A 1RHYA 2MW8A 4IZZA 4WALA 2F5EA 1IG7A 1IN8A 5L3FA 1HNWH 5CVRA 5EEHA 2CWHA 2VLAA 1YJNI 1UHSA 3DF8A 4ENMA 5ED4A 3J80W 2LDUA 3K9TA 3F21A 3W6JB 1FWLA 3HBLA 4IO9F 4DPUA 4XORA 3TO9A 5DNLA 3NQOA 1AOYA 3AKZA 4V2FA 3ECHA 2M30A 3BWGA 3OL3A 1RIOH 3TP0A 3AL0C 4UTGA 4Y13A 1XMOE 3FBNB 1ZG3A 3F8CA 4RMNA 1UZCA 3D5RC 5BPIA 1X1BA 1T2KA 3S2HJ 4DYRA 3VSKA 1FOWA 3CJQB 2NNNA 5HS9A 2F4VI 4QNKA 5GAEJ 3HGYA 3BG9A 3ZRGA 2KIUA 2DBBA 3TL4X 3FK7A 3VOEA 5IOZA 1ACIA 4WUCA 3B6CA 4YRVA 1QGPA 2Q2EB 1PP7U 1FTTA 1P9QC 2ZNYA 4S04A 2FF4A 4PFOA 1V3FA 1OR7C 2KISA 2NS7A 5K36B 2R3VA 2UU9H 1IBKE 3OIOA 1SMTA 4DW6A 4YHHE 1ZG1A 4XTJA 3Q9VA 3ZMVA 4L5EA 1HNZH 2OCCH 5H6QA 4PGGA 5F0CA 4Z2YA 3S14J 1IZ1A 3LFKA 5LHHA 1NXUA 2Y48A 2XRLA 3T5XA 4D0PA 3HHGA 3HSFA 3TDUC 1MJAA 3E3VA 2Z2SB 2WY7Q 4DV7E 3F6OA 3A02A 5IOYA 1VQMI 2M7AA 2O5RA 4LG3A 1N75A 1RETA 4P5OA 3OIQA 3WTYC 4NXME 4BBRJ 3BG7A 1CGPA 1UDSA 2LY2A 4AIJA 4EJWA 1MBKA 5M3FJ 4JI6I 4JI2E 4DV1I 4RB2C 1DDNA 2UUBE 1FP1D 1GXPA 1I94E 1MBGA 5E3LA 1X2NA 4HNUA 3B8HA 1U6GA 2H1LA 3LSKA 3GCMA 2ZXJA 4FWGA 3IAS2 1QNTA 2LNBA 3NEUA 4NC8A 4HDVA 2JE6B 1Y1VJ 3CJTB 3H36A 2IVMA 2UXBH 2X06A 1ETOA 3TGNA 4BAYA 2EFNA 4UT4A 2LFBA 4C2TA 5DDGA 4WANA 1NHIA 2X1EA 1FWZA 2XB5A 4RB0A 2ZMEC 1OYWA 2DPDA 4JVYA 1XNRH 4KQVA 3PUFA 4G8XA 1W1WE 3HUGB 3TMOA 3PQJA 1XSXA 2XAJA 3V42A 4DBQA 1VQ5I 1ZG5A 1WJ5A 1FX7A 2CRGA 2JEAB 2LLKA 2MC4A 3BG5A 4XSXF 5K36G 2IGMA 1GUUA 2K4JA 2FEZA 3IV5A 1UFMA 4FT8A 3T1YH 3HG9A 1TT0A 2FE3A 1ETYA 2VBYA 3E7LA 3Q3SA 4M72A 4X66E 2JZXA 3TQNA 1FYKA 2JSCA 4YG2F 2BVMA 1SFUA 4QTRA 4F91B 3P3GA 1BIBA 2EIJH 4LF9E 2VQFE 4BHCA 1Y8RB 2RVCA 1KU9A 1FNNA 2X85A 3OYBA 1Y6IA 1A04A 1ZHFA 2RDPA 4IQ4A 4NNJA 5FLVA 2ZM6H 2VOPA 3MQ0A 3W6KB 5ICGA 1FNMA 2JEAI 1YYVA 1E3HA 2XAHA 4A3IJ 3G1MA 2GXBA 4LIJA 3SFZA 5GMDA 1PUFA 3HXLA 1Z9CA 2DFFA 1VQNI 4I3HA 2KT0A 4C3IJ 5LRSA 1OMIA 3FBIB 5D5UB 2MGQA 2LTPA 4ZH4F 2FPHX 3RKYA 2LJPA 4DV0H 2QBYB 2H27A 3DLAA 3HOUJ 1XTAA 5K5OA 5FKKA 3OYMA 2OPTA 4CCLA 1O3RA 2GLOA 2Z3YA 5K36D 3Q5FA 2ETHA 2F5CA 4BGDA 3PL8A 2R0QC 3KDGA 2JPBA 2OD5A 2FX0A 1XMQE 1B63A 2DDAA 2B0LA 4LK0F 3ZP5A 4CH7A 2QYOA 3IKTA 4X64H 4U0WA 3J81Z 4YFKF 5DRPA 4JVHA 1HDPA 1XMOH 3FXUA 3JRDA 1KA8A 2CUZA 1SAUA 3CDLA 3MZHA 4JI0I 2IPQX 4B4CA 1VNDA 2M8EA 1FWKA 2HHHE 3BR2A 3M7NG 3DP7A 2W00A 3BTJA 3O8HA 4JK1X 2HH2A 5CYVA 5CVVA 3K1JA 5DNXA 3GFMA 1D1BA 1ON2A 2VIXA 1LEAA 1O4XA 1POGA 4USMA 1N0VC 1SD5A 1MBHA 4I7HA 1ENHA 2VQCA 2FJ1A 5LHGA 1U8RA 3FDYA 3ULQB 4OD6A 2HPIA 2WAFA 4UVBA 5TJJA 1QVTA 2VOOA 4G9YA 4YHHH 1IBKH 4A3KJ 2OBPA 1X4OA 4Y15A 1F36A 2M9HA 2GOXB 2DYSH 2WA0A 3HUGA 4K2EA 4P9FA 4LFCE 1REPC 5IT9W 4DR3I 3K7AJ 5K7HA 1J5YA 1F1ZA 3M85G 1EH7A 1EF4A 1YLFA 2EZLA 2JEAA 1HNWI 1GHCA 3JAMW 1DPUA 4P9UA 4DV7H 4JP0A 1RR7A 2O03A 2I8DA 5DCMA 1W5TA 5B1BH 4A3LJ 3AEVB 2G0EA 1A36A 5DS9A 4OU0A 1P7JA 2A05A 2QQ8A 2OPUA 4NXMH 1B6AA 2ECBA 3JTHA 3FMRA 3ZQHA 2NNYA 1HBXG 4B8CD 1VIGA 5C0XB 3PFIA 2FNAA 1WH5A 2W85A 4LF7E 4JI2H 2PEXA 1T95A 1USTA 3DKYA 4LFAI 4OIPF 1J9IA 4LF6I 4E7HA 1T33A 1E2XA 4KITB 3M6AA 1ODHA 5C44J 4LLLA 2DQRA 2YSRA 2A5WA 4MIMA 3J7ZI 2KZGA 3ECOA 3T8TA 3GBGA 2X6WA 2X36A 3W2WA 4XKVA 2UZKA 2UU9I 2IOQA 3F22A 2M2EA 3A1YA 3QPHA 1C0WA 4MEYF 3PS1A 4RB3C 4IS9A 3K4MA 4J19A 4KYWA 4BE0A 2P6SA 2CQNA 3BTLA 3EQLF 5ICFA 3JSPA 3OYIA 1XD7A 3GTQJ 4B3TH 2L4AA 1UB9A 1NG7A 2HZTA 1Z05A 2GA1A 2IBDA 5BQTA 4UXNA 2HYFA 1J5KA 1OYYA 2LC2A 4AC0A 1Y6ZA 3S8PA 2UXCH 5JEAF 2FMRA 4E9JA 2VBXA 4ESBA 2OTJI 1HLVA 2K3PA 2WTEA 4IHVA 1APLC 1V55H 2DA5A 3DTEA 2JPCA 4IFDE 2R5ZB 1QZRA 1W7PB 2PMHA 4BHPA 3CMMA 3H1CA 2WAQA 3O3KA 1H8AC 3K17A 4YY3E 4ESJA 1UEKA 1ETWA 4DV4H 4JX6A 5ICEA 4MU0A 2VB6A 2FOKA 4X65H 3I5UA 4CYDA 1Z6RA 2X6OA 2E19A 1B62A 1J5EE 3VEPA 5C0XG 1V8CA 2K3FA 3VSLA 1HK7A 2LYCA 5DROA 3LSPA 2LOOA 3CZ6A 2HQ5A 3V69A 4KICA 1W5CC 4M6VA 4FX0A 2VN2A 4NB5A 3KEYA 1N34E 1QZEA 5LGNA 2L9VA 2EV5A 3CUQB 4USKA 2BXYA 5EZGA 2IGNA 1MBEA 2WC2A 2Z33A 3HOYJ 4JYAE 4DR5H 1K1GA 1K83J 3LPSA 3I55I 1OISA 3CP8A 3T8RA 2VBZA 2O61A 1N0UA 5E1WA 3S2DJ 5F6FA 5JEAC 3U1YA 3J7AM 2DN0A 2IS1A 2VI6A 1JHHA 3MZYA 3FF5A 3OYFA 1Y1WJ 3T1YI 3H5RA 4N9IA 4HBLA 5EZHA 3EUHA 4ISAA 1A6FA 2ZSIB 3WHBA 3U1DA 1R1UA 3E97A 2DDBA 5DD4A 5CVIA 4XICA 4HLYA 4P55A 5FKMA 1JKPC 1XMQH 4E7LA 1Y4UA 5F64A 2JRMA 4EVIA 2STTA 3GTPJ 3F72A 3I53A 3W2AA 4GQUA 2LRRA 4JI7H 2GOMA 3DEUA 4TV7A 1MNMC 3QP6A 4IOCF 1QPMA 2BGCA 2A61A 3ZQIA 4BHBA 2ZM6I 1BR4A 2ZJ2A 3CCMI 5BNGA 1SFOJ 1H88C 2BM1A 2C38B 2UXDI 3RJPA 2JA8J 2HHHH 4HACB 2UUAI 1JTXA 2QWWA 2Z1DA 5FRNA 2FA5A 4M73A 4B3RI 2FQ3A 3BPVA 3J80Z 2EZHA 3HZJA 3CESA 3K2ZA 2BHYA 3TW6A 4KIBA 1MNEA 2V1DA 1CF7B 4M9SA 4DXLA 4UB8C 2R92J 1ZLKA 1X4PA 1YQAA 4NQWB 4UHTA 3PQKA 4DV0I 3CJNA 1P6RA 3HOSA 2JJ7A 3NARA 3GX4X 3GLLA 4Y3OA 2FU4A 1B72B 3LMMA 2JK3A 2XIGA 5EGOB 1KIJA 1X58A 3T1HE 2XSDC 3F9KA 1K78B 4IRIA 4L9NA 4E7SA 2DA7A 1X4NA 4L0ZB 2WNRA 2NAZA 3DLLF 3GZNB 1D1CA 1XMAA 1DGWY 1W7PA 2EQRA 2HQRA 4FISA 3J80K 1G4DA 1Y4SA 3H92A 1BI2A 4E6KG 3CUOA 3SZTA 3PNTA 2IXSA 2GXGA 1Z6TA 2X0LA 1XMOI 2ID6A 4DV6H 5KAIC 4WUBA 2GIZA 3SXYA 3OSFA 1I5ZA 2CJJA 3GXOA 2R7UA 2Z5CB 1R22A 1FKAE 1ZZKA 3JRIA 2GA2A 4NXNE 4KN4X 4O3MA 1W7PD 2KLOA 5AONA 3P5JA 2GAUA 2EFGA 4QLCU 1T08B 2LG4A 4QMFB 1FOYA 2DW4A 2JA2A 2R7FA 2L7ZA 4BE2A 4YHHI 1IBKI 5A2QK 2F5FA 5C4XJ 2G7UA 4JOMA 1YOVB 3RSNA 3F8NA 4U7BA 3F8BA 1XCBA 2VKHA 3KE2A 4ZYEA 3SJMA 2O8KA 4GYGA 2PMUA 2E2IJ 3TP3A 4DV7I 4IZKA 4QPOA 1G3SA 3S32A 3LNUA 4PRXA 1JE8A 2OTLI 1WZ2A 4NXMI 2AQFA 4HRIA 2X48A 2DTZA 2V6CA 5IWAE 1IRFA 1D1AA 3WU6A 4XN0A 1OJLA 4JI2I 2BY1A 2MBFA 2HS5A 5L3EA 1HR0E 4ENKA 4PDBA 4P96A 1I94I 2BY3A 3RKXA 2F4VH 2VJIA 3C3WA 4XBFA 4AQYE 5C3EJ 5LGTA 1G3YA 2LSOA 2BR2A 1SD6A 2AXTC 1WUUA 4HACA 4RB1A 3CC2I 1J5EH 1X3WB 4J01A 1N36E 1YW8A 2DO7A 2LBFB 1SAXA 4LG0B 1ZREA 5FLXK 2PO2A 5L3JA 1FJGE 5J1RA 1ETQA 1OKRA 2A6EF 4HSRA 2JZYA 2D9IA 1Y0UA 2FBKA 3DXJF 2QEXI 2V2ZA 3BDDA 2V34A 4MEXF 2E7XA 4MYUA 3FMSA 2FBIA 4XLHA 3REOA 3BZCA 1JXSA 1H7UA 1MGTA 4UUSB 5EF6A 3SEQA 5M5YJ 2MJHA 3KEOA 4ZTJA 1W0UA 3QD7X 2H1KA 2XAFA 3R4KA 2E60A 2PG4A 3IRRA 4HX7A 2VKCA 3BZ6A 3LSHA 2XGXA 5ILSA 1RUOA 1YH8A 3QT8A 4FE4A 2L02A 3GZ6A 4LF5E 1G2HA 1ELOA 3W3CA 2NOJB 1ZGWA 4GKKE 4GDFA 3ZKDA 2ELKA 3S17J 3FISA 4XIDA 4X66I 2O0YA 3ABLH 1U8BA 4IZJB 4XKBA 1PJRA 5IYDJ 2KFDA 4DBRA 4JI6H 5F27A 2XPWA 2ACJA 2CW0F 4DV1H 1AA7A 2HTJA 3HRSA 2XASA 4DU8A 4LF9I 3MWMA 2VQFI 1SFEA 1ZK8A 4DV4I 4MDTA 2VONA 4DUZE 2BY0A 4Q5SF 3HHHA 3M8JA 2JVGA 1MKMA 1BOAA 1MNDA 2H8WA 3H0DA 1L3LA 2E5ZA 1FC3A 1J0RA 2FMYA 5J3LA 3E1SA 3QPSA 3PS2A 5ELWA 1T6SA 2JTVA 3GYHX 1KYZA 1BIAA 1FIPA 3ABTA 4MLOA 4M3BA 1XHKA 4WUDA 1Z0BA 3QQAA 2CMPA 4C9YA 3NZKA 3WTXC 5BS6A 2PNMA 2K9LA 2WADA 3BR0A 3PO2J 2YQRA 4AUXA 5LMNE 2MSYA 3ESWB 3QPLA 2LTLA 2Y0SA 4FJSA 3QAHA 3GVAA 2JT1A 4JX4A 2ZXIA 3E6CC 4KHPE 2O7OA 4L9JA 4W1UA 2XGEA 4BNCA 2LKSA 2V2QA 1Z0XA 2VKDA 1XG1A 4CDGA 3GONA 2XGCA 4IHXA 4IL6C 1FOXA 4PUSA 2KP6A 1Z3YA 5EJCA 4DV3E 1JUMA 3AG4H 3E0JB 3T1HH 2DTRA 2VXZA 3S1RJ 1AKHB 1XMQI 1BI0A 2KJBA 3ERMA 2MD0A 2MABA 3LNQA 1IJWC 4LB6B 2EIMH 1PYVA 3G3ZA 2X4HA 2NVQJ 5JVGF 4PJ0C 5EEGA 4ON0A 4FN5A 2ELHA 2XROA 2LRDA 3RIRA 3LFUA 1KU3A 2VUMJ 4JI5E 3HULA 1XMKA 2HXIA 4RA2A 2HHHI 5ERIA 1YW9A 1LB2A 1RKWA 2VT2A 1GV2A 4MYTA 4EM0B 1JT0A 6PAXA 1SVLA 2YX4A 3CQZJ 3JAMZ 5DUIA 2MFZA 2NVXJ 1O3TA 3K4NA 1EKEA 3FXJA 4WXCA 3DD6A 1IXRC 3K10A 3JRBA 1UHMA 2G7HA 1MMDA 3K1NA 2NS0A 3ZR8X 2WAQN 4LFCI 2VT3A 3LA2A 3KP7A 1G59A 4PJLA 3CC7I 2HKEA 1WJBA 3DFGA 1XXEA 2P81A 3K4CA 4OZEA 5B3SH 4XRSG 1I27A 3OYHA 3M4OJ 5LMUE 3G71I 2LTMA 4XN3A 2PO0A 2F4MB 2X9DA 4A3DJ 4IZJA 2R7RA 5IWAH 2YX7A 3Q9SA 1T0FA 4HV5A 1WI3A 1Z5BA 4JI3H 4LF7I 5IP7J 4OIRF 1NHHA 2W48A 2NYXA 2DA4A 4KUMA 3SB1A 5CVJA 2DK8A 4QWQA 3ZCOA 4FWHA 1E3OC 1EV7A 1FMVA 2ESNA 1ZXNA 4GYIA 1IW7F 5CLSA 2ZQEA 4BL0B 4IZJD 3L00A 3FM3A 1WQ2A 2F5DA 5B66C 4L9VA 4BXUA 4PU9A 2PN6A 1FJGH 4RDUA 1Z0CA 3WTVC 3BPXA 2OV7A 1HSTA 4IFDB 4HNTA 3BJOA 1K4SA 2KIQA 1MIJA 4JX5A 4MU4A 4ESFA 2DMTA 4RGSA 3ZQ7A 3G1LA 1XNQE 2VC1A 5LEKA 4BJ6C 1BR1A 2C39A 1EC6A 5HNFA 3HIFA 2DA1A 2RQQA 3BTIA 3P7NA 4UUTA 5L3BA 2KL4A 1D0ZA 2XV4S 3HSEA 4ZYGA 3ROUA 2L9NA 2XKPA 1ODDA 3VWBA 2AXYA 2EA4A 5FO5A 2F1DA 4LF5H 3O8GA 1WE8A 5BMZA 2Y3MA 1MH4A 3DBLB 4OO1F 2ZXWH 3I71A 2EV6A 2F6CA 1Y8QB 4DPYA 4W97A 3WE3A 2M0CA 1A6IA 2MD5A 1OCZH 3M9AA 4JQFA 3RPUA 5HODA 4LFAH 3R61A 4LF6H 3OMYA 5J40A 1YS7A 2PI0A 3IH4A 4YY3I 2KJCA 2D5VA 5D4SA
chains in the Genus database with same CATH topology
3V69A 1R6MA 1WVNA 3M7NG 4NBQA 1UDSA 5C0XF 3KRNA 2HH2A 4OO1A 1K1GA 5JEAB 2BR2B 1DT4A 2JVZA 2C37B 2PY9A 3GCMA 3L7ZB 5JEAC 1UDQA 1OYPA 2JE6B 2PO2B 3H36A 1X4MA 4OO1B 5JEAE 5JEAA 3L7ZC 2CTFA 3DD6A 4OO1D 2BR2A 3M85G 1E3PA 4WANA 4AM3A 4IFDG 2WP8B 1DTJA 4BA1A 2JEAA 4OO1C 3L7ZA 2PO0B 1UDOA 2JE6A 2PO2A 1KHMA 4JVYA 2BA1G 2CTMA 3AEVB 3VKEA 1UDNA 4OO1E 3U1KA 2DGRA 4IFDF 2OPUA 1ZZIA 4AIDA 2C38B 5JEAD 1VIGA 5C0XB 2JA9A 2WP8A 4BA1B 2JEAB 3GMEA 1R6LA 2ANRA 2P2RA 5K36G 2PO0A 2NN6G 4BA2B 2MJHA 3CDJA 3CDIA 5C0XC 2PQUA 2CTKA 2JZXA 2CTEA 2BA0G 2JEBA 3B4TA 2QNDA 2C38A 5K36F 4WALA 1OYRA 2NN6F 5C0XE 5C0XA 2HH3A 2WNRB 4BA2A 2Z0SA 2ANNA 1ZZJA 3GLLA 4BA1I 2JEAI 2C39B 2JEBB 1E3HA 4LIJA 4BA2I 2JE6I 5JEAG 1X4NA 2WNRA 4IFDB 2PO1A 5C0XD 1VIHA 1TUAA 2NN6A 4IFDD 4AIMA 1J5KA 2C39A 5JEAF 4IFDC 2CTJA 2FMRA 1EC6A 1WHUA 2BA0A 2BA1D 4OO1G 3M7ND 2OPVA 4IFDA 2PO1B 4IFDE 1J4WA 3HKMA 2PNZB 2BL5A 2AXYA 1ZTGA 5K36B 1ZZKA 2JEBI 2NN6B 1WE8A 2YQRA 3H1CA 1OYSA 5K36D 2CPQA 4OO1F 4B8TA 2NN6D 5K36C 2NN6C 4QMFB 2E3UA 2BA0D 2PNZA 5C0XG 5K36E 5K36A 3M85D 2NN6E 2CTLA 4JVHA 2C37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V69 A;  1R6M A;  1WVN A;  3M7N G;  4NBQ A;  1UDS A;  5C0X F;  3KRN A;  2HH2 A;  4OO1 A;  1K1G A;  5JEA B;  2BR2 B;  1DT4 A;  2JVZ A;  2C37 B;  2PY9 A;  3GCM A;  3L7Z B;  5JEA C;  1UDQ A;  1OYP A;  2JE6 B;  2PO2 B;  3H36 A;  1X4M A;  4OO1 B;  5JEA E;  5JEA A;  3L7Z C;  2CTF A;  3DD6 A;  4OO1 D;  2BR2 A;  3M85 G;  1E3P A;  4WAN A;  4AM3 A;  4IFD G;  2WP8 B;  1DTJ A;  4BA1 A;  2JEA A;  4OO1 C;  3L7Z A;  2PO0 B;  1UDO A;  2JE6 A;  2PO2 A;  1KHM A;  4JVY A;  2BA1 G;  2CTM A;  3AEV B;  3VKE A;  1UDN A;  4OO1 E;  3U1K A;  2DGR A;  4IFD F;  2OPU A;  1ZZI A;  4AID A;  2C38 B;  5JEA D;  1VIG A;  5C0X B;  2JA9 A;  2WP8 A;  4BA1 B;  2JEA B;  3GME A;  1R6L A;  2ANR A;  2P2R A;  5K36 G;  2PO0 A;  2NN6 G;  4BA2 B;  2MJH A;  3CDJ A;  3CDI A;  5C0X C;  2PQU A;  2CTK A;  2JZX A;  2CTE A;  2BA0 G;  2JEB A;  3B4T A;  2QND A;  2C38 A;  5K36 F;  4WAL A;  1OYR A;  2NN6 F;  5C0X E;  5C0X A;  2HH3 A;  2WNR B;  4BA2 A;  2Z0S A;  2ANN A;  1ZZJ A;  3GLL A;  4BA1 I;  2JEA I;  2C39 B;  2JEB B;  1E3H A;  4LIJ A;  4BA2 I;  2JE6 I;  5JEA G;  1X4N A;  2WNR A;  4IFD B;  2PO1 A;  5C0X D;  1VIH A;  1TUA A;  2NN6 A;  4IFD D;  4AIM A;  1J5K A;  2C39 A;  5JEA F;  4IFD C;  2CTJ A;  2FMR A;  1EC6 A;  1WHU A;  2BA0 A;  2BA1 D;  4OO1 G;  3M7N D;  2OPV A;  4IFD A;  2PO1 B;  4IFD E;  1J4W A;  3HKM A;  2PNZ B;  2BL5 A;  2AXY A;  1ZTG A;  5K36 B;  1ZZK A;  2JEB I;  2NN6 B;  1WE8 A;  2YQR A;  3H1C A;  1OYS A;  5K36 D;  2CPQ A;  4OO1 F;  4B8T A;  2NN6 D;  5K36 C;  2NN6 C;  4QMF B;  2E3U A;  2BA0 D;  2PNZ A;  5C0X G;  5K36 E;  5K36 A;  3M85 D;  2NN6 E;  2CTL A;  4JVH A;  2C37 A; 
#chains in the Genus database with same CATH topology
 1XCV A;  4XMY A;  3K70 D;  4G94 A;  3GAB A;  3MAJ A;  1J5E I;  2K1H A;  4F92 B;  1R4N B;  1WVN A;  1R5I D;  1FBU A;  4CHU A;  4FE7 A;  3ZMT A;  2QUF A;  1JKQ C;  5A2Q W;  4MO7 A;  2BYV E;  4Y4R A;  3HKZ A;  2EBI A;  1FI4 A;  3GF2 A;  5AIQ A;  4KN7 X;  3RPU D;  1KU2 A;  5F0F A;  1N34 I;  2H8R A;  2WY8 Q;  4U0V A;  3CME I;  1YJW I;  5LLQ A;  1EI1 A;  4I76 A;  2DT7 B;  4JYA I;  3JW4 A;  3I59 A;  2Z5B B;  4DUY E;  5FJ8 J;  5H20 A;  2K7L A;  4XOT A;  5DUK A;  4BKX A;  5JEA E;  1RUN A;  3LWF A;  1BN5 A;  3MEX A;  5DEQ A;  2WP8 B;  5HLI A;  3OYE A;  2E5L H;  1WRJ A;  4IFD G;  4XKW A;  4OO1 C;  2BW3 B;  2EH3 A;  2J7K A;  3L7Z A;  2AS5 F;  4A6E A;  3IWF A;  4B44 A;  4IX7 A;  3RYP A;  1Z5A A;  4DV3 H;  3TW7 A;  3BQY A;  3EYY A;  3OL4 A;  5E8G A;  3WG9 A;  3KYD B;  3AG2 H;  4DZP A;  2CU7 A;  2VBW A;  3UKG A;  1SEU A;  4BU2 A;  2ANR A;  2I10 A;  1YHC A;  1SVM A;  4B47 A;  5FLX W;  1HKQ A;  3K6G A;  3GTG J;  1W4M A;  4X6A J;  4DR1 E;  4JI5 H;  3HJE A;  1BC8 C;  1XDS A;  3HYI A;  4BUP A;  1TW2 A;  4NC6 A;  4FTH A;  2M87 A;  2CVE A;  1GVD A;  3TOB A;  3B4T A;  1YIJ I;  5BPD A;  5D5V B;  5H2F C;  1TWG J;  4JBA A;  5J4V A;  1MSE C;  4IHW A;  3HB9 A;  4B3A A;  4G7Z F;  1T98 A;  2AXL A;  1RC9 A;  4ZJZ A;  3AL0 B;  3IKV A;  1OCR H;  2BY2 A;  2V9V A;  4MHG A;  3RCO A;  1SC7 A;  1IXC A;  3H3U A;  2IOP A;  4DOZ A;  3L7W A;  1S4E A;  2B63 J;  2BEO A;  4U87 A;  5E20 A;  1RNL A;  4KIG A;  3DEW A;  3FZV A;  5LBQ A;  2A6H F;  4DR6 E;  2HZD A;  2DA3 A;  2F2E A;  2P5K A;  3ML6 A;  4OOI A;  4C30 A;  2JE6 I;  4FJU A;  5J6X A;  3WTU C;  4BYY A;  1U5T C;  3CCE I;  4M6X A;  4DR4 E;  1TUA A;  2DI3 A;  3C2H A;  1VIH A;  4PK4 A;  2BV6 A;  4EGY A;  3T1B A;  4IFD D;  4CYC B;  3T1H I;  5LMU H;  5JVT A;  1OPC A;  2VC0 A;  2FUG 2;  4AIH A;  3MN2 A;  2EFW A;  3V7C A;  4RAZ A;  5J1U A;  1D0Y A;  5FD5 A;  2QM3 A;  2YR2 A;  1VQ9 I;  2DCE A;  4ED4 A;  2NVU B;  4HQE A;  2J65 A;  1BI1 A;  1V9N A;  3KP6 A;  5LL6 R;  3FK6 A;  2ZIT A;  4N3O A;  1FOK A;  3J7A Y;  2EIL H;  1S6L A;  1VQ7 I;  2Q0O A;  2A2D A;  4LJZ F;  3VOD A;  5IYC J;  2HDD A;  3MMY B;  1S29 A;  2Q2E A;  1H72 C;  1Z0W A;  2UXD H;  2LMD A;  4GKJ H;  4MFE A;  3I54 A;  1UJ8 A;  2XPV A;  2UUA H;  4NXN I;  5JR3 A;  2K9S A;  1BW6 A;  3TDZ C;  1VI0 A;  5GAD J;  3J81 Q;  4B3R H;  1Z7L A;  5K36 A;  2OCE A;  1YHQ I;  2KRF A;  3DPT A;  4B3X A;  2E1N A;  3WG7 H;  4U3D A;  2BVL A;  2ZFU A;  3DTI A;  1WSU A;  4H4K C;  1LDJ A;  3IL2 A;  1A35 A;  2RNJ A;  4EJO A;  2L0K A;  3Q0V A;  4AIK A;  1XNQ H;  2K9N A;  2EB7 A;  1XGS A;  3ZMZ A;  1HXD A;  3HGG A;  3S16 J;  4URL A;  1V5G A;  2IA1 A;  3KEQ A;  4LCH A;  2LKP A;  1K7A A;  3BLY A;  3R0A A;  2CSO A;  2O3F A;  5HS7 A;  1UEL B;  2EFP A;  2KKO A;  3EUH C;  1EA6 A;  2DXI A;  3GWZ A;  4PRV A;  2D45 A;  1F9N A;  2CH0 A;  1RR9 A;  1X4M A;  1MX0 A;  3QWL A;  4X62 E;  4IPA A;  1LFB A;  4DZJ A;  5IWA I;  2ZME B;  1D0X A;  2IP2 A;  3KCC A;  5FD6 A;  2JA7 J;  4JI3 I;  4MGR A;  1XC5 A;  1E3P A;  2N8G A;  4LMY A;  3HOT A;  2DMP A;  1SEI A;  4NZT M;  3BC8 A;  2Y0S N;  1HR0 I;  1BM9 A;  1VQP I;  1QVU A;  2B7E A;  1F4K A;  2JE6 A;  3BG3 A;  2ZJQ F;  3ASO H;  1KHM A;  2GIV A;  1J2X A;  1ZLJ A;  2WBM A;  2GXA A;  5KHD A;  3FM5 A;  2RKH A;  1S20 A;  4BJ5 C;  3JRG A;  4MNU A;  4NC7 A;  2DPU A;  3PYG A;  1FJG I;  4XM3 A;  2JUC A;  3F0N A;  1TQP A;  1S5L C;  4Z7C A;  2OQR A;  1T39 A;  2VOD A;  2CWF A;  4EV0 A;  1Q1V A;  4F55 A;  1HNX E;  2CTK A;  4CIC A;  4B3S E;  1VQ6 I;  2CQK A;  4N0B A;  2R7W A;  2EA2 A;  1F0X A;  4DUY H;  2NN6 F;  3I4P A;  4GGG A;  2VKE A;  4G7H F;  1JJ8 C;  1N32 E;  2FML A;  3FIW A;  1OCT C;  1O3Q A;  5DM7 F;  4JI4 E;  3PSF A;  4HOB A;  4L0Y B;  2BXZ A;  4LF5 I;  3V7S A;  5HLH A;  4WCG A;  1OR7 A;  4XNF A;  2CV0 A;  4GKK I;  4EGZ A;  1YE9 A;  1LJ9 A;  4BS9 A;  5M5X J;  5M5W J;  5CKT A;  2JQ7 A;  3F3X A;  3LL7 A;  2HPM A;  1FJL A;  3ZMD A;  2CV2 A;  2DQL A;  2A69 F;  2HQA A;  4RM2 A;  1B4A A;  1I3A A;  3U21 A;  4DQ2 A;  2GM4 A;  2UUB H;  1I94 H;  1GV5 A;  1R1V A;  4DUZ I;  5GAH J;  4RPF A;  3I0P A;  2HXO A;  4GFB A;  2MA3 A;  1ZRC A;  3P06 A;  4HEA 2;  1BC7 C;  4XLN F;  3M7N D;  5GAG J;  4DR1 H;  1LUJ B;  3QP5 A;  5HNH A;  1WTJ A;  5FLM J;  4XRM A;  1USV A;  4JI1 E;  5E3M A;  1R5H A;  4E7Z A;  5HDN A;  1ETV A;  2K85 A;  2NRA C;  1WKM A;  2VQL A;  3GUD A;  4I09 A;  3FHN A;  1ZM3 A;  4BQA A;  4J3D A;  2RRE A;  1I1S A;  4MU1 A;  4JI8 E;  4DYC A;  3NWS A;  1MMG A;  4ZZL A;  4CCN A;  2NN6 C;  1WPK A;  2LK2 A;  4C3H J;  2QBY A;  4YIF A;  5LMN I;  1WJA A;  1IBM E;  4PSX A;  2V6E A;  3F0C A;  5D6F A;  3S15 J;  4XLE A;  3F23 A;  2LH9 A;  2Y69 H;  5F1J A;  2DFH A;  1HCR A;  3M85 D;  4KHP I;  3J7Y J;  3GFI A;  5HLG A;  1HA8 A;  3WU4 A;  1U2W A;  4EQQ A;  3LQR A;  2R7Z J;  2E5L I;  2ADU A;  1ETK A;  1IDY A;  1X1P A;  4DR4 H;  1R6M A;  3FX3 A;  4NBQ A;  3RI4 A;  4DV3 I;  1UG8 A;  1P42 A;  2B9S A;  4X66 H;  2QEN A;  1RES A;  3I58 A;  2A2C A;  1LVA A;  3AG3 H;  1OFC X;  2DOD A;  1MSF C;  4WXD A;  5F04 A;  4B8X A;  2COM A;  4LF9 H;  2VQF H;  2DMU A;  3CMA I;  2R93 J;  1WH7 A;  2M4K A;  2ZSH B;  1AWC A;  4HYM A;  2K5C A;  4Q4Z F;  4OIQ F;  4EEF G;  2DEJ A;  1QPI A;  4JI5 I;  4ZTF A;  4XON A;  1BI3 A;  1G8X A;  3PYF A;  2BBY A;  2K02 A;  3FXL A;  5BR8 E;  3OOU A;  1HKT A;  1OYI A;  4QPQ A;  3O2P E;  1AU7 A;  3OWT A;  3MVP A;  5DYM A;  2WB1 A;  2AHQ A;  1KQ8 A;  1X0A A;  2ISY A;  3KLO A;  3S93 A;  1USS A;  2OQG A;  2W82 A;  1PP8 F;  1R4M B;  2CUE A;  3VFZ A;  3ASN H;  2DT6 A;  4CXF A;  4HZF A;  1ZR2 A;  1WJC A;  4BJT A;  2JA9 A;  1ITY A;  4BA1 B;  5ILV A;  1B1B A;  1P4X A;  3GME A;  2P2R A;  1WWX A;  1NHA A;  1X19 A;  2DK5 A;  4Y7N J;  5E1Z B;  4BA2 B;  4DYQ A;  3GW2 A;  2X51 A;  4B43 A;  1FEX A;  5ICC A;  2PLY A;  4FCY A;  3H0G J;  2CGP A;  2R42 A;  3S3O A;  2MH9 A;  4Z6Y A;  2NVT J;  5LMU I;  3S3M A;  3HKZ N;  1J7K A;  4EM2 A;  5IT9 C;  2DT5 A;  5J4Y A;  5C0X A;  1E17 A;  2ZCW A;  1TWA J;  3RYR A;  2HH3 A;  1TT5 B;  1XS9 A;  4GCV A;  1KU7 A;  5LRR A;  1ZRD A;  3ELK A;  1R00 A;  4X62 H;  1E0E A;  3F6V A;  2GO3 A;  4LF8 E;  5TIS C;  2J5O A;  3WU1 B;  2Z9O A;  3GEZ A;  4PJM A;  1JJ6 C;  4HF1 A;  2VQE E;  4BA1 I;  3WOD F;  2JEB B;  1MD0 A;  1X1D A;  4GXO A;  4BA2 I;  1Z0G A;  2UUZ A;  4DV5 E;  4GKJ I;  1YG2 A;  1VI7 A;  1QO0 D;  1W36 C;  5C0X D;  3ZXS A;  3LA3 A;  1GVJ A;  1B8I B;  2KMU A;  2L4M A;  5L3C A;  3A01 B;  4EJU A;  3GKU A;  3V2U C;  1YJ9 I;  1IDZ A;  2D1H A;  4KMF A;  3WTW C;  1D5V A;  4IXA A;  3PIP F;  2YPR A;  2ZXH A;  2OF7 A;  1W0T A;  1XNQ I;  2CPM A;  2KIM A;  4LFC H;  2BL5 A;  2X7I A;  1TWF J;  4B3S H;  2JEB I;  5DM6 F;  4OCH A;  3FXQ A;  1D8J A;  2W84 A;  2Z16 A;  3CCJ I;  2PJP A;  3CCU I;  3WHC A;  3HRM A;  4CZC A;  3PRY A;  3NWT A;  4FHT A;  1R6R A;  3F8M A;  1CQT A;  3ZM7 A;  2Q1Z B;  3JRE A;  1BJZ A;  2R7T A;  2R5Z A;  1Z21 A;  4X0G A;  5A2Q Z;  3WGI A;  3QPT A;  2K27 A;  1KKH A;  4IJA A;  4LF7 H;  4B3M E;  4PFP A;  1SFK A;  4M3F A;  2CFX A;  3I3L A;  4ZZD A;  2ZBK B;  3I4M J;  1O57 A;  5JEA B;  3ZPL A;  4LGW A;  4Z7Y A;  1LQ1 A;  3QOD A;  4FW9 A;  1G3T A;  4OAZ A;  2MG4 A;  5F0H A;  4MQV A;  4A69 C;  1ZQ3 P;  5IP9 J;  1QHG A;  4I02 A;  3GO5 A;  1I6H J;  3P3E A;  1LDD A;  5CVU A;  2V9P A;  3CUQ A;  5H6R A;  4JI8 H;  3GZ5 A;  1XGN A;  3DEE A;  1H9G A;  2FQ4 A;  3MKW B;  1D6T A;  4L18 B;  4D5F A;  3EPZ A;  1DTJ A;  4XKC A;  4BA1 A;  4DUY I;  3R0J A;  1Z91 A;  2L01 A;  5KK1 A;  5K5R A;  1JKO C;  3OYG A;  2A5Y B;  3S3N A;  1S8N A;  3R6S A;  4B48 A;  3GTM J;  3VKE A;  1TQM A;  3V8J A;  5FLX Z;  5FRO A;  4OO1 E;  2CZ9 A;  3NAU A;  5FKN A;  1Z7U A;  3HOV J;  4XQF A;  3FKI J;  3M8F A;  2ZJR F;  2BZT A;  4I6Z A;  4V19 K;  1T0F C;  3MKL A;  4ZDL A;  4HF2 A;  9ANT A;  1SVO A;  2M45 A;  2ICW G;  3CDJ A;  5KVR A;  5F08 A;  3RZD J;  3OYL A;  3PS3 A;  2UUB I;  2RN7 A;  3UHM A;  4AD9 A;  1YX5 A;  1UHW A;  2QZ8 A;  1BJA A;  2P0W A;  2RC4 A;  2XKO A;  2LF7 A;  1T38 A;  3H3V K;  3H5N A;  2JEB A;  3LTO A;  4YY3 H;  2C38 A;  1NK2 P;  4U3B A;  4JV5 E;  4G12 A;  1A31 A;  1KQ9 A;  1TTY A;  2D2W A;  4DR1 I;  3R60 A;  3N4M A;  4FW6 A;  2H6B A;  3L2V A;  2CG4 A;  2JRT A;  3IHU A;  1IF1 A;  1YO5 C;  2W57 A;  2E34 A;  2Y2Z A;  3ZGK A;  1MDM B;  2PJR B;  1CF7 A;  1TW3 A;  4LF4 E;  1N34 H;  1XB4 A;  5JEA G;  4NQW A;  3OS2 A;  4JYA H;  4M9X A;  3Q6M A;  4JI0 E;  2UUC E;  1S72 I;  2EWN A;  2HK3 A;  2V26 A;  4BAC A;  3CCL I;  1OCC H;  4DR6 I;  2FFM A;  3ZQG A;  4LCF A;  3HOX J;  1B72 A;  2ME0 A;  3JRC A;  2RQP A;  3LSJ A;  4WWC A;  3OYC A;  5EGO A;  2M3A A;  1SD7 A;  4DR4 I;  1WVR A;  1K78 A;  5D5X B;  3DU6 A;  2PFB A;  3TOA A;  1B9M A;  1IBL E;  2PNZ B;  3OTO E;  1ZTG A;  1IRG A;  3P3C A;  3RDI A;  1R5G A;  3VPR A;  4KFC A;  2O9L A;  3OYA A;  4IQJ A;  4IRG A;  3V7R A;  2RNG A;  1DGR M;  1EJ9 A;  1OCP A;  4FW5 A;  3DKW A;  1D5Y A;  2VKV A;  4CA0 A;  2ZBK A;  3V5R A;  2PQ8 A;  1Z0E A;  2HKO A;  2Z5C A;  2O1U A;  3NRV A;  4WK8 F;  4G08 A;  2E1M C;  4Y52 J;  3Q1Q A;  2EJR A;  3FWE A;  2MC3 A;  3LSM A;  2R7X A;  3GTJ J;  4I98 B;  5D8L B;  2O1V A;  2L7F P;  1ZYR F;  3H4L A;  3KRN A;  2X6Y A;  2BV3 A;  1HW5 A;  2IER A;  4DR7 E;  1NTC A;  4ITV A;  2M6Q A;  5IT9 Q;  1QQI A;  2DFI A;  3ABU A;  3ZQC A;  2IW5 A;  2IGO A;  4P7A A;  1V54 H;  2OZ6 A;  2HVR A;  1OQY A;  3P9K A;  4BEH B;  3WU5 A;  1H7S A;  2AJ4 A;  2XF6 A;  4HST A;  3HC7 A;  3L7Z C;  2E1O A;  3OIP A;  2CTF A;  1NH3 A;  2V8P A;  1HNZ E;  3FXK A;  3FXR A;  1FZP B;  3SFI A;  4X62 I;  1TWH J;  5EYR A;  3N97 A;  1HC8 A;  2NXN B;  2BA1 G;  2E5N A;  4F7Z A;  1UDN A;  1LVK A;  4HY1 A;  5GME A;  3CLQ A;  5JFR A;  5JI6 A;  2DGR A;  3LSI A;  4OIO F;  4B3M H;  1RPW A;  2E35 A;  3D5L A;  2LF0 A;  3IP4 B;  1QBJ A;  4ASN A;  3FKJ A;  4WX9 A;  2LBF A;  4L5J A;  4LG0 A;  3QRF F;  1FKA H;  1YW7 A;  4NXN H;  3LST A;  4ZYA A;  3E5X A;  3IWZ A;  3BCA A;  1KZH A;  4DV2 E;  3G2B A;  4Q47 A;  5EL9 A;  3LQQ A;  1MDM A;  3C2B A;  1V4R A;  1VZ0 A;  3BT9 A;  2E2H J;  2VF3 A;  5GPA A;  4CGZ A;  5K36 F;  1HQC A;  2F5V A;  4R79 A;  1X2M A;  2A1S A;  4LIU A;  3RQ4 A;  3JRA A;  5IYB J;  4QNJ A;  4UUS A;  4Y33 A;  5DCF A;  3MD2 A;  2X6X A;  4MQY A;  2ID3 A;  1Z77 A;  4ZYH A;  4B3S I;  4DGW B;  1ZM2 A;  2UXB E;  4OWR B;  3T0Y A;  1T56 A;  1Z1D A;  1YIT I;  3CD6 I;  3ZZ0 A;  3H9Q A;  4UB6 C;  3J81 C;  3QT6 A;  5J8F A;  4MFD A;  3HL2 A;  3KFW X;  3SZG A;  2E1M B;  2K4B A;  2VPL A;  2KZV A;  1H73 A;  3EZJ A;  4M74 A;  4BDY A;  1XNR E;  2HDW A;  2WB1 N;  1M1E B;  3K1P A;  4AIM A;  4G6D A;  4YEJ A;  1D3Y A;  3CDH A;  4EMS A;  5FRM A;  1JI8 A;  1D8K A;  1MU5 A;  2CTJ A;  3BR6 A;  2ZC2 A;  2ELJ A;  1IN6 A;  2BA1 D;  5DRQ A;  1FLI A;  4A3C J;  1HR0 H;  4OMY A;  1VQL I;  1IN5 A;  4RLF A;  1WJE A;  4RLQ A;  2K9Q A;  1LDK B;  4AQY H;  4V2G A;  3T1Y E;  5FFZ A;  3KET A;  3HRU A;  5LEJ A;  3A0H C;  4M71 A;  1J75 A;  2V1N A;  2CPQ A;  2W24 A;  2JA6 J;  1N25 A;  2XAU A;  3B73 A;  1N36 H;  2HOE A;  5K36 C;  4JI1 I;  4L5I A;  2V1X A;  1XSD A;  4DPX A;  1G6N A;  4XRS A;  4JI8 I;  4ABZ A;  4OX9 E;  5DV5 A;  4LF4 H;  2NN6 E;  2Y31 A;  4XRF A;  5ILU A;  2ZM6 E;  2G8Y A;  1JT6 A;  1X1C A;  3BR3 A;  1P92 A;  3HEF A;  4A3G J;  2UUC H;  5IP6 A;  3BRO A;  1IUF A;  3MZ8 A;  5CQG A;  3COA C;  3TED A;  1ZN2 A;  3VYT B;  2EZI A;  3DTK A;  1IO2 A;  3H9G A;  2M34 A;  5AIP A;  4A0X A;  2HVS A;  3HJC A;  1ZXM A;  2CQQ A;  1SAN A;  1MJ9 A;  5JHF A;  4GKK H;  5CJ9 A;  1BKN A;  4F52 A;  2C6Y A;  1ONV A;  3H5A A;  2HKX A;  1AKH A;  2V9K A;  3CTA A;  2Y0M A;  5DT9 A;  4E7J A;  1OYP A;  1J09 A;  4DV0 E;  1TLH B;  4BQN A;  3JTG A;  2XHK A;  2UWM A;  2EIN H;  2J5P A;  1JUP A;  3FMQ A;  3G1O A;  4G6Q A;  2IAI A;  1PVE A;  1Z5C A;  1R36 A;  2CYY A;  2DMQ A;  3WU0 A;  4AM3 A;  4DUZ H;  5E79 C;  2Q8K A;  3V8K A;  1XX5 A;  1I1G A;  4PZJ A;  1HOM A;  1KON A;  3P9I A;  5CQE A;  1UG2 A;  4OAY A;  1PUE E;  1J59 A;  2WV0 A;  1Y5Y A;  2O4C A;  3GR5 A;  1SMY F;  2HR3 A;  2CTM A;  1P4A A;  3L2W A;  2LD5 A;  4E70 A;  5BR8 I;  4YII A;  3UR3 C;  1XRH A;  2P8T A;  2VJ4 A;  5L3G A;  4X64 E;  4RBO A;  4DNC A;  1XPX A;  3VYS B;  3PIO F;  1JHF A;  3G4S I;  1FIA A;  3WTT C;  1S9H A;  2YS9 A;  4DR7 H;  1Y0N A;  4UVC A;  5E8I A;  2L2O A;  3PYD A;  5LMN H;  3ABM H;  3TO7 A;  2FBH A;  3LSG A;  3M1C A;  4O5V A;  4S05 A;  3CC4 I;  4RGR A;  4Q48 A;  2I5U A;  4KHP H;  2DJN A;  3ZZT A;  2QSF X;  2VL8 A;  2XRN A;  3A4C A;  2EPF A;  4B09 A;  3WGG A;  1PUF B;  1Y60 A;  3JRH A;  1USU A;  1KVK A;  4LFU A;  2Z0S A;  3C1D A;  1I6U A;  1KQ0 A;  2XSJ C;  3HRT A;  4G7O F;  1Y56 A;  5HS8 A;  3VYU B;  3FHZ A;  1ZAR A;  3ABK H;  4HV6 A;  2GO4 A;  1MZB A;  4E4H A;  3SQN A;  5K7Z A;  2ISZ A;  1P2F A;  4EAT A;  4YFX F;  4HDU A;  4LF8 I;  4QIW N;  1FSE A;  2WAE A;  5K7F A;  2VQE I;  5DRR A;  1GDT A;  3PO3 J;  2BE5 F;  4YFN F;  3QYF A;  1YFH A;  3FAU A;  4DV5 I;  2A3S A;  3KIO A;  2MLG A;  2GS8 A;  1WHU A;  4A0Y A;  3W6V A;  4LLG F;  4LD5 A;  2QCO A;  4HAM A;  2ZO4 A;  3U9G A;  2HU9 A;  2UV1 A;  4ANJ A;  4DV2 H;  4IFD A;  2EFO A;  1R23 A;  2WW4 A;  2JT2 A;  4KIS A;  1FPQ A;  1MH3 A;  3A03 A;  2GQ0 A;  5D8K B;  2STW A;  4LCG A;  2EZK A;  4D7M A;  2O1T A;  3M07 A;  2M4G A;  2IRF G;  1N78 A;  3ZKB A;  1N33 E;  3OV8 A;  2JMW A;  1NK3 P;  3KZZ A;  1H89 C;  3CCR I;  2L7K A;  1FMW A;  4LPF A;  4II2 A;  3LOC A;  1ZRF A;  4H0E A;  3I56 I;  1R49 A;  5B1A H;  4LB5 A;  1QRY A;  2OI2 A;  4DPW A;  2YU3 A;  3RQI A;  3GLX A;  2E2J J;  1VFC A;  3BOQ A;  1XGM A;  1WGX A;  4CUG A;  1DPR A;  4I01 A;  3RZO J;  5C0X F;  4B3T E;  1WI9 A;  3G73 A;  1QZY A;  4N9H A;  3J80 C;  4BQO A;  1ZM9 A;  1O7L A;  3E6B A;  2CW8 A;  4B3M I;  2BHZ A;  3HOZ J;  3ZQQ A;  1HW2 A;  3PNY A;  3IH2 A;  2UXC E;  4UY8 I;  2EFQ A;  1B59 A;  2Y75 A;  3L2Q A;  4ZDP A;  1IN4 A;  3KDK A;  3CJR B;  2QSH X;  5DCM B;  2A6T A;  2DOA A;  3D0S A;  4OO1 B;  3QOE A;  1IAW A;  2HWV A;  3WTS C;  2KQR A;  2CG9 A;  1H9T A;  2XVC A;  2L5Q A;  2DA2 A;  4HX8 A;  1S7O A;  3QT5 A;  3BP8 A;  5EEA A;  1FBS A;  3M3Y J;  2IT0 A;  1Z67 A;  1A6Q A;  4K0K E;  2HK2 A;  4ZDO A;  2Z5B A;  2JUG A;  4DV4 E;  1Z3X A;  2DAO A;  4OX9 H;  1K4T A;  1BW5 A;  2MH2 A;  4A12 A;  4X65 E;  4ZYD A;  1BR2 A;  1QHH D;  1IGN A;  5A2Q C;  1DP3 A;  2FOW A;  1TNS A;  2NOG A;  4P52 A;  5HLT A;  3OR2 C;  2PT7 G;  2XF5 A;  3PFY A;  3SDB A;  2CV1 A;  3QT7 A;  5J8C A;  2D1V A;  2WP8 A;  3Q6N A;  2K40 A;  1R58 A;  2BW3 A;  5LGU A;  2M7B A;  2YUS A;  4HLX A;  2E7W A;  3IRQ A;  2PMZ A;  1LNW A;  3E6D A;  3I9V 2;  1QZZ A;  5KAF C;  3OYN A;  5JHU A;  1R9T J;  1VQK I;  5C0X C;  4LOM A;  3AAF A;  4DR5 E;  2BA0 G;  2IEK A;  2CUJ A;  3CCQ I;  2WWY A;  3DQV C;  3KZI C;  2HKJ A;  3HPG A;  2QKM B;  1OYR A;  3HPH A;  3OSG A;  1B9N A;  2QQB A;  3S1M J;  2O3Z A;  1V5F A;  2W4S A;  4PJJ A;  1NZ0 A;  4AQY I;  1STZ A;  2LP0 A;  1ZZJ A;  1U5T B;  3GTK J;  2DU9 A;  4JV5 I;  4ENN A;  3VYR B;  3DCF A;  3K85 A;  4KT5 C;  1N36 I;  2E71 A;  2CWE A;  3S1N J;  3SZP A;  1IRX A;  4JI7 E;  3F8F A;  5E18 F;  4B1R A;  5FLX C;  3ZZU A;  2VAS A;  4C3J J;  4LF4 I;  2M8G X;  4PCQ A;  1V5E A;  1H74 A;  1ETX A;  5E3O A;  3WE2 A;  3QOP A;  4HXZ A;  4A5N A;  4DR2 E;  3A2K A;  4PJN A;  4I0B A;  2BA0 A;  4OO1 G;  3DBR B;  4NHJ A;  2LKX A;  2UUC I;  1LFU P;  4FW4 A;  2PNL A;  2PO1 B;  1JKR C;  2HFU A;  3SDG A;  4CYC A;  2F4I A;  2XB0 X;  1OYS A;  3H35 A;  3D5S C;  4A6D A;  3KX2 A;  4HPQ A;  4XOP A;  4IOA F;  5BOX A;  1GT0 C;  2FSW A;  1IBL I;  3OTO I;  3QU3 A;  2H6C A;  5E3N A;  3ZQL A;  2JVZ A;  1LKX A;  3LAP A;  4HF0 A;  1YX3 A;  3DKX A;  3BJ6 A;  2R7D A;  2BA0 D;  3J81 K;  4A3J J;  1UAA A;  4A93 J;  2X1D A;  4EJV A;  1R71 A;  1IXS B;  2ZB9 A;  2CTL A;  2E36 A;  2QGU A;  4XLF A;  1QU3 A;  1TWC J;  3UOE A;  1YIO A;  4IHS A;  1BA5 A;  2HFH A;  1X1A A;  4JYK A;  2MLK A;  5JLW A;  2DJI A;  3JCU C;  3X2Q H;  1SFX A;  4OO1 A;  4DIQ A;  1TQI A;  3G6E I;  4AWX B;  3OSS D;  2TRT A;  5FWK A;  3EYI A;  5D4R A;  2QSG X;  4S0H B;  4D1Q A;  3CUQ C;  3KP2 A;  4BY7 J;  3GTO J;  4O6J A;  1ERD A;  4DV6 E;  2NS8 A;  1I39 A;  3OYD A;  2L9S A;  2P6T A;  1Z0V A;  3BTC A;  1ZR4 A;  2HOS A;  1ZM4 A;  4DR7 I;  1S16 A;  1K61 A;  3B02 A;  1S03 G;  1XSV A;  2R7Q A;  4Y17 A;  2V2V A;  4OO1 D;  4PGH A;  4DR6 H;  2VQG A;  3DU5 A;  5KCM A;  2V4J C;  4U88 A;  3VB2 A;  2DYR H;  3ZQF A;  3IH3 A;  3RTR A;  1N33 H;  4LFB E;  2DFE A;  1FP2 A;  3V8L A;  2HGC A;  3IC7 A;  2KRC A;  1RRJ A;  3CF5 F;  3BY6 A;  1FYL A;  5HDG A;  4RAG A;  2UXX A;  1ZEL A;  2CQ7 A;  2ECC A;  3A0B C;  1HNZ I;  2ZME A;  2OAZ A;  3TBI A;  1SD4 A;  4AID A;  2L54 A;  1Q1H A;  2L9R A;  2COB A;  3FXO A;  3OOP A;  4HYE A;  4LIV A;  1F5T A;  3J7A G;  4NZR M;  3Q0W A;  1K6Y A;  1ZTR A;  3KPH A;  3BG6 A;  4R1F A;  2XF7 A;  1DAR A;  3ZN0 A;  5HDK A;  3CCV I;  2PQU A;  1QA6 A;  4N4O B;  3M1E A;  1U5T A;  4FAS D;  3K4B A;  2BM0 A;  3K69 A;  5FKO A;  5F1R A;  2X1C A;  1GXQ A;  5M3M J;  4OKG A;  3CO7 C;  4XLA A;  2WNR B;  1PQX A;  4DV2 I;  1ORK A;  1N77 A;  2LVS A;  2O8X A;  4FW3 A;  3MCZ A;  3ZN1 A;  3CCS I;  4BDZ A;  2P5V A;  2ANN A;  2Y30 A;  1P4W A;  1VQ8 I;  1Z59 A;  1XMX A;  4I2O A;  2QKL B;  4A3M J;  2F4V E;  4K0K H;  3KLN A;  1U2R A;  3N05 A;  3EUA A;  3PJR A;  4XLP F;  2AO9 A;  4R8H A;  4YIR X;  3D1N I;  3M7G A;  2HOA A;  2UXB I;  2PO1 A;  1YS6 A;  3CF2 A;  2R4G A;  1K79 A;  3HM5 A;  1LE8 B;  3J80 Q;  1U9N A;  2E1R A;  3BQZ A;  1MBF A;  3L9F A;  1VTN C;  1JUS A;  3CMY A;  4UUV A;  5K1Y A;  2HFS A;  3H9J A;  1O3S A;  1U3E M;  2CQX A;  2F48 A;  2RV8 A;  4BXX J;  1XNR I;  2OPV A;  2QQ9 A;  4KMU X;  3L2C A;  3HDD A;  1YTY A;  3HKM A;  4WXH A;  3JAM C;  1VIS A;  2LRE A;  1H0M A;  1G3W A;  2NN6 B;  3ONQ A;  3ERE D;  4BBS J;  4OMZ A;  4KJZ A;  3S1Q J;  3ZMS A;  4ENJ A;  4AU7 A;  3OET A;  3OY9 A;  3SYT A;  4A3F J;  4A3E J;  3ZOB A;  4EMD A;  2CS3 A;  4N4N B;  4UNO A;  4DJA A;  4IZK B;  2E1C A;  1X9Z A;  2LF8 A;  4CCM A;  5A2Q Q;  2JN6 A;  2CW7 A;  4HW0 A;  3BCB A;  5K36 E;  3EDP A;  3QYB A;  4M3G A;  2V7F A;  4KT6 A;  5J47 A;  4JI6 E;  4DV1 E;  4RAF A;  3D4J A;  5HOO A;  1MW7 A;  2XDV A;  4F93 B;  2EIK H;  1DP7 P;  4EC5 A;  4FET A;  1PVG A;  4OX9 I;  5LL6 b;  4R1H A;  3OYK A;  4IVN A;  1BL0 A;  2AE8 A;  3IUO A;  1OCO H;  2W1O A;  4AYB A;  3RKQ A;  1HNX H;  4KNY A;  1ZH5 A;  3L2U A;  4DR2 H;  2Z5U A;  4M6Y A;  2BR2 B;  5D6E A;  1TL8 A;  2G9W A;  2C37 B;  2PY9 A;  1YRN B;  1HKS A;  1N32 H;  4HA8 A;  4JI4 H;  2PO2 B;  5B5E C;  3CCY A;  4EJT A;  1ULY A;  1W5S A;  4L9T A;  2VJJ A;  5EG0 B;  3E5U A;  3E5Q A;  4ETS A;  3KP4 A;  1FY7 A;  2RGV A;  2O6G E;  2HQN A;  4HX4 A;  1TZL A;  2TCT A;  5FLX Q;  2LY1 A;  3B82 A;  4EM1 A;  1EH6 A;  2IA2 A;  2HYG D;  2VE9 A;  2DMN A;  2H94 A;  2A07 F;  4CCK A;  4LK1 F;  4MTE A;  3I4N J;  3RF2 A;  3DWL E;  1ZZI A;  1T8I A;  4FQG A;  3SEZ A;  1R6L A;  1U9O A;  2OZU A;  2KPM A;  3DV8 A;  2NN6 G;  4JI1 H;  4E7K A;  1KGS A;  2NVY J;  3PM1 A;  3I0T A;  5GPC A;  5EKW A;  4X64 I;  1FBQ A;  1I3Q J;  3C7J A;  2V1U A;  2OJE D;  1IRZ A;  2CTE A;  3J7A K;  3B78 A;  4E7I A;  2HOT A;  1F43 A;  2QND A;  5IPA A;  4MQ9 F;  5K5Q A;  4NDL A;  1XDU A;  3M8E A;  3HOW J;  2L3D A;  3BZK A;  1IBM H;  3HSR A;  3TO6 A;  3KP5 A;  4BA2 A;  1TP4 A;  2R7O A;  1LE8 A;  3OS0 A;  4RGX A;  2IES A;  1RI7 A;  1U0J A;  2IGK A;  2DOE A;  4LFB H;  3GFJ A;  1FYM A;  2DEI A;  3W2V A;  3CWV A;  1EA3 A;  2OA4 A;  2IS6 A;  3KYL A;  3GFL A;  1I50 J;  2PX9 A;  1RZ4 A;  3OS1 A;  4A0Z A;  3HTS B;  4QSH A;  2KDO A;  1ON1 A;  3LA7 A;  2O1W A;  3BR1 A;  2EK5 A;  4CCJ A;  2NN6 A;  3GTL J;  1LEB A;  4WF2 A;  4UV9 A;  2VE8 A;  4XL9 A;  2JVH A;  5DD8 A;  2IS2 A;  4D7N A;  3NCV A;  2HVQ A;  4KDP A;  3JSO A;  4FW7 A;  1P7I A;  1JTY A;  3SHF A;  1J4W A;  2QF7 A;  5FFX A;  2A68 F;  2HYJ A;  2WV1 A;  2M1B A;  5FB2 A;  1MG7 A;  2M8W A;  4KIF A;  5BR8 H;  1B8I A;  3WU2 C;  2P5L C;  2PMZ N;  1XGO A;  3AFH A;  3V4G A;  4JI3 E;  3A01 A;  4B8T A;  2NN6 D;  1TBX A;  2RAE A;  2QA4 I;  3ZMU A;  5IT3 A;  1HSJ A;  2EV0 A;  4H8A A;  1GLN A;  3LAJ A;  2UXN A;  4RM3 A;  1RKT A;  5FGM A;  1FSH A;  4C2U A;  3S2W A;  1AN7 A;  1MSZ A;  1O7F A;  2GZW A;  4D9J A;  1RR8 C;  3ISP A;  1DU6 A;  3CP2 A;  2C37 A;  2JSP A;  1YRN A;  3PSI A;  3UNG C;  4BY1 J;  4A3B J;  1PDN C;  3WU3 A;  1DQU A;  1N33 I;  1WJD A;  4XR6 A;  3K70 C;  3K4L A;  5IY5 H;  4M9Z A;  3MKZ A;  3RPQ A;  1HW1 A;  3KP3 A;  3J81 W;  2ESH A;  3VDX A;  3OR1 C;  5EG0 A;  1YI2 I;  1MMN A;  3PYE A;  3IAM 2;  2VPR A;  3K2A A;  1TC3 C;  4B3T I;  2GQQ A;  3QYE A;  4DR3 E;  2HNH A;  1UDQ A;  2FRH A;  2BOL A;  2IA0 A;  2VJ5 A;  3C2G A;  4XLC A;  4CCO A;  2F4O B;  4FWD A;  1WJF A;  1HNW E;  4LF8 H;  2ZFW A;  4X1E A;  4ZC3 A;  4M3E A;  4A2U A;  5JEA A;  4D5C A;  2VQE H;  1S7E A;  1LPQ A;  2HDC A;  2UXC I;  2OUM A;  2OU2 A;  5EDN A;  2R3S A;  3PNV A;  1WFX A;  4I99 C;  3WTZ A;  2W7N A;  4DV5 H;  2IS4 A;  4U0Y A;  2PO0 B;  1IN7 A;  4I0A A;  4AVP A;  1UDO A;  2XEX A;  1IV6 A;  1PIE A;  2DLL A;  4LLN A;  2M5W A;  2NPF A;  2KDZ A;  4P1W A;  4LOC A;  2ZKZ A;  3U1K A;  1Z2I A;  4FX4 A;  1AHD P;  4LFA E;  4IFD F;  4IHY A;  4AVZ A;  4LF6 E;  4K0K I;  1IC8 A;  3L09 A;  5JEA D;  4MU3 A;  1BOB A;  1ZKG A;  1FTZ A;  2XUB A;  4YEL A;  5TGT A;  1VQO I;  4X65 I;  2VQH A;  2R5Y B;  3JAM Q;  1UG0 A;  2HI3 A;  3JR9 A;  4ZVI A;  3BJA A;  3CDI A;  2CFO A;  3QU6 A;  4UVA A;  4RAY A;  2XAQ A;  5HVQ C;  2JWT A;  2UU9 E;  5C0X E;  3HTU A;  5L3D A;  5D5W B;  4NUB A;  3LSR A;  3H3Z A;  1X3Z B;  3U2R A;  3FXM A;  2MYS A;  5KNL A;  5TRD A;  4BQQ A;  3DBH B;  2JA5 J;  1MMS A;  4DR5 I;  3DPU A;  1ZGJ A;  4GRI A;  4JG4 A;  3WGH A;  2PBI A;  2C39 B;  2R7V A;  4M3D A;  1FT9 A;  4IRH A;  2LR8 A;  5FKL A;  1W36 D;  1ZGA A;  5DTD A;  1HDD C;  2E5L E;  1IUY A;  4F3Q A;  4IEJ A;  2XAG A;  1K6O A;  1WCM J;  2H09 A;  4HNV A;  1X3U A;  3MKY B;  3MFK A;  1K47 A;  2FXA A;  2KIF A;  4CSW A;  1JGS A;  5LFA A;  4IHT A;  1WHR A;  1EH8 A;  4CZZ A;  3C18 A;  4IFD C;  2PJR A;  2VXD A;  4PDK A;  1TNT A;  5LD2 C;  3DPL C;  4JI7 I;  2QVO A;  2TDX A;  3CO6 C;  3OYJ A;  2K9M A;  1HNX I;  4II3 A;  5CPR B;  2K86 A;  5C4J J;  4KA4 A;  4BXF A;  3J7A O;  1I6X A;  4CO8 A;  4DR2 I;  2L7M P;  4C2M J;  2FD5 A;  2GWR A;  4IF4 A;  3CLO A;  4LIT A;  5E17 F;  5IT9 Z;  1DUX C;  2ME6 A;  1S7A A;  3B6A A;  3Q0U A;  4HQM A;  3TKY A;  1N32 I;  1MJB A;  4JI4 I;  4XK4 A;  1LFP A;  4PSW A;  4RGU A;  3K1M A;  4J00 A;  2FNP A;  2E3U A;  3L1P A;  2CO5 A;  2KRH A;  4RS8 A;  2PNZ A;  1PKP A;  1KYW A;  1XN7 A;  3KYC B;  2DA6 A;  3AG1 H;  3K4J A;  3I64 A;  2CUF A;  3PUB A;  3I59 B;  3L2R A;  3E6M A;  1JGG A;  1VBI A;  2W25 A;  4DPT A;  2VES A;  2Z5E A;  1IV8 A;  4DU7 A;  4IKF A;  2HTS A;  1Z0T A;  1U78 A;  3JRF A;  1DU0 A;  5IT9 K;  2P4W A;  2QLZ A;  1DT4 A;  1BBY A;  4JV5 H;  2V79 A;  3L7Z B;  2XGD A;  3JAM K;  2ZNZ A;  2ZJP F;  2IJL A;  2Y9Y A;  3K4K A;  2OC6 A;  1UCR A;  1VF9 A;  1S3J A;  3RKW A;  1VQ4 I;  2R7S A;  5J1Y A;  1A5J A;  4DV6 I;  5E1X A;  2GBY A;  5LHI A;  2Z99 A;  2LY9 A;  1R7J A;  3O6B B;  1RRE A;  2DOF A;  2P7C B;  3EUK L;  3P9C A;  1IBM I;  2HEO A;  2R5Y A;  4JI0 H;  4HG2 A;  2Y9Z A;  4GO1 A;  1HF0 A;  2UXD E;  1MBJ A;  4U7D A;  1NHJ A;  1OJ4 A;  4BEH A;  4GKJ E;  4BE1 A;  2UUA E;  2AQE A;  1R1T A;  2QQA A;  4B3R E;  2YU9 J;  1MMA A;  3P76 A;  4LFB I;  1UMQ A;  4XSZ F;  3K0L A;  2M0M A;  2KHM A;  4BH9 A;  3KZY A;  5GTH C;  5JLX A;  4MTD A;  3BR5 A;  5GP9 A;  4A5M A;  1IBL H;  1NG6 A;  1Y39 A;  4OIN F;  2CGE A;  3OTO H;  1OLT A;  1L0O C;  1KTV A;  4G6T B;  4UV8 A;  5GTI C;  3EET A;  2P7V B;  2XPU A;  1ZAO A;  4DR3 H;  4M1K A;  4AYB N;  2XC7 A;  1RHY A;  2MW8 A;  4IZZ A;  4WAL A;  2F5E A;  1IG7 A;  1IN8 A;  5L3F A;  1HNW H;  5CVR A;  5EEH A;  2CWH A;  2VLA A;  1YJN I;  1UHS A;  3DF8 A;  4ENM A;  5ED4 A;  3J80 W;  2LDU A;  3K9T A;  3F21 A;  3W6J B;  1FWL A;  3HBL A;  4IO9 F;  4DPU A;  4XOR A;  3TO9 A;  5DNL A;  3NQO A;  1AOY A;  3AKZ A;  4V2F A;  3ECH A;  2M30 A;  3BWG A;  3OL3 A;  1RIO H;  3TP0 A;  3AL0 C;  4UTG A;  4Y13 A;  1XMO E;  3FBN B;  1ZG3 A;  3F8C A;  4RMN A;  1UZC A;  3D5R C;  5BPI A;  1X1B A;  1T2K A;  3S2H J;  4DYR A;  3VSK A;  1FOW A;  3CJQ B;  2NNN A;  5HS9 A;  2F4V I;  4QNK A;  5GAE J;  3HGY A;  3BG9 A;  3ZRG A;  2KIU A;  2DBB A;  3TL4 X;  3FK7 A;  3VOE A;  5IOZ A;  1ACI A;  4WUC A;  3B6C A;  4YRV A;  1QGP A;  2Q2E B;  1PP7 U;  1FTT A;  1P9Q C;  2ZNY A;  4S04 A;  2FF4 A;  4PFO A;  1V3F A;  1OR7 C;  2KIS A;  2NS7 A;  5K36 B;  2R3V A;  2UU9 H;  1IBK E;  3OIO A;  1SMT A;  4DW6 A;  4YHH E;  1ZG1 A;  4XTJ A;  3Q9V A;  3ZMV A;  4L5E A;  1HNZ H;  2OCC H;  5H6Q A;  4PGG A;  5F0C A;  4Z2Y A;  3S14 J;  1IZ1 A;  3LFK A;  5LHH A;  1NXU A;  2Y48 A;  2XRL A;  3T5X A;  4D0P A;  3HHG A;  3HSF A;  3TDU C;  1MJA A;  3E3V A;  2Z2S B;  2WY7 Q;  4DV7 E;  3F6O A;  3A02 A;  5IOY A;  1VQM I;  2M7A A;  2O5R A;  4LG3 A;  1N75 A;  1RET A;  4P5O A;  3OIQ A;  3WTY C;  4NXM E;  4BBR J;  3BG7 A;  1CGP A;  1UDS A;  2LY2 A;  4AIJ A;  4EJW A;  1MBK A;  5M3F J;  4JI6 I;  4JI2 E;  4DV1 I;  4RB2 C;  1DDN A;  2UUB E;  1FP1 D;  1GXP A;  1I94 E;  1MBG A;  5E3L A;  1X2N A;  4HNU A;  3B8H A;  1U6G A;  2H1L A;  3LSK A;  3GCM A;  2ZXJ A;  4FWG A;  3IAS 2;  1QNT A;  2LNB A;  3NEU A;  4NC8 A;  4HDV A;  2JE6 B;  1Y1V J;  3CJT B;  3H36 A;  2IVM A;  2UXB H;  2X06 A;  1ETO A;  3TGN A;  4BAY A;  2EFN A;  4UT4 A;  2LFB A;  4C2T A;  5DDG A;  4WAN A;  1NHI A;  2X1E A;  1FWZ A;  2XB5 A;  4RB0 A;  2ZME C;  1OYW A;  2DPD A;  4JVY A;  1XNR H;  4KQV A;  3PUF A;  4G8X A;  1W1W E;  3HUG B;  3TMO A;  3PQJ A;  1XSX A;  2XAJ A;  3V42 A;  4DBQ A;  1VQ5 I;  1ZG5 A;  1WJ5 A;  1FX7 A;  2CRG A;  2JEA B;  2LLK A;  2MC4 A;  3BG5 A;  4XSX F;  5K36 G;  2IGM A;  1GUU A;  2K4J A;  2FEZ A;  3IV5 A;  1UFM A;  4FT8 A;  3T1Y H;  3HG9 A;  1TT0 A;  2FE3 A;  1ETY A;  2VBY A;  3E7L A;  3Q3S A;  4M72 A;  4X66 E;  2JZX A;  3TQN A;  1FYK A;  2JSC A;  4YG2 F;  2BVM A;  1SFU A;  4QTR A;  4F91 B;  3P3G A;  1BIB A;  2EIJ H;  4LF9 E;  2VQF E;  4BHC A;  1Y8R B;  2RVC A;  1KU9 A;  1FNN A;  2X85 A;  3OYB A;  1Y6I A;  1A04 A;  1ZHF A;  2RDP A;  4IQ4 A;  4NNJ A;  5FLV A;  2ZM6 H;  2VOP A;  3MQ0 A;  3W6K B;  5ICG A;  1FNM A;  2JEA I;  1YYV A;  1E3H A;  2XAH A;  4A3I J;  3G1M A;  2GXB A;  4LIJ A;  3SFZ A;  5GMD A;  1PUF A;  3HXL A;  1Z9C A;  2DFF A;  1VQN I;  4I3H A;  2KT0 A;  4C3I J;  5LRS A;  1OMI A;  3FBI B;  5D5U B;  2MGQ A;  2LTP A;  4ZH4 F;  2FPH X;  3RKY A;  2LJP A;  4DV0 H;  2QBY B;  2H27 A;  3DLA A;  3HOU J;  1XTA A;  5K5O A;  5FKK A;  3OYM A;  2OPT A;  4CCL A;  1O3R A;  2GLO A;  2Z3Y A;  5K36 D;  3Q5F A;  2ETH A;  2F5C A;  4BGD A;  3PL8 A;  2R0Q C;  3KDG A;  2JPB A;  2OD5 A;  2FX0 A;  1XMQ E;  1B63 A;  2DDA A;  2B0L A;  4LK0 F;  3ZP5 A;  4CH7 A;  2QYO A;  3IKT A;  4X64 H;  4U0W A;  3J81 Z;  4YFK F;  5DRP A;  4JVH A;  1HDP A;  1XMO H;  3FXU A;  3JRD A;  1KA8 A;  2CUZ A;  1SAU A;  3CDL A;  3MZH A;  4JI0 I;  2IPQ X;  4B4C A;  1VND A;  2M8E A;  1FWK A;  2HHH E;  3BR2 A;  3M7N G;  3DP7 A;  2W00 A;  3BTJ A;  3O8H A;  4JK1 X;  2HH2 A;  5CYV A;  5CVV A;  3K1J A;  5DNX A;  3GFM A;  1D1B A;  1ON2 A;  2VIX A;  1LEA A;  1O4X A;  1POG A;  4USM A;  1N0V C;  1SD5 A;  1MBH A;  4I7H A;  1ENH A;  2VQC A;  2FJ1 A;  5LHG A;  1U8R A;  3FDY A;  3ULQ B;  4OD6 A;  2HPI A;  2WAF A;  4UVB A;  5TJJ A;  1QVT A;  2VOO A;  4G9Y A;  4YHH H;  1IBK H;  4A3K J;  2OBP A;  1X4O A;  4Y15 A;  1F36 A;  2M9H A;  2GOX B;  2DYS H;  2WA0 A;  3HUG A;  4K2E A;  4P9F A;  4LFC E;  1REP C;  5IT9 W;  4DR3 I;  3K7A J;  5K7H A;  1J5Y A;  1F1Z A;  3M85 G;  1EH7 A;  1EF4 A;  1YLF A;  2EZL A;  2JEA A;  1HNW I;  1GHC A;  3JAM W;  1DPU A;  4P9U A;  4DV7 H;  4JP0 A;  1RR7 A;  2O03 A;  2I8D A;  5DCM A;  1W5T A;  5B1B H;  4A3L J;  3AEV B;  2G0E A;  1A36 A;  5DS9 A;  4OU0 A;  1P7J A;  2A05 A;  2QQ8 A;  2OPU A;  4NXM H;  1B6A A;  2ECB A;  3JTH A;  3FMR A;  3ZQH A;  2NNY A;  1HBX G;  4B8C D;  1VIG A;  5C0X B;  3PFI A;  2FNA A;  1WH5 A;  2W85 A;  4LF7 E;  4JI2 H;  2PEX A;  1T95 A;  1UST A;  3DKY A;  4LFA I;  4OIP F;  1J9I A;  4LF6 I;  4E7H A;  1T33 A;  1E2X A;  4KIT B;  3M6A A;  1ODH A;  5C44 J;  4LLL A;  2DQR A;  2YSR A;  2A5W A;  4MIM A;  3J7Z I;  2KZG A;  3ECO A;  3T8T A;  3GBG A;  2X6W A;  2X36 A;  3W2W A;  4XKV A;  2UZK A;  2UU9 I;  2IOQ A;  3F22 A;  2M2E A;  3A1Y A;  3QPH A;  1C0W A;  4MEY F;  3PS1 A;  4RB3 C;  4IS9 A;  3K4M A;  4J19 A;  4KYW A;  4BE0 A;  2P6S A;  2CQN A;  3BTL A;  3EQL F;  5ICF A;  3JSP A;  3OYI A;  1XD7 A;  3GTQ J;  4B3T H;  2L4A A;  1UB9 A;  1NG7 A;  2HZT A;  1Z05 A;  2GA1 A;  2IBD A;  5BQT A;  4UXN A;  2HYF A;  1J5K A;  1OYY A;  2LC2 A;  4AC0 A;  1Y6Z A;  3S8P A;  2UXC H;  5JEA F;  2FMR A;  4E9J A;  2VBX A;  4ESB A;  2OTJ I;  1HLV A;  2K3P A;  2WTE A;  4IHV A;  1APL C;  1V55 H;  2DA5 A;  3DTE A;  2JPC A;  4IFD E;  2R5Z B;  1QZR A;  1W7P B;  2PMH A;  4BHP A;  3CMM A;  3H1C A;  2WAQ A;  3O3K A;  1H8A C;  3K17 A;  4YY3 E;  4ESJ A;  1UEK A;  1ETW A;  4DV4 H;  4JX6 A;  5ICE A;  4MU0 A;  2VB6 A;  2FOK A;  4X65 H;  3I5U A;  4CYD A;  1Z6R A;  2X6O A;  2E19 A;  1B62 A;  1J5E E;  3VEP A;  5C0X G;  1V8C A;  2K3F A;  3VSL A;  1HK7 A;  2LYC A;  5DRO A;  3LSP A;  2LOO A;  3CZ6 A;  2HQ5 A;  3V69 A;  4KIC A;  1W5C C;  4M6V A;  4FX0 A;  2VN2 A;  4NB5 A;  3KEY A;  1N34 E;  1QZE A;  5LGN A;  2L9V A;  2EV5 A;  3CUQ B;  4USK A;  2BXY A;  5EZG A;  2IGN A;  1MBE A;  2WC2 A;  2Z33 A;  3HOY J;  4JYA E;  4DR5 H;  1K1G A;  1K83 J;  3LPS A;  3I55 I;  1OIS A;  3CP8 A;  3T8R A;  2VBZ A;  2O61 A;  1N0U A;  5E1W A;  3S2D J;  5F6F A;  5JEA C;  3U1Y A;  3J7A M;  2DN0 A;  2IS1 A;  2VI6 A;  1JHH A;  3MZY A;  3FF5 A;  3OYF A;  1Y1W J;  3T1Y I;  3H5R A;  4N9I A;  4HBL A;  5EZH A;  3EUH A;  4ISA A;  1A6F A;  2ZSI B;  3WHB A;  3U1D A;  1R1U A;  3E97 A;  2DDB A;  5DD4 A;  5CVI A;  4XIC A;  4HLY A;  4P55 A;  5FKM A;  1JKP C;  1XMQ H;  4E7L A;  1Y4U A;  5F64 A;  2JRM A;  4EVI A;  2STT A;  3GTP J;  3F72 A;  3I53 A;  3W2A A;  4GQU A;  2LRR A;  4JI7 H;  2GOM A;  3DEU A;  4TV7 A;  1MNM C;  3QP6 A;  4IOC F;  1QPM A;  2BGC A;  2A61 A;  3ZQI A;  4BHB A;  2ZM6 I;  1BR4 A;  2ZJ2 A;  3CCM I;  5BNG A;  1SFO J;  1H88 C;  2BM1 A;  2C38 B;  2UXD I;  3RJP A;  2JA8 J;  2HHH H;  4HAC B;  2UUA I;  1JTX A;  2QWW A;  2Z1D A;  5FRN A;  2FA5 A;  4M73 A;  4B3R I;  2FQ3 A;  3BPV A;  3J80 Z;  2EZH A;  3HZJ A;  3CES A;  3K2Z A;  2BHY A;  3TW6 A;  4KIB A;  1MNE A;  2V1D A;  1CF7 B;  4M9S A;  4DXL A;  4UB8 C;  2R92 J;  1ZLK A;  1X4P A;  1YQA A;  4NQW B;  4UHT A;  3PQK A;  4DV0 I;  3CJN A;  1P6R A;  3HOS A;  2JJ7 A;  3NAR A;  3GX4 X;  3GLL A;  4Y3O A;  2FU4 A;  1B72 B;  3LMM A;  2JK3 A;  2XIG A;  5EGO B;  1KIJ A;  1X58 A;  3T1H E;  2XSD C;  3F9K A;  1K78 B;  4IRI A;  4L9N A;  4E7S A;  2DA7 A;  1X4N A;  4L0Z B;  2WNR A;  2NAZ A;  3DLL F;  3GZN B;  1D1C A;  1XMA A;  1DGW Y;  1W7P A;  2EQR A;  2HQR A;  4FIS A;  3J80 K;  1G4D A;  1Y4S A;  3H92 A;  1BI2 A;  4E6K G;  3CUO A;  3SZT A;  3PNT A;  2IXS A;  2GXG A;  1Z6T A;  2X0L A;  1XMO I;  2ID6 A;  4DV6 H;  5KAI C;  4WUB A;  2GIZ A;  3SXY A;  3OSF A;  1I5Z A;  2CJJ A;  3GXO A;  2R7U A;  2Z5C B;  1R22 A;  1FKA E;  1ZZK A;  3JRI A;  2GA2 A;  4NXN E;  4KN4 X;  4O3M A;  1W7P D;  2KLO A;  5AON A;  3P5J A;  2GAU A;  2EFG A;  4QLC U;  1T08 B;  2LG4 A;  4QMF B;  1FOY A;  2DW4 A;  2JA2 A;  2R7F A;  2L7Z A;  4BE2 A;  4YHH I;  1IBK I;  5A2Q K;  2F5F A;  5C4X J;  2G7U A;  4JOM A;  1YOV B;  3RSN A;  3F8N A;  4U7B A;  3F8B A;  1XCB A;  2VKH A;  3KE2 A;  4ZYE A;  3SJM A;  2O8K A;  4GYG A;  2PMU A;  2E2I J;  3TP3 A;  4DV7 I;  4IZK A;  4QPO A;  1G3S A;  3S32 A;  3LNU A;  4PRX A;  1JE8 A;  2OTL I;  1WZ2 A;  4NXM I;  2AQF A;  4HRI A;  2X48 A;  2DTZ A;  2V6C A;  5IWA E;  1IRF A;  1D1A A;  3WU6 A;  4XN0 A;  1OJL A;  4JI2 I;  2BY1 A;  2MBF A;  2HS5 A;  5L3E A;  1HR0 E;  4ENK A;  4PDB A;  4P96 A;  1I94 I;  2BY3 A;  3RKX A;  2F4V H;  2VJI A;  3C3W A;  4XBF A;  4AQY E;  5C3E J;  5LGT A;  1G3Y A;  2LSO A;  2BR2 A;  1SD6 A;  2AXT C;  1WUU A;  4HAC A;  4RB1 A;  3CC2 I;  1J5E H;  1X3W B;  4J01 A;  1N36 E;  1YW8 A;  2DO7 A;  2LBF B;  1SAX A;  4LG0 B;  1ZRE A;  5FLX K;  2PO2 A;  5L3J A;  1FJG E;  5J1R A;  1ETQ A;  1OKR A;  2A6E F;  4HSR A;  2JZY A;  2D9I A;  1Y0U A;  2FBK A;  3DXJ F;  2QEX I;  2V2Z A;  3BDD A;  2V34 A;  4MEX F;  2E7X A;  4MYU A;  3FMS A;  2FBI A;  4XLH A;  3REO A;  3BZC A;  1JXS A;  1H7U A;  1MGT A;  4UUS B;  5EF6 A;  3SEQ A;  5M5Y J;  2MJH A;  3KEO A;  4ZTJ A;  1W0U A;  3QD7 X;  2H1K A;  2XAF A;  3R4K A;  2E60 A;  2PG4 A;  3IRR A;  4HX7 A;  2VKC A;  3BZ6 A;  3LSH A;  2XGX A;  5ILS A;  1RUO A;  1YH8 A;  3QT8 A;  4FE4 A;  2L02 A;  3GZ6 A;  4LF5 E;  1G2H A;  1ELO A;  3W3C A;  2NOJ B;  1ZGW A;  4GKK E;  4GDF A;  3ZKD A;  2ELK A;  3S17 J;  3FIS A;  4XID A;  4X66 I;  2O0Y A;  3ABL H;  1U8B A;  4IZJ B;  4XKB A;  1PJR A;  5IYD J;  2KFD A;  4DBR A;  4JI6 H;  5F27 A;  2XPW A;  2ACJ A;  2CW0 F;  4DV1 H;  1AA7 A;  2HTJ A;  3HRS A;  2XAS A;  4DU8 A;  4LF9 I;  3MWM A;  2VQF I;  1SFE A;  1ZK8 A;  4DV4 I;  4MDT A;  2VON A;  4DUZ E;  2BY0 A;  4Q5S F;  3HHH A;  3M8J A;  2JVG A;  1MKM A;  1BOA A;  1MND A;  2H8W A;  3H0D A;  1L3L A;  2E5Z A;  1FC3 A;  1J0R A;  2FMY A;  5J3L A;  3E1S A;  3QPS A;  3PS2 A;  5ELW A;  1T6S A;  2JTV A;  3GYH X;  1KYZ A;  1BIA A;  1FIP A;  3ABT A;  4MLO A;  4M3B A;  1XHK A;  4WUD A;  1Z0B A;  3QQA A;  2CMP A;  4C9Y A;  3NZK A;  3WTX C;  5BS6 A;  2PNM A;  2K9L A;  2WAD A;  3BR0 A;  3PO2 J;  2YQR A;  4AUX A;  5LMN E;  2MSY A;  3ESW B;  3QPL A;  2LTL A;  2Y0S A;  4FJS A;  3QAH A;  3GVA A;  2JT1 A;  4JX4 A;  2ZXI A;  3E6C C;  4KHP E;  2O7O A;  4L9J A;  4W1U A;  2XGE A;  4BNC A;  2LKS A;  2V2Q A;  1Z0X A;  2VKD A;  1XG1 A;  4CDG A;  3GON A;  2XGC A;  4IHX A;  4IL6 C;  1FOX A;  4PUS A;  2KP6 A;  1Z3Y A;  5EJC A;  4DV3 E;  1JUM A;  3AG4 H;  3E0J B;  3T1H H;  2DTR A;  2VXZ A;  3S1R J;  1AKH B;  1XMQ I;  1BI0 A;  2KJB A;  3ERM A;  2MD0 A;  2MAB A;  3LNQ A;  1IJW C;  4LB6 B;  2EIM H;  1PYV A;  3G3Z A;  2X4H A;  2NVQ J;  5JVG F;  4PJ0 C;  5EEG A;  4ON0 A;  4FN5 A;  2ELH A;  2XRO A;  2LRD A;  3RIR A;  3LFU A;  1KU3 A;  2VUM J;  4JI5 E;  3HUL A;  1XMK A;  2HXI A;  4RA2 A;  2HHH I;  5ERI A;  1YW9 A;  1LB2 A;  1RKW A;  2VT2 A;  1GV2 A;  4MYT A;  4EM0 B;  1JT0 A;  6PAX A;  1SVL A;  2YX4 A;  3CQZ J;  3JAM Z;  5DUI A;  2MFZ A;  2NVX J;  1O3T A;  3K4N A;  1EKE A;  3FXJ A;  4WXC A;  3DD6 A;  1IXR C;  3K10 A;  3JRB A;  1UHM A;  2G7H A;  1MMD A;  3K1N A;  2NS0 A;  3ZR8 X;  2WAQ N;  4LFC I;  2VT3 A;  3LA2 A;  3KP7 A;  1G59 A;  4PJL A;  3CC7 I;  2HKE A;  1WJB A;  3DFG A;  1XXE A;  2P81 A;  3K4C A;  4OZE A;  5B3S H;  4XRS G;  1I27 A;  3OYH A;  3M4O J;  5LMU E;  3G71 I;  2LTM A;  4XN3 A;  2PO0 A;  2F4M B;  2X9D A;  4A3D J;  4IZJ A;  2R7R A;  5IWA H;  2YX7 A;  3Q9S A;  1T0F A;  4HV5 A;  1WI3 A;  1Z5B A;  4JI3 H;  4LF7 I;  5IP7 J;  4OIR F;  1NHH A;  2W48 A;  2NYX A;  2DA4 A;  4KUM A;  3SB1 A;  5CVJ A;  2DK8 A;  4QWQ A;  3ZCO A;  4FWH A;  1E3O C;  1EV7 A;  1FMV A;  2ESN A;  1ZXN A;  4GYI A;  1IW7 F;  5CLS A;  2ZQE A;  4BL0 B;  4IZJ D;  3L00 A;  3FM3 A;  1WQ2 A;  2F5D A;  5B66 C;  4L9V A;  4BXU A;  4PU9 A;  2PN6 A;  1FJG H;  4RDU A;  1Z0C A;  3WTV C;  3BPX A;  2OV7 A;  1HST A;  4IFD B;  4HNT A;  3BJO A;  1K4S A;  2KIQ A;  1MIJ A;  4JX5 A;  4MU4 A;  4ESF A;  2DMT A;  4RGS A;  3ZQ7 A;  3G1L A;  1XNQ E;  2VC1 A;  5LEK A;  4BJ6 C;  1BR1 A;  2C39 A;  1EC6 A;  5HNF A;  3HIF A;  2DA1 A;  2RQQ A;  3BTI A;  3P7N A;  4UUT A;  5L3B A;  2KL4 A;  1D0Z A;  2XV4 S;  3HSE A;  4ZYG A;  3ROU A;  2L9N A;  2XKP A;  1ODD A;  3VWB A;  2AXY A;  2EA4 A;  5FO5 A;  2F1D A;  4LF5 H;  3O8G A;  1WE8 A;  5BMZ A;  2Y3M A;  1MH4 A;  3DBL B;  4OO1 F;  2ZXW H;  3I71 A;  2EV6 A;  2F6C A;  1Y8Q B;  4DPY A;  4W97 A;  3WE3 A;  2M0C A;  1A6I A;  2MD5 A;  1OCZ H;  3M9A A;  4JQF A;  3RPU A;  5HOD A;  4LFA H;  3R61 A;  4LF6 H;  3OMY A;  5J40 A;  1YS7 A;  2PI0 A;  3IH4 A;  4YY3 I;  2KJC A;  2D5V A;  5D4S A; 
#chains in the Genus database with same CATH homology
 3V69 A;  1R6M A;  1WVN A;  3M7N G;  4NBQ A;  1UDS A;  5C0X F;  3KRN A;  2HH2 A;  4OO1 A;  1K1G A;  5JEA B;  2BR2 B;  1DT4 A;  2JVZ A;  2C37 B;  2PY9 A;  3GCM A;  3L7Z B;  5JEA C;  1UDQ A;  1OYP A;  2JE6 B;  2PO2 B;  3H36 A;  1X4M A;  4OO1 B;  5JEA E;  5JEA A;  3L7Z C;  2CTF A;  3DD6 A;  4OO1 D;  2BR2 A;  3M85 G;  1E3P A;  4WAN A;  4AM3 A;  4IFD G;  2WP8 B;  1DTJ A;  4BA1 A;  2JEA A;  4OO1 C;  3L7Z A;  2PO0 B;  1UDO A;  2JE6 A;  2PO2 A;  1KHM A;  4JVY A;  2BA1 G;  2CTM A;  3AEV B;  3VKE A;  1UDN A;  4OO1 E;  3U1K A;  2DGR A;  4IFD F;  2OPU A;  1ZZI A;  4AID A;  2C38 B;  5JEA D;  1VIG A;  5C0X B;  2JA9 A;  2WP8 A;  4BA1 B;  2JEA B;  3GME A;  1R6L A;  2ANR A;  2P2R A;  5K36 G;  2PO0 A;  2NN6 G;  4BA2 B;  2MJH A;  3CDJ A;  3CDI A;  5C0X C;  2PQU A;  2CTK A;  2JZX A;  2CTE A;  2BA0 G;  2JEB A;  3B4T A;  2QND A;  2C38 A;  5K36 F;  4WAL A;  1OYR A;  2NN6 F;  5C0X E;  5C0X A;  2HH3 A;  2WNR B;  4BA2 A;  2Z0S A;  2ANN A;  1ZZJ A;  3GLL A;  4BA1 I;  2JEA I;  2C39 B;  2JEB B;  1E3H A;  4LIJ A;  4BA2 I;  2JE6 I;  5JEA G;  1X4N A;  2WNR A;  4IFD B;  2PO1 A;  5C0X D;  1VIH A;  1TUA A;  2NN6 A;  4IFD D;  4AIM A;  1J5K A;  2C39 A;  5JEA F;  4IFD C;  2CTJ A;  2FMR A;  1EC6 A;  1WHU A;  2BA0 A;  2BA1 D;  4OO1 G;  3M7N D;  2OPV A;  4IFD A;  2PO1 B;  4IFD E;  1J4W A;  3HKM A;  2PNZ B;  2BL5 A;  2AXY A;  1ZTG A;  5K36 B;  1ZZK A;  2JEB I;  2NN6 B;  1WE8 A;  2YQR A;  3H1C A;  1OYS A;  5K36 D;  2CPQ A;  4OO1 F;  4B8T A;  2NN6 D;  5K36 C;  2NN6 C;  4QMF B;  2E3U A;  2BA0 D;  2PNZ A;  5C0X G;  5K36 E;  5K36 A;  3M85 D;  2NN6 E;  2CTL A;  4JVH A;  2C37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...