4AM3A

Crystal structure of c. crescentus pnpase bound to rna
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
622
structure length
622
Chain Sequence
GSMFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAVFAKSQKPGQDFFPLTVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVKGFKNEVQVVVTVLQHDLENDPDILGMVAASAALCLSGAPFMGPIGAARVGWVDGAYVLNPTLDEMKESKMDLVVAGTADAVMMVESEIQELSEEIVLGGVNFAHQQMQAVIDAIIDLAEHAAKEPFAFEPEDTDAIKAKMKDLVGADIAAAYKIQKKQDRYEAVGAAKKKAIAALGLSDENPTGYDPLKLGAIFKELEADVVRRGILDTGLRIDGRDVKTVRPILGEVGILPRTHGSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKESFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLAMMDAGVPLVRPVSGIAMGLILEQDGFAVLSDILGDEDHLGDMDFKVAGTSEGLTSLQMDIKIAGITPAIMEQALAQAKEGRAHILGEMNKAMDAPRADVGDFAPKIETINIPTDKIREVIGSGGKVIREIVATTGAKVDINDDGVVKVSASDGAKIKAAIDWIKSITDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYRIBONUCLEOTIDE NUCLEOTIDYLTRANSFERASE
publication title Crystal Structure of Caulobacter Crescentus Polynucleotide Phosphorylase Reveals a Mechanism of RNA Substrate Channelling and RNA Degradosome Assembly.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transferase/rna
total genus 175
structure length 622
sequence length 622
chains with identical sequence B, C
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2012-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
A PF00575 S1 S1 RNA binding domain
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 4am3A02
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4am3A03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4am3A01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4am3A04
2E3UA 5JEAG 5JEAF 1UDQA 5JEAA 2C39B 4WALA 2PQUA 2PNZA 2FMRA 3H1CA 2BA0G 1ZZIA 2BA0A 5JEAC 3M7NG 3DD6A 5C0XC 4BA2B 4BA1I 2NN6D 1X4MA 2CTJA 4LIJA 2Z0SA 2JEAA 4JVYA 2CTFA 2JE6I 2OPUA 2JE6A 1R6LA 1E3PA 2C38A 2NN6B 4NBQA 3KRNA 4JVHA 5K36D 2C39A 4AM3A 1OYPA 3L7ZB 4IFDF 1KHMA 1WHUA 1J5KA 2YQRA 2JA9A 2BA1D 5K36B 2WNRB 4OO1D 1DTJA 3CDJA 4IFDC 3M85G 2CTKA 4QMFB 2BL5A 2PO2A 4OO1B 2NN6G 5K36E 2PO1A 3GLLA 4B8TA 1ZTGA 3H36A 2PO0B 2JEAI 3HKMA 3L7ZA 2BR2B 1OYRA 2CTLA 2ANRA 2PY9A 1WE8A 2AXYA 2WP8B 5K36G 4OO1E 2C37B 2CTMA 2WNRA 2DGRA 1VIHA 2JEBB 2QNDA 2BA1G 5JEAD 4OO1G 4OO1F 5C0XD 4OO1A 2NN6E 4BA2I 4BA2A 2PO0A 2HH2A 1UDNA 1X4NA 2BA0D 1R6MA 5C0XB 2BR2A 3B4TA 3CDIA 2CPQA 3U1KA 2NN6F 2WP8A 2NN6A 3GMEA 1E3HA 2C37A 1ZZJA 1WVNA 1J4WA 2MJHA 2HH3A 4BA1B 4AIDA 1UDOA 3V69A 3AEVB 5C0XE 1DT4A 2CTEA 2NN6C 5K36F 5K36A 1EC6A 3GCMA 2JE6B 1OYSA 4IFDD 2JZXA 3L7ZC 5C0XG 5C0XF 5C0XA 4AIMA 5K36C 4IFDB 2JVZA 3VKEA 4WANA 3M85D 5JEAB 1TUAA 4BA1A 2P2RA 3M7ND 4OO1C 4IFDE 2OPVA 2PNZB 2PO2B 1ZZKA 2PO1B 2JEBI 2JEBA 5JEAE 1VIGA 2JEAB 4IFDG 4IFDA 1K1GA 1UDSA 2ANNA 2C38B
chains in the Genus database with same CATH superfamily
1SFXA 3PO2J 2QBYA 2NNYA 3HRMA 1BKNA 1XNQI 2FFMA 4OMYA 5KVRA 1H73A 2CUZA 3ZN1A 3SB1A 4CGZA 4Y13A 2LSOA 3U21A 2ZMEA 2CQKA 4UB8C 4XLEA 2KFDA 4DR2I 3PNVA 4ITVA 4UTGA 1K4TA 3ZQLA 3BR3A 2FBHA 3V42A 5C44J 2W00A 5M5WJ 2ZNZA 5H20A 1LNWA 4UUSB 4JI5E 2M4GA 4DR4E 2VOOA 3G1LA 2Y30A 5BNGA 2RN7A 4MGRA 2KJBA 3I56I 4LLGF 2PMZA 4R79A 3ZMSA 4NXNE 3R0AA 4XORA 1GVDA 1ORKA 2V6CA 4HOBA 2NOJB 1QU3A 4MU4A 4WUBA 1ETQA 5CJ9A 3L00A 2V9PA 4KIFA 4B4CA 3M85G 2F5DA 2XAHA 3NQOA 4M6YA 5EGOB 5BR8E 1IBKI 4JYAI 1S7OA 1ZELA 2GO4A 4YG2F 1I94I 2LMDA 4J19A 4DV7I 1Y0UA 1XD7A 2JJ7A 5HVQC 1YIJI 5HS9A 2PI0A 3I5UA 1BW5A 2ZQEA 1EA3A 2OPTA 2UUCH 1K61A 2O3ZA 3NAUA 4LD5A 3L7ZA 2FUG2 2QCOA 3J81W 1FBQA 1P7JA 1YH8A 4U7DA 4LPFA 1YX5A 2C37B 5HLIA 2ETHA 2LOOA 3SDBA 2Z99A 5DM7F 2DA1A 4BL0B 4FWGA 2OZUA 4UVBA 3OYIA 4LCGA 4OX9I 1RKTA 1ETVA 3M1EA 4FX4A 4F91B 3BCAA 3GFIA 2DCEA 1USTA 3S93A 1YHQI 1SAXA 3LQQA 1H88C 2HPMA 1DARA 2LJPA 5FLXQ 2O8XA 5HNFA 2PO0A 1IZ1A 3CF2A 3GBGA 4ANJA 4IHXA 1AOYA 2BR2A 3B4TA 1DP3A 1J5EH 3EZJA 1SVLA 3RPUD 2VC1A 3B82A 1ZZJA 4LLNA 1TLHB 3Q6MA 4LFAE 2MJHA 3LSPA 1FY7A 3Q9SA 3BLYA 1K78B 2A69F 4ZTFA 1N78A 1OYIA 4NZRM 2CRGA 2HEOA 1ZN2A 4B3MI 4KIGA 5K36A 4RGUA 1RPWA 3OYCA 3PYEA 3ELKA 4JI0H 4BQOA 4E7LA 1BR4A 3CUQA 1HLVA 1HDDC 4CSWA 2CW7A 1WZ2A 4CA0A 1PUEE 1RC9A 1UZCA 1IUYA 4C2MJ 1FJGH 1X19A 3A02A 3I59A 5DEQA 3TW6A 2VBWA 3JRFA 2ZBKB 5FLXC 5LMUH 4PGHA 1SVOA 2GIVA 3TQNA 4BQNA 2M8WA 4D7MA 5LMUE 1VQ7I 2GWRA 2X85A 3C7JA 1VI7A 4BE2A 2F2EA 3JTHA 1OCTC 3ABUA 2PNZB 4DV4H 2A5YB 4KFCA 1O3RA 2XPUA 3H35A 4XKWA 3BJAA 1IN8A 1W36C 2F4IA 2R7FA 3O8HA 2EV6A 3GYHX 2K3PA 3WTSC 1BJAA 1VQ9I 3RJPA 4JI6I 3S2DJ 1V3FA 2C38B 4LF6I 3SFZA 4H8AA 3I4MJ 2HKJA 1YRNB 2OJED 2FBKA 3C1DA 1FBUA 1RKWA 2MLKA 4R1FA 1IUFA 3M9AA 3FKIJ 3OOUA 1FMWA 3H1CA 4E7HA 1XMQH 2DQLA 2VJ4A 2JSPA 3K1PA 2VKDA 5K1YA 3HOXJ 4HY1A 2LKXA 2K9SA 3KE2A 2IGMA 5ICGA 2NN6D 2Z0SA 3DPUA 4B3RI 4HYEA 2P7CB 2MH9A 1IDYA 2BY1A 1D8JA 2PJRB 2OPUA 2Y0SN 2ZMEC 2E19A 2M34A 4YELA 2R5YA 2OI2A 3T1YE 2P6SA 3ASOH 1FZPB 4JOMA 4MFDA 1NG6A 1HNXI 1OYPA 3HHGA 3RKYA 4OCHA 2E2HJ 3V8KA 4Z2YA 1W1WE 5HDGA 3HXLA 3J80Z 2XPWA 2KRCA 3HSFA 1XN7A 1IXRC 1ON1A 1TQMA 5HS7A 3ZGKA 1YHCA 5BOXA 2R7UA 2LNBA 4HRIA 4KICA 2DK5A 3CP8A 5EZHA 1P6RA 4GKJE 1ZTGA 3QAHA 2EA2A 4UT4A 3E6DA 4LF8I 5B1BH 2HHHI 2PX9A 1UHMA 1YJNI 4OU0A 1N33I 3LNUA 3VYTB 1UCRA 3QPHA 1Z3XA 2DT5A 2UUAE 4DR6I 2QF7A 1ENHA 3M8FA 3K7AJ 4G12A 1Y4UA 2BA1G 2VQEE 1UELB 2HQRA 1LE8B 1V9NA 2JPCA 3FK7A 3BY6A 2K9NA 2HNHA 4F3QA 3S3MA 4FWHA 4GXOA 3WU3A 4OWRB 2XSJC 1R6MA 2R7TA 4KT5C 1KYWA 4FWDA 2XUBA 4II2A 2HTSA 3OYMA 3A4CA 2Z5BA 1FKAH 3O2PE 1PQXA 1IN5A 5HNHA 1H7SA 4DR3I 2HH3A 4C3JJ 1UJ8A 3GKUA 3W6KB 3BG6A 4BJ6C 4P96A 3CMAI 4ZDLA 1LDDA 4BXUA 4LMYA 1EC6A 1BR2A 1IRGA 3UHMA 4CYCA 4MFEA 2KL4A 1OYSA 1WH7A 2L3DA 2VXZA 1V55H 4CCLA 2FJ1A 3G1MA 4CICA 4NDLA 1NH3A 4RS8A 4G8XA 1N34E 3GEZA 4AIMA 4UXNA 1B1BA 4G6DA 5K36C 2JVZA 3WU1B 2VXDA 4N9IA 4A3BJ 3S32A 3F8FA 3CUQC 1T0FA 2R3SA 2Y9YA 2BEOA 3FMSA 3KFWX 3ZZUA 2DT7B 3IP4B 3V7RA 2KHMA 4LFBI 2CW8A 4JI4E 4LB5A 3MMYB 4CO8A 2HVSA 4J3DA 2F6CA 1RRJA 1AKHA 2PO2B 1HNZH 1J09A 5LRRA 3EUAA 5D4RA 2E5LH 3G73A 4M3EA 1MMSA 2MSYA 3HJCA 4DR5I 2Y31A 3DLLF 2R7VA 1Z77A 5D5WB 2R7XA 3ZQCA 2IGNA 1KA8A 3IH3A 4LF9E 1ZYRF 1REPC 2DTZA 1TWHJ 5EYRA 4FW4A 4JX6A 2PQUA 1Z6RA 4PJMA 3CC7I 3D5LA 2VQHA 2LTMA 1P4WA 1FP2A 3FXUA 4IPAA 1X1DA 4AQYI 4JI1H 1VQOI 4HV5A 5GTIC 3HRUA 1SD5A 4FASD 1IBLI 4A3JJ 1S4EA 5KK1A 5IT9Q 1Z0TA 4S04A 4FW3A 3BR6A 3PYDA 2IOPA 4NXMH 3QODA 1ETYA 3EUKL 4B47A 2HOTA 2H09A 1B8IA 3QPTA 5IP6A 1TTYA 4A93J 2QLZA 4D5FA 1FWZA 3HUGA 1OMIA 1RUNA 2KRFA 4YFNF 5JFRA 4L5EA 1K7AA 4FT8A 3GXOA 4L0YB 1FTTA 1CF7B 5LLQA 1ZH5A 1B63A 4NC6A 3GR5A 4P52A 1U9OA 1P42A 3AL0B 2QQAA 3ULQB 4E6KG 2AQEA 3HM5A 4MDTA 2IS2A 1OYRA 3F8BA 2PLYA 5IT9C 2FE3A 2AXYA 4IZJB 5K36G 5KHDA 1Y4SA 1MJ9A 4HDUA 4Y4RA 2JEBB 1BW6A 3A03A 2HDDA 1X1PA 3H5NA 1TC3C 4HSRA 2FSWA 5EG0A 4FTHA 3H92A 4K2EA 4I3HA 1S9HA 4EQQA 2W48A 1VQPI 4XK4A 1LFPA 1T8IA 3K6GA 3BZCA 3PUFA 2ZM6H 2HI3A 3U1KA 1W7PB 4K0KI 3KPHA 3GMEA 1RHYA 3GONA 2EFWA 3RQIA 1T56A 1YX3A 2OQRA 3Q9VA 1P4XA 3HJEA 4LLLA 4NC8A 4MNUA 2M8GX 2V6EA 3ZKDA 3K2AA 2RV8A 3AG2H 4DZJA 4A3FJ 3LA2A 1P2FA 5FKKA 4XTJA 3HGYA 2W25A 4YIRX 3CCMI 4Q4ZF 2PNLA 2M5WA 2N8GA 3HRTA 1B6AA 1JI8A 1V8CA 3C2GA 1O3QA 2K40A 2K4JA 2QQ8A 1QA6A 2UXBI 2L9VA 1UG0A 1P7IA 2DA4A 3RPQA 4XICA 3SDGA 5B5EC 1MBFA 1N36H 2KKOA 3KZZA 3PSFA 1IV6A 4RGRA 4L5IA 1B59A 4C2TA 3CQZJ 3JRCA 2HYGD 2D9IA 2FU4A 1FSHA 1VIGA 2E60A 3GWZA 5GAEJ 3WTZA 1DGWY 2AXTC 4O5VA 2JA6J 2H6BA 1SFEA 1XSXA 4DV1H 2XF7A 2LBFB 1VQ5I 5AIQA 1H9TA 2E3UA 3PQKA 2G7HA 3OL4A 5K7HA 4DV1E 2X06A 2NVUB 1YJ9I 3B8HA 3F9KA 4OIRF 3FISA 2LP0A 4DPWA 4MQYA 4YHHI 4DV0I 1J5YA 1MNDA 3ROUA 3S1NJ 2FMRA 3MKYB 2BA0G 1HNWE 2Y48A 1Z7LA 5F1JA 2IA1A 5M3FJ 2UXDI 1NZ0A 4PJLA 2FNAA 1E2XA 4LIJA 3LSGA 2D5VA 4UV9A 5TISC 4JV5I 4R1HA 4X65H 1JT6A 2JE6I 3IAS2 2IGKA 4M6VA 3I64A 2JE6A 3J80Q 2A05A 3OR2C 5IWAH 2IW5A 4B8CD 3JAMW 3MWMA 5FD5A 1USVA 1FWKA 2A1SA 1ZRCA 2A6EF 3P06A 4HNVA 1W5TA 4A69C 4PRXA 5D6EA 4LF5I 2ZJQF 3HC7A 1HW1A 1EH8A 4Z6YA 2K85A 4NZTM 4AVPA 1G3TA 1X3ZB 1ZG1A 4WWCA 2LREA 3TBIA 3H36A 1QPMA 2JEAI 4G7HF 2IESA 1KU2A 3PS1A 1GDTA 2UWMA 2DBBA 5DCFA 3ABMH 1XGOA 3IKVA 1EV7A 4LK0F 1U9NA 4HX4A 3J80C 1UMQA 1MBHA 1BI0A 5C4XJ 1U3EM 1OJ4A 2QNDA 2L02A 4EJWA 5C4JJ 4BE0A 1TWCJ 3RCOA 1K83J 4ZC3A 3HHHA 2CUJA 4QWQA 3WHCA 4OO1A 1KGSA 4OIOF 3RSNA 4BA2I 1W5CC 4X62I 4BA2A 4AU7A 5J4VA 2R3VA 2L4AA 2CWEA 2JSCA 3ZMZA 3QOEA 3T1HE 3CO6C 5ICFA 2KIUA 2TRTA 2X7IA 2F5VA 3K69A 2NPFA 2V34A 1HQCA 3HRSA 3V69A 2X36A 1XCVA 2DT6A 1FSEA 4P9UA 2NAZA 1RR8C 1UHWA 3HGGA 3J81K 4KQVA 1D8KA 1HF0A 3OYNA 3FMQA 1ODDA 1XC5A 1UAAA 1P9QC 3DBLB 1EI1A 3BT9A 3KZYA 4DUYH 4JI8H 2BY3A 2PT7G 5LHHA 2E34A 1I5ZA 3DKWA 1V5GA 4RM3A 5CVIA 2IPQX 5DCMB 4DV3E 5CLSA 2A5WA 3DBRB 1MH3A 3I0PA 1FWLA 4EGZA 1RI7A 3OR1C 4M74A 1YQAA 1QVTA 5L3FA 4GQUA 2P0WA 5HDNA 2HQ5A 1WUUA 5FLXZ 5A2QZ 1T95A 2K1HA 2ZXWH 2E1OA 1MU5A 4EMDA 2L5QA 1F36A 2WC2A 3TDZC 3U1DA 4BHCA 4C3IJ 4X64H 2Z3YA 2DA7A 2E1NA 2WAQN 3TO7A 2I10A 1K1GA 2UXCI 3L2CA 3ZMUA 2IA2A 2QSFX 2NS8A 4JI7E 4DV6I 1WFXA 2XB0X 5JEAF 1BA5A 1NK2P 1RESA 2EZKA 5K7ZA 2JA2A 2QYOA 4DYRA 4ZYEA 3Q0WA 2HXIA 2IP2A 1PP7U 1BI3A 1SEUA 2BW3A 2QZ8A 2W57A 3A1YA 5JHUA 3M7NG 2MGQA 4HNUA 4YY3H 4LF4I 4WX9A 3BJOA 1T6SA 3EQLF 1R36A 1DUXC 2EA4A 3BTLA 1R6LA 3DWLE 2A2DA 1XGMA 2M4KA 2DK8A 2LK2A 1SD6A 2OV7A 2VQGA 3LWFA 2KPMA 3I4PA 1ZHFA 5FGMA 3H3UA 4XLNF 4MLOA 1N32E 2YQRA 1U6GA 5EZGA 1WGXA 2HFHA 1T08B 2LY2A 3K1NA 4YFKF 4LK1F 3W6VA 4GKKI 3MKZA 4OO1D 5J1RA 2LKSA 5ELWA 1FYLA 4IFDC 2FRHA 3GZ6A 4N4NB 5D8KB 2UZKA 1BOAA 1L0OC 2V8PA 2DJNA 4BDZA 2CG9A 4FE7A 2PBIA 3CC2I 1Y60A 4DR7E 1BN5A 4B43A 2X48A 2HK3A 1XMAA 1XNRI 5J6XA 4LF7E 1Q1VA 2K02A 2Y0MA 1RZ4A 4BY7J 1Y8RB 1N0VC 4H4KC 4HQMA 5IP7J 5DS9A 2DA6A 2PMZN 1YTYA 3I3LA 2M0MA 1FC3A 3LPSA 2V1NA 1XCBA 2LTLA 2DMPA 2OU2A 3LOCA 3ML6A 5E8GA 1ONVA 3TGNA 3CCJI 1X1AA 1D5VA 4QIWN 5K7FA 3ZZTA 3OETA 4A6DA 4DR7I 1ZTRA 1ETWA 2UUBI 4HF0A 3OYEA 1U0JA 2VBXA 1AWCA 1WJ5A 5HOOA 3CCRI 3H3VK 2VB6A 3H9GA 4IRIA 1Z05A 3ZMTA 3OTOE 2VJ5A 1BL0A 2CTEA 2ELHA 1XNQE 3GF2A 4DV5I 1A6FA 3CCYA 5D6FA 1R49A 3K9TA 2ADUA 4HACA 2XAJA 2O4CA 4DR2E 1MBKA 4PU9A 3Q3SA 1G4DA 4XNFA 4XN0A 4QPQA 2FQ4A 2NVQJ 5GAHJ 1D3YA 4DJAA 1ZXNA 2VE8A 4I01A 1KU7A 4Q5SF 4B3TH 1PUFA 2NS7A 4NQWB 3SZTA 2E2JJ 4HF1A 4IRHA 1H89C 3M85D 2ELKA 3K4BA 4JK1X 1POGA 4FX0A 4BA1A 4I6ZA 1FYKA 3J7AK 3KYDB 2IJLA 3KP7A 2OPVA 1HCRA 4PK4A 4N3OA 2F4OB 4RDUA 2F4VI 1FMVA 2GXGA 1WJAA 4KMUX 3WU2C 1MBGA 2XKPA 2BXYA 1ZG5A 4IFDG 3BPVA 3JRIA 1X4PA 2RNGA 4IL6C 1IBKE 1SFUA 1SC7A 4JYAE 5JEAG 1I94E 4DV7E 1XMOH 3GTJJ 1S29A 3K70C 3S17J 2O61A 1J2XA 2IXSA 3OYKA 3E97A 1SFKA 3J7AM 2QWWA 4XN3A 5FKOA 3TO6A 3Q5FA 3WG9A 2OQGA 3F8NA 3RPUA 2IT0A 2E7WA 3HOVJ 4JI2I 3M8JA 3OYGA 2HTJA 4ZH4F 3F6OA 4JQFA 1B72B 4OX9E 4LFCI 1E3PA 3OSGA 4XBFA 2LY9A 5L3EA 5LMNH 1BM9A 2WV0A 4XLHA 2P5LC 4EJVA 3OYDA 3ECOA 4KDPA 2V79A 2WV1A 1J5KA 5H2FC 1NG7A 3VYRB 2V1XA 3FM5A 2KQRA 3QYFA 3QP6A 5DYMA 2R5ZB 3M07A 3OIQA 4BKXA 1XS9A 4KHPI 2R0QC 2ZKZA 4ON0A 1FNNA 1Y1WJ 3I53A 3FX3A 1U2WA 2VKEA 3BPXA 3DEUA 1R71A 5FFZA 4HF2A 4B3ME 5K36E 4UUSA 2V7FA 1RIOH 2ZFWA 5F27A 4IOCF 3WU6A 4B8TA 4JI5H 2EV5A 4DR4H 3BR2A 1I6UA 3ISPA 1WE8A 3KP5A 2CW0F 1QQIA 4B3SI 2XGXA 4NXNH 2DA2A 4M3BA 4RGSA 1KYZA 3ASNH 1BC8C 3GTKJ 5IT9Z 2B9SA 5EGOA 5K5QA 1WKMA 1JXSA 5BR8H 2FXAA 3DBHB 2A68F 5J4YA 3PM1A 3TP3A 2D1VA 2QBYB 2HH2A 1ODHA 1IRFA 2LH9A 3VFZA 1VNDA 3FBNB 1H7UA 2GZWA 2Z5EA 4XKBA 3G1OA 4JI6E 2NN6A 2RQQA 2C37A 2K7LA 1MH4A 2LD5A 2JVHA 4LF6E 2ZMEB 2R7QA 2G0EA 1SMYF 3SYTA 3CO7C 5LL6R 4C2UA 5BMZA 3R6SA 2EFPA 4XIDA 1ZM3A 4BAYA 4ESBA 3GTOJ 2O1UA 2JRMA 2QM3A 2DJIA 1SD7A 1OQYA 2NOGA 5C0XF 3UOEA 3CWVA 2KDZA 2XPVA 4B3RE 1Y56A 1XDSA 3G71I 1NHIA 5A2QQ 1TWAJ 2OD5A 5FLXW 3RQ4A 1ZAOA 1XDUA 1D0YA 2CQNA 4M1KA 1K78A 1O4XA 2A07F 4LFAH 2WADA 4QTRA 2CZ9A 2EIKH 1HNXE 2F5FA 3P7NA 2BV6A 2GA2A 1A5JA 3F0NA 1X1BA 3J81Q 2OAZA 5BQTA 2YX4A 1R00A 4PGGA 1A6QA 2WW4A 2M6QA 4L9JA 3CLQA 5LEJA 1NXUA 4IZZA 1OR7A 3KCCA 2Z16A 4II3A 2EH3A 2BE5F 2HVQA 1Y1VJ 2PJPA 1ZLKA 2VUMJ 2M8EA 1ITYA 2ZJPF 2LYCA 2Q2EA 3DLAA 3VYUB 5J1YA 4MU0A 4U3DA 4CXFA 5JLWA 5FLMJ 3SJMA 1XSDA 4LF8E 2HHHE 4U87A 2PNZA 1D0XA 1WH5A 3BOQA 1N33E 2DOFA 3E5UA 3L7WA 5A2QC 2V1DA 5DUKA 5C0XC 4DR6E 1YJWI 1KU9A 3HPHA 2Z2SB 2HK2A 2ECBA 4V2GA 4KYWA 4E7SA 2Y3MA 4XM3A 4OMZA 2AJ4A 4MO7A 3KIOA 1ZG3A 2DPDA 3MD2A 2EFGA 2C38A 3J81C 2V9VA 4MQ9F 2LG4A 2CQQA 2BY2A 2ME0A 4E7IA 1KQ9A 1U5TB 3DTEA 4FHTA 3DCFA 4X0GA 2VJIA 3ZQ7A 4CUGA 3GX4X 4IO9F 5K36B 3PSIA 2OZ6A 2FEZA 4M3DA 4DR3E 5JLXA 3L2QA 3GTPJ 2BL5A 1T39A 4PDKA 3C2BA 1HR0H 3I59B 4BEHA 3T1YH 2A2CA 1HR0E 2EZLA 1T2KA 4NHJA 3BCBA 1YS6A 4IEJA 4RB2C 1IW7F 2BGCA 4E4HA 3KETA 2FBIA 2K9LA 2Z5CB 4A3DJ 2W85A 1FP1D 2XB5A 4RLFA 4CZCA 4LFBE 2CH0A 3DPLC 2LTPA 1OCZH 2UUCI 4A3MJ 4UY8I 5JR3A 4WXDA 4GKJH 3CDIA 4DR5E 2E36A 3BJ6A 3C18A 3FIWA 4KIBA 1FOKA 1WVRA 2MW8A 3TKYA 2XGEA 1YW8A 2NRAC 2O8KA 2GS8A 2UUAH 2J5PA 2GOXB 3FXKA 2E1MB 2AQFA 4BGDA 2NN6C 1TW3A 5K36F 2VQEH 4XRSG 2R5YB 1K47A 4RM2A 3JW4A 4PZJA 4RAFA 1AU7A 1J5EI 4BUPA 3L7ZC 5C0XG 1WI9A 2XAGA 4QPOA 1JHHA 3I54A 1Z9CA 4AQYE 3F6VA 4GGGA 4HXZA 2ZCWA 3HOWJ 3FXJA 4BQQA 5EL9A 1IBLE 1MW7A 2CO5A 1VI0A 2OBPA 1XRHA 3HDDA 4DPTA 3AG3H 1QBJA 3FF5A 2J5OA 2X4HA 4XKVA 3T8RA 2M3AA 2P2RA 2OA4A 3OYFA 1K6OA 1R22A 3KEQA 3JTGA 4JI0I 2BM1A 4DR1H 1LVKA 2X1DA 1IN7A 2K9QA 2M9HA 3BTJA 4W1UA 5LHGA 2GOMA 4IHTA 1HKTA 1ZZKA 3OYLA 2E71A 3GTMJ 3NCVA 5L3DA 2QQ9A 4UNOA 4DR1E 1R1VA 1FJGI 2P6TA 4HA8A 5LMUI 1YW7A 4A0YA 2G9WA 2VQFH 1RETA 3OTOI 3KDKA 1N34H 1QZEA 3ESWB 3C3WA 5IT3A 2LC2A 4ZYGA 1UDQA 2C39B 2VQFE 4DV4I 4HBLA 4HLXA 1JHFA 1Y8QB 3MZ8A 1JKPC 1D6TA 4F93B 2JRTA 2EPFA 3ZQFA 2P4WA 4EM0B 4JI4H 2RVCA 3IRQA 3JRHA 1V5FA 1USSA 3FAUA 5FROA 2VBZA 4HW0A 4WUCA 2XC7A 3N97A 1VF9A 4A3EJ 1X0AA 1PVEA 2PEXA 4XONA 5DNLA 1XGSA 2Z1DA 3VDXA 1OYWA 3CD6I 1WJFA 2Z5BB 2EILH 5H6RA 1Y39A 1B62A 3BR5A 3E3VA 5IYBJ 5LGUA 1QHHD 1YI2I 2L2OA 4KN4X 3M1CA 5FB2A 1KVKA 2DFIA 1LFUP 3QT6A 1XMQI 2DLLA 3SZGA 3H5RA 3T8TA 3MQ0A 1W0UA 2JVGA 2Q1ZB 3SEZA 4F7ZA 1MSZA 2UU9H 4BBRJ 4K0KE 3O8GA 4CCJA 4CYCB 2WNRB 4DOZA 4DNCA 2HS5A 1MSEC 1DTJA 3DTKA 5GP9A 4LIVA 4PDBA 1KQ0A 2UU9E 4HV6A 4LG3A 1SMTA 4UVCA 4AC0A 2JK3A 1R1TA 3H9JA 5LHIA 4EM1A 2UUZA 3M3YJ 2NN6G 2DMTA 2GQ0A 2CWFA 1GV2A 1Z5CA 3JRAA 3HZJA 2R7OA 1IXSB 3HKMA 5IT9W 2KZVA 1ETXA 1ZM2A 3V8JA 3ZPLA 2ZNYA 3LL7A 1XSVA 2EIJH 5H6QA 3CF5F 1Z21A 2P81A 4D7NA 1JT0A 1K79A 2O1TA 3LFKA 1R5ID 2HFUA 1HOMA 1X3WB 4KA4A 2UXBE 5ILUA 3GFMA 1MNMC 4HG2A 2ZXJA 4MTEA 3JREA 2CV0A 4AIJA 4LCHA 4HQEA 2DQRA 1I39A 4X66H 2BA0D 5HLTA 1Z91A 4ESJA 5HDKA 2XDVA 3CDHA 2W4SA 2VESA 2VJJA 1ZR2A 1A6IA 4X66E 3P5JA 3BG3A 3QYBA 4B09A 4PUSA 3L2UA 5CPRB 3I0TA 3CTAA 4LCFA 1T33A 4L18B 2FMLA 4YHHE 4DV0E 4FQGA 1J59A 1I27A 2UXDE 4MIMA 1R7JA 3F72A 3WGHA 4B3AA 5ILVA 4S05A 3MN2A 1W7PA 4RAZA 4JV5E 2O1WA 2PN6A 3TOBA 1XMKA 4BNCA 1WJDA 1PDNC 2L7KA 2X0LA 4BJ5C 1XXEA 4G08A 2VONA 4EGYA 4IFDE 2VOPA 5E3OA 3KP4A 1ZRFA 4DU8A 2GXBA 3VOEA 5JEAE 2R7DA 2ZFUA 1A35A 3PYFA 4J00A 2CWHA 4LF5E 1MJBA 2A6HF 2WB1A 2VC0A 3IAM2 5E1ZB 4KNYA 3HIFA 1SAUA 4ZYAA 3J7AG 2VPRA 2CPMA 3WODF 3S15J 5FWKA 5DT9A 4DGWB 3J7AO 2WAEA 3SQNA 2STTA 2BY0A 1HNZI 1QO0D 1UG2A 1R5GA 2R7WA 5IP9J 1D0ZA 3DF8A 1V54H 2E5LI 1SD4A 1O3SA 5EG0B 1ZZIA 2CQXA 2XAUA 4CCKA 5F1RA 4L5JA 2ZSHB 2XEXA 1W4MA 2UXNA 2O3FA 1QVUA 3P3GA 1R1UA 5M3MJ 1YYVA 1T0FC 2DODA 3FWEA 2LBFA 2XVCA 3KEYA 3HKZA 2IS4A 1FTZA 1FLIA 4GYGA 5K5RA 1QZRA 1XB4A 2DYSH 4HX7A 1ERDA 1PKPA 4DU7A 4X62E 3E1SA 1I6XA 4I02A 3A0BC 3KP6A 1KHMA 3H5AA 2XASA 5E3MA 4YFXF 4JI1I 4BE1A 3N05A 4C3HJ 1HNWH 5B3SH 1A04A 2RKHA 3K17A 1QZZA 1JTYA 5FRNA 1T98A 1ZR4A 1NTCA 2L0KA 4NXMI 1ACIA 2PO1A 2V26A 4IZJD 1TNSA 5DRQA 3JCUC 4OOIA 5J1UA 4F52A 5DTDA 3B6AA 3AFHA 2WP8B 4MEXF 2RQPA 3J80W 3GVAA 2DDBA 3AG4H 1AKHB 3G3ZA 3LA3A 1OCRH 3T5XA 5F0HA 2W82A 2JZYA 1GHCA 2O1VA 3FXRA 1FOWA 2W1OA 3TO9A 1BI2A 1G6NA 4U0VA 2QEXI 3EUHA 3K4CA 2MYSA 1FOXA 5CVUA 3HTUA 3WU4A 1ZM4A 4A0XA 1U8BA 1W7PD 3I71A 2VPLA 5E20A 2CMPA 2V2QA 4RGXA 4G9YA 5M5YJ 3LSIA 5JHFA 2Z5UA 3WGIA 4GFBA 4FW6A 3F0CA 2UXCE 2XHKA 3DKXA 4ENKA 3VPRA 2R7ZJ 3A01A 3V4GA 4DV6E 3OS1A 2R4GA 5EEAA 4G7ZF 6PAXA 2L9NA 4ZYDA 3V2UC 2EIMH 3S8PA 2JE6B 3W3CA 2HXOA 5CVRA 2KJCA 5FRMA 2X1EA 2JA7J 2ZM6I 1Z7UA 1FBSA 2GM4A 2E35A 4PSXA 3FZVA 3MZYA 3EETA 4LF4E 4IFDB 1R9TJ 1MX0A 2FF4A 3E6CC 3TW7A 3QPSA 4WANA 3T1HH 2R42A 2XGDA 4CCNA 5GMEA 4GO1A 5JEAB 2DA5A 3OYAA 1TZLA 1Z0VA 4OD6A 4XOPA 1ZGWA 3HYIA 1OFCX 3ABLH 4RA2A 4E7JA 4GDFA 4JI3E 5TJJA 1O57A 2QENA 3IC7A 3HL2A 2JQ7A 1ULYA 1X2MA 2QGUA 2DO7A 2HKEA 2B63J 1DU6A 4DUZE 4GKKE 3P76A 2JEAB 4OZEA 1YG2A 2GLOA 2QA4I 4IHVA 3CCVI 2ZC2A 2VT2A 2MLGA 1N0UA 3CCLI 1N36I 2LRRA 3P9CA 3ZRGA 2E1RA 4DV3H 3UKGA 1G59A 1SVMA 1H8AC 4CH7A 2ZXIA 1VQ4I 1XNRE 3BTCA 3DP7A 4EEFG 1ZXMA 3JSPA 2O7OA 3ONQA 3K85A 1G8XA 1Y6ZA 1ELOA 4BA2B 3J7AY 4DV1I 1X4MA 2CJJA 1J0RA 2CTJA 1VQ6I 4BXXJ 5B66C 1OCOH 1VQLI 4EJTA 5GPAA 1OISA 1WRJA 3REOA 1IBMH 2H8WA 1GLNA 5CVJA 2HDWA 4UVAA 4JI7H 2IBDA 5AONA 1TNTA 1X4OA 4R8HA 5HLGA 3IV5A 1USUA 3LNQA 1IBME 4XKCA 2UUBE 4IFDF 2DTRA 2X6OA 2JT2A 4FJSA 1LEBA 2JA9A 3J81Z 3O3KA 2NNNA 3L2RA 2F48A 3WGGA 5FJ8J 3G6EI 2ZSIB 2EINH 2PQ8A 3PIOF 4X65I 3E5XA 2IGOA 4G94A 2FNPA 2XAQA 2CTKA 4QMFB 2E5ZA 5IWAI 4DV5E 2MD0A 4HAMA 4UB6C 3ZXSA 4ASNA 4M71A 3RYRA 1ZARA 3IKTA 4DV2H 3BTIA 4BYYA 4BXFA 1FJLA 2FMYA 2AHQA 3FXQA 3EPZA 3WTUC 1MSFC 5EEGA 4CDGA 5FFXA 2F4MB 4DV2E 1N32H 1I3AA 3QRFF 4OIQF 1XX5A 2G8YA 2JPBA 3ERMA 1DPUA 5JEAD 3OIPA 1L3LA 3KX2A 4OO1F 1Z6TA 3K10A 2CUEA 3V8LA 2HR3A 2RDPA 2XGCA 3K4NA 3CCQI 2CGEA 3QOPA 3NARA 2F4VE 2DEIA 1LDJA 1HSTA 2RREA 4L9VA 2YS9A 4P1WA 3VODA 4A2UA 1S6LA 3PYGA 3EUHC 4DIQA 3V5RA 3TP0A 1R23A 2EFQA 4LF7H 1FPQA 5D4SA 3DKYA 2AXLA 2BW3B 4P5OA 1JUPA 2VLAA 4DPUA 1K4SA 1FNMA 4LG0A 1UDOA 4XSXF 4BS9A 3S14J 4RMNA 2O5RA 3LSRA 5C0XE 2ID3A 1MBJA 3VWBA 4DBRA 3JSOA 1G3SA 2X6WA 1OKRA 2K4BA 4M9XA 5LGNA 2COMA 2J65A 3D5RC 4FW7A 1VBIA 4QNJA 3V7SA 4KMFA 4KISA 3NEUA 4A5MA 4JI2E 4AIKA 2ZJRF 2FA5A 4ZDOA 3CJRB 5E3LA 5DDGA 2W84A 5D5UB 4LFCE 1JJ8C 2DFFA 3DQVC 4Y7NJ 1NHJA 3OTOH 2KISA 2KT0A 2Q8KA 4USKA 1X9ZA 1HBXG 4OO1C 1UEKA 3TDUC 4I76A 4TV7A 3HPGA 2EZHA 3BQZA 2W7NA 1XNQH 1MDMA 4JI8I 4DUYI 2E7XA 4FCYA 2M87A 1GV5A 3TMOA 3JRDA 4KHPE 3A2KA 4IX7A 1I3QJ 2DMQA 1VQKI 2QSHX 4DR2H 2CG4A 3HSRA 1JJ6C 4S0HB 4BJTA 3CCSI 3B6CA 3LA7A 2RNJA 3MFKA 5D5VB 3RZOJ 4IZKB 2XF5A 3L09A 3WTVC 4ZTJA 2LR8A 3IUOA 4JX5A 1QPIA 2LF0A 3JR9A 4C30A 4LGWA 4X64I 3GO5A 3FXLA 2WAFA 1IO2A 2COBA 4B3SE 4BA1I 5IOZA 3OMYA 2BOLA 2CTFA 3WTTC 4XMYA 2GBYA 2LY1A 1IF1A 1IBKH 4MQVA 4AYBA 3M4OJ 1R5HA 2Y75A 4EV0A 3KRNA 4JYAH 5J47A 3CMEI 2JN6A 5L3BA 1I94H 4DV7H 1P92A 1IRXA 1FEXA 4IJAA 3SFIA 4YY3I 2I5UA 3CLOA 1IC8A 2AO9A 2NXNB 3BQYA 3ZM7A 3E6BA 3BWGA 2BV3A 2AS5F 1WQ2A 2L4MA 2FOKA 2X9DA 4G6TB 2M30A 2OTLI 1XPXA 3DV8A 3R0JA 3TL4X 3MVPA 3GLLA 4OX9H 3K4JA 2IA0A 4LF9H 2JTVA 3M7GA 2YX7A 3OSFA 3I4NJ 2HVRA 2NYXA 1KIJA 5FLVA 5E1WA 3R4KA 1ZGJA 4HX8A 4GCVA 2LF7A 3ECHA 2CTMA 3AKZA 1GVJA 2DGRA 3B73A 4EJOA 2Z9OA 2CUFA 3LMMA 3PQJA 3FKJA 4OO1G 2DEJA 3IH4A 2PMUA 3P3CA 2VKCA 4KITB 4B3MH 5CKTA 5M5XJ 1ZM9A 2L7FP 5HODA 1IV8A 1S03G 1UDNA 5BPDA 1T38A 4Y3OA 5IYCJ 5C0XB 5F08A 1MMAA 4Y33A 3F8MA 5FO5A 4PJJA 1YOVB 4ABZA 1GUUA 1WVNA 1JE8A 2FX0A 2ME6A 5C0XD 4AUXA 3PRYA 2CSOA 3KZIC 1DT4A 4D0PA 4OAZA 1I50J 4FETA 3RTRA 2JWTA 3PIPF 3OS0A 5JVGF 3S1QJ 1Z2IA 2ZO4A 5F04A 5L3GA 1DP7P 2V2ZA 4E70A 2DDAA 5GADJ 4P9FA 1WWXA 3L1PA 4UUVA 1MMNA 1F0XA 2JMWA 3RIRA 1EA6A 2DXIA 2JUCA 4JI6H 2EZIA 1EH6A 1I1SA 1MJAA 4LF6H 5TGTA 3E6MA 1IGNA 3FHNA 4M3FA 2BZTA 3GUDA 3K0LA 3OS2A 4A3KJ 2ACJA 1F43A 2E1CA 3QYEA 4JP0A 1DGRM 3QT7A 4B3TI 5EDNA 1N25A 3HTSB 1E0EA 3V7CA 2IAIA 4A12A 1KKHA 5AIPA 2OUMA 3K1JA 2BVMA 5DRRA 5E17F 2F5EA 3FBIB 2DI3A 1G3WA 5E8IA 1ZLJA 3E7LA 4B3RH 4I2OA 5LRSA 2MG4A 2LF8A 3LSJA 4OAYA 2J7KA 2BVLA 1R4MB 2DOAA 3FM3A 3RKWA 1HNXH 5IYDJ 5A2QW 2RGVA 1HDPA 4PCQA 4V2FA 1S3JA 3SHFA 3LTOA 1VZ0A 3RKXA 4HPQA 3F3XA 1Z1DA 4LB6B 5FKLA 2IOQA 4JVYA 1QZYA 4M73A 3U2RA 2F1DA 4RAYA 2OCCH 1CGPA 1XMOI 1Z5AA 4U0YA 2NN6B 4NBQA 1H74A 3Q1QA 2UUCE 2M7BA 2YUSA 5CYVA 2LFBA 4P55A 3GTQJ 3L7ZB 4A3CJ 2H27A 2HQAA 2Q0OA 2BA1D 2W24A 2ZBKA 4D5CA 5KNLA 4KN7X 4DXLA 4LF8H 2HHHH 3DU6A 4DZPA 2LKPA 1N33H 1TP4A 3CDJA 3W2AA 4DR6H 4BDYA 2OC6A 3I55I 1EF4A 2BM0A 4FN5A 2NVTJ 2LVSA 5LMNI 4U3BA 3CZ6A 4MU1A 1W36D 2CGPA 2KDOA 4F92B 5DNXA 1QHGA 4BHBA 2PO0B 1BR1A 4UUTA 4LOCA 1U5TA 3LAPA 3BG7A 3CCUI 1J5EE 3T0YA 3WTYC 4IHWA 4BU2A 3BZKA 2NVXJ 2O03A 1WCMJ 2BR2B 4IF4A 2PY9A 1Q1HA 1B4AA 1WJCA 3P9KA 3IWFA 4IQ4A 3OYHA 4BACA 5KAIC 1YRNA 2CQ7A 1LQ1A 1IN4A 3B78A 3U1YA 2R7RA 2GQQA 4HSTA 4PJNA 1XHKA 1IDZA 4DR3H 4JI0E 2GAUA 2VL8A 4Y52J 4M6XA 3S1MJ 4JI5I 4DR4I 3S2HJ 4A5NA 1JGGA 3CUQB 4LFUA 2K5CA 4P7AA 1I1GA 2Q2EB 2FOWA 2P5KA 3EYYA 1FJGE 4NXNI 2PJRA 5E79C 2NN6F 3K4KA 2R93J 4A0ZA 4O3MA 1J4WA 3HOSA 2CS3A 2Z5CA 2FPHX 2CFOA 2L01A 2UXXA 2MBFA 5BR8I 4B3XA 4DV4E 2MC3A 1MD0A 4LFBH 3GCMA 1FI4A 1P4AA 2QSGX 3J80K 4ZVIA 1Z0XA 4M9ZA 2MFZA 4G6QA 2HKXA 4QLCU 3CP2A 3DFGA 3WU5A 5IY5H 4YEJA 4U0WA 3JAMK 1JKQC 2XROA 2K3FA 2XIGA 4B8XA 3VKEA 4DR5H 3W2VA 2Y9ZA 1ZREA 2BHZA 3F8CA 1TUAA 4E7ZA 1U8RA 3ZOBA 1I6HJ 4U7BA 2B7EA 4C9YA 1XMQE 2I8DA 2L9RA 1TL8A 2HOEA 2RC4A 2JUGA 4XRFA 1GXQA 3GZ5A 5LGTA 1QRYA 1DQUA 1S72I 4XLFA 3BR1A 1TT5B 4BEHB 5F6FA 2P5VA 5E3NA 1IN6A 1GT0C 1LE8A 3F21A 5L3JA 2MH2A 1HK7A 4AQYH 2TCTA 2PMHA 2ANNA 4LFAI 2WY8Q 3HEFA 4HZFA 1IBLH 1ZRDA 2YU9J 5F0CA 4EJUA 3GZNB 2ZXHA 1WI3A 5JVTA 4IS9A 3RZDJ 4BBSJ 2HKOA 4IXAA 1KTVA 5B1AH 2X6XA 3BROA 3JAMZ 4M9SA 2BA0A 2QKMB 5DV5A 1F1ZA 1X3UA 2YR2A 3U9GA 2BBYA 1TWGJ 3I9V2 3FK6A 3MEXA 1S7AA 5IOYA 3CESA 2QQBA 2P7VB 5L3CA 2VBYA 5GPCA 4FW5A 4ZJZA 4E9JA 3FMRA 3PFYA 1EKEA 4JVHA 2WB1N 1X4NA 5D8LB 5K36D 1JKOC 2HZTA 3DU5A 3KLNA 1K6YA 4BHPA 2C39A 4AVZA 4E7KA 4AWXB 3TEDA 1D1AA 1WHUA 3FDYA 2H1KA 1YLFA 1LVAA 5HLHA 2BYVE 3ERED 4A6EA 4D9JA 1G3YA 2HOAA 3QQAA 1OR7C 3QD7X 3FXOA 1X2NA 3F23A 2IS1A 4DQ2A 3QPLA 2PO2A 3GW2A 3KP3A 1GXPA 4LOMA 3H0DA 1BIAA 1H72C 3HKZN 2QVOA 1A36A 3DEEA 1IAWA 1FKAE 1MKMA 3ZZ0A 1MMDA 4Z7CA 1YE9A 5FD6A 4RB1A 2WNRA 3W6JB 1U5TC 4K0KH 4ZDPA 1Z67A 4PSWA 1HR0I 4A3LJ 2ELJA 3AAFA 1W0TA 5K5OA 2GO3A 3T1YI 4XSZF 2PG4A 1QNTA 3Q0VA 4I99C 1UFMA 3OL3A 5CQGA 4F55A 3RI4A 1VFCA 2JA8J 5FKNA 3NZKA 1AN7A 3KYCB 1VTNC 1NK3P 1HSJA 1BOBA 2PNMA 2MA3A 3VEPA 1V5EA 1NHAA 1MBEA 1EJ9A 1E17A 3RYPA 4B44A 2M0CA 3ZR8X 3ZQQA 1HW2A 1G2HA 1F5TA 4ZYHA 1OCPA 4I0AA 1LUJB 2VE9A 3OSSD 2IERA 1HNZE 4CCMA 2UXBH 2K86A 1HC8A 3Q0UA 4LJZF 2DU9A 1AHDP 2E5LE 4GKJI 2WA0A 4NB5A 3LSKA 4XLAA 3BC8A 2WTEA 4DYCA 5DROA 4ENJA 1STZA 5ED4A 1APLC 2FQ3A 1Z0WA 2LLKA 3VB2A 1CF7A 1S5LC 4ESFA 5GAGJ 2UUAI 2STWA 1PIEA 3HOTA 1IXCA 1ZGAA 3L9FA 2VQEI 3GLXA 4RLQA 4WK8F 2XRLA 2CU7A 4IZJA 4FE4A 5D5XB 3MKLA 4AIHA 3FHZA 1FYMA 1JGSA 2OTJI 2H1LA 3ZN0A 1A31A 4JI1E 2XAFA 3IWZA 3ZQIA 2JEBI 4YHHH 2JEBA 4DV0H 1B9NA 2E1MC 2Y0SA 4IKFA 1RUOA 3D4JA 2UXDH 1O7FA 3DEWA 1UDSA 3WE2A 4AD9A 4NXME 4JV5H 1LJ9A 4Z7YA 4DR1I 3MZHA 2MC4A 3ABKH 2VQCA 1JTXA 2ZJ2A 5EF6A 1B8IB 3A0HC 5HS8A 2KLOA 3DD6A 2ZITA 3KEOA 4Y15A 1QGPA 2VODA 3HUGB 2VQFI 4IQJA 4LIUA 1N34I 3SEQA 4XOTA 2ISZA 1WJEA 2D2WA 3QT5A 3ZQHA 4LF5H 1TQPA 1XMXA 1H0MA 3OWTA 4L9NA 1HXDA 2OCEA 4ZZDA 4HEA2 4WCGA 3CCEI 2M45A 3PS2A 4JI4I 2L9SA 4BY1J 2KP6A 4IHYA 4AM3A 3G4SI 1Z0EA 4EVIA 1BC7C 2O6GE 3HOZJ 1TW2A 9ANTA 2EK5A 5TRDA 4UV8A 3O6BB 4BQAA 1R58A 2H94A 2HU9A 2EV0A 2MD5A 2Y2ZA 4UHTA 2DAOA 3COAC 3MCZA 2CV1A 3HOUJ 2DOEA 1WHRA 4I7HA 2YPRA 1VISA 4RPFA 1UG8A 3H0GJ 2E5NA 3PNTA 4D1QA 3IRRA 4LF9I 3BDDA 2DN0A 2UU9I 2ZM6E 5F0FA 4X62H 2V2VA 3EYIA 1J9IA 4OO1E 2EJRA 3RF2A 2V9KA 2KIMA 2Z33A 4ZZLA 1VQMI 4IVNA 1SANA 2HDCA 4X1EA 5GTHC 5J40A 2XSDC 1HKSA 1YO5C 1KZHA 3N4MA 1S20A 1V4RA 1HKQA 4N4OB 4CYDA 3GTGJ 1W5SA 1MNEA 1XTAA 3M6AA 2CPQA 3OYJA 2WP8A 1OYYA 1E3OC 3FXMA 1Y5YA 1E3HA 3HBLA 3S2WA 3H4LA 2VQLA 3CUOA 4JX4A 4YIIA 2BHYA 4N0BA 1N36E 4CCOA 2CYYA 2X6YA 5IPAA 3QU6A 4OINF 2C6YA 5ICCA 4X66I 2BXZA 1OLTA 2K27A 3PL8A 4YRVA 2A61A 4NC7A 2JZXA 3PS3A 2HGCA 4H0EA 1H9GA 4ENMA 1LKXA 2QKLB 1LFBA 1UHSA 2HYJA 2YSRA 1C0WA 2VF3A 3S16J 3D0SA 2Y69H 1LB2A 3F22A 5E18F 2EFNA 4WXHA 4DPXA 3JRBA 1AA7A 2XKOA 5DRPA 1MG7A 2UXCH 2AE8A 1HW5A 1XGNA 3CDLA 1KU3A 2RAEA 3M7ND 4DV6H 5J8CA 5C3EJ 1D5YA 4KT6A 3LSTA 1U2RA 4QSHA 5LD2C 3AL0C 2A6TA 2DA3A 2P8TA 2PO1B 4GRIA 1TQIA 1PYVA 4X65E 3LAJA 3KYLA 4IFDA 5LL6b 3P9IA 3JAMQ 1F9NA 1BJZA 5IWAE 3R61A 4LF4H 2YU3A 2GXAA 4ISAA 1M1EB 2ECCA 2ZB9A 3OIOA 3L2VA 1PP8F 4MU3A 5JEAA 2XF6A 4ETSA 4B1RA 1MMGA 4WALA 3MKWB 3ZMVA 5J8FA 1LPQA 1DDNA 4JI3H 1JUSA 2O0YA 2JEAA 4DUZH 4O6JA 4GKKH 3VYSB 3L2WA 3GTLJ 3D1NI 1XG1A 2KMUA 3S3OA 4N9HA 4X6AJ 1U78A 5DD8A 4DW6A 2A3SA 1JKRC 4NUBA 1X58A 2VASA 3A01B 2B0LA 1X1CA 2VKVA 3G2BA 3PJRA 4DYQA 4Q47A 2ICWG 2D1HA 2EQRA 4J01A 1SEIA 3QU3A 1UB9A 3JAMC 1XNRH 5DCMA 2DPUA 3CC4I 1KQ8A 4LITA 4M72A 1LEAA 3H3ZA 3OOPA 5BS6A 1R4NB 4WXCA 3WE3A 2WWYA 5F64A 1Z5BA 4EC5A 4OO1B 1ETOA 2O9LA 5A2QK 5FLXK 4HNTA 3WTWC 3M8EA 3J7YJ 3LFUA 2H8RA 3ZKBA 4WUDA 3ZQGA 4FW9A 2L54A 5LEKA 4RAGA 3QP5A 3CMMA 4AYBN 2CTLA 1ETKA 4CHUA 2ANRA 1HNWI 1TBXA 2UUBH 4DR7H 2HZDA 5DUIA 4MYUA 1IG7A 3K1MA 4MTDA 4PFOA 1YITI 3BZ6A 2EB7A 1MGTA 4URLA 4HDVA 2X51A 3VSKA 2WBMA 4WF2A 4A3GJ 2TDXA 2VT3A 1YIOA 1ZK8A 3CMYA 4DV5H 2DFEA 4USMA 4JI8E 4M3GA 5LBQA 4DUYE 2E2IJ 3BP8A 1Z0GA 2KIQA 1D1BA 3PUBA 1RR9A 1ZKGA 2IRFG 1OCCH 1BIBA 2KIFA 2V4JC 4DPYA 2EBIA 3DTIA 4XR6A 4V19K 3BG9A 3W2WA 1RR7A 4Q48A 4AIDA 3K4MA 3D5SC 1HA8A 1JUMA 2ID6A 2HPIA 4MEYF 4JBAA 1Z0CA 3K2ZA 4MYTA 4IFDD 4X64E 4L9TA 2H6CA 2HOSA 3KDGA 3ZMDA 2F4VH 1YW9A 1VQNI 3P3EA 4PRVA 4CZZA 1DPRA 4RB0A 1N75A 3B02A 5GMDA 4NNJA 2QUFA 3ZCOA 3PFIA 5CVVA 1CQTA 3RKQA 2IEKA 4MHGA 3H9QA 2GA1A 1S8NA 3IHUA 4YY3E 3T1BA 4JYKA 1FIAA 1WSUA 1VQ8I 1WTJA 1IRZA 4EM2A 3T1HI 3CJQB 1YFHA 4JI3I 4G7OF 3BG5A 4JI2H 1R6RA 1OJLA 1EH7A 5KCMA 3MAJA 2OF7A 2VIXA 1RREA 4JG4A 1TWFJ 2GIZA 4DUZI 1FX7A 4LFCH 4YIFA 1D1CA 5EJCA 1SFOJ 1O7LA 4I98B 4QNKA 2LRDA 3QWLA 1Y0NA 2NVYJ 5JEAC 4L0ZB 3NRVA 5E1XA 1OPCA 1TT0A 4Y17A 2HYFA 3S1RJ 2XV4S 3Q6NA 4KHPH 3K4LA 4DV3I 2L7MP 3IH2A 2VN2A 4DBQA 3J7ZI 4IZKA 5BPIA 4XL9A 4LG0B 2CV2A 4OKGA 4I09A 2R7SA 4IHSA 3GABA 3RDIA 4FISA 3I58A 3KP2A 3S3NA 3R60A 1RNLA 4NQWA 4FJUA 5EKWA 2F5CA 1N77A 5LFAA 4PJ0C 2LDUA 1MZBA 2G7UA 2KZGA 4IRGA 4RBOA 4OIPF 4EATA 1IBMI 4B3SH 1Z59A 3PNYA 3EDPA 4JI7I 3C2HA 3UR3C 3X2QH 1MIJA 2M1BA 3TOAA 1S7EA 4GYIA 3BR0A 2M7AA 3DXJF 3WTXC 5J3LA 3WU0A 4KUMA 2WY7Q 2DMNA 3UNGC 3JRGA 2ESNA 1LDKB 2CFXA 3KLOA 3NWTA 3OY9A 2D45A 3HG9A 3AG1H 3CJNA 4KJZA 4RB3C 3K70D 2VI6A 1MDMB 2R92J 5ILSA 3GFLA 2IS6A 1VIHA 3GFJA 4IOAF 3ABTA 2JA5J 2DW4A 3LQRA 4XQFA 4XRMA 3PO3J 1S16A 2V1UA 4DV2I 2NN6E 4HYMA 1ON2A 2PFBA 4HACB 2DFHA 3DPTA 2XRNA 3WG7H 4ED4A 1J75A 1Z3YA 1N32I 2HQNA 4B3TE 2JT1A 3LSHA 4ENNA 2EWNA 1B72A 2DMUA 2HFSA 1PUFB 3E5QA 3IL2A 1WJBA 1YS7A 2ISYA 1Y6IA 1BI1A 2X1CA 3SXYA 2KRHA 4BA1B 3AEVB 2UV1A 5ICEA 3WHBA 1FOYA 3VSLA 3NWSA 4XLPF 1WPKA 3CJTB 1BBYA 1PJRA 4I0BA 1IJWC 5ERIA 4XRSA 2WAQA 2NS0A 3ZP5A 1B9MA 2R5ZA 3QT8A 1KONA 4A3IJ 2ESHA 2HWVA 4LF7I 5JI6A 2FD5A 4PFPA 5C0XA 5KAFC 4W97A 5CQEA 4BH9A 1FT9A 1XMOE 3HOYJ 4XLCA 3HB9A 3HULA 1NHHA 5DM6F 1DU0A 2M2EA 2K9MA 2VKHA 2IVMA 1F4KA 1PVGA 4B48A 5EEHA 3OYBA 5DD4A 4U88A 1FIPA 3OV8A 4EMSA 1ZQ3P 3LSMA 3HSEA 2CVEA 1O3TA 3SZPA 5FKMA 1Z0BA 5IT9K 1J7KA 3E0JB 2DYRH 2MABA 5LMNE 4HLYA 2EFOA 2L7ZA
chains in the Genus database with same CATH topology
2E3UA 5JEAG 5JEAF 1UDQA 5JEAA 2C39B 4WALA 2PQUA 2PNZA 2FMRA 3H1CA 2BA0G 1ZZIA 2BA0A 5JEAC 3M7NG 3DD6A 5C0XC 4BA2B 4BA1I 2NN6D 1X4MA 2CTJA 4LIJA 2Z0SA 2JEAA 4JVYA 2CTFA 2JE6I 2OPUA 2JE6A 1R6LA 1E3PA 2C38A 2NN6B 4NBQA 3KRNA 4JVHA 5K36D 2C39A 4AM3A 1OYPA 3L7ZB 4IFDF 1KHMA 1WHUA 1J5KA 2YQRA 2JA9A 2BA1D 5K36B 2WNRB 4OO1D 1DTJA 3CDJA 4IFDC 3M85G 2CTKA 4QMFB 2BL5A 2PO2A 4OO1B 2NN6G 5K36E 2PO1A 3GLLA 4B8TA 1ZTGA 3H36A 2PO0B 2JEAI 3HKMA 3L7ZA 2BR2B 1OYRA 2CTLA 2ANRA 2PY9A 1WE8A 2AXYA 2WP8B 5K36G 4OO1E 2C37B 2CTMA 2WNRA 2DGRA 1VIHA 2JEBB 2QNDA 2BA1G 5JEAD 4OO1G 4OO1F 5C0XD 4OO1A 2NN6E 4BA2I 4BA2A 2PO0A 2HH2A 1UDNA 1X4NA 2BA0D 1R6MA 5C0XB 2BR2A 3B4TA 3CDIA 2CPQA 3U1KA 2NN6F 2WP8A 2NN6A 3GMEA 1E3HA 2C37A 1ZZJA 1WVNA 1J4WA 2MJHA 2HH3A 4BA1B 4AIDA 1UDOA 3V69A 3AEVB 5C0XE 1DT4A 2CTEA 2NN6C 5K36F 5K36A 1EC6A 3GCMA 2JE6B 1OYSA 4IFDD 2JZXA 3L7ZC 5C0XG 5C0XF 5C0XA 4AIMA 5K36C 4IFDB 2JVZA 3VKEA 4WANA 3M85D 5JEAB 1TUAA 4BA1A 2P2RA 3M7ND 4OO1C 4IFDE 2OPVA 2PNZB 2PO2B 1ZZKA 2PO1B 2JEBI 2JEBA 5JEAE 1VIGA 2JEAB 4IFDG 4IFDA 1K1GA 1UDSA 2ANNA 2C38B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3U A;  5JEA G;  5JEA F;  1UDQ A;  5JEA A;  2C39 B;  4WAL A;  2PQU A;  2PNZ A;  2FMR A;  3H1C A;  2BA0 G;  1ZZI A;  2BA0 A;  5JEA C;  3M7N G;  3DD6 A;  5C0X C;  4BA2 B;  4BA1 I;  2NN6 D;  1X4M A;  2CTJ A;  4LIJ A;  2Z0S A;  2JEA A;  4JVY A;  2CTF A;  2JE6 I;  2OPU A;  2JE6 A;  1R6L A;  1E3P A;  2C38 A;  2NN6 B;  4NBQ A;  3KRN A;  4JVH A;  5K36 D;  2C39 A;  4AM3 A;  1OYP A;  3L7Z B;  4IFD F;  1KHM A;  1WHU A;  1J5K A;  2YQR A;  2JA9 A;  2BA1 D;  5K36 B;  2WNR B;  4OO1 D;  1DTJ A;  3CDJ A;  4IFD C;  3M85 G;  2CTK A;  4QMF B;  2BL5 A;  2PO2 A;  4OO1 B;  2NN6 G;  5K36 E;  2PO1 A;  3GLL A;  4B8T A;  1ZTG A;  3H36 A;  2PO0 B;  2JEA I;  3HKM A;  3L7Z A;  2BR2 B;  1OYR A;  2CTL A;  2ANR A;  2PY9 A;  1WE8 A;  2AXY A;  2WP8 B;  5K36 G;  4OO1 E;  2C37 B;  2CTM A;  2WNR A;  2DGR A;  1VIH A;  2JEB B;  2QND A;  2BA1 G;  5JEA D;  4OO1 G;  4OO1 F;  5C0X D;  4OO1 A;  2NN6 E;  4BA2 I;  4BA2 A;  2PO0 A;  2HH2 A;  1UDN A;  1X4N A;  2BA0 D;  1R6M A;  5C0X B;  2BR2 A;  3B4T A;  3CDI A;  2CPQ A;  3U1K A;  2NN6 F;  2WP8 A;  2NN6 A;  3GME A;  1E3H A;  2C37 A;  1ZZJ A;  1WVN A;  1J4W A;  2MJH A;  2HH3 A;  4BA1 B;  4AID A;  1UDO A;  3V69 A;  3AEV B;  5C0X E;  1DT4 A;  2CTE A;  2NN6 C;  5K36 F;  5K36 A;  1EC6 A;  3GCM A;  2JE6 B;  1OYS A;  4IFD D;  2JZX A;  3L7Z C;  5C0X G;  5C0X F;  5C0X A;  4AIM A;  5K36 C;  4IFD B;  2JVZ A;  3VKE A;  4WAN A;  3M85 D;  5JEA B;  1TUA A;  4BA1 A;  2P2R A;  3M7N D;  4OO1 C;  4IFD E;  2OPV A;  2PNZ B;  2PO2 B;  1ZZK A;  2PO1 B;  2JEB I;  2JEB A;  5JEA E;  1VIG A;  2JEA B;  4IFD G;  4IFD A;  1K1G A;  1UDS A;  2ANN A;  2C38 B; 
#chains in the Genus database with same CATH topology
 1SFX A;  3PO2 J;  2QBY A;  2NNY A;  3HRM A;  1BKN A;  1XNQ I;  2FFM A;  4OMY A;  5KVR A;  1H73 A;  2CUZ A;  3ZN1 A;  3SB1 A;  4CGZ A;  4Y13 A;  2LSO A;  3U21 A;  2ZME A;  2CQK A;  4UB8 C;  4XLE A;  2KFD A;  4DR2 I;  3PNV A;  4ITV A;  4UTG A;  1K4T A;  3ZQL A;  3BR3 A;  2FBH A;  3V42 A;  5C44 J;  2W00 A;  5M5W J;  2ZNZ A;  5H20 A;  1LNW A;  4UUS B;  4JI5 E;  2M4G A;  4DR4 E;  2VOO A;  3G1L A;  2Y30 A;  5BNG A;  2RN7 A;  4MGR A;  2KJB A;  3I56 I;  4LLG F;  2PMZ A;  4R79 A;  3ZMS A;  4NXN E;  3R0A A;  4XOR A;  1GVD A;  1ORK A;  2V6C A;  4HOB A;  2NOJ B;  1QU3 A;  4MU4 A;  4WUB A;  1ETQ A;  5CJ9 A;  3L00 A;  2V9P A;  4KIF A;  4B4C A;  3M85 G;  2F5D A;  2XAH A;  3NQO A;  4M6Y A;  5EGO B;  5BR8 E;  1IBK I;  4JYA I;  1S7O A;  1ZEL A;  2GO4 A;  4YG2 F;  1I94 I;  2LMD A;  4J19 A;  4DV7 I;  1Y0U A;  1XD7 A;  2JJ7 A;  5HVQ C;  1YIJ I;  5HS9 A;  2PI0 A;  3I5U A;  1BW5 A;  2ZQE A;  1EA3 A;  2OPT A;  2UUC H;  1K61 A;  2O3Z A;  3NAU A;  4LD5 A;  3L7Z A;  2FUG 2;  2QCO A;  3J81 W;  1FBQ A;  1P7J A;  1YH8 A;  4U7D A;  4LPF A;  1YX5 A;  2C37 B;  5HLI A;  2ETH A;  2LOO A;  3SDB A;  2Z99 A;  5DM7 F;  2DA1 A;  4BL0 B;  4FWG A;  2OZU A;  4UVB A;  3OYI A;  4LCG A;  4OX9 I;  1RKT A;  1ETV A;  3M1E A;  4FX4 A;  4F91 B;  3BCA A;  3GFI A;  2DCE A;  1UST A;  3S93 A;  1YHQ I;  1SAX A;  3LQQ A;  1H88 C;  2HPM A;  1DAR A;  2LJP A;  5FLX Q;  2O8X A;  5HNF A;  2PO0 A;  1IZ1 A;  3CF2 A;  3GBG A;  4ANJ A;  4IHX A;  1AOY A;  2BR2 A;  3B4T A;  1DP3 A;  1J5E H;  3EZJ A;  1SVL A;  3RPU D;  2VC1 A;  3B82 A;  1ZZJ A;  4LLN A;  1TLH B;  3Q6M A;  4LFA E;  2MJH A;  3LSP A;  1FY7 A;  3Q9S A;  3BLY A;  1K78 B;  2A69 F;  4ZTF A;  1N78 A;  1OYI A;  4NZR M;  2CRG A;  2HEO A;  1ZN2 A;  4B3M I;  4KIG A;  5K36 A;  4RGU A;  1RPW A;  3OYC A;  3PYE A;  3ELK A;  4JI0 H;  4BQO A;  4E7L A;  1BR4 A;  3CUQ A;  1HLV A;  1HDD C;  4CSW A;  2CW7 A;  1WZ2 A;  4CA0 A;  1PUE E;  1RC9 A;  1UZC A;  1IUY A;  4C2M J;  1FJG H;  1X19 A;  3A02 A;  3I59 A;  5DEQ A;  3TW6 A;  2VBW A;  3JRF A;  2ZBK B;  5FLX C;  5LMU H;  4PGH A;  1SVO A;  2GIV A;  3TQN A;  4BQN A;  2M8W A;  4D7M A;  5LMU E;  1VQ7 I;  2GWR A;  2X85 A;  3C7J A;  1VI7 A;  4BE2 A;  2F2E A;  3JTH A;  1OCT C;  3ABU A;  2PNZ B;  4DV4 H;  2A5Y B;  4KFC A;  1O3R A;  2XPU A;  3H35 A;  4XKW A;  3BJA A;  1IN8 A;  1W36 C;  2F4I A;  2R7F A;  3O8H A;  2EV6 A;  3GYH X;  2K3P A;  3WTS C;  1BJA A;  1VQ9 I;  3RJP A;  4JI6 I;  3S2D J;  1V3F A;  2C38 B;  4LF6 I;  3SFZ A;  4H8A A;  3I4M J;  2HKJ A;  1YRN B;  2OJE D;  2FBK A;  3C1D A;  1FBU A;  1RKW A;  2MLK A;  4R1F A;  1IUF A;  3M9A A;  3FKI J;  3OOU A;  1FMW A;  3H1C A;  4E7H A;  1XMQ H;  2DQL A;  2VJ4 A;  2JSP A;  3K1P A;  2VKD A;  5K1Y A;  3HOX J;  4HY1 A;  2LKX A;  2K9S A;  3KE2 A;  2IGM A;  5ICG A;  2NN6 D;  2Z0S A;  3DPU A;  4B3R I;  4HYE A;  2P7C B;  2MH9 A;  1IDY A;  2BY1 A;  1D8J A;  2PJR B;  2OPU A;  2Y0S N;  2ZME C;  2E19 A;  2M34 A;  4YEL A;  2R5Y A;  2OI2 A;  3T1Y E;  2P6S A;  3ASO H;  1FZP B;  4JOM A;  4MFD A;  1NG6 A;  1HNX I;  1OYP A;  3HHG A;  3RKY A;  4OCH A;  2E2H J;  3V8K A;  4Z2Y A;  1W1W E;  5HDG A;  3HXL A;  3J80 Z;  2XPW A;  2KRC A;  3HSF A;  1XN7 A;  1IXR C;  1ON1 A;  1TQM A;  5HS7 A;  3ZGK A;  1YHC A;  5BOX A;  2R7U A;  2LNB A;  4HRI A;  4KIC A;  2DK5 A;  3CP8 A;  5EZH A;  1P6R A;  4GKJ E;  1ZTG A;  3QAH A;  2EA2 A;  4UT4 A;  3E6D A;  4LF8 I;  5B1B H;  2HHH I;  2PX9 A;  1UHM A;  1YJN I;  4OU0 A;  1N33 I;  3LNU A;  3VYT B;  1UCR A;  3QPH A;  1Z3X A;  2DT5 A;  2UUA E;  4DR6 I;  2QF7 A;  1ENH A;  3M8F A;  3K7A J;  4G12 A;  1Y4U A;  2BA1 G;  2VQE E;  1UEL B;  2HQR A;  1LE8 B;  1V9N A;  2JPC A;  3FK7 A;  3BY6 A;  2K9N A;  2HNH A;  4F3Q A;  3S3M A;  4FWH A;  4GXO A;  3WU3 A;  4OWR B;  2XSJ C;  1R6M A;  2R7T A;  4KT5 C;  1KYW A;  4FWD A;  2XUB A;  4II2 A;  2HTS A;  3OYM A;  3A4C A;  2Z5B A;  1FKA H;  3O2P E;  1PQX A;  1IN5 A;  5HNH A;  1H7S A;  4DR3 I;  2HH3 A;  4C3J J;  1UJ8 A;  3GKU A;  3W6K B;  3BG6 A;  4BJ6 C;  4P96 A;  3CMA I;  4ZDL A;  1LDD A;  4BXU A;  4LMY A;  1EC6 A;  1BR2 A;  1IRG A;  3UHM A;  4CYC A;  4MFE A;  2KL4 A;  1OYS A;  1WH7 A;  2L3D A;  2VXZ A;  1V55 H;  4CCL A;  2FJ1 A;  3G1M A;  4CIC A;  4NDL A;  1NH3 A;  4RS8 A;  4G8X A;  1N34 E;  3GEZ A;  4AIM A;  4UXN A;  1B1B A;  4G6D A;  5K36 C;  2JVZ A;  3WU1 B;  2VXD A;  4N9I A;  4A3B J;  3S32 A;  3F8F A;  3CUQ C;  1T0F A;  2R3S A;  2Y9Y A;  2BEO A;  3FMS A;  3KFW X;  3ZZU A;  2DT7 B;  3IP4 B;  3V7R A;  2KHM A;  4LFB I;  2CW8 A;  4JI4 E;  4LB5 A;  3MMY B;  4CO8 A;  2HVS A;  4J3D A;  2F6C A;  1RRJ A;  1AKH A;  2PO2 B;  1HNZ H;  1J09 A;  5LRR A;  3EUA A;  5D4R A;  2E5L H;  3G73 A;  4M3E A;  1MMS A;  2MSY A;  3HJC A;  4DR5 I;  2Y31 A;  3DLL F;  2R7V A;  1Z77 A;  5D5W B;  2R7X A;  3ZQC A;  2IGN A;  1KA8 A;  3IH3 A;  4LF9 E;  1ZYR F;  1REP C;  2DTZ A;  1TWH J;  5EYR A;  4FW4 A;  4JX6 A;  2PQU A;  1Z6R A;  4PJM A;  3CC7 I;  3D5L A;  2VQH A;  2LTM A;  1P4W A;  1FP2 A;  3FXU A;  4IPA A;  1X1D A;  4AQY I;  4JI1 H;  1VQO I;  4HV5 A;  5GTI C;  3HRU A;  1SD5 A;  4FAS D;  1IBL I;  4A3J J;  1S4E A;  5KK1 A;  5IT9 Q;  1Z0T A;  4S04 A;  4FW3 A;  3BR6 A;  3PYD A;  2IOP A;  4NXM H;  3QOD A;  1ETY A;  3EUK L;  4B47 A;  2HOT A;  2H09 A;  1B8I A;  3QPT A;  5IP6 A;  1TTY A;  4A93 J;  2QLZ A;  4D5F A;  1FWZ A;  3HUG A;  1OMI A;  1RUN A;  2KRF A;  4YFN F;  5JFR A;  4L5E A;  1K7A A;  4FT8 A;  3GXO A;  4L0Y B;  1FTT A;  1CF7 B;  5LLQ A;  1ZH5 A;  1B63 A;  4NC6 A;  3GR5 A;  4P52 A;  1U9O A;  1P42 A;  3AL0 B;  2QQA A;  3ULQ B;  4E6K G;  2AQE A;  3HM5 A;  4MDT A;  2IS2 A;  1OYR A;  3F8B A;  2PLY A;  5IT9 C;  2FE3 A;  2AXY A;  4IZJ B;  5K36 G;  5KHD A;  1Y4S A;  1MJ9 A;  4HDU A;  4Y4R A;  2JEB B;  1BW6 A;  3A03 A;  2HDD A;  1X1P A;  3H5N A;  1TC3 C;  4HSR A;  2FSW A;  5EG0 A;  4FTH A;  3H92 A;  4K2E A;  4I3H A;  1S9H A;  4EQQ A;  2W48 A;  1VQP I;  4XK4 A;  1LFP A;  1T8I A;  3K6G A;  3BZC A;  3PUF A;  2ZM6 H;  2HI3 A;  3U1K A;  1W7P B;  4K0K I;  3KPH A;  3GME A;  1RHY A;  3GON A;  2EFW A;  3RQI A;  1T56 A;  1YX3 A;  2OQR A;  3Q9V A;  1P4X A;  3HJE A;  4LLL A;  4NC8 A;  4MNU A;  2M8G X;  2V6E A;  3ZKD A;  3K2A A;  2RV8 A;  3AG2 H;  4DZJ A;  4A3F J;  3LA2 A;  1P2F A;  5FKK A;  4XTJ A;  3HGY A;  2W25 A;  4YIR X;  3CCM I;  4Q4Z F;  2PNL A;  2M5W A;  2N8G A;  3HRT A;  1B6A A;  1JI8 A;  1V8C A;  3C2G A;  1O3Q A;  2K40 A;  2K4J A;  2QQ8 A;  1QA6 A;  2UXB I;  2L9V A;  1UG0 A;  1P7I A;  2DA4 A;  3RPQ A;  4XIC A;  3SDG A;  5B5E C;  1MBF A;  1N36 H;  2KKO A;  3KZZ A;  3PSF A;  1IV6 A;  4RGR A;  4L5I A;  1B59 A;  4C2T A;  3CQZ J;  3JRC A;  2HYG D;  2D9I A;  2FU4 A;  1FSH A;  1VIG A;  2E60 A;  3GWZ A;  5GAE J;  3WTZ A;  1DGW Y;  2AXT C;  4O5V A;  2JA6 J;  2H6B A;  1SFE A;  1XSX A;  4DV1 H;  2XF7 A;  2LBF B;  1VQ5 I;  5AIQ A;  1H9T A;  2E3U A;  3PQK A;  2G7H A;  3OL4 A;  5K7H A;  4DV1 E;  2X06 A;  2NVU B;  1YJ9 I;  3B8H A;  3F9K A;  4OIR F;  3FIS A;  2LP0 A;  4DPW A;  4MQY A;  4YHH I;  4DV0 I;  1J5Y A;  1MND A;  3ROU A;  3S1N J;  2FMR A;  3MKY B;  2BA0 G;  1HNW E;  2Y48 A;  1Z7L A;  5F1J A;  2IA1 A;  5M3F J;  2UXD I;  1NZ0 A;  4PJL A;  2FNA A;  1E2X A;  4LIJ A;  3LSG A;  2D5V A;  4UV9 A;  5TIS C;  4JV5 I;  4R1H A;  4X65 H;  1JT6 A;  2JE6 I;  3IAS 2;  2IGK A;  4M6V A;  3I64 A;  2JE6 A;  3J80 Q;  2A05 A;  3OR2 C;  5IWA H;  2IW5 A;  4B8C D;  3JAM W;  3MWM A;  5FD5 A;  1USV A;  1FWK A;  2A1S A;  1ZRC A;  2A6E F;  3P06 A;  4HNV A;  1W5T A;  4A69 C;  4PRX A;  5D6E A;  4LF5 I;  2ZJQ F;  3HC7 A;  1HW1 A;  1EH8 A;  4Z6Y A;  2K85 A;  4NZT M;  4AVP A;  1G3T A;  1X3Z B;  1ZG1 A;  4WWC A;  2LRE A;  3TBI A;  3H36 A;  1QPM A;  2JEA I;  4G7H F;  2IES A;  1KU2 A;  3PS1 A;  1GDT A;  2UWM A;  2DBB A;  5DCF A;  3ABM H;  1XGO A;  3IKV A;  1EV7 A;  4LK0 F;  1U9N A;  4HX4 A;  3J80 C;  1UMQ A;  1MBH A;  1BI0 A;  5C4X J;  1U3E M;  1OJ4 A;  2QND A;  2L02 A;  4EJW A;  5C4J J;  4BE0 A;  1TWC J;  3RCO A;  1K83 J;  4ZC3 A;  3HHH A;  2CUJ A;  4QWQ A;  3WHC A;  4OO1 A;  1KGS A;  4OIO F;  3RSN A;  4BA2 I;  1W5C C;  4X62 I;  4BA2 A;  4AU7 A;  5J4V A;  2R3V A;  2L4A A;  2CWE A;  2JSC A;  3ZMZ A;  3QOE A;  3T1H E;  3CO6 C;  5ICF A;  2KIU A;  2TRT A;  2X7I A;  2F5V A;  3K69 A;  2NPF A;  2V34 A;  1HQC A;  3HRS A;  3V69 A;  2X36 A;  1XCV A;  2DT6 A;  1FSE A;  4P9U A;  2NAZ A;  1RR8 C;  1UHW A;  3HGG A;  3J81 K;  4KQV A;  1D8K A;  1HF0 A;  3OYN A;  3FMQ A;  1ODD A;  1XC5 A;  1UAA A;  1P9Q C;  3DBL B;  1EI1 A;  3BT9 A;  3KZY A;  4DUY H;  4JI8 H;  2BY3 A;  2PT7 G;  5LHH A;  2E34 A;  1I5Z A;  3DKW A;  1V5G A;  4RM3 A;  5CVI A;  2IPQ X;  5DCM B;  4DV3 E;  5CLS A;  2A5W A;  3DBR B;  1MH3 A;  3I0P A;  1FWL A;  4EGZ A;  1RI7 A;  3OR1 C;  4M74 A;  1YQA A;  1QVT A;  5L3F A;  4GQU A;  2P0W A;  5HDN A;  2HQ5 A;  1WUU A;  5FLX Z;  5A2Q Z;  1T95 A;  2K1H A;  2ZXW H;  2E1O A;  1MU5 A;  4EMD A;  2L5Q A;  1F36 A;  2WC2 A;  3TDZ C;  3U1D A;  4BHC A;  4C3I J;  4X64 H;  2Z3Y A;  2DA7 A;  2E1N A;  2WAQ N;  3TO7 A;  2I10 A;  1K1G A;  2UXC I;  3L2C A;  3ZMU A;  2IA2 A;  2QSF X;  2NS8 A;  4JI7 E;  4DV6 I;  1WFX A;  2XB0 X;  5JEA F;  1BA5 A;  1NK2 P;  1RES A;  2EZK A;  5K7Z A;  2JA2 A;  2QYO A;  4DYR A;  4ZYE A;  3Q0W A;  2HXI A;  2IP2 A;  1PP7 U;  1BI3 A;  1SEU A;  2BW3 A;  2QZ8 A;  2W57 A;  3A1Y A;  5JHU A;  3M7N G;  2MGQ A;  4HNU A;  4YY3 H;  4LF4 I;  4WX9 A;  3BJO A;  1T6S A;  3EQL F;  1R36 A;  1DUX C;  2EA4 A;  3BTL A;  1R6L A;  3DWL E;  2A2D A;  1XGM A;  2M4K A;  2DK8 A;  2LK2 A;  1SD6 A;  2OV7 A;  2VQG A;  3LWF A;  2KPM A;  3I4P A;  1ZHF A;  5FGM A;  3H3U A;  4XLN F;  4MLO A;  1N32 E;  2YQR A;  1U6G A;  5EZG A;  1WGX A;  2HFH A;  1T08 B;  2LY2 A;  3K1N A;  4YFK F;  4LK1 F;  3W6V A;  4GKK I;  3MKZ A;  4OO1 D;  5J1R A;  2LKS A;  5ELW A;  1FYL A;  4IFD C;  2FRH A;  3GZ6 A;  4N4N B;  5D8K B;  2UZK A;  1BOA A;  1L0O C;  2V8P A;  2DJN A;  4BDZ A;  2CG9 A;  4FE7 A;  2PBI A;  3CC2 I;  1Y60 A;  4DR7 E;  1BN5 A;  4B43 A;  2X48 A;  2HK3 A;  1XMA A;  1XNR I;  5J6X A;  4LF7 E;  1Q1V A;  2K02 A;  2Y0M A;  1RZ4 A;  4BY7 J;  1Y8R B;  1N0V C;  4H4K C;  4HQM A;  5IP7 J;  5DS9 A;  2DA6 A;  2PMZ N;  1YTY A;  3I3L A;  2M0M A;  1FC3 A;  3LPS A;  2V1N A;  1XCB A;  2LTL A;  2DMP A;  2OU2 A;  3LOC A;  3ML6 A;  5E8G A;  1ONV A;  3TGN A;  3CCJ I;  1X1A A;  1D5V A;  4QIW N;  5K7F A;  3ZZT A;  3OET A;  4A6D A;  4DR7 I;  1ZTR A;  1ETW A;  2UUB I;  4HF0 A;  3OYE A;  1U0J A;  2VBX A;  1AWC A;  1WJ5 A;  5HOO A;  3CCR I;  3H3V K;  2VB6 A;  3H9G A;  4IRI A;  1Z05 A;  3ZMT A;  3OTO E;  2VJ5 A;  1BL0 A;  2CTE A;  2ELH A;  1XNQ E;  3GF2 A;  4DV5 I;  1A6F A;  3CCY A;  5D6F A;  1R49 A;  3K9T A;  2ADU A;  4HAC A;  2XAJ A;  2O4C A;  4DR2 E;  1MBK A;  4PU9 A;  3Q3S A;  1G4D A;  4XNF A;  4XN0 A;  4QPQ A;  2FQ4 A;  2NVQ J;  5GAH J;  1D3Y A;  4DJA A;  1ZXN A;  2VE8 A;  4I01 A;  1KU7 A;  4Q5S F;  4B3T H;  1PUF A;  2NS7 A;  4NQW B;  3SZT A;  2E2J J;  4HF1 A;  4IRH A;  1H89 C;  3M85 D;  2ELK A;  3K4B A;  4JK1 X;  1POG A;  4FX0 A;  4BA1 A;  4I6Z A;  1FYK A;  3J7A K;  3KYD B;  2IJL A;  3KP7 A;  2OPV A;  1HCR A;  4PK4 A;  4N3O A;  2F4O B;  4RDU A;  2F4V I;  1FMV A;  2GXG A;  1WJA A;  4KMU X;  3WU2 C;  1MBG A;  2XKP A;  2BXY A;  1ZG5 A;  4IFD G;  3BPV A;  3JRI A;  1X4P A;  2RNG A;  4IL6 C;  1IBK E;  1SFU A;  1SC7 A;  4JYA E;  5JEA G;  1I94 E;  4DV7 E;  1XMO H;  3GTJ J;  1S29 A;  3K70 C;  3S17 J;  2O61 A;  1J2X A;  2IXS A;  3OYK A;  3E97 A;  1SFK A;  3J7A M;  2QWW A;  4XN3 A;  5FKO A;  3TO6 A;  3Q5F A;  3WG9 A;  2OQG A;  3F8N A;  3RPU A;  2IT0 A;  2E7W A;  3HOV J;  4JI2 I;  3M8J A;  3OYG A;  2HTJ A;  4ZH4 F;  3F6O A;  4JQF A;  1B72 B;  4OX9 E;  4LFC I;  1E3P A;  3OSG A;  4XBF A;  2LY9 A;  5L3E A;  5LMN H;  1BM9 A;  2WV0 A;  4XLH A;  2P5L C;  4EJV A;  3OYD A;  3ECO A;  4KDP A;  2V79 A;  2WV1 A;  1J5K A;  5H2F C;  1NG7 A;  3VYR B;  2V1X A;  3FM5 A;  2KQR A;  3QYF A;  3QP6 A;  5DYM A;  2R5Z B;  3M07 A;  3OIQ A;  4BKX A;  1XS9 A;  4KHP I;  2R0Q C;  2ZKZ A;  4ON0 A;  1FNN A;  1Y1W J;  3I53 A;  3FX3 A;  1U2W A;  2VKE A;  3BPX A;  3DEU A;  1R71 A;  5FFZ A;  4HF2 A;  4B3M E;  5K36 E;  4UUS A;  2V7F A;  1RIO H;  2ZFW A;  5F27 A;  4IOC F;  3WU6 A;  4B8T A;  4JI5 H;  2EV5 A;  4DR4 H;  3BR2 A;  1I6U A;  3ISP A;  1WE8 A;  3KP5 A;  2CW0 F;  1QQI A;  4B3S I;  2XGX A;  4NXN H;  2DA2 A;  4M3B A;  4RGS A;  1KYZ A;  3ASN H;  1BC8 C;  3GTK J;  5IT9 Z;  2B9S A;  5EGO A;  5K5Q A;  1WKM A;  1JXS A;  5BR8 H;  2FXA A;  3DBH B;  2A68 F;  5J4Y A;  3PM1 A;  3TP3 A;  2D1V A;  2QBY B;  2HH2 A;  1ODH A;  1IRF A;  2LH9 A;  3VFZ A;  1VND A;  3FBN B;  1H7U A;  2GZW A;  2Z5E A;  4XKB A;  3G1O A;  4JI6 E;  2NN6 A;  2RQQ A;  2C37 A;  2K7L A;  1MH4 A;  2LD5 A;  2JVH A;  4LF6 E;  2ZME B;  2R7Q A;  2G0E A;  1SMY F;  3SYT A;  3CO7 C;  5LL6 R;  4C2U A;  5BMZ A;  3R6S A;  2EFP A;  4XID A;  1ZM3 A;  4BAY A;  4ESB A;  3GTO J;  2O1U A;  2JRM A;  2QM3 A;  2DJI A;  1SD7 A;  1OQY A;  2NOG A;  5C0X F;  3UOE A;  3CWV A;  2KDZ A;  2XPV A;  4B3R E;  1Y56 A;  1XDS A;  3G71 I;  1NHI A;  5A2Q Q;  1TWA J;  2OD5 A;  5FLX W;  3RQ4 A;  1ZAO A;  1XDU A;  1D0Y A;  2CQN A;  4M1K A;  1K78 A;  1O4X A;  2A07 F;  4LFA H;  2WAD A;  4QTR A;  2CZ9 A;  2EIK H;  1HNX E;  2F5F A;  3P7N A;  2BV6 A;  2GA2 A;  1A5J A;  3F0N A;  1X1B A;  3J81 Q;  2OAZ A;  5BQT A;  2YX4 A;  1R00 A;  4PGG A;  1A6Q A;  2WW4 A;  2M6Q A;  4L9J A;  3CLQ A;  5LEJ A;  1NXU A;  4IZZ A;  1OR7 A;  3KCC A;  2Z16 A;  4II3 A;  2EH3 A;  2BE5 F;  2HVQ A;  1Y1V J;  2PJP A;  1ZLK A;  2VUM J;  2M8E A;  1ITY A;  2ZJP F;  2LYC A;  2Q2E A;  3DLA A;  3VYU B;  5J1Y A;  4MU0 A;  4U3D A;  4CXF A;  5JLW A;  5FLM J;  3SJM A;  1XSD A;  4LF8 E;  2HHH E;  4U87 A;  2PNZ A;  1D0X A;  1WH5 A;  3BOQ A;  1N33 E;  2DOF A;  3E5U A;  3L7W A;  5A2Q C;  2V1D A;  5DUK A;  5C0X C;  4DR6 E;  1YJW I;  1KU9 A;  3HPH A;  2Z2S B;  2HK2 A;  2ECB A;  4V2G A;  4KYW A;  4E7S A;  2Y3M A;  4XM3 A;  4OMZ A;  2AJ4 A;  4MO7 A;  3KIO A;  1ZG3 A;  2DPD A;  3MD2 A;  2EFG A;  2C38 A;  3J81 C;  2V9V A;  4MQ9 F;  2LG4 A;  2CQQ A;  2BY2 A;  2ME0 A;  4E7I A;  1KQ9 A;  1U5T B;  3DTE A;  4FHT A;  3DCF A;  4X0G A;  2VJI A;  3ZQ7 A;  4CUG A;  3GX4 X;  4IO9 F;  5K36 B;  3PSI A;  2OZ6 A;  2FEZ A;  4M3D A;  4DR3 E;  5JLX A;  3L2Q A;  3GTP J;  2BL5 A;  1T39 A;  4PDK A;  3C2B A;  1HR0 H;  3I59 B;  4BEH A;  3T1Y H;  2A2C A;  1HR0 E;  2EZL A;  1T2K A;  4NHJ A;  3BCB A;  1YS6 A;  4IEJ A;  4RB2 C;  1IW7 F;  2BGC A;  4E4H A;  3KET A;  2FBI A;  2K9L A;  2Z5C B;  4A3D J;  2W85 A;  1FP1 D;  2XB5 A;  4RLF A;  4CZC A;  4LFB E;  2CH0 A;  3DPL C;  2LTP A;  1OCZ H;  2UUC I;  4A3M J;  4UY8 I;  5JR3 A;  4WXD A;  4GKJ H;  3CDI A;  4DR5 E;  2E36 A;  3BJ6 A;  3C18 A;  3FIW A;  4KIB A;  1FOK A;  1WVR A;  2MW8 A;  3TKY A;  2XGE A;  1YW8 A;  2NRA C;  2O8K A;  2GS8 A;  2UUA H;  2J5P A;  2GOX B;  3FXK A;  2E1M B;  2AQF A;  4BGD A;  2NN6 C;  1TW3 A;  5K36 F;  2VQE H;  4XRS G;  2R5Y B;  1K47 A;  4RM2 A;  3JW4 A;  4PZJ A;  4RAF A;  1AU7 A;  1J5E I;  4BUP A;  3L7Z C;  5C0X G;  1WI9 A;  2XAG A;  4QPO A;  1JHH A;  3I54 A;  1Z9C A;  4AQY E;  3F6V A;  4GGG A;  4HXZ A;  2ZCW A;  3HOW J;  3FXJ A;  4BQQ A;  5EL9 A;  1IBL E;  1MW7 A;  2CO5 A;  1VI0 A;  2OBP A;  1XRH A;  3HDD A;  4DPT A;  3AG3 H;  1QBJ A;  3FF5 A;  2J5O A;  2X4H A;  4XKV A;  3T8R A;  2M3A A;  2P2R A;  2OA4 A;  3OYF A;  1K6O A;  1R22 A;  3KEQ A;  3JTG A;  4JI0 I;  2BM1 A;  4DR1 H;  1LVK A;  2X1D A;  1IN7 A;  2K9Q A;  2M9H A;  3BTJ A;  4W1U A;  5LHG A;  2GOM A;  4IHT A;  1HKT A;  1ZZK A;  3OYL A;  2E71 A;  3GTM J;  3NCV A;  5L3D A;  2QQ9 A;  4UNO A;  4DR1 E;  1R1V A;  1FJG I;  2P6T A;  4HA8 A;  5LMU I;  1YW7 A;  4A0Y A;  2G9W A;  2VQF H;  1RET A;  3OTO I;  3KDK A;  1N34 H;  1QZE A;  3ESW B;  3C3W A;  5IT3 A;  2LC2 A;  4ZYG A;  1UDQ A;  2C39 B;  2VQF E;  4DV4 I;  4HBL A;  4HLX A;  1JHF A;  1Y8Q B;  3MZ8 A;  1JKP C;  1D6T A;  4F93 B;  2JRT A;  2EPF A;  3ZQF A;  2P4W A;  4EM0 B;  4JI4 H;  2RVC A;  3IRQ A;  3JRH A;  1V5F A;  1USS A;  3FAU A;  5FRO A;  2VBZ A;  4HW0 A;  4WUC A;  2XC7 A;  3N97 A;  1VF9 A;  4A3E J;  1X0A A;  1PVE A;  2PEX A;  4XON A;  5DNL A;  1XGS A;  2Z1D A;  3VDX A;  1OYW A;  3CD6 I;  1WJF A;  2Z5B B;  2EIL H;  5H6R A;  1Y39 A;  1B62 A;  3BR5 A;  3E3V A;  5IYB J;  5LGU A;  1QHH D;  1YI2 I;  2L2O A;  4KN4 X;  3M1C A;  5FB2 A;  1KVK A;  2DFI A;  1LFU P;  3QT6 A;  1XMQ I;  2DLL A;  3SZG A;  3H5R A;  3T8T A;  3MQ0 A;  1W0U A;  2JVG A;  2Q1Z B;  3SEZ A;  4F7Z A;  1MSZ A;  2UU9 H;  4BBR J;  4K0K E;  3O8G A;  4CCJ A;  4CYC B;  2WNR B;  4DOZ A;  4DNC A;  2HS5 A;  1MSE C;  1DTJ A;  3DTK A;  5GP9 A;  4LIV A;  4PDB A;  1KQ0 A;  2UU9 E;  4HV6 A;  4LG3 A;  1SMT A;  4UVC A;  4AC0 A;  2JK3 A;  1R1T A;  3H9J A;  5LHI A;  4EM1 A;  2UUZ A;  3M3Y J;  2NN6 G;  2DMT A;  2GQ0 A;  2CWF A;  1GV2 A;  1Z5C A;  3JRA A;  3HZJ A;  2R7O A;  1IXS B;  3HKM A;  5IT9 W;  2KZV A;  1ETX A;  1ZM2 A;  3V8J A;  3ZPL A;  2ZNY A;  3LL7 A;  1XSV A;  2EIJ H;  5H6Q A;  3CF5 F;  1Z21 A;  2P81 A;  4D7N A;  1JT0 A;  1K79 A;  2O1T A;  3LFK A;  1R5I D;  2HFU A;  1HOM A;  1X3W B;  4KA4 A;  2UXB E;  5ILU A;  3GFM A;  1MNM C;  4HG2 A;  2ZXJ A;  4MTE A;  3JRE A;  2CV0 A;  4AIJ A;  4LCH A;  4HQE A;  2DQR A;  1I39 A;  4X66 H;  2BA0 D;  5HLT A;  1Z91 A;  4ESJ A;  5HDK A;  2XDV A;  3CDH A;  2W4S A;  2VES A;  2VJJ A;  1ZR2 A;  1A6I A;  4X66 E;  3P5J A;  3BG3 A;  3QYB A;  4B09 A;  4PUS A;  3L2U A;  5CPR B;  3I0T A;  3CTA A;  4LCF A;  1T33 A;  4L18 B;  2FML A;  4YHH E;  4DV0 E;  4FQG A;  1J59 A;  1I27 A;  2UXD E;  4MIM A;  1R7J A;  3F72 A;  3WGH A;  4B3A A;  5ILV A;  4S05 A;  3MN2 A;  1W7P A;  4RAZ A;  4JV5 E;  2O1W A;  2PN6 A;  3TOB A;  1XMK A;  4BNC A;  1WJD A;  1PDN C;  2L7K A;  2X0L A;  4BJ5 C;  1XXE A;  4G08 A;  2VON A;  4EGY A;  4IFD E;  2VOP A;  5E3O A;  3KP4 A;  1ZRF A;  4DU8 A;  2GXB A;  3VOE A;  5JEA E;  2R7D A;  2ZFU A;  1A35 A;  3PYF A;  4J00 A;  2CWH A;  4LF5 E;  1MJB A;  2A6H F;  2WB1 A;  2VC0 A;  3IAM 2;  5E1Z B;  4KNY A;  3HIF A;  1SAU A;  4ZYA A;  3J7A G;  2VPR A;  2CPM A;  3WOD F;  3S15 J;  5FWK A;  5DT9 A;  4DGW B;  3J7A O;  2WAE A;  3SQN A;  2STT A;  2BY0 A;  1HNZ I;  1QO0 D;  1UG2 A;  1R5G A;  2R7W A;  5IP9 J;  1D0Z A;  3DF8 A;  1V54 H;  2E5L I;  1SD4 A;  1O3S A;  5EG0 B;  1ZZI A;  2CQX A;  2XAU A;  4CCK A;  5F1R A;  4L5J A;  2ZSH B;  2XEX A;  1W4M A;  2UXN A;  2O3F A;  1QVU A;  3P3G A;  1R1U A;  5M3M J;  1YYV A;  1T0F C;  2DOD A;  3FWE A;  2LBF A;  2XVC A;  3KEY A;  3HKZ A;  2IS4 A;  1FTZ A;  1FLI A;  4GYG A;  5K5R A;  1QZR A;  1XB4 A;  2DYS H;  4HX7 A;  1ERD A;  1PKP A;  4DU7 A;  4X62 E;  3E1S A;  1I6X A;  4I02 A;  3A0B C;  3KP6 A;  1KHM A;  3H5A A;  2XAS A;  5E3M A;  4YFX F;  4JI1 I;  4BE1 A;  3N05 A;  4C3H J;  1HNW H;  5B3S H;  1A04 A;  2RKH A;  3K17 A;  1QZZ A;  1JTY A;  5FRN A;  1T98 A;  1ZR4 A;  1NTC A;  2L0K A;  4NXM I;  1ACI A;  2PO1 A;  2V26 A;  4IZJ D;  1TNS A;  5DRQ A;  3JCU C;  4OOI A;  5J1U A;  4F52 A;  5DTD A;  3B6A A;  3AFH A;  2WP8 B;  4MEX F;  2RQP A;  3J80 W;  3GVA A;  2DDB A;  3AG4 H;  1AKH B;  3G3Z A;  3LA3 A;  1OCR H;  3T5X A;  5F0H A;  2W82 A;  2JZY A;  1GHC A;  2O1V A;  3FXR A;  1FOW A;  2W1O A;  3TO9 A;  1BI2 A;  1G6N A;  4U0V A;  2QEX I;  3EUH A;  3K4C A;  2MYS A;  1FOX A;  5CVU A;  3HTU A;  3WU4 A;  1ZM4 A;  4A0X A;  1U8B A;  1W7P D;  3I71 A;  2VPL A;  5E20 A;  2CMP A;  2V2Q A;  4RGX A;  4G9Y A;  5M5Y J;  3LSI A;  5JHF A;  2Z5U A;  3WGI A;  4GFB A;  4FW6 A;  3F0C A;  2UXC E;  2XHK A;  3DKX A;  4ENK A;  3VPR A;  2R7Z J;  3A01 A;  3V4G A;  4DV6 E;  3OS1 A;  2R4G A;  5EEA A;  4G7Z F;  6PAX A;  2L9N A;  4ZYD A;  3V2U C;  2EIM H;  3S8P A;  2JE6 B;  3W3C A;  2HXO A;  5CVR A;  2KJC A;  5FRM A;  2X1E A;  2JA7 J;  2ZM6 I;  1Z7U A;  1FBS A;  2GM4 A;  2E35 A;  4PSX A;  3FZV A;  3MZY A;  3EET A;  4LF4 E;  4IFD B;  1R9T J;  1MX0 A;  2FF4 A;  3E6C C;  3TW7 A;  3QPS A;  4WAN A;  3T1H H;  2R42 A;  2XGD A;  4CCN A;  5GME A;  4GO1 A;  5JEA B;  2DA5 A;  3OYA A;  1TZL A;  1Z0V A;  4OD6 A;  4XOP A;  1ZGW A;  3HYI A;  1OFC X;  3ABL H;  4RA2 A;  4E7J A;  4GDF A;  4JI3 E;  5TJJ A;  1O57 A;  2QEN A;  3IC7 A;  3HL2 A;  2JQ7 A;  1ULY A;  1X2M A;  2QGU A;  2DO7 A;  2HKE A;  2B63 J;  1DU6 A;  4DUZ E;  4GKK E;  3P76 A;  2JEA B;  4OZE A;  1YG2 A;  2GLO A;  2QA4 I;  4IHV A;  3CCV I;  2ZC2 A;  2VT2 A;  2MLG A;  1N0U A;  3CCL I;  1N36 I;  2LRR A;  3P9C A;  3ZRG A;  2E1R A;  4DV3 H;  3UKG A;  1G59 A;  1SVM A;  1H8A C;  4CH7 A;  2ZXI A;  1VQ4 I;  1XNR E;  3BTC A;  3DP7 A;  4EEF G;  1ZXM A;  3JSP A;  2O7O A;  3ONQ A;  3K85 A;  1G8X A;  1Y6Z A;  1ELO A;  4BA2 B;  3J7A Y;  4DV1 I;  1X4M A;  2CJJ A;  1J0R A;  2CTJ A;  1VQ6 I;  4BXX J;  5B66 C;  1OCO H;  1VQL I;  4EJT A;  5GPA A;  1OIS A;  1WRJ A;  3REO A;  1IBM H;  2H8W A;  1GLN A;  5CVJ A;  2HDW A;  4UVA A;  4JI7 H;  2IBD A;  5AON A;  1TNT A;  1X4O A;  4R8H A;  5HLG A;  3IV5 A;  1USU A;  3LNQ A;  1IBM E;  4XKC A;  2UUB E;  4IFD F;  2DTR A;  2X6O A;  2JT2 A;  4FJS A;  1LEB A;  2JA9 A;  3J81 Z;  3O3K A;  2NNN A;  3L2R A;  2F48 A;  3WGG A;  5FJ8 J;  3G6E I;  2ZSI B;  2EIN H;  2PQ8 A;  3PIO F;  4X65 I;  3E5X A;  2IGO A;  4G94 A;  2FNP A;  2XAQ A;  2CTK A;  4QMF B;  2E5Z A;  5IWA I;  4DV5 E;  2MD0 A;  4HAM A;  4UB6 C;  3ZXS A;  4ASN A;  4M71 A;  3RYR A;  1ZAR A;  3IKT A;  4DV2 H;  3BTI A;  4BYY A;  4BXF A;  1FJL A;  2FMY A;  2AHQ A;  3FXQ A;  3EPZ A;  3WTU C;  1MSF C;  5EEG A;  4CDG A;  5FFX A;  2F4M B;  4DV2 E;  1N32 H;  1I3A A;  3QRF F;  4OIQ F;  1XX5 A;  2G8Y A;  2JPB A;  3ERM A;  1DPU A;  5JEA D;  3OIP A;  1L3L A;  3KX2 A;  4OO1 F;  1Z6T A;  3K10 A;  2CUE A;  3V8L A;  2HR3 A;  2RDP A;  2XGC A;  3K4N A;  3CCQ I;  2CGE A;  3QOP A;  3NAR A;  2F4V E;  2DEI A;  1LDJ A;  1HST A;  2RRE A;  4L9V A;  2YS9 A;  4P1W A;  3VOD A;  4A2U A;  1S6L A;  3PYG A;  3EUH C;  4DIQ A;  3V5R A;  3TP0 A;  1R23 A;  2EFQ A;  4LF7 H;  1FPQ A;  5D4S A;  3DKY A;  2AXL A;  2BW3 B;  4P5O A;  1JUP A;  2VLA A;  4DPU A;  1K4S A;  1FNM A;  4LG0 A;  1UDO A;  4XSX F;  4BS9 A;  3S14 J;  4RMN A;  2O5R A;  3LSR A;  5C0X E;  2ID3 A;  1MBJ A;  3VWB A;  4DBR A;  3JSO A;  1G3S A;  2X6W A;  1OKR A;  2K4B A;  4M9X A;  5LGN A;  2COM A;  2J65 A;  3D5R C;  4FW7 A;  1VBI A;  4QNJ A;  3V7S A;  4KMF A;  4KIS A;  3NEU A;  4A5M A;  4JI2 E;  4AIK A;  2ZJR F;  2FA5 A;  4ZDO A;  3CJR B;  5E3L A;  5DDG A;  2W84 A;  5D5U B;  4LFC E;  1JJ8 C;  2DFF A;  3DQV C;  4Y7N J;  1NHJ A;  3OTO H;  2KIS A;  2KT0 A;  2Q8K A;  4USK A;  1X9Z A;  1HBX G;  4OO1 C;  1UEK A;  3TDU C;  4I76 A;  4TV7 A;  3HPG A;  2EZH A;  3BQZ A;  2W7N A;  1XNQ H;  1MDM A;  4JI8 I;  4DUY I;  2E7X A;  4FCY A;  2M87 A;  1GV5 A;  3TMO A;  3JRD A;  4KHP E;  3A2K A;  4IX7 A;  1I3Q J;  2DMQ A;  1VQK I;  2QSH X;  4DR2 H;  2CG4 A;  3HSR A;  1JJ6 C;  4S0H B;  4BJT A;  3CCS I;  3B6C A;  3LA7 A;  2RNJ A;  3MFK A;  5D5V B;  3RZO J;  4IZK B;  2XF5 A;  3L09 A;  3WTV C;  4ZTJ A;  2LR8 A;  3IUO A;  4JX5 A;  1QPI A;  2LF0 A;  3JR9 A;  4C30 A;  4LGW A;  4X64 I;  3GO5 A;  3FXL A;  2WAF A;  1IO2 A;  2COB A;  4B3S E;  4BA1 I;  5IOZ A;  3OMY A;  2BOL A;  2CTF A;  3WTT C;  4XMY A;  2GBY A;  2LY1 A;  1IF1 A;  1IBK H;  4MQV A;  4AYB A;  3M4O J;  1R5H A;  2Y75 A;  4EV0 A;  3KRN A;  4JYA H;  5J47 A;  3CME I;  2JN6 A;  5L3B A;  1I94 H;  4DV7 H;  1P92 A;  1IRX A;  1FEX A;  4IJA A;  3SFI A;  4YY3 I;  2I5U A;  3CLO A;  1IC8 A;  2AO9 A;  2NXN B;  3BQY A;  3ZM7 A;  3E6B A;  3BWG A;  2BV3 A;  2AS5 F;  1WQ2 A;  2L4M A;  2FOK A;  2X9D A;  4G6T B;  2M30 A;  2OTL I;  1XPX A;  3DV8 A;  3R0J A;  3TL4 X;  3MVP A;  3GLL A;  4OX9 H;  3K4J A;  2IA0 A;  4LF9 H;  2JTV A;  3M7G A;  2YX7 A;  3OSF A;  3I4N J;  2HVR A;  2NYX A;  1KIJ A;  5FLV A;  5E1W A;  3R4K A;  1ZGJ A;  4HX8 A;  4GCV A;  2LF7 A;  3ECH A;  2CTM A;  3AKZ A;  1GVJ A;  2DGR A;  3B73 A;  4EJO A;  2Z9O A;  2CUF A;  3LMM A;  3PQJ A;  3FKJ A;  4OO1 G;  2DEJ A;  3IH4 A;  2PMU A;  3P3C A;  2VKC A;  4KIT B;  4B3M H;  5CKT A;  5M5X J;  1ZM9 A;  2L7F P;  5HOD A;  1IV8 A;  1S03 G;  1UDN A;  5BPD A;  1T38 A;  4Y3O A;  5IYC J;  5C0X B;  5F08 A;  1MMA A;  4Y33 A;  3F8M A;  5FO5 A;  4PJJ A;  1YOV B;  4ABZ A;  1GUU A;  1WVN A;  1JE8 A;  2FX0 A;  2ME6 A;  5C0X D;  4AUX A;  3PRY A;  2CSO A;  3KZI C;  1DT4 A;  4D0P A;  4OAZ A;  1I50 J;  4FET A;  3RTR A;  2JWT A;  3PIP F;  3OS0 A;  5JVG F;  3S1Q J;  1Z2I A;  2ZO4 A;  5F04 A;  5L3G A;  1DP7 P;  2V2Z A;  4E70 A;  2DDA A;  5GAD J;  4P9F A;  1WWX A;  3L1P A;  4UUV A;  1MMN A;  1F0X A;  2JMW A;  3RIR A;  1EA6 A;  2DXI A;  2JUC A;  4JI6 H;  2EZI A;  1EH6 A;  1I1S A;  1MJA A;  4LF6 H;  5TGT A;  3E6M A;  1IGN A;  3FHN A;  4M3F A;  2BZT A;  3GUD A;  3K0L A;  3OS2 A;  4A3K J;  2ACJ A;  1F43 A;  2E1C A;  3QYE A;  4JP0 A;  1DGR M;  3QT7 A;  4B3T I;  5EDN A;  1N25 A;  3HTS B;  1E0E A;  3V7C A;  2IAI A;  4A12 A;  1KKH A;  5AIP A;  2OUM A;  3K1J A;  2BVM A;  5DRR A;  5E17 F;  2F5E A;  3FBI B;  2DI3 A;  1G3W A;  5E8I A;  1ZLJ A;  3E7L A;  4B3R H;  4I2O A;  5LRS A;  2MG4 A;  2LF8 A;  3LSJ A;  4OAY A;  2J7K A;  2BVL A;  1R4M B;  2DOA A;  3FM3 A;  3RKW A;  1HNX H;  5IYD J;  5A2Q W;  2RGV A;  1HDP A;  4PCQ A;  4V2F A;  1S3J A;  3SHF A;  3LTO A;  1VZ0 A;  3RKX A;  4HPQ A;  3F3X A;  1Z1D A;  4LB6 B;  5FKL A;  2IOQ A;  4JVY A;  1QZY A;  4M73 A;  3U2R A;  2F1D A;  4RAY A;  2OCC H;  1CGP A;  1XMO I;  1Z5A A;  4U0Y A;  2NN6 B;  4NBQ A;  1H74 A;  3Q1Q A;  2UUC E;  2M7B A;  2YUS A;  5CYV A;  2LFB A;  4P55 A;  3GTQ J;  3L7Z B;  4A3C J;  2H27 A;  2HQA A;  2Q0O A;  2BA1 D;  2W24 A;  2ZBK A;  4D5C A;  5KNL A;  4KN7 X;  4DXL A;  4LF8 H;  2HHH H;  3DU6 A;  4DZP A;  2LKP A;  1N33 H;  1TP4 A;  3CDJ A;  3W2A A;  4DR6 H;  4BDY A;  2OC6 A;  3I55 I;  1EF4 A;  2BM0 A;  4FN5 A;  2NVT J;  2LVS A;  5LMN I;  4U3B A;  3CZ6 A;  4MU1 A;  1W36 D;  2CGP A;  2KDO A;  4F92 B;  5DNX A;  1QHG A;  4BHB A;  2PO0 B;  1BR1 A;  4UUT A;  4LOC A;  1U5T A;  3LAP A;  3BG7 A;  3CCU I;  1J5E E;  3T0Y A;  3WTY C;  4IHW A;  4BU2 A;  3BZK A;  2NVX J;  2O03 A;  1WCM J;  2BR2 B;  4IF4 A;  2PY9 A;  1Q1H A;  1B4A A;  1WJC A;  3P9K A;  3IWF A;  4IQ4 A;  3OYH A;  4BAC A;  5KAI C;  1YRN A;  2CQ7 A;  1LQ1 A;  1IN4 A;  3B78 A;  3U1Y A;  2R7R A;  2GQQ A;  4HST A;  4PJN A;  1XHK A;  1IDZ A;  4DR3 H;  4JI0 E;  2GAU A;  2VL8 A;  4Y52 J;  4M6X A;  3S1M J;  4JI5 I;  4DR4 I;  3S2H J;  4A5N A;  1JGG A;  3CUQ B;  4LFU A;  2K5C A;  4P7A A;  1I1G A;  2Q2E B;  2FOW A;  2P5K A;  3EYY A;  1FJG E;  4NXN I;  2PJR A;  5E79 C;  2NN6 F;  3K4K A;  2R93 J;  4A0Z A;  4O3M A;  1J4W A;  3HOS A;  2CS3 A;  2Z5C A;  2FPH X;  2CFO A;  2L01 A;  2UXX A;  2MBF A;  5BR8 I;  4B3X A;  4DV4 E;  2MC3 A;  1MD0 A;  4LFB H;  3GCM A;  1FI4 A;  1P4A A;  2QSG X;  3J80 K;  4ZVI A;  1Z0X A;  4M9Z A;  2MFZ A;  4G6Q A;  2HKX A;  4QLC U;  3CP2 A;  3DFG A;  3WU5 A;  5IY5 H;  4YEJ A;  4U0W A;  3JAM K;  1JKQ C;  2XRO A;  2K3F A;  2XIG A;  4B8X A;  3VKE A;  4DR5 H;  3W2V A;  2Y9Z A;  1ZRE A;  2BHZ A;  3F8C A;  1TUA A;  4E7Z A;  1U8R A;  3ZOB A;  1I6H J;  4U7B A;  2B7E A;  4C9Y A;  1XMQ E;  2I8D A;  2L9R A;  1TL8 A;  2HOE A;  2RC4 A;  2JUG A;  4XRF A;  1GXQ A;  3GZ5 A;  5LGT A;  1QRY A;  1DQU A;  1S72 I;  4XLF A;  3BR1 A;  1TT5 B;  4BEH B;  5F6F A;  2P5V A;  5E3N A;  1IN6 A;  1GT0 C;  1LE8 A;  3F21 A;  5L3J A;  2MH2 A;  1HK7 A;  4AQY H;  2TCT A;  2PMH A;  2ANN A;  4LFA I;  2WY8 Q;  3HEF A;  4HZF A;  1IBL H;  1ZRD A;  2YU9 J;  5F0C A;  4EJU A;  3GZN B;  2ZXH A;  1WI3 A;  5JVT A;  4IS9 A;  3RZD J;  4BBS J;  2HKO A;  4IXA A;  1KTV A;  5B1A H;  2X6X A;  3BRO A;  3JAM Z;  4M9S A;  2BA0 A;  2QKM B;  5DV5 A;  1F1Z A;  1X3U A;  2YR2 A;  3U9G A;  2BBY A;  1TWG J;  3I9V 2;  3FK6 A;  3MEX A;  1S7A A;  5IOY A;  3CES A;  2QQB A;  2P7V B;  5L3C A;  2VBY A;  5GPC A;  4FW5 A;  4ZJZ A;  4E9J A;  3FMR A;  3PFY A;  1EKE A;  4JVH A;  2WB1 N;  1X4N A;  5D8L B;  5K36 D;  1JKO C;  2HZT A;  3DU5 A;  3KLN A;  1K6Y A;  4BHP A;  2C39 A;  4AVZ A;  4E7K A;  4AWX B;  3TED A;  1D1A A;  1WHU A;  3FDY A;  2H1K A;  1YLF A;  1LVA A;  5HLH A;  2BYV E;  3ERE D;  4A6E A;  4D9J A;  1G3Y A;  2HOA A;  3QQA A;  1OR7 C;  3QD7 X;  3FXO A;  1X2N A;  3F23 A;  2IS1 A;  4DQ2 A;  3QPL A;  2PO2 A;  3GW2 A;  3KP3 A;  1GXP A;  4LOM A;  3H0D A;  1BIA A;  1H72 C;  3HKZ N;  2QVO A;  1A36 A;  3DEE A;  1IAW A;  1FKA E;  1MKM A;  3ZZ0 A;  1MMD A;  4Z7C A;  1YE9 A;  5FD6 A;  4RB1 A;  2WNR A;  3W6J B;  1U5T C;  4K0K H;  4ZDP A;  1Z67 A;  4PSW A;  1HR0 I;  4A3L J;  2ELJ A;  3AAF A;  1W0T A;  5K5O A;  2GO3 A;  3T1Y I;  4XSZ F;  2PG4 A;  1QNT A;  3Q0V A;  4I99 C;  1UFM A;  3OL3 A;  5CQG A;  4F55 A;  3RI4 A;  1VFC A;  2JA8 J;  5FKN A;  3NZK A;  1AN7 A;  3KYC B;  1VTN C;  1NK3 P;  1HSJ A;  1BOB A;  2PNM A;  2MA3 A;  3VEP A;  1V5E A;  1NHA A;  1MBE A;  1EJ9 A;  1E17 A;  3RYP A;  4B44 A;  2M0C A;  3ZR8 X;  3ZQQ A;  1HW2 A;  1G2H A;  1F5T A;  4ZYH A;  1OCP A;  4I0A A;  1LUJ B;  2VE9 A;  3OSS D;  2IER A;  1HNZ E;  4CCM A;  2UXB H;  2K86 A;  1HC8 A;  3Q0U A;  4LJZ F;  2DU9 A;  1AHD P;  2E5L E;  4GKJ I;  2WA0 A;  4NB5 A;  3LSK A;  4XLA A;  3BC8 A;  2WTE A;  4DYC A;  5DRO A;  4ENJ A;  1STZ A;  5ED4 A;  1APL C;  2FQ3 A;  1Z0W A;  2LLK A;  3VB2 A;  1CF7 A;  1S5L C;  4ESF A;  5GAG J;  2UUA I;  2STW A;  1PIE A;  3HOT A;  1IXC A;  1ZGA A;  3L9F A;  2VQE I;  3GLX A;  4RLQ A;  4WK8 F;  2XRL A;  2CU7 A;  4IZJ A;  4FE4 A;  5D5X B;  3MKL A;  4AIH A;  3FHZ A;  1FYM A;  1JGS A;  2OTJ I;  2H1L A;  3ZN0 A;  1A31 A;  4JI1 E;  2XAF A;  3IWZ A;  3ZQI A;  2JEB I;  4YHH H;  2JEB A;  4DV0 H;  1B9N A;  2E1M C;  2Y0S A;  4IKF A;  1RUO A;  3D4J A;  2UXD H;  1O7F A;  3DEW A;  1UDS A;  3WE2 A;  4AD9 A;  4NXM E;  4JV5 H;  1LJ9 A;  4Z7Y A;  4DR1 I;  3MZH A;  2MC4 A;  3ABK H;  2VQC A;  1JTX A;  2ZJ2 A;  5EF6 A;  1B8I B;  3A0H C;  5HS8 A;  2KLO A;  3DD6 A;  2ZIT A;  3KEO A;  4Y15 A;  1QGP A;  2VOD A;  3HUG B;  2VQF I;  4IQJ A;  4LIU A;  1N34 I;  3SEQ A;  4XOT A;  2ISZ A;  1WJE A;  2D2W A;  3QT5 A;  3ZQH A;  4LF5 H;  1TQP A;  1XMX A;  1H0M A;  3OWT A;  4L9N A;  1HXD A;  2OCE A;  4ZZD A;  4HEA 2;  4WCG A;  3CCE I;  2M45 A;  3PS2 A;  4JI4 I;  2L9S A;  4BY1 J;  2KP6 A;  4IHY A;  4AM3 A;  3G4S I;  1Z0E A;  4EVI A;  1BC7 C;  2O6G E;  3HOZ J;  1TW2 A;  9ANT A;  2EK5 A;  5TRD A;  4UV8 A;  3O6B B;  4BQA A;  1R58 A;  2H94 A;  2HU9 A;  2EV0 A;  2MD5 A;  2Y2Z A;  4UHT A;  2DAO A;  3COA C;  3MCZ A;  2CV1 A;  3HOU J;  2DOE A;  1WHR A;  4I7H A;  2YPR A;  1VIS A;  4RPF A;  1UG8 A;  3H0G J;  2E5N A;  3PNT A;  4D1Q A;  3IRR A;  4LF9 I;  3BDD A;  2DN0 A;  2UU9 I;  2ZM6 E;  5F0F A;  4X62 H;  2V2V A;  3EYI A;  1J9I A;  4OO1 E;  2EJR A;  3RF2 A;  2V9K A;  2KIM A;  2Z33 A;  4ZZL A;  1VQM I;  4IVN A;  1SAN A;  2HDC A;  4X1E A;  5GTH C;  5J40 A;  2XSD C;  1HKS A;  1YO5 C;  1KZH A;  3N4M A;  1S20 A;  1V4R A;  1HKQ A;  4N4O B;  4CYD A;  3GTG J;  1W5S A;  1MNE A;  1XTA A;  3M6A A;  2CPQ A;  3OYJ A;  2WP8 A;  1OYY A;  1E3O C;  3FXM A;  1Y5Y A;  1E3H A;  3HBL A;  3S2W A;  3H4L A;  2VQL A;  3CUO A;  4JX4 A;  4YII A;  2BHY A;  4N0B A;  1N36 E;  4CCO A;  2CYY A;  2X6Y A;  5IPA A;  3QU6 A;  4OIN F;  2C6Y A;  5ICC A;  4X66 I;  2BXZ A;  1OLT A;  2K27 A;  3PL8 A;  4YRV A;  2A61 A;  4NC7 A;  2JZX A;  3PS3 A;  2HGC A;  4H0E A;  1H9G A;  4ENM A;  1LKX A;  2QKL B;  1LFB A;  1UHS A;  2HYJ A;  2YSR A;  1C0W A;  2VF3 A;  3S16 J;  3D0S A;  2Y69 H;  1LB2 A;  3F22 A;  5E18 F;  2EFN A;  4WXH A;  4DPX A;  3JRB A;  1AA7 A;  2XKO A;  5DRP A;  1MG7 A;  2UXC H;  2AE8 A;  1HW5 A;  1XGN A;  3CDL A;  1KU3 A;  2RAE A;  3M7N D;  4DV6 H;  5J8C A;  5C3E J;  1D5Y A;  4KT6 A;  3LST A;  1U2R A;  4QSH A;  5LD2 C;  3AL0 C;  2A6T A;  2DA3 A;  2P8T A;  2PO1 B;  4GRI A;  1TQI A;  1PYV A;  4X65 E;  3LAJ A;  3KYL A;  4IFD A;  5LL6 b;  3P9I A;  3JAM Q;  1F9N A;  1BJZ A;  5IWA E;  3R61 A;  4LF4 H;  2YU3 A;  2GXA A;  4ISA A;  1M1E B;  2ECC A;  2ZB9 A;  3OIO A;  3L2V A;  1PP8 F;  4MU3 A;  5JEA A;  2XF6 A;  4ETS A;  4B1R A;  1MMG A;  4WAL A;  3MKW B;  3ZMV A;  5J8F A;  1LPQ A;  1DDN A;  4JI3 H;  1JUS A;  2O0Y A;  2JEA A;  4DUZ H;  4O6J A;  4GKK H;  3VYS B;  3L2W A;  3GTL J;  3D1N I;  1XG1 A;  2KMU A;  3S3O A;  4N9H A;  4X6A J;  1U78 A;  5DD8 A;  4DW6 A;  2A3S A;  1JKR C;  4NUB A;  1X58 A;  2VAS A;  3A01 B;  2B0L A;  1X1C A;  2VKV A;  3G2B A;  3PJR A;  4DYQ A;  4Q47 A;  2ICW G;  2D1H A;  2EQR A;  4J01 A;  1SEI A;  3QU3 A;  1UB9 A;  3JAM C;  1XNR H;  5DCM A;  2DPU A;  3CC4 I;  1KQ8 A;  4LIT A;  4M72 A;  1LEA A;  3H3Z A;  3OOP A;  5BS6 A;  1R4N B;  4WXC A;  3WE3 A;  2WWY A;  5F64 A;  1Z5B A;  4EC5 A;  4OO1 B;  1ETO A;  2O9L A;  5A2Q K;  5FLX K;  4HNT A;  3WTW C;  3M8E A;  3J7Y J;  3LFU A;  2H8R A;  3ZKB A;  4WUD A;  3ZQG A;  4FW9 A;  2L54 A;  5LEK A;  4RAG A;  3QP5 A;  3CMM A;  4AYB N;  2CTL A;  1ETK A;  4CHU A;  2ANR A;  1HNW I;  1TBX A;  2UUB H;  4DR7 H;  2HZD A;  5DUI A;  4MYU A;  1IG7 A;  3K1M A;  4MTD A;  4PFO A;  1YIT I;  3BZ6 A;  2EB7 A;  1MGT A;  4URL A;  4HDV A;  2X51 A;  3VSK A;  2WBM A;  4WF2 A;  4A3G J;  2TDX A;  2VT3 A;  1YIO A;  1ZK8 A;  3CMY A;  4DV5 H;  2DFE A;  4USM A;  4JI8 E;  4M3G A;  5LBQ A;  4DUY E;  2E2I J;  3BP8 A;  1Z0G A;  2KIQ A;  1D1B A;  3PUB A;  1RR9 A;  1ZKG A;  2IRF G;  1OCC H;  1BIB A;  2KIF A;  2V4J C;  4DPY A;  2EBI A;  3DTI A;  4XR6 A;  4V19 K;  3BG9 A;  3W2W A;  1RR7 A;  4Q48 A;  4AID A;  3K4M A;  3D5S C;  1HA8 A;  1JUM A;  2ID6 A;  2HPI A;  4MEY F;  4JBA A;  1Z0C A;  3K2Z A;  4MYT A;  4IFD D;  4X64 E;  4L9T A;  2H6C A;  2HOS A;  3KDG A;  3ZMD A;  2F4V H;  1YW9 A;  1VQN I;  3P3E A;  4PRV A;  4CZZ A;  1DPR A;  4RB0 A;  1N75 A;  3B02 A;  5GMD A;  4NNJ A;  2QUF A;  3ZCO A;  3PFI A;  5CVV A;  1CQT A;  3RKQ A;  2IEK A;  4MHG A;  3H9Q A;  2GA1 A;  1S8N A;  3IHU A;  4YY3 E;  3T1B A;  4JYK A;  1FIA A;  1WSU A;  1VQ8 I;  1WTJ A;  1IRZ A;  4EM2 A;  3T1H I;  3CJQ B;  1YFH A;  4JI3 I;  4G7O F;  3BG5 A;  4JI2 H;  1R6R A;  1OJL A;  1EH7 A;  5KCM A;  3MAJ A;  2OF7 A;  2VIX A;  1RRE A;  4JG4 A;  1TWF J;  2GIZ A;  4DUZ I;  1FX7 A;  4LFC H;  4YIF A;  1D1C A;  5EJC A;  1SFO J;  1O7L A;  4I98 B;  4QNK A;  2LRD A;  3QWL A;  1Y0N A;  2NVY J;  5JEA C;  4L0Z B;  3NRV A;  5E1X A;  1OPC A;  1TT0 A;  4Y17 A;  2HYF A;  3S1R J;  2XV4 S;  3Q6N A;  4KHP H;  3K4L A;  4DV3 I;  2L7M P;  3IH2 A;  2VN2 A;  4DBQ A;  3J7Z I;  4IZK A;  5BPI A;  4XL9 A;  4LG0 B;  2CV2 A;  4OKG A;  4I09 A;  2R7S A;  4IHS A;  3GAB A;  3RDI A;  4FIS A;  3I58 A;  3KP2 A;  3S3N A;  3R60 A;  1RNL A;  4NQW A;  4FJU A;  5EKW A;  2F5C A;  1N77 A;  5LFA A;  4PJ0 C;  2LDU A;  1MZB A;  2G7U A;  2KZG A;  4IRG A;  4RBO A;  4OIP F;  4EAT A;  1IBM I;  4B3S H;  1Z59 A;  3PNY A;  3EDP A;  4JI7 I;  3C2H A;  3UR3 C;  3X2Q H;  1MIJ A;  2M1B A;  3TOA A;  1S7E A;  4GYI A;  3BR0 A;  2M7A A;  3DXJ F;  3WTX C;  5J3L A;  3WU0 A;  4KUM A;  2WY7 Q;  2DMN A;  3UNG C;  3JRG A;  2ESN A;  1LDK B;  2CFX A;  3KLO A;  3NWT A;  3OY9 A;  2D45 A;  3HG9 A;  3AG1 H;  3CJN A;  4KJZ A;  4RB3 C;  3K70 D;  2VI6 A;  1MDM B;  2R92 J;  5ILS A;  3GFL A;  2IS6 A;  1VIH A;  3GFJ A;  4IOA F;  3ABT A;  2JA5 J;  2DW4 A;  3LQR A;  4XQF A;  4XRM A;  3PO3 J;  1S16 A;  2V1U A;  4DV2 I;  2NN6 E;  4HYM A;  1ON2 A;  2PFB A;  4HAC B;  2DFH A;  3DPT A;  2XRN A;  3WG7 H;  4ED4 A;  1J75 A;  1Z3Y A;  1N32 I;  2HQN A;  4B3T E;  2JT1 A;  3LSH A;  4ENN A;  2EWN A;  1B72 A;  2DMU A;  2HFS A;  1PUF B;  3E5Q A;  3IL2 A;  1WJB A;  1YS7 A;  2ISY A;  1Y6I A;  1BI1 A;  2X1C A;  3SXY A;  2KRH A;  4BA1 B;  3AEV B;  2UV1 A;  5ICE A;  3WHB A;  1FOY A;  3VSL A;  3NWS A;  4XLP F;  1WPK A;  3CJT B;  1BBY A;  1PJR A;  4I0B A;  1IJW C;  5ERI A;  4XRS A;  2WAQ A;  2NS0 A;  3ZP5 A;  1B9M A;  2R5Z A;  3QT8 A;  1KON A;  4A3I J;  2ESH A;  2HWV A;  4LF7 I;  5JI6 A;  2FD5 A;  4PFP A;  5C0X A;  5KAF C;  4W97 A;  5CQE A;  4BH9 A;  1FT9 A;  1XMO E;  3HOY J;  4XLC A;  3HB9 A;  3HUL A;  1NHH A;  5DM6 F;  1DU0 A;  2M2E A;  2K9M A;  2VKH A;  2IVM A;  1F4K A;  1PVG A;  4B48 A;  5EEH A;  3OYB A;  5DD4 A;  4U88 A;  1FIP A;  3OV8 A;  4EMS A;  1ZQ3 P;  3LSM A;  3HSE A;  2CVE A;  1O3T A;  3SZP A;  5FKM A;  1Z0B A;  5IT9 K;  1J7K A;  3E0J B;  2DYR H;  2MAB A;  5LMN E;  4HLY A;  2EFO A;  2L7Z A; 
#chains in the Genus database with same CATH homology
 2E3U A;  5JEA G;  5JEA F;  1UDQ A;  5JEA A;  2C39 B;  4WAL A;  2PQU A;  2PNZ A;  2FMR A;  3H1C A;  2BA0 G;  1ZZI A;  2BA0 A;  5JEA C;  3M7N G;  3DD6 A;  5C0X C;  4BA2 B;  4BA1 I;  2NN6 D;  1X4M A;  2CTJ A;  4LIJ A;  2Z0S A;  2JEA A;  4JVY A;  2CTF A;  2JE6 I;  2OPU A;  2JE6 A;  1R6L A;  1E3P A;  2C38 A;  2NN6 B;  4NBQ A;  3KRN A;  4JVH A;  5K36 D;  2C39 A;  4AM3 A;  1OYP A;  3L7Z B;  4IFD F;  1KHM A;  1WHU A;  1J5K A;  2YQR A;  2JA9 A;  2BA1 D;  5K36 B;  2WNR B;  4OO1 D;  1DTJ A;  3CDJ A;  4IFD C;  3M85 G;  2CTK A;  4QMF B;  2BL5 A;  2PO2 A;  4OO1 B;  2NN6 G;  5K36 E;  2PO1 A;  3GLL A;  4B8T A;  1ZTG A;  3H36 A;  2PO0 B;  2JEA I;  3HKM A;  3L7Z A;  2BR2 B;  1OYR A;  2CTL A;  2ANR A;  2PY9 A;  1WE8 A;  2AXY A;  2WP8 B;  5K36 G;  4OO1 E;  2C37 B;  2CTM A;  2WNR A;  2DGR A;  1VIH A;  2JEB B;  2QND A;  2BA1 G;  5JEA D;  4OO1 G;  4OO1 F;  5C0X D;  4OO1 A;  2NN6 E;  4BA2 I;  4BA2 A;  2PO0 A;  2HH2 A;  1UDN A;  1X4N A;  2BA0 D;  1R6M A;  5C0X B;  2BR2 A;  3B4T A;  3CDI A;  2CPQ A;  3U1K A;  2NN6 F;  2WP8 A;  2NN6 A;  3GME A;  1E3H A;  2C37 A;  1ZZJ A;  1WVN A;  1J4W A;  2MJH A;  2HH3 A;  4BA1 B;  4AID A;  1UDO A;  3V69 A;  3AEV B;  5C0X E;  1DT4 A;  2CTE A;  2NN6 C;  5K36 F;  5K36 A;  1EC6 A;  3GCM A;  2JE6 B;  1OYS A;  4IFD D;  2JZX A;  3L7Z C;  5C0X G;  5C0X F;  5C0X A;  4AIM A;  5K36 C;  4IFD B;  2JVZ A;  3VKE A;  4WAN A;  3M85 D;  5JEA B;  1TUA A;  4BA1 A;  2P2R A;  3M7N D;  4OO1 C;  4IFD E;  2OPV A;  2PNZ B;  2PO2 B;  1ZZK A;  2PO1 B;  2JEB I;  2JEB A;  5JEA E;  1VIG A;  2JEA B;  4IFD G;  4IFD A;  1K1G A;  1UDS A;  2ANN A;  2C38 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...