2CWFA

Crystal structure of delta1-piperideine-2-carboxylate reductase from pseudomonas syringae complexed with nadph
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
332
structure length
332
Chain Sequence
TQTVSYPQLIDLLRRIFVVHGTSPEVADVLAENCASAQRDGSHSHGIFRIPGYLSSLASGWVDGKAVPVVEDVGAAFVRVDACNGFAQPALAAARSLLIDKARSAGVAILAIRGSHHFAALWPDVEPFAEQGLVALSMVNSMTCVVPHGARQPLFGTNPIAFGAPRAGGEPIVFDLATSAIAHGDVQIAAREGRLLPAGMGVDRDGLPTQEPRAILDGGALLPFGGHKGSALSMMVELLAAGLTGGNFSFEFDWSKHPGAQTPWTGQLLIVIDPDKGAGQHFAQRSEELVRQLHGVGQERLPGDRRYLERARSMAHGIVIAQADLERLQELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords delta1-piperideine-2-carboxylate reductase
publication title Crystal structures of Delta1-piperideine-2-carboxylate/Delta1-pyrroline-2-carboxylate reductase belonging to a new family of NAD(P)H-dependent oxidoreductases: conformational change, substrate recognition, and stereochemistry of the reaction
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
total genus 113
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.4.1.17: N-methylalanine dehydrogenase.
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 2cwfA01
3.30.60.50 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Hypothetical oxidoreductase yiak; domain 3 2cwfA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 2cwfA02
1XRHA 1WTJA 4FJSA 2X06A 3I0PA 1S20A 1V9NA 4FJUA 4H8AA 2CWFA 1X0AA 2G8YA 2CWHA 1VBIA 1NXUA 1Z2IA 3UOEA
chains in the Genus database with same CATH superfamily
4JI7H 1KBEA 3VKEA 2E73A 4SGBI 2VQEH 2LTLA 3PDNA 2JEBI 1FAQA 4L9MA 2HH2A 1I6UA 1VBIA 3TO9A 2XRCA 3TO6A 1P9GA 5FUYA 3R5CA 4DUZH 4PDBA 5DT9A 1CHOI 2PY9A 1MT1A 5J8CA 5LMNH 2NN6G 1SGRI 3OTOH 1XX6A 1IBKH 5E3PA 2AXYA 4JCVE 2CPMA 1IBMH 4LF9H 2BUSA 1CT2I 1TBQR 5DAEA 1W3SA 2ENZA 2ROWA 1HDLA 4DV2H 3OXGA 1CGJI 2VQFH 1SGNI 2LB7A 4H8AA 3TOAA 5BR8H 3J80W 3R5BA 4LFAH 3VDUA 3BJIA 2UVOA 3KDKA 1CE3A 1NUBA 5E3QA 4DV1H 3U1KA 1ZZIA 4JVHA 1MJAA 2CTMA 2BL5A 2Z0SA 3KDGA 1FJGH 2F4VH 5IT9W 4NZRM 4WALA 1X0AA 5C0XG 2OPUA 4JI1H 5HI7A 2KMPA 1J4WA 5LMUH 2E5LH 5JHWC 4DR3H 2KMOA 4B8TA 2UXBH 2UUBH 2ARPF 3HH2C 1R0RI 3UGIA 1YTPA 1Y1BA 3FC3A 2QQCA 1RFHA 1CT4I 4LF5H 1XA6A 1K7TA 2E5RA 3FSYA 3FSXA 4E1PA 4LF8H 1HPTA 2A20A 2JVZA 2JYYA 2O4CA 1HNZH 2DIPA 1N34H 1AN1I 2K9HA 3VE5A 3GR5A 4LF4H 2B8TA 2GKRI 2QQEA 1BMOA 1U5KA 4DR6H 2V53A 2D9IA 4K0KH 2ELIA 4QMFB 2NU1I 3UEJA 4DR4H 1XBTA 4OD6A 4AIMA 4GKKH 4EC5A 2KMQA 1HR0H 2GKTI 4DV6H 4JI5H 1VDDA 1SGYI 2SGQI 4JV5H 4UXHA 1IBLH 2N52A 3QTLD 2E3UA 1CGII 4LFBH 1TUAA 4B8CD 4JI0H 5K36G 2RIJA 2YUUA 3E59A 1XNQH 4GKJH 2L7XA 3NCVA 4DV5H 1ULMA 2JZXA 4BA2I 2ZM6H 2ANNA 4OX9H 1PJUA 1Y1CA 5IWAH 2DKVA 4HGUA 4B6DA 2UZ3A 1J5KA 3MEKA 1FYBA 1HJAI 1V1HA 1WVNA 4MPIA 2ANRA 1N13A 1F0XA 1V9NA 3OETA 4WANA 5JEAG 1IY5A 2DGRA 1FARA 4JI8H 2CPQA 4LF7H 1MJ9A 5EX0A 3QAHA 3UFFA 2LF0A 2CTLA 3QWPA 4OCHA 1DS2I 2J9RA 4FJUA 1WHRA 1LR7A 1TBNA 2SGFI 4GI3C 2CWHA 3OVOA 4X62H 1ULKA 2N71A 1X4NA 4UXJA 4FJSA 1UG8A 4DR7H 1ULNA 4X64H 1ZTGA 4JVYA 4YHHH 2FMRA 4B3RH 1DTJA 5CCMA 1LR9A 4JI4H 3CXLA 4BA1I 1OMTA 1SGPI 4NXMH 2GVIA 2OPVA 4JI3H 2JZMA 2Y0MA 1R79A 3VDPA 4YY3H 1KHMA 4NZTM 2LEOA 3QD7X 1V8CA 5LL6b 2UXCH 1ODHA 3GABA 2X06A 2NU4I 1Y8FA 5J8FA 1KBFA 4WP4A 2HH3A 1UVFA 3SB1A 1FKAH 1SGEI 4E1RA 3OSSD 4IFDG 4AMLA 1PCEA 4OVOA 5EX3A 2JXDA 1TBRR 2BA0A 3SGQI 1EC6A 1TBOA 1PTRA 2GKVA 3T1YH 2NU0I 3UGLA 2JA9A 1WTJA 1TURA 1K7UA 2SGDI 2WGCA 2Y3MA 4B3MH 1N32H 2CJSC 1MSZA 2ODDA 2SGPI 1S20A 2NU2I 4E9JA 1HNXH 1X9ZA 3OL0A 4G08A 2UXDH 1DT4A 2VRWB 1OYVI 3JAMW 4DUYH 2CTFA 3EZJA 2MJHA 3KY9A 2P2RA 2B0UC 2JEAI 2YQPA 2QNDA 3RU0A 1CSOI 3R5DA 1UUCA 1N36H 1N33H 2FPHX 2CTJA 1WGTA 1Z2IA 1MJBA 1SGDI 3T1HH 4JYAH 4KHPH 2X52A 5HQ8A 3SGBI 4DR5H 2GIVA 2OZUA 2G8YA 1PQXA 2ORVA 5FUVA 2M8WA 5CCLA 1VIHA 5FUXA 1DS3I 9WGAA 2CTKA 4A24A 4AM3A 3J7AK 2JA1A 1OMUA 1IY6A 5E3RA 2M5XA 3OXFA 3E2IA 2LRRA 1M8CA 2ENNA 1X4SA 1HNWH 2WVJA 2F3CI 2OD1A 1I94H 2FFMA 4NBQA 2VKCA 3TJQA 4JI6H 4JI2H 4DV4H 2PQUA 4DR2H 1ZZJA 2WCYA 1WGCA 2QQ0A 2P6AC 1YU6C 1BUSA 1FY7A 4X65H 1M8BA 1TUSA 2CTEA 3V69A 2HHHH 1CT0I 4LF6H 2YQRA 1SGQI 5FLXW 2PQ8A 3FAUA 1TGSI 2V1CA 1X4MA 2RC4A 3GKUA 5FUWA 2KCXA 2LUYA 2JW6A 1IW4A 4OO1G 1AN7A 2NU3I 1HEVA 1P9ZA 4DNCA 1XMQH 1SEIA 2QQDA 2CWGA 2V1CC 1PTQA 1LR8A 3B4VC 3UEYA 3R5AA 3D00A 4AQYH 3I0PA 2X3TA 1WE8A 2K1HA 2ORWA 7WGAA 2W0TA 3OXLA 2UU9H 2UUCH 2ZQEA 4DV0H 4DR1H 1NXUA 1UHAA 2UUAH 4X66H 2OU2A 1W4RA 1Q9BA 4FKDA 2SGEI 1J5EH 3AEVB 1WKXA 1KMAA 4DV3H 2N1AB 2KMRA 1K1GA 2A1SA 1UVGA 1OVOA 2N17A 2L8EA 1XRHA 4LIJA 4B3TH 1TIHA 2OVOA 2JE6I 1S03G 1ZZKA 2ERWA 3UOEA 1XMOH 5A2QW 2J87A 2PT7G 1XNRH 4B3SH 2CWFA 2QPOA 3GOXA 3TOBA 3SEKC 1PPFI 2FNFX 3J81W 4NXNH 1K7VA 3TO7A 1VIGA 2DB6A 1H0ZA 3UGDA 4DV7H 3RF2A 1TOTA 3L7ZC 2M6QA 4LFCH 4UXIA 1Z7KB 2LTMA 1V1IA 1X74A
chains in the Genus database with same CATH topology
1XRHA 1WTJA 4FJSA 2X06A 3I0PA 1S20A 1V9NA 4FJUA 4H8AA 2CWFA 1X0AA 2G8YA 2CWHA 1VBIA 1NXUA 1Z2IA 3UOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XRH A;  1WTJ A;  4FJS A;  2X06 A;  3I0P A;  1S20 A;  1V9N A;  4FJU A;  4H8A A;  2CWF A;  1X0A A;  2G8Y A;  2CWH A;  1VBI A;  1NXU A;  1Z2I A;  3UOE A; 
#chains in the Genus database with same CATH topology
 4JI7 H;  1KBE A;  3VKE A;  2E73 A;  4SGB I;  2VQE H;  2LTL A;  3PDN A;  2JEB I;  1FAQ A;  4L9M A;  2HH2 A;  1I6U A;  1VBI A;  3TO9 A;  2XRC A;  3TO6 A;  1P9G A;  5FUY A;  3R5C A;  4DUZ H;  4PDB A;  5DT9 A;  1CHO I;  2PY9 A;  1MT1 A;  5J8C A;  5LMN H;  2NN6 G;  1SGR I;  3OTO H;  1XX6 A;  1IBK H;  5E3P A;  2AXY A;  4JCV E;  2CPM A;  1IBM H;  4LF9 H;  2BUS A;  1CT2 I;  1TBQ R;  5DAE A;  1W3S A;  2ENZ A;  2ROW A;  1HDL A;  4DV2 H;  3OXG A;  1CGJ I;  2VQF H;  1SGN I;  2LB7 A;  4H8A A;  3TOA A;  5BR8 H;  3J80 W;  3R5B A;  4LFA H;  3VDU A;  3BJI A;  2UVO A;  3KDK A;  1CE3 A;  1NUB A;  5E3Q A;  4DV1 H;  3U1K A;  1ZZI A;  4JVH A;  1MJA A;  2CTM A;  2BL5 A;  2Z0S A;  3KDG A;  1FJG H;  2F4V H;  5IT9 W;  4NZR M;  4WAL A;  1X0A A;  5C0X G;  2OPU A;  4JI1 H;  5HI7 A;  2KMP A;  1J4W A;  5LMU H;  2E5L H;  5JHW C;  4DR3 H;  2KMO A;  4B8T A;  2UXB H;  2UUB H;  2ARP F;  3HH2 C;  1R0R I;  3UGI A;  1YTP A;  1Y1B A;  3FC3 A;  2QQC A;  1RFH A;  1CT4 I;  4LF5 H;  1XA6 A;  1K7T A;  2E5R A;  3FSY A;  3FSX A;  4E1P A;  4LF8 H;  1HPT A;  2A20 A;  2JVZ A;  2JYY A;  2O4C A;  1HNZ H;  2DIP A;  1N34 H;  1AN1 I;  2K9H A;  3VE5 A;  3GR5 A;  4LF4 H;  2B8T A;  2GKR I;  2QQE A;  1BMO A;  1U5K A;  4DR6 H;  2V53 A;  2D9I A;  4K0K H;  2ELI A;  4QMF B;  2NU1 I;  3UEJ A;  4DR4 H;  1XBT A;  4OD6 A;  4AIM A;  4GKK H;  4EC5 A;  2KMQ A;  1HR0 H;  2GKT I;  4DV6 H;  4JI5 H;  1VDD A;  1SGY I;  2SGQ I;  4JV5 H;  4UXH A;  1IBL H;  2N52 A;  3QTL D;  2E3U A;  1CGI I;  4LFB H;  1TUA A;  4B8C D;  4JI0 H;  5K36 G;  2RIJ A;  2YUU A;  3E59 A;  1XNQ H;  4GKJ H;  2L7X A;  3NCV A;  4DV5 H;  1ULM A;  2JZX A;  4BA2 I;  2ZM6 H;  2ANN A;  4OX9 H;  1PJU A;  1Y1C A;  5IWA H;  2DKV A;  4HGU A;  4B6D A;  2UZ3 A;  1J5K A;  3MEK A;  1FYB A;  1HJA I;  1V1H A;  1WVN A;  4MPI A;  2ANR A;  1N13 A;  1F0X A;  1V9N A;  3OET A;  4WAN A;  5JEA G;  1IY5 A;  2DGR A;  1FAR A;  4JI8 H;  2CPQ A;  4LF7 H;  1MJ9 A;  5EX0 A;  3QAH A;  3UFF A;  2LF0 A;  2CTL A;  3QWP A;  4OCH A;  1DS2 I;  2J9R A;  4FJU A;  1WHR A;  1LR7 A;  1TBN A;  2SGF I;  4GI3 C;  2CWH A;  3OVO A;  4X62 H;  1ULK A;  2N71 A;  1X4N A;  4UXJ A;  4FJS A;  1UG8 A;  4DR7 H;  1ULN A;  4X64 H;  1ZTG A;  4JVY A;  4YHH H;  2FMR A;  4B3R H;  1DTJ A;  5CCM A;  1LR9 A;  4JI4 H;  3CXL A;  4BA1 I;  1OMT A;  1SGP I;  4NXM H;  2GVI A;  2OPV A;  4JI3 H;  2JZM A;  2Y0M A;  1R79 A;  3VDP A;  4YY3 H;  1KHM A;  4NZT M;  2LEO A;  3QD7 X;  1V8C A;  5LL6 b;  2UXC H;  1ODH A;  3GAB A;  2X06 A;  2NU4 I;  1Y8F A;  5J8F A;  1KBF A;  4WP4 A;  2HH3 A;  1UVF A;  3SB1 A;  1FKA H;  1SGE I;  4E1R A;  3OSS D;  4IFD G;  4AML A;  1PCE A;  4OVO A;  5EX3 A;  2JXD A;  1TBR R;  2BA0 A;  3SGQ I;  1EC6 A;  1TBO A;  1PTR A;  2GKV A;  3T1Y H;  2NU0 I;  3UGL A;  2JA9 A;  1WTJ A;  1TUR A;  1K7U A;  2SGD I;  2WGC A;  2Y3M A;  4B3M H;  1N32 H;  2CJS C;  1MSZ A;  2ODD A;  2SGP I;  1S20 A;  2NU2 I;  4E9J A;  1HNX H;  1X9Z A;  3OL0 A;  4G08 A;  2UXD H;  1DT4 A;  2VRW B;  1OYV I;  3JAM W;  4DUY H;  2CTF A;  3EZJ A;  2MJH A;  3KY9 A;  2P2R A;  2B0U C;  2JEA I;  2YQP A;  2QND A;  3RU0 A;  1CSO I;  3R5D A;  1UUC A;  1N36 H;  1N33 H;  2FPH X;  2CTJ A;  1WGT A;  1Z2I A;  1MJB A;  1SGD I;  3T1H H;  4JYA H;  4KHP H;  2X52 A;  5HQ8 A;  3SGB I;  4DR5 H;  2GIV A;  2OZU A;  2G8Y A;  1PQX A;  2ORV A;  5FUV A;  2M8W A;  5CCL A;  1VIH A;  5FUX A;  1DS3 I;  9WGA A;  2CTK A;  4A24 A;  4AM3 A;  3J7A K;  2JA1 A;  1OMU A;  1IY6 A;  5E3R A;  2M5X A;  3OXF A;  3E2I A;  2LRR A;  1M8C A;  2ENN A;  1X4S A;  1HNW H;  2WVJ A;  2F3C I;  2OD1 A;  1I94 H;  2FFM A;  4NBQ A;  2VKC A;  3TJQ A;  4JI6 H;  4JI2 H;  4DV4 H;  2PQU A;  4DR2 H;  1ZZJ A;  2WCY A;  1WGC A;  2QQ0 A;  2P6A C;  1YU6 C;  1BUS A;  1FY7 A;  4X65 H;  1M8B A;  1TUS A;  2CTE A;  3V69 A;  2HHH H;  1CT0 I;  4LF6 H;  2YQR A;  1SGQ I;  5FLX W;  2PQ8 A;  3FAU A;  1TGS I;  2V1C A;  1X4M A;  2RC4 A;  3GKU A;  5FUW A;  2KCX A;  2LUY A;  2JW6 A;  1IW4 A;  4OO1 G;  1AN7 A;  2NU3 I;  1HEV A;  1P9Z A;  4DNC A;  1XMQ H;  1SEI A;  2QQD A;  2CWG A;  2V1C C;  1PTQ A;  1LR8 A;  3B4V C;  3UEY A;  3R5A A;  3D00 A;  4AQY H;  3I0P A;  2X3T A;  1WE8 A;  2K1H A;  2ORW A;  7WGA A;  2W0T A;  3OXL A;  2UU9 H;  2UUC H;  2ZQE A;  4DV0 H;  4DR1 H;  1NXU A;  1UHA A;  2UUA H;  4X66 H;  2OU2 A;  1W4R A;  1Q9B A;  4FKD A;  2SGE I;  1J5E H;  3AEV B;  1WKX A;  1KMA A;  4DV3 H;  2N1A B;  2KMR A;  1K1G A;  2A1S A;  1UVG A;  1OVO A;  2N17 A;  2L8E A;  1XRH A;  4LIJ A;  4B3T H;  1TIH A;  2OVO A;  2JE6 I;  1S03 G;  1ZZK A;  2ERW A;  3UOE A;  1XMO H;  5A2Q W;  2J87 A;  2PT7 G;  1XNR H;  4B3S H;  2CWF A;  2QPO A;  3GOX A;  3TOB A;  3SEK C;  1PPF I;  2FNF X;  3J81 W;  4NXN H;  1K7V A;  3TO7 A;  1VIG A;  2DB6 A;  1H0Z A;  3UGD A;  4DV7 H;  3RF2 A;  1TOT A;  3L7Z C;  2M6Q A;  4LFC H;  4UXI A;  1Z7K B;  2LTM A;  1V1I A;  1X74 A; 
#chains in the Genus database with same CATH homology
 1XRH A;  1WTJ A;  4FJS A;  2X06 A;  3I0P A;  1S20 A;  1V9N A;  4FJU A;  4H8A A;  2CWF A;  1X0A A;  2G8Y A;  2CWH A;  1VBI A;  1NXU A;  1Z2I A;  3UOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...