2CWFA

Crystal structure of delta1-piperideine-2-carboxylate reductase from pseudomonas syringae complexed with nadph
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
332
structure length
332
Chain Sequence
b'TQTVSYPQLIDLLRRIFVVHGTSPEVADVLAENCASAQRDGSHSHGIFRIPGYLSSLASGWVDGKAVPVVEDVGAAFVRVDACNGFAQPALAAARSLLIDKARSAGVAILAIRGSHHFAALWPDVEPFAEQGLVALSMVNSMTCVVPHGARQPLFGTNPIAFGAPRAGGEPIVFDLATSAIAHGDVQIAAREGRLLPAGMGVDRDGLPTQEPRAILDGGALLPFGGHKGSALSMMVELLAAGLTGGNFSFEFDWSKHPGAQTPWTGQLLIVIDPDKGAGQHFAQRSEELVRQLHGVGQERLPGDRRYLERARSMAHGIVIAQADLERLQELA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords delta1-piperideine-2-carboxylate reductase
molecule tags Oxidoreductase
source organism Pseudomonas syringae pv. tomato
publication title Crystal structures of Delta1-piperideine-2-carboxylate/Delta1-pyrroline-2-carboxylate reductase belonging to a new family of NAD(P)H-dependent oxidoreductases: conformational change, substrate recognition, and stereochemistry of the reaction
pubmed doi rcsb
total genus 113
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.4.1.17: N-methylalanine dehydrogenase.
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 2cwfA01
3.30.60.50 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Hypothetical oxidoreductase yiak; domain 3 2cwfA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 2cwfA02
1V9NA 1VBIA 2CWHA 4FJUA 1S20A 1XRHA 1WTJA 2G8YA 2X06A 1Z2IA 1X0AA 4FJSA 1NXUA 3UOEA 3I0PA 4H8AA 2CWFA
chains in the Genus database with same CATH superfamily
1V9NA 1UVGA 4GKJH 1CT4I 3OVOA 3CXLA 5IT9W 2ZQEA 1HR0H 2JE6I 4JV5H 3FC3A 4UXIA 3FSXA 1PTRA 4DV3H 4FJSA 1ZTGA 1XNRH 4JI7H 2UUCH 2G8YA 1BMOA 4E1PA 4OO1G 2CWGA 4GI3C 1CGJI 4H8AA 1FJGH 3J81W 1TGSI 4OCHA 4JI5H 1WHRA 5EX0A 1WE8A 4LIJA 2CTFA 2Z0SA 1K7TA 3V69A 2Y0MA 1WGCA 1VIHA 5HI7A 2BA0A 3SB1A 1NXUA 5A2QW 3HH2C 1TUSA 1J5EH 5E3PA 2NU0I 3TOAA 1ULKA 2ROWA 3J80W 1XA6A 1PCEA 3FSYA 2UUAH 1OMUA 5LMNH 1W4RA 3VDPA 2FFMA 2BUSA 1HDLA 4B3TH 3VKEA 1OVOA 2QQEA 1P9GA 1K1GA 1RFHA 2SGEI 4BA2I 4FKDA 1N34H 4OX9H 4B3RH 2UXDH 1J5KA 2YUUA 3UFFA 1MJBA 4NZRM 3B4VC 2OZUA 1AN7A 1SGQI 2DB6A 1HNWH 2VQEH 2B0UC 2JXDA 2LB7A 3UEJA 1IY5A 2L7XA 3MEKA 2WGCA 2RIJA 2CTKA 4NBQA 2ARPF 4OD6A 1MJAA 3TOBA 1R0RI 4AM3A 4X64H 2QQCA 3QTLD 4YHHH 1TURA 2KMOA 5CCMA 4JVYA 1VBIA 5CCLA 4B8TA 2CWFA 3GABA 5EX3A 5C0XG 3UGDA 2X06A 2N1AB 1X0AA 1XBTA 9WGAA 4DR4H 2E3UA 2P6AC 1CT2I 1SGEI 1DT4A 1K7VA 3GKUA 4LF7H 4LF4H 2J87A 4JYAH 3OXFA 4DV7H 1SGRI 2ORVA 2A20A 2CWHA 2SGQI 3QAHA 2CTMA 2E5LH 5IWAH 2JA1A 5E3QA 4X62H 1MSZA 1P9ZA 1Y8FA 2V1CC 2LTLA 4DR3H 1N36H 4DR2H 2SGDI 7WGAA 4PDBA 2CPQA 3BJIA 4DV1H 4UXHA 2X52A 3I0PA 3OETA 4DR1H 2M6QA 1HPTA 2FPHX 1NUBA 2KMRA 1CHOI 2Y3MA 2QQ0A 1TOTA 2V1CA 1XX6A 2J9RA 3SEKC 1N33H 3OXGA 4LFCH 3L7ZC 1WTJA 1XMOH 1HEVA 2WVJA 2CTJA 1X74A 2GVIA 4DUYH 2LF0A 2MJHA 5BR8H 1I94H 4L9MA 3FAUA 5J8CA 2WCYA 1ODHA 4WP4A 3OXLA 4FJUA 4A24A 4KHPH 4OVOA 2CJSC 4MPIA 5JEAG 2PQUA 2GKVA 1TUAA 4BA1I 4LF8H 2NU4I 4B3MH 2JEAI 3TJQA 1IBLH 3OSSD 2ODDA 1FAQA 4AIMA 1WKXA 2RC4A 1PPFI 2NN6G 2ERWA 3UGLA 3E59A 4SGBI 2GKTI 1M8CA 1XRHA 4JI3H 1VDDA 2GIVA 3SGBI 2XRCA 2OPUA 1V8CA 1V1IA 2A1SA 1OMTA 1PJUA 1VIGA 3RU0A 1TIHA 4UXJA 4WANA 2P2RA 2OPVA 2FNFX 2NU1I 1WGTA 2K9HA 1LR7A 3JAMW 3E2IA 1XNQH 3R5CA 1DS2I 2PY9A 4DNCA 2N17A 1CE3A 3UGIA 2JYYA 5DT9A 1I6UA 1XMQH 2JW6A 1M8BA 3T1HH 4GKKH 4B3SH 2KMPA 1UUCA 2CTEA 3VDUA 2O4CA 2F3CI 1FKAH 4G08A 5FUVA 2UU9H 2ORWA 4LF6H 1YU6C 2JVZA 3KDKA 2DGRA 1SGPI 1UHAA 4NXMH 1PTQA 5FUXA 1MT1A 3OL0A 2LTMA 2NU2I 5JHWC 3KY9A 2ELIA 4JI8H 1DS3I 3OTOH 4WALA 5LL6b 2YQPA 1IBMH 3TO9A 2UXCH 2X3TA 4JI2H 1ULMA 2PQ8A 2CPMA 4X65H 2JA9A 2UZ3A 4YY3H 3RF2A 1WVNA 3VE5A 3GOXA 4AQYH 4JVHA 2PT7G 4JI1H 2LEOA 2L8EA 1EC6A 1HJAI 2N71A 1F0XA 3KDGA 4LF5H 1FY7A 2QQDA 2OD1A 4NZTM 1S20A 3J7AK 1SGDI 1KBFA 3QWPA 1KMAA 4QMFB 1ZZIA 1Z2IA 1X4MA 1KBEA 2UVOA 2HH3A 4NXNH 2VRWB 1DTJA 2LRRA 2N52A 2HHHH 2QPOA 4JI4H 4AMLA 3EZJA 2VQFH 4E1RA 1FARA 5LMUH 3D00A 3PDNA 2OVOA 4E9JA 2E73A 4DR7H 2KMQA 3UEYA 1W3SA 1KHMA 4LF9H 2AXYA 4JI0H 2LUYA 1X4NA 2QNDA 2DIPA 1N32H 2ANRA 4DV6H 2FMRA 4K0KH 1U5KA 2GKRI 1V1HA 4B6DA 3GR5A 2ZM6H 1IY6A 4DV2H 1R79A 1HNXH 1UG8A 2W0TA 4DR5H 2BL5A 3R5BA 5E3RA 1X9ZA 2UUBH 1IBKH 3U1KA 2NU3I 1PQXA 3TO7A 1ZZKA 4DUZH 1SGNI 3QD7X 1HNZH 1MJ9A 1TBRR 3SGQI 1Y1CA 2DKVA 3T1YH 5J8FA 2HH2A 2K1HA 3UOEA 2M8WA 1Z7KB 1ULNA 1AN1I 1J4WA 4HGUA 1LR8A 1K7UA 2JZXA 5HQ8A 5FUYA 2YQRA 1TBOA 4EC5A 2KCXA 1OYVI 5FUWA 1FYBA 1IW4A 4X66H 1SGYI 4IFDG 1BUSA 1Q9BA 2CTLA 4JCVE 2D9IA 2OU2A 5K36G 1UVFA 2E5RA 2ENNA 1ZZJA 4LFAH 1X4SA 2JZMA 2ENZA 4JI6H 1S03G 2V53A 2SGFI 2F4VH 1CT0I 3NCVA 2ANNA 4DV5H 4DR6H 1YTPA 1TBQR 5FLXW 3AEVB 4LFBH 2UXBH 3R5DA 4B8CD 2SGPI 4DV0H 1TBNA 4DV4H 1SEIA 2JEBI 5DAEA 2VKCA 1Y1BA 1LR9A 2M5XA 1H0ZA 1CSOI 2B8TA 3R5AA 3TO6A 1N13A 1CGII
chains in the Genus database with same CATH topology
1V9NA 1VBIA 2CWHA 4FJUA 1S20A 1XRHA 1WTJA 2G8YA 2X06A 1Z2IA 1X0AA 4FJSA 1NXUA 3UOEA 3I0PA 4H8AA 2CWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V9N A;  1VBI A;  2CWH A;  4FJU A;  1S20 A;  1XRH A;  1WTJ A;  2G8Y A;  2X06 A;  1Z2I A;  1X0A A;  4FJS A;  1NXU A;  3UOE A;  3I0P A;  4H8A A;  2CWF A; 
#chains in the Genus database with same CATH topology
 1V9N A;  1UVG A;  4GKJ H;  1CT4 I;  3OVO A;  3CXL A;  5IT9 W;  2ZQE A;  1HR0 H;  2JE6 I;  4JV5 H;  3FC3 A;  4UXI A;  3FSX A;  1PTR A;  4DV3 H;  4FJS A;  1ZTG A;  1XNR H;  4JI7 H;  2UUC H;  2G8Y A;  1BMO A;  4E1P A;  4OO1 G;  2CWG A;  4GI3 C;  1CGJ I;  4H8A A;  1FJG H;  3J81 W;  1TGS I;  4OCH A;  4JI5 H;  1WHR A;  5EX0 A;  1WE8 A;  4LIJ A;  2CTF A;  2Z0S A;  1K7T A;  3V69 A;  2Y0M A;  1WGC A;  1VIH A;  5HI7 A;  2BA0 A;  3SB1 A;  1NXU A;  5A2Q W;  3HH2 C;  1TUS A;  1J5E H;  5E3P A;  2NU0 I;  3TOA A;  1ULK A;  2ROW A;  3J80 W;  1XA6 A;  1PCE A;  3FSY A;  2UUA H;  1OMU A;  5LMN H;  1W4R A;  3VDP A;  2FFM A;  2BUS A;  1HDL A;  4B3T H;  3VKE A;  1OVO A;  2QQE A;  1P9G A;  1K1G A;  1RFH A;  2SGE I;  4BA2 I;  4FKD A;  1N34 H;  4OX9 H;  4B3R H;  2UXD H;  1J5K A;  2YUU A;  3UFF A;  1MJB A;  4NZR M;  3B4V C;  2OZU A;  1AN7 A;  1SGQ I;  2DB6 A;  1HNW H;  2VQE H;  2B0U C;  2JXD A;  2LB7 A;  3UEJ A;  1IY5 A;  2L7X A;  3MEK A;  2WGC A;  2RIJ A;  2CTK A;  4NBQ A;  2ARP F;  4OD6 A;  1MJA A;  3TOB A;  1R0R I;  4AM3 A;  4X64 H;  2QQC A;  3QTL D;  4YHH H;  1TUR A;  2KMO A;  5CCM A;  4JVY A;  1VBI A;  5CCL A;  4B8T A;  2CWF A;  3GAB A;  5EX3 A;  5C0X G;  3UGD A;  2X06 A;  2N1A B;  1X0A A;  1XBT A;  9WGA A;  4DR4 H;  2E3U A;  2P6A C;  1CT2 I;  1SGE I;  1DT4 A;  1K7V A;  3GKU A;  4LF7 H;  4LF4 H;  2J87 A;  4JYA H;  3OXF A;  4DV7 H;  1SGR I;  2ORV A;  2A20 A;  2CWH A;  2SGQ I;  3QAH A;  2CTM A;  2E5L H;  5IWA H;  2JA1 A;  5E3Q A;  4X62 H;  1MSZ A;  1P9Z A;  1Y8F A;  2V1C C;  2LTL A;  4DR3 H;  1N36 H;  4DR2 H;  2SGD I;  7WGA A;  4PDB A;  2CPQ A;  3BJI A;  4DV1 H;  4UXH A;  2X52 A;  3I0P A;  3OET A;  4DR1 H;  2M6Q A;  1HPT A;  2FPH X;  1NUB A;  2KMR A;  1CHO I;  2Y3M A;  2QQ0 A;  1TOT A;  2V1C A;  1XX6 A;  2J9R A;  3SEK C;  1N33 H;  3OXG A;  4LFC H;  3L7Z C;  1WTJ A;  1XMO H;  1HEV A;  2WVJ A;  2CTJ A;  1X74 A;  2GVI A;  4DUY H;  2LF0 A;  2MJH A;  5BR8 H;  1I94 H;  4L9M A;  3FAU A;  5J8C A;  2WCY A;  1ODH A;  4WP4 A;  3OXL A;  4FJU A;  4A24 A;  4KHP H;  4OVO A;  2CJS C;  4MPI A;  5JEA G;  2PQU A;  2GKV A;  1TUA A;  4BA1 I;  4LF8 H;  2NU4 I;  4B3M H;  2JEA I;  3TJQ A;  1IBL H;  3OSS D;  2ODD A;  1FAQ A;  4AIM A;  1WKX A;  2RC4 A;  1PPF I;  2NN6 G;  2ERW A;  3UGL A;  3E59 A;  4SGB I;  2GKT I;  1M8C A;  1XRH A;  4JI3 H;  1VDD A;  2GIV A;  3SGB I;  2XRC A;  2OPU A;  1V8C A;  1V1I A;  2A1S A;  1OMT A;  1PJU A;  1VIG A;  3RU0 A;  1TIH A;  4UXJ A;  4WAN A;  2P2R A;  2OPV A;  2FNF X;  2NU1 I;  1WGT A;  2K9H A;  1LR7 A;  3JAM W;  3E2I A;  1XNQ H;  3R5C A;  1DS2 I;  2PY9 A;  4DNC A;  2N17 A;  1CE3 A;  3UGI A;  2JYY A;  5DT9 A;  1I6U A;  1XMQ H;  2JW6 A;  1M8B A;  3T1H H;  4GKK H;  4B3S H;  2KMP A;  1UUC A;  2CTE A;  3VDU A;  2O4C A;  2F3C I;  1FKA H;  4G08 A;  5FUV A;  2UU9 H;  2ORW A;  4LF6 H;  1YU6 C;  2JVZ A;  3KDK A;  2DGR A;  1SGP I;  1UHA A;  4NXM H;  1PTQ A;  5FUX A;  1MT1 A;  3OL0 A;  2LTM A;  2NU2 I;  5JHW C;  3KY9 A;  2ELI A;  4JI8 H;  1DS3 I;  3OTO H;  4WAL A;  5LL6 b;  2YQP A;  1IBM H;  3TO9 A;  2UXC H;  2X3T A;  4JI2 H;  1ULM A;  2PQ8 A;  2CPM A;  4X65 H;  2JA9 A;  2UZ3 A;  4YY3 H;  3RF2 A;  1WVN A;  3VE5 A;  3GOX A;  4AQY H;  4JVH A;  2PT7 G;  4JI1 H;  2LEO A;  2L8E A;  1EC6 A;  1HJA I;  2N71 A;  1F0X A;  3KDG A;  4LF5 H;  1FY7 A;  2QQD A;  2OD1 A;  4NZT M;  1S20 A;  3J7A K;  1SGD I;  1KBF A;  3QWP A;  1KMA A;  4QMF B;  1ZZI A;  1Z2I A;  1X4M A;  1KBE A;  2UVO A;  2HH3 A;  4NXN H;  2VRW B;  1DTJ A;  2LRR A;  2N52 A;  2HHH H;  2QPO A;  4JI4 H;  4AML A;  3EZJ A;  2VQF H;  4E1R A;  1FAR A;  5LMU H;  3D00 A;  3PDN A;  2OVO A;  4E9J A;  2E73 A;  4DR7 H;  2KMQ A;  3UEY A;  1W3S A;  1KHM A;  4LF9 H;  2AXY A;  4JI0 H;  2LUY A;  1X4N A;  2QND A;  2DIP A;  1N32 H;  2ANR A;  4DV6 H;  2FMR A;  4K0K H;  1U5K A;  2GKR I;  1V1H A;  4B6D A;  3GR5 A;  2ZM6 H;  1IY6 A;  4DV2 H;  1R79 A;  1HNX H;  1UG8 A;  2W0T A;  4DR5 H;  2BL5 A;  3R5B A;  5E3R A;  1X9Z A;  2UUB H;  1IBK H;  3U1K A;  2NU3 I;  1PQX A;  3TO7 A;  1ZZK A;  4DUZ H;  1SGN I;  3QD7 X;  1HNZ H;  1MJ9 A;  1TBR R;  3SGQ I;  1Y1C A;  2DKV A;  3T1Y H;  5J8F A;  2HH2 A;  2K1H A;  3UOE A;  2M8W A;  1Z7K B;  1ULN A;  1AN1 I;  1J4W A;  4HGU A;  1LR8 A;  1K7U A;  2JZX A;  5HQ8 A;  5FUY A;  2YQR A;  1TBO A;  4EC5 A;  2KCX A;  1OYV I;  5FUW A;  1FYB A;  1IW4 A;  4X66 H;  1SGY I;  4IFD G;  1BUS A;  1Q9B A;  2CTL A;  4JCV E;  2D9I A;  2OU2 A;  5K36 G;  1UVF A;  2E5R A;  2ENN A;  1ZZJ A;  4LFA H;  1X4S A;  2JZM A;  2ENZ A;  4JI6 H;  1S03 G;  2V53 A;  2SGF I;  2F4V H;  1CT0 I;  3NCV A;  2ANN A;  4DV5 H;  4DR6 H;  1YTP A;  1TBQ R;  5FLX W;  3AEV B;  4LFB H;  2UXB H;  3R5D A;  4B8C D;  2SGP I;  4DV0 H;  1TBN A;  4DV4 H;  1SEI A;  2JEB I;  5DAE A;  2VKC A;  1Y1B A;  1LR9 A;  2M5X A;  1H0Z A;  1CSO I;  2B8T A;  3R5A A;  3TO6 A;  1N13 A;  1CGI I; 
#chains in the Genus database with same CATH homology
 1V9N A;  1VBI A;  2CWH A;  4FJU A;  1S20 A;  1XRH A;  1WTJ A;  2G8Y A;  2X06 A;  1Z2I A;  1X0A A;  4FJS A;  1NXU A;  3UOE A;  3I0P A;  4H8A A;  2CWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...