2CWFA

Crystal structure of delta1-piperideine-2-carboxylate reductase from pseudomonas syringae complexed with nadph
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
332
structure length
332
Chain Sequence
TQTVSYPQLIDLLRRIFVVHGTSPEVADVLAENCASAQRDGSHSHGIFRIPGYLSSLASGWVDGKAVPVVEDVGAAFVRVDACNGFAQPALAAARSLLIDKARSAGVAILAIRGSHHFAALWPDVEPFAEQGLVALSMVNSMTCVVPHGARQPLFGTNPIAFGAPRAGGEPIVFDLATSAIAHGDVQIAAREGRLLPAGMGVDRDGLPTQEPRAILDGGALLPFGGHKGSALSMMVELLAAGLTGGNFSFEFDWSKHPGAQTPWTGQLLIVIDPDKGAGQHFAQRSEELVRQLHGVGQERLPGDRRYLERARSMAHGIVIAQADLERLQELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Delta1-piperideine-2-carboxylate/Delta1-pyrroline-2-carboxylate reductase belonging to a new family of NAD(P)H-dependent oxidoreductases: conformational change, substrate recognition, and stereochemistry of the reaction
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
molecule keywords delta1-piperideine-2-carboxylate reductase
total genus 113
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.4.1.17: N-methylalanine dehydrogenase.
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 2cwfA01
3.30.60.50 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Hypothetical oxidoreductase yiak; domain 3 2cwfA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 2cwfA02
3I0PA 2CWFA 4FJSA 2CWHA 1XRHA 4H8AA 1V9NA 1WTJA 1Z2IA 1NXUA 2X06A 4FJUA 1VBIA 1X0AA 1S20A 3UOEA 2G8YA
chains in the Genus database with same CATH superfamily
3TO7A 4OX9H 1MJ9A 2SGQI 2CTLA 2X52A 3OVOA 2PQUA 4BA1I 2HH3A 4WALA 4E1PA 1CT4I 1OVOA 1TBQR 1W3SA 3OXLA 2K9HA 2P6AC 2M5XA 1LR9A 1WKXA 2J9RA 1HR0H 2W0TA 3FSXA 1NXUA 2ROWA 4LIJA 2X3TA 2N17A 1ZTGA 4DV2H 1XBTA 4B3MH 2CTKA 1IY5A 3E2IA 4EC5A 2BL5A 4YY3H 1Z2IA 3VE5A 1Q9BA 2YQRA 5K36G 4AMLA 1I6UA 3QAHA 1XMOH 4JVYA 2OU2A 1RFHA 2Y0MA 1V9NA 2DKVA 2JVZA 1M8BA 4GI3C 4JYAH 1FKAH 2QQCA 1LR7A 1N13A 1WTJA 1UG8A 3SEKC 2F3CI 1YU6C 3KDGA 5IT9W 5FLXW 4JI2H 1HNWH 1K7TA 3J80W 2ENZA 4DR6H 1CSOI 1XX6A 4X65H 3RU0A 3GKUA 2LF0A 4JI0H 1WHRA 3BJIA 2FPHX 3QD7X 5LMNH 2JYYA 4LF8H 1EC6A 4DNCA 3TJQA 1X9ZA 4E1RA 3UEJA 3TO6A 2CTJA 1HDLA 4UXHA 4FJUA 2KCXA 3TOBA 3J7AK 2ELIA 2Y3MA 2UXDH 3MEKA 2CWFA 2BUSA 1BUSA 1S20A 2QQDA 2JA1A 4NXNH 1DS3I 2LEOA 9WGAA 1W4RA 4LFBH 3R5AA 4IFDG 4UXIA 2VQFH 3I0PA 4QMFB 1Z7KB 1IBLH 4AIMA 3AEVB 4GKKH 1ZZKA 3UGIA 1WE8A 1M8CA 5CCLA 7WGAA 2J87A 2SGFI 1ZZJA 1FAQA 3GR5A 3GABA 1ZZIA 5A2QW 3T1YH 1X0AA 1XMQH 2ORWA 2L8EA 4DV7H 1ULMA 1AN7A 3TO9A 3PDNA 4DV3H 2OZUA 2FNFX 5HQ8A 3NCVA 4JI1H 2GIVA 4DV0H 2E5RA 2CPQA 3V69A 2OPVA 5DT9A 1TUAA 1VBIA 4DV4H 1V8CA 4FKDA 1FY7A 4OCHA 1S03G 5JHWC 1CE3A 1PJUA 3GOXA 2QPOA 2GVIA 1CGJI 3CXLA 2RC4A 3RF2A 4PDBA 2NU4I 3UEYA 5CCMA 5EX3A 1SGRI 1N36H 2E3UA 2ANRA 4NZTM 1TGSI 3UGLA 2UXBH 4SGBI 2FMRA 2LRRA 2SGEI 1SGPI 1X4MA 1KBEA 4B6DA 2KMPA 1SGYI 2WGCA 4B3SH 4OVOA 1HNZH 5BR8H 4NBQA 2ZQEA 1TBNA 3QTLD 5LMUH 4JI5H 4K0KH 4LFCH 3SGBI 2V53A 4DV6H 2BA0A 3U1KA 1PTQA 2HHHH 1TUSA 1DS2I 1DT4A 1PQXA 1OYVI 2A20A 5FUYA 5C0XG 1MT1A 4KHPH 3QWPA 1ODHA 2D9IA 3J81W 4JVHA 1R79A 1VIHA 4BA2I 4NXMH 1HEVA 4LFAH 3OETA 1N33H 2ODDA 1VDDA 2N52A 2E5LH 2JEAI 1SGQI 2CWHA 2UUAH 1SEIA 3SGQI 1R0RI 1BMOA 1MSZA 4AM3A 4JI4H 3EZJA 4DR5H 1CGII 1PCEA 2NU0I 1J5EH 1KBFA 1CHOI 4YHHH 1OMUA 2GKRI 1PPFI 3E59A 4LF6H 2UUBH 1WGTA 1UHAA 5FUVA 2NU3I 1Y1CA 4LF9H 2LB7A 2ZM6H 1P9ZA 3VDPA 1I94H 2V1CA 4DUZH 1N32H 2QQ0A 2JE6I 4X66H 2CJSC 1KHMA 1UVGA 1J4WA 1K1GA 2CWGA 2CTEA 1UUCA 4JI8H 2NU2I 2YQPA 1N34H 4DR1H 2M6QA 2UUCH 4FJSA 2QQEA 3D00A 2WCYA 2UXCH 2PY9A 2ORVA 2UU9H 3OXGA 1IBMH 1HJAI 4MPIA 2KMQA 4JV5H 1DTJA 4B3TH 2UZ3A 1K7UA 2RIJA 3FAUA 2DGRA 4GKJH 5EX0A 3VKEA 2NU1I 3R5BA 2VKCA 1CT0I 1OMTA 4A24A 5J8FA 2E73A 1FARA 1V1HA 1U5KA 1MJAA 3UFFA 1P9GA 2XRCA 2ERWA 2CPMA 2SGPI 2HH2A 1X4SA 2A1SA 3OTOH 1ULNA 1HNXH 1VIGA 2GKVA 1SGEI 1UVFA 4B3RH 2O4CA 3L7ZC 1ULKA 2ENNA 3R5CA 2DIPA 5E3RA 3TOAA 1TOTA 2MJHA 4L9MA 4WP4A 4OO1G 4OD6A 5IWAH 1IY6A 4DUYH 1TBOA 1PTRA 2N1AB 1SGNI 2JXDA 4DR4H 1NUBA 1FJGH 2LTLA 3KY9A 4B8TA 3OL0A 2OD1A 4X64H 1V1IA 2GKTI 2NN6G 3T1HH 2ANNA 2PT7G 4JCVE 2B0UC 2JA9A 3OXFA 4HGUA 3VDUA 1TBRR 3KDKA 5LL6b 2JZXA 1TIHA 4DV5H 4UXJA 3UOEA 3FC3A 2KMRA 2OVOA 5J8CA 1X4NA 4AQYH 2JZMA 2CTMA 2KMOA 3R5DA 3FSYA 3OSSD 4DR7H 1SGDI 4DR2H 1IW4A 1WVNA 1H0ZA 2SGDI 3HH2C 2AXYA 1MJBA 5E3PA 4DV1H 2OPUA 1XA6A 1LR8A 5DAEA 1Y1BA 3UGDA 3SB1A 2V1CC 4LF5H 5FUWA 2Z0SA 1WGCA 4B8CD 4DR3H 5JEAG 1X74A 2PQ8A 5E3QA 2FFMA 2K1HA 4G08A 2YUUA 4E9JA 3JAMW 2X06A 5HI7A 1CT2I 4NZRM 1AN1I 2UVOA 1KMAA 2JEBI 2JW6A 2P2RA 2N71A 2L7XA 2VRWB 4WANA 1XRHA 3B4VC 2DB6A 2QNDA 4JI6H 1YTPA 1HPTA 1FYBA 4H8AA 4LF7H 1TURA 5FUXA 2WVJA 1J5KA 1IBKH 1K7VA 4LF4H 2VQEH 2B8TA 2CTFA 1Y8FA 4X62H 2F4VH 2G8YA 2ARPF 4JI3H 2LUYA 1XNQH 4JI7H 1F0XA 2LTMA 1XNRH 2M8WA
chains in the Genus database with same CATH topology
3I0PA 2CWFA 4FJSA 2CWHA 1XRHA 4H8AA 1V9NA 1WTJA 1Z2IA 1NXUA 2X06A 4FJUA 1VBIA 1X0AA 1S20A 3UOEA 2G8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0P A;  2CWF A;  4FJS A;  2CWH A;  1XRH A;  4H8A A;  1V9N A;  1WTJ A;  1Z2I A;  1NXU A;  2X06 A;  4FJU A;  1VBI A;  1X0A A;  1S20 A;  3UOE A;  2G8Y A; 
#chains in the Genus database with same CATH topology
 3TO7 A;  4OX9 H;  1MJ9 A;  2SGQ I;  2CTL A;  2X52 A;  3OVO A;  2PQU A;  4BA1 I;  2HH3 A;  4WAL A;  4E1P A;  1CT4 I;  1OVO A;  1TBQ R;  1W3S A;  3OXL A;  2K9H A;  2P6A C;  2M5X A;  1LR9 A;  1WKX A;  2J9R A;  1HR0 H;  2W0T A;  3FSX A;  1NXU A;  2ROW A;  4LIJ A;  2X3T A;  2N17 A;  1ZTG A;  4DV2 H;  1XBT A;  4B3M H;  2CTK A;  1IY5 A;  3E2I A;  4EC5 A;  2BL5 A;  4YY3 H;  1Z2I A;  3VE5 A;  1Q9B A;  2YQR A;  5K36 G;  4AML A;  1I6U A;  3QAH A;  1XMO H;  4JVY A;  2OU2 A;  1RFH A;  2Y0M A;  1V9N A;  2DKV A;  2JVZ A;  1M8B A;  4GI3 C;  4JYA H;  1FKA H;  2QQC A;  1LR7 A;  1N13 A;  1WTJ A;  1UG8 A;  3SEK C;  2F3C I;  1YU6 C;  3KDG A;  5IT9 W;  5FLX W;  4JI2 H;  1HNW H;  1K7T A;  3J80 W;  2ENZ A;  4DR6 H;  1CSO I;  1XX6 A;  4X65 H;  3RU0 A;  3GKU A;  2LF0 A;  4JI0 H;  1WHR A;  3BJI A;  2FPH X;  3QD7 X;  5LMN H;  2JYY A;  4LF8 H;  1EC6 A;  4DNC A;  3TJQ A;  1X9Z A;  4E1R A;  3UEJ A;  3TO6 A;  2CTJ A;  1HDL A;  4UXH A;  4FJU A;  2KCX A;  3TOB A;  3J7A K;  2ELI A;  2Y3M A;  2UXD H;  3MEK A;  2CWF A;  2BUS A;  1BUS A;  1S20 A;  2QQD A;  2JA1 A;  4NXN H;  1DS3 I;  2LEO A;  9WGA A;  1W4R A;  4LFB H;  3R5A A;  4IFD G;  4UXI A;  2VQF H;  3I0P A;  4QMF B;  1Z7K B;  1IBL H;  4AIM A;  3AEV B;  4GKK H;  1ZZK A;  3UGI A;  1WE8 A;  1M8C A;  5CCL A;  7WGA A;  2J87 A;  2SGF I;  1ZZJ A;  1FAQ A;  3GR5 A;  3GAB A;  1ZZI A;  5A2Q W;  3T1Y H;  1X0A A;  1XMQ H;  2ORW A;  2L8E A;  4DV7 H;  1ULM A;  1AN7 A;  3TO9 A;  3PDN A;  4DV3 H;  2OZU A;  2FNF X;  5HQ8 A;  3NCV A;  4JI1 H;  2GIV A;  4DV0 H;  2E5R A;  2CPQ A;  3V69 A;  2OPV A;  5DT9 A;  1TUA A;  1VBI A;  4DV4 H;  1V8C A;  4FKD A;  1FY7 A;  4OCH A;  1S03 G;  5JHW C;  1CE3 A;  1PJU A;  3GOX A;  2QPO A;  2GVI A;  1CGJ I;  3CXL A;  2RC4 A;  3RF2 A;  4PDB A;  2NU4 I;  3UEY A;  5CCM A;  5EX3 A;  1SGR I;  1N36 H;  2E3U A;  2ANR A;  4NZT M;  1TGS I;  3UGL A;  2UXB H;  4SGB I;  2FMR A;  2LRR A;  2SGE I;  1SGP I;  1X4M A;  1KBE A;  4B6D A;  2KMP A;  1SGY I;  2WGC A;  4B3S H;  4OVO A;  1HNZ H;  5BR8 H;  4NBQ A;  2ZQE A;  1TBN A;  3QTL D;  5LMU H;  4JI5 H;  4K0K H;  4LFC H;  3SGB I;  2V53 A;  4DV6 H;  2BA0 A;  3U1K A;  1PTQ A;  2HHH H;  1TUS A;  1DS2 I;  1DT4 A;  1PQX A;  1OYV I;  2A20 A;  5FUY A;  5C0X G;  1MT1 A;  4KHP H;  3QWP A;  1ODH A;  2D9I A;  3J81 W;  4JVH A;  1R79 A;  1VIH A;  4BA2 I;  4NXM H;  1HEV A;  4LFA H;  3OET A;  1N33 H;  2ODD A;  1VDD A;  2N52 A;  2E5L H;  2JEA I;  1SGQ I;  2CWH A;  2UUA H;  1SEI A;  3SGQ I;  1R0R I;  1BMO A;  1MSZ A;  4AM3 A;  4JI4 H;  3EZJ A;  4DR5 H;  1CGI I;  1PCE A;  2NU0 I;  1J5E H;  1KBF A;  1CHO I;  4YHH H;  1OMU A;  2GKR I;  1PPF I;  3E59 A;  4LF6 H;  2UUB H;  1WGT A;  1UHA A;  5FUV A;  2NU3 I;  1Y1C A;  4LF9 H;  2LB7 A;  2ZM6 H;  1P9Z A;  3VDP A;  1I94 H;  2V1C A;  4DUZ H;  1N32 H;  2QQ0 A;  2JE6 I;  4X66 H;  2CJS C;  1KHM A;  1UVG A;  1J4W A;  1K1G A;  2CWG A;  2CTE A;  1UUC A;  4JI8 H;  2NU2 I;  2YQP A;  1N34 H;  4DR1 H;  2M6Q A;  2UUC H;  4FJS A;  2QQE A;  3D00 A;  2WCY A;  2UXC H;  2PY9 A;  2ORV A;  2UU9 H;  3OXG A;  1IBM H;  1HJA I;  4MPI A;  2KMQ A;  4JV5 H;  1DTJ A;  4B3T H;  2UZ3 A;  1K7U A;  2RIJ A;  3FAU A;  2DGR A;  4GKJ H;  5EX0 A;  3VKE A;  2NU1 I;  3R5B A;  2VKC A;  1CT0 I;  1OMT A;  4A24 A;  5J8F A;  2E73 A;  1FAR A;  1V1H A;  1U5K A;  1MJA A;  3UFF A;  1P9G A;  2XRC A;  2ERW A;  2CPM A;  2SGP I;  2HH2 A;  1X4S A;  2A1S A;  3OTO H;  1ULN A;  1HNX H;  1VIG A;  2GKV A;  1SGE I;  1UVF A;  4B3R H;  2O4C A;  3L7Z C;  1ULK A;  2ENN A;  3R5C A;  2DIP A;  5E3R A;  3TOA A;  1TOT A;  2MJH A;  4L9M A;  4WP4 A;  4OO1 G;  4OD6 A;  5IWA H;  1IY6 A;  4DUY H;  1TBO A;  1PTR A;  2N1A B;  1SGN I;  2JXD A;  4DR4 H;  1NUB A;  1FJG H;  2LTL A;  3KY9 A;  4B8T A;  3OL0 A;  2OD1 A;  4X64 H;  1V1I A;  2GKT I;  2NN6 G;  3T1H H;  2ANN A;  2PT7 G;  4JCV E;  2B0U C;  2JA9 A;  3OXF A;  4HGU A;  3VDU A;  1TBR R;  3KDK A;  5LL6 b;  2JZX A;  1TIH A;  4DV5 H;  4UXJ A;  3UOE A;  3FC3 A;  2KMR A;  2OVO A;  5J8C A;  1X4N A;  4AQY H;  2JZM A;  2CTM A;  2KMO A;  3R5D A;  3FSY A;  3OSS D;  4DR7 H;  1SGD I;  4DR2 H;  1IW4 A;  1WVN A;  1H0Z A;  2SGD I;  3HH2 C;  2AXY A;  1MJB A;  5E3P A;  4DV1 H;  2OPU A;  1XA6 A;  1LR8 A;  5DAE A;  1Y1B A;  3UGD A;  3SB1 A;  2V1C C;  4LF5 H;  5FUW A;  2Z0S A;  1WGC A;  4B8C D;  4DR3 H;  5JEA G;  1X74 A;  2PQ8 A;  5E3Q A;  2FFM A;  2K1H A;  4G08 A;  2YUU A;  4E9J A;  3JAM W;  2X06 A;  5HI7 A;  1CT2 I;  4NZR M;  1AN1 I;  2UVO A;  1KMA A;  2JEB I;  2JW6 A;  2P2R A;  2N71 A;  2L7X A;  2VRW B;  4WAN A;  1XRH A;  3B4V C;  2DB6 A;  2QND A;  4JI6 H;  1YTP A;  1HPT A;  1FYB A;  4H8A A;  4LF7 H;  1TUR A;  5FUX A;  2WVJ A;  1J5K A;  1IBK H;  1K7V A;  4LF4 H;  2VQE H;  2B8T A;  2CTF A;  1Y8F A;  4X62 H;  2F4V H;  2G8Y A;  2ARP F;  4JI3 H;  2LUY A;  1XNQ H;  4JI7 H;  1F0X A;  2LTM A;  1XNR H;  2M8W A; 
#chains in the Genus database with same CATH homology
 3I0P A;  2CWF A;  4FJS A;  2CWH A;  1XRH A;  4H8A A;  1V9N A;  1WTJ A;  1Z2I A;  1NXU A;  2X06 A;  4FJU A;  1VBI A;  1X0A A;  1S20 A;  3UOE A;  2G8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...