4WALA

Crystal structure of selenomethionine msl5 protein in complex with rna at 2.2 a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
PTKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSVKEGKNASDLPPGAMNFEDPLHCLIMADSEDKMQKGIKVCQNIMIKAVTSPEGQNDLKRGQLRELAELNGTLREDNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Branchpoint-bridging protein
publication title Structural basis for recognition of intron branchpoint RNA by yeast Msl5 and selective effects of interfacial mutations on splicing of yeast pre-mRNAs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/rna
total genus 31
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4walA00
1WE8A 2CTKA 1EC6A 2DGRA 1DTJA 2BA0A 1ZTGA 2MJHA 2JEAI 4WANA 2ANNA 2CTMA 4IFDG 1X4NA 4JVYA 1VIHA 5C0XG 2CTJA 2JA9A 5JEAG 4QMFB 2JEBI 2AXYA 4B8TA 2P2RA 4BA1I 2ANRA 2HH3A 4OO1G 2HH2A 5K36G 1J5KA 2PQUA 1K1GA 2OPUA 1KHMA 1TUAA 2CTLA 2CTFA 4LIJA 4AIMA 3VKEA 2JE6I 2NN6G 1J4WA 4BA2I 4AM3A 3U1KA 2PY9A 3V69A 4WALA 4NBQA 2CTEA 2FMRA 1VIGA 2CPQA 3L7ZC 2E3UA 1DT4A 2OPVA 2BL5A 3AEVB 1WVNA 2QNDA 2JVZA 1ZZKA 4JVHA 2JZXA 2YQRA 2Z0SA 1ZZIA 1ZZJA 1X4MA
chains in the Genus database with same CATH superfamily
1WE8A 3OTOH 4DR7H 1IBMH 4LF5H 1X9ZA 3J81W 4DUZH 2CTMA 4NZTM 5IWAH 1XMOH 4G08A 4DR5H 2PT7G 4GKJH 1FKAH 1X4NA 4B3TH 2JA9A 5DT9A 4DR3H 2P2RA 4AQYH 2LTLA 5LL6b 4B3RH 1K1GA 4JI4H 4FJSA 2D9IA 1KHMA 5LMNH 2CTFA 4LIJA 1V9NA 4GKKH 4JYAH 4LF4H 2VQEH 2UXDH 1IBLH 3V69A 4WALA 4DV6H 3T1YH 1X0AA 4E9JA 3L7ZC 2VQFH 2UUCH 3T1HH 1HNXH 2JVZA 2ZM6H 1S03G 2YQRA 4X64H 1ZZIA 2A1SA 3SB1A 4LF7H 4DR6H 1WTJA 4LF6H 5IT9W 2E5LH 4WANA 2JEAI 2ZQEA 2X06A 3GABA 2CPMA 4DV3H 4X66H 4OO1G 1HNWH 4JI2H 4B8TA 5K36G 4LFCH 4DUYH 4YHHH 4LFAH 1XNQH 2OPUA 4KHPH 1TUAA 2K1HA 4OD6A 1MSZA 1J4WA 4AM3A 1XMQH 2PY9A 4EC5A 4NBQA 2FMRA 1SEIA 1DT4A 2M8WA 2OPVA 3AEVB 2QNDA 4JI5H 1ZZKA 1HR0H 1XNRH 3J7AK 2JZXA 1NXUA 4OX9H 2Z0SA 2G8YA 4LF9H 1UG8A 2HHHH 3QD7X 4IFDG 1X4MA 3JAMW 2CTKA 2DGRA 2UXCH 4PDBA 1DTJA 1ZTGA 2ANNA 4OCHA 2LF0A 1AN7A 3OETA 1N33H 4DV4H 4B3SH 2O4CA 5C0XG 2UU9H 5JEAG 2UUBH 2Y3MA 4QMFB 3RF2A 2AXYA 4NXNH 4DR4H 5BR8H 2HH2A 5LMUH 1J5KA 1PQXA 1IBKH 4JI1H 4JI7H 4B3MH 4K0KH 4DV5H 4DV2H 4LFBH 2CTLA 3UOEA 4NZRM 2CWFA 2JE6I 1N32H 4DV1H 4JI0H 1HNZH 4H8AA 2FFMA 4DR2H 1XRHA 2F4VH 4JV5H 1VIGA 2LTMA 1ODHA 1VBIA 1WVNA 4DR1H 3OSSD 4NXMH 3U1KA 1ZZJA 4FJUA 3GR5A 4X65H 4B8CD 1I94H 4X62H 1N36H 1EC6A 3EZJA 2BA0A 2MJHA 4LF8H 2LRRA 1FJGH 2UUAH 1V8CA 1J5EH 3KDGA 1WHRA 4JI8H 4JVYA 2CWHA 1VIHA 2CTJA 4JI3H 3FAUA 2JEBI 4BA1I 2ANRA 2HH3A 2PQUA 4YY3H 4JI6H 4DV0H 2VKCA 3I0PA 4AIMA 3VKEA 5A2QW 2NN6G 5FLXW 4DV7H 4BA2I 1F0XA 2CTEA 3NCVA 2CPQA 2E3UA 1N34H 1I6UA 1Z2IA 2BL5A 2FPHX 3GKUA 3J80W 4JVHA 3KDKA 1S20A 2M6QA 2UXBH
chains in the Genus database with same CATH topology
1WE8A 2CTKA 1EC6A 2DGRA 1DTJA 2BA0A 1ZTGA 2MJHA 2JEAI 4WANA 2ANNA 2CTMA 4IFDG 1X4NA 4JVYA 1VIHA 5C0XG 2CTJA 2JA9A 5JEAG 4QMFB 2JEBI 2AXYA 4B8TA 2P2RA 4BA1I 2ANRA 2HH3A 4OO1G 2HH2A 5K36G 1J5KA 2PQUA 1K1GA 2OPUA 1KHMA 1TUAA 2CTLA 2CTFA 4LIJA 4AIMA 3VKEA 2JE6I 2NN6G 1J4WA 4BA2I 4AM3A 3U1KA 2PY9A 3V69A 4WALA 4NBQA 2CTEA 2FMRA 1VIGA 2CPQA 3L7ZC 2E3UA 1DT4A 2OPVA 2BL5A 3AEVB 1WVNA 2QNDA 2JVZA 1ZZKA 4JVHA 2JZXA 2YQRA 2Z0SA 1ZZIA 1ZZJA 1X4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WE8 A;  2CTK A;  1EC6 A;  2DGR A;  1DTJ A;  2BA0 A;  1ZTG A;  2MJH A;  2JEA I;  4WAN A;  2ANN A;  2CTM A;  4IFD G;  1X4N A;  4JVY A;  1VIH A;  5C0X G;  2CTJ A;  2JA9 A;  5JEA G;  4QMF B;  2JEB I;  2AXY A;  4B8T A;  2P2R A;  4BA1 I;  2ANR A;  2HH3 A;  4OO1 G;  2HH2 A;  5K36 G;  1J5K A;  2PQU A;  1K1G A;  2OPU A;  1KHM A;  1TUA A;  2CTL A;  2CTF A;  4LIJ A;  4AIM A;  3VKE A;  2JE6 I;  2NN6 G;  1J4W A;  4BA2 I;  4AM3 A;  3U1K A;  2PY9 A;  3V69 A;  4WAL A;  4NBQ A;  2CTE A;  2FMR A;  1VIG A;  2CPQ A;  3L7Z C;  2E3U A;  1DT4 A;  2OPV A;  2BL5 A;  3AEV B;  1WVN A;  2QND A;  2JVZ A;  1ZZK A;  4JVH A;  2JZX A;  2YQR A;  2Z0S A;  1ZZI A;  1ZZJ A;  1X4M A; 
#chains in the Genus database with same CATH topology
 1WE8 A;  3OTO H;  4DR7 H;  1IBM H;  4LF5 H;  1X9Z A;  3J81 W;  4DUZ H;  2CTM A;  4NZT M;  5IWA H;  1XMO H;  4G08 A;  4DR5 H;  2PT7 G;  4GKJ H;  1FKA H;  1X4N A;  4B3T H;  2JA9 A;  5DT9 A;  4DR3 H;  2P2R A;  4AQY H;  2LTL A;  5LL6 b;  4B3R H;  1K1G A;  4JI4 H;  4FJS A;  2D9I A;  1KHM A;  5LMN H;  2CTF A;  4LIJ A;  1V9N A;  4GKK H;  4JYA H;  4LF4 H;  2VQE H;  2UXD H;  1IBL H;  3V69 A;  4WAL A;  4DV6 H;  3T1Y H;  1X0A A;  4E9J A;  3L7Z C;  2VQF H;  2UUC H;  3T1H H;  1HNX H;  2JVZ A;  2ZM6 H;  1S03 G;  2YQR A;  4X64 H;  1ZZI A;  2A1S A;  3SB1 A;  4LF7 H;  4DR6 H;  1WTJ A;  4LF6 H;  5IT9 W;  2E5L H;  4WAN A;  2JEA I;  2ZQE A;  2X06 A;  3GAB A;  2CPM A;  4DV3 H;  4X66 H;  4OO1 G;  1HNW H;  4JI2 H;  4B8T A;  5K36 G;  4LFC H;  4DUY H;  4YHH H;  4LFA H;  1XNQ H;  2OPU A;  4KHP H;  1TUA A;  2K1H A;  4OD6 A;  1MSZ A;  1J4W A;  4AM3 A;  1XMQ H;  2PY9 A;  4EC5 A;  4NBQ A;  2FMR A;  1SEI A;  1DT4 A;  2M8W A;  2OPV A;  3AEV B;  2QND A;  4JI5 H;  1ZZK A;  1HR0 H;  1XNR H;  3J7A K;  2JZX A;  1NXU A;  4OX9 H;  2Z0S A;  2G8Y A;  4LF9 H;  1UG8 A;  2HHH H;  3QD7 X;  4IFD G;  1X4M A;  3JAM W;  2CTK A;  2DGR A;  2UXC H;  4PDB A;  1DTJ A;  1ZTG A;  2ANN A;  4OCH A;  2LF0 A;  1AN7 A;  3OET A;  1N33 H;  4DV4 H;  4B3S H;  2O4C A;  5C0X G;  2UU9 H;  5JEA G;  2UUB H;  2Y3M A;  4QMF B;  3RF2 A;  2AXY A;  4NXN H;  4DR4 H;  5BR8 H;  2HH2 A;  5LMU H;  1J5K A;  1PQX A;  1IBK H;  4JI1 H;  4JI7 H;  4B3M H;  4K0K H;  4DV5 H;  4DV2 H;  4LFB H;  2CTL A;  3UOE A;  4NZR M;  2CWF A;  2JE6 I;  1N32 H;  4DV1 H;  4JI0 H;  1HNZ H;  4H8A A;  2FFM A;  4DR2 H;  1XRH A;  2F4V H;  4JV5 H;  1VIG A;  2LTM A;  1ODH A;  1VBI A;  1WVN A;  4DR1 H;  3OSS D;  4NXM H;  3U1K A;  1ZZJ A;  4FJU A;  3GR5 A;  4X65 H;  4B8C D;  1I94 H;  4X62 H;  1N36 H;  1EC6 A;  3EZJ A;  2BA0 A;  2MJH A;  4LF8 H;  2LRR A;  1FJG H;  2UUA H;  1V8C A;  1J5E H;  3KDG A;  1WHR A;  4JI8 H;  4JVY A;  2CWH A;  1VIH A;  2CTJ A;  4JI3 H;  3FAU A;  2JEB I;  4BA1 I;  2ANR A;  2HH3 A;  2PQU A;  4YY3 H;  4JI6 H;  4DV0 H;  2VKC A;  3I0P A;  4AIM A;  3VKE A;  5A2Q W;  2NN6 G;  5FLX W;  4DV7 H;  4BA2 I;  1F0X A;  2CTE A;  3NCV A;  2CPQ A;  2E3U A;  1N34 H;  1I6U A;  1Z2I A;  2BL5 A;  2FPH X;  3GKU A;  3J80 W;  4JVH A;  3KDK A;  1S20 A;  2M6Q A;  2UXB H; 
#chains in the Genus database with same CATH homology
 1WE8 A;  2CTK A;  1EC6 A;  2DGR A;  1DTJ A;  2BA0 A;  1ZTG A;  2MJH A;  2JEA I;  4WAN A;  2ANN A;  2CTM A;  4IFD G;  1X4N A;  4JVY A;  1VIH A;  5C0X G;  2CTJ A;  2JA9 A;  5JEA G;  4QMF B;  2JEB I;  2AXY A;  4B8T A;  2P2R A;  4BA1 I;  2ANR A;  2HH3 A;  4OO1 G;  2HH2 A;  5K36 G;  1J5K A;  2PQU A;  1K1G A;  2OPU A;  1KHM A;  1TUA A;  2CTL A;  2CTF A;  4LIJ A;  4AIM A;  3VKE A;  2JE6 I;  2NN6 G;  1J4W A;  4BA2 I;  4AM3 A;  3U1K A;  2PY9 A;  3V69 A;  4WAL A;  4NBQ A;  2CTE A;  2FMR A;  1VIG A;  2CPQ A;  3L7Z C;  2E3U A;  1DT4 A;  2OPV A;  2BL5 A;  3AEV B;  1WVN A;  2QND A;  2JVZ A;  1ZZK A;  4JVH A;  2JZX A;  2YQR A;  2Z0S A;  1ZZI A;  1ZZJ A;  1X4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...