4WALA

Crystal structure of selenomethionine msl5 protein in complex with rna at 2.2 a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
PTKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSVKEGKNASDLPPGAMNFEDPLHCLIMADSEDKMQKGIKVCQNIMIKAVTSPEGQNDLKRGQLRELAELNGTLREDNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Branchpoint-bridging protein
publication title Structural basis for recognition of intron branchpoint RNA by yeast Msl5 and selective effects of interfacial mutations on splicing of yeast pre-mRNAs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/rna
total genus 31
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4walA00
2CTMA 2ANRA 4IFDG 2DGRA 1X4NA 2JE6I 4BA1I 2JEAI 2E3UA 2JEBI 2ANNA 4NBQA 3V69A 4OO1G 2BA0A 2HH3A 2YQRA 2PQUA 3L7ZC 2JZXA 2CTEA 4QMFB 1VIGA 2OPVA 1DT4A 4WALA 1K1GA 2MJHA 4LIJA 1KHMA 2PY9A 2NN6G 2CPQA 1X4MA 3U1KA 4JVHA 4B8TA 2OPUA 3VKEA 2JVZA 1ZTGA 4BA2I 1ZZJA 2HH2A 2CTKA 1J5KA 2JA9A 2CTJA 2QNDA 4JVYA 1WE8A 2CTFA 2P2RA 4AIMA 4AM3A 4WANA 1DTJA 2BL5A 2Z0SA 2AXYA 1ZZIA 1TUAA 1VIHA 1EC6A 2CTLA 1WVNA 5JEAG 5C0XG 5K36G 3AEVB 1J4WA 2FMRA 1ZZKA
chains in the Genus database with same CATH superfamily
4YY3H 1XMQH 2DGRA 4FJSA 5IWAH 1X4NA 4BA1I 2D9IA 4NZTM 1FJGH 4OO1G 2PQUA 1V8CA 2VQFH 1HR0H 1Z2IA 4DV3H 1S03G 4DR1H 1N32H 4B3MH 2UXBH 4NXNH 4DV7H 4AQYH 3U1KA 3I0PA 4JI7H 3GR5A 5A2QW 1SEIA 4DV0H 1ZZJA 4JI3H 4B8CD 2JA9A 1FKAH 4LF5H 4JVYA 1S20A 1WTJA 1DTJA 1AN7A 4GKJH 3RF2A 4JI8H 1ZZIA 4DR3H 5IT9W 4B3SH 2K1HA 2CTLA 5JEAG 4JYAH 2ZM6H 4JI1H 1ZZKA 1VBIA 1N36H 1IBKH 1V9NA 5LL6b 1N33H 2HHHH 2LTLA 4DV1H 2JEAI 1X9ZA 3QD7X 2ANNA 2JEBI 4DV6H 1J5EH 4LF6H 4K0KH 2BA0A 4H8AA 2LF0A 2JZXA 2OPVA 2FFMA 2O4CA 1UG8A 2UU9H 4JI5H 3NCVA 5BR8H 4LFBH 2NN6G 1X0AA 4JVHA 1XRHA 4B8TA 3VKEA 4B3TH 4DR2H 4B3RH 3KDGA 4DR7H 2CTKA 4OCHA 2CWFA 1J5KA 2CTJA 1N34H 1IBMH 1WE8A 4EC5A 1XNRH 4GKKH 2CTFA 5FLXW 2P2RA 4AM3A 2UXCH 3J7AK 2BL5A 2Z0SA 3FAUA 2G8YA 3J80W 1TUAA 4PDBA 3OETA 1WVNA 5C0XG 2UUAH 3T1HH 5K36G 1J4WA 1HNZH 1VIGA 1MSZA 2M8WA 2CTMA 4LFAH 4IFDG 2CPMA 2JE6I 4KHPH 4LF4H 2CWHA 2E3UA 1PQXA 4NBQA 4OX9H 3GKUA 2Y3MA 2X06A 3GABA 2CTEA 4QMFB 3KDKA 1K1GA 2MJHA 4DR4H 2UUCH 4LIJA 2LRRA 1KHMA 2LTMA 4JI6H 2CPQA 1X4MA 4FJUA 1I6UA 4DUZH 2A1SA 4X65H 4JI4H 2JVZA 1ZTGA 2UUBH 3JAMW 1WHRA 4DUYH 5DT9A 5LMNH 4DV5H 4DR5H 4AIMA 4NXMH 2AXYA 4LFCH 4LF9H 2VQEH 5LMUH 4YHHH 4X66H 3AEVB 1NXUA 4JV5H 2FMRA 1I94H 4OD6A 4JI2H 3UOEA 2ANRA 2FPHX 4LF8H 3J81W 3T1YH 2E5LH 4DV4H 3SB1A 3V69A 2UXDH 2HH3A 2YQRA 2ZQEA 3L7ZC 1F0XA 1HNWH 1DT4A 4WALA 2VKCA 3OSSD 4NZRM 2PY9A 2M6QA 4G08A 4LF7H 2OPUA 4BA2I 2HH2A 1HNXH 4DV2H 1IBLH 2QNDA 4JI0H 4E9JA 4WANA 4DR6H 4X64H 2PT7G 4X62H 1VIHA 1XMOH 1XNQH 3OTOH 1EC6A 2F4VH 3EZJA 1ODHA
chains in the Genus database with same CATH topology
2CTMA 2ANRA 4IFDG 2DGRA 1X4NA 2JE6I 4BA1I 2JEAI 2E3UA 2JEBI 2ANNA 4NBQA 3V69A 4OO1G 2BA0A 2HH3A 2YQRA 2PQUA 3L7ZC 2JZXA 2CTEA 4QMFB 1VIGA 2OPVA 1DT4A 4WALA 1K1GA 2MJHA 4LIJA 1KHMA 2PY9A 2NN6G 2CPQA 1X4MA 3U1KA 4JVHA 4B8TA 2OPUA 3VKEA 2JVZA 1ZTGA 4BA2I 1ZZJA 2HH2A 2CTKA 1J5KA 2JA9A 2CTJA 2QNDA 4JVYA 1WE8A 2CTFA 2P2RA 4AIMA 4AM3A 4WANA 1DTJA 2BL5A 2Z0SA 2AXYA 1ZZIA 1TUAA 1VIHA 1EC6A 2CTLA 1WVNA 5JEAG 5C0XG 5K36G 3AEVB 1J4WA 2FMRA 1ZZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTM A;  2ANR A;  4IFD G;  2DGR A;  1X4N A;  2JE6 I;  4BA1 I;  2JEA I;  2E3U A;  2JEB I;  2ANN A;  4NBQ A;  3V69 A;  4OO1 G;  2BA0 A;  2HH3 A;  2YQR A;  2PQU A;  3L7Z C;  2JZX A;  2CTE A;  4QMF B;  1VIG A;  2OPV A;  1DT4 A;  4WAL A;  1K1G A;  2MJH A;  4LIJ A;  1KHM A;  2PY9 A;  2NN6 G;  2CPQ A;  1X4M A;  3U1K A;  4JVH A;  4B8T A;  2OPU A;  3VKE A;  2JVZ A;  1ZTG A;  4BA2 I;  1ZZJ A;  2HH2 A;  2CTK A;  1J5K A;  2JA9 A;  2CTJ A;  2QND A;  4JVY A;  1WE8 A;  2CTF A;  2P2R A;  4AIM A;  4AM3 A;  4WAN A;  1DTJ A;  2BL5 A;  2Z0S A;  2AXY A;  1ZZI A;  1TUA A;  1VIH A;  1EC6 A;  2CTL A;  1WVN A;  5JEA G;  5C0X G;  5K36 G;  3AEV B;  1J4W A;  2FMR A;  1ZZK A; 
#chains in the Genus database with same CATH topology
 4YY3 H;  1XMQ H;  2DGR A;  4FJS A;  5IWA H;  1X4N A;  4BA1 I;  2D9I A;  4NZT M;  1FJG H;  4OO1 G;  2PQU A;  1V8C A;  2VQF H;  1HR0 H;  1Z2I A;  4DV3 H;  1S03 G;  4DR1 H;  1N32 H;  4B3M H;  2UXB H;  4NXN H;  4DV7 H;  4AQY H;  3U1K A;  3I0P A;  4JI7 H;  3GR5 A;  5A2Q W;  1SEI A;  4DV0 H;  1ZZJ A;  4JI3 H;  4B8C D;  2JA9 A;  1FKA H;  4LF5 H;  4JVY A;  1S20 A;  1WTJ A;  1DTJ A;  1AN7 A;  4GKJ H;  3RF2 A;  4JI8 H;  1ZZI A;  4DR3 H;  5IT9 W;  4B3S H;  2K1H A;  2CTL A;  5JEA G;  4JYA H;  2ZM6 H;  4JI1 H;  1ZZK A;  1VBI A;  1N36 H;  1IBK H;  1V9N A;  5LL6 b;  1N33 H;  2HHH H;  2LTL A;  4DV1 H;  2JEA I;  1X9Z A;  3QD7 X;  2ANN A;  2JEB I;  4DV6 H;  1J5E H;  4LF6 H;  4K0K H;  2BA0 A;  4H8A A;  2LF0 A;  2JZX A;  2OPV A;  2FFM A;  2O4C A;  1UG8 A;  2UU9 H;  4JI5 H;  3NCV A;  5BR8 H;  4LFB H;  2NN6 G;  1X0A A;  4JVH A;  1XRH A;  4B8T A;  3VKE A;  4B3T H;  4DR2 H;  4B3R H;  3KDG A;  4DR7 H;  2CTK A;  4OCH A;  2CWF A;  1J5K A;  2CTJ A;  1N34 H;  1IBM H;  1WE8 A;  4EC5 A;  1XNR H;  4GKK H;  2CTF A;  5FLX W;  2P2R A;  4AM3 A;  2UXC H;  3J7A K;  2BL5 A;  2Z0S A;  3FAU A;  2G8Y A;  3J80 W;  1TUA A;  4PDB A;  3OET A;  1WVN A;  5C0X G;  2UUA H;  3T1H H;  5K36 G;  1J4W A;  1HNZ H;  1VIG A;  1MSZ A;  2M8W A;  2CTM A;  4LFA H;  4IFD G;  2CPM A;  2JE6 I;  4KHP H;  4LF4 H;  2CWH A;  2E3U A;  1PQX A;  4NBQ A;  4OX9 H;  3GKU A;  2Y3M A;  2X06 A;  3GAB A;  2CTE A;  4QMF B;  3KDK A;  1K1G A;  2MJH A;  4DR4 H;  2UUC H;  4LIJ A;  2LRR A;  1KHM A;  2LTM A;  4JI6 H;  2CPQ A;  1X4M A;  4FJU A;  1I6U A;  4DUZ H;  2A1S A;  4X65 H;  4JI4 H;  2JVZ A;  1ZTG A;  2UUB H;  3JAM W;  1WHR A;  4DUY H;  5DT9 A;  5LMN H;  4DV5 H;  4DR5 H;  4AIM A;  4NXM H;  2AXY A;  4LFC H;  4LF9 H;  2VQE H;  5LMU H;  4YHH H;  4X66 H;  3AEV B;  1NXU A;  4JV5 H;  2FMR A;  1I94 H;  4OD6 A;  4JI2 H;  3UOE A;  2ANR A;  2FPH X;  4LF8 H;  3J81 W;  3T1Y H;  2E5L H;  4DV4 H;  3SB1 A;  3V69 A;  2UXD H;  2HH3 A;  2YQR A;  2ZQE A;  3L7Z C;  1F0X A;  1HNW H;  1DT4 A;  4WAL A;  2VKC A;  3OSS D;  4NZR M;  2PY9 A;  2M6Q A;  4G08 A;  4LF7 H;  2OPU A;  4BA2 I;  2HH2 A;  1HNX H;  4DV2 H;  1IBL H;  2QND A;  4JI0 H;  4E9J A;  4WAN A;  4DR6 H;  4X64 H;  2PT7 G;  4X62 H;  1VIH A;  1XMO H;  1XNQ H;  3OTO H;  1EC6 A;  2F4V H;  3EZJ A;  1ODH A; 
#chains in the Genus database with same CATH homology
 2CTM A;  2ANR A;  4IFD G;  2DGR A;  1X4N A;  2JE6 I;  4BA1 I;  2JEA I;  2E3U A;  2JEB I;  2ANN A;  4NBQ A;  3V69 A;  4OO1 G;  2BA0 A;  2HH3 A;  2YQR A;  2PQU A;  3L7Z C;  2JZX A;  2CTE A;  4QMF B;  1VIG A;  2OPV A;  1DT4 A;  4WAL A;  1K1G A;  2MJH A;  4LIJ A;  1KHM A;  2PY9 A;  2NN6 G;  2CPQ A;  1X4M A;  3U1K A;  4JVH A;  4B8T A;  2OPU A;  3VKE A;  2JVZ A;  1ZTG A;  4BA2 I;  1ZZJ A;  2HH2 A;  2CTK A;  1J5K A;  2JA9 A;  2CTJ A;  2QND A;  4JVY A;  1WE8 A;  2CTF A;  2P2R A;  4AIM A;  4AM3 A;  4WAN A;  1DTJ A;  2BL5 A;  2Z0S A;  2AXY A;  1ZZI A;  1TUA A;  1VIH A;  1EC6 A;  2CTL A;  1WVN A;  5JEA G;  5C0X G;  5K36 G;  3AEV B;  1J4W A;  2FMR A;  1ZZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...