4WALA

Crystal structure of selenomethionine msl5 protein in complex with rna at 2.2 a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
PTKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSVKEGKNASDLPPGAMNFEDPLHCLIMADSEDKMQKGIKVCQNIMIKAVTSPEGQNDLKRGQLRELAELNGTLREDNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for recognition of intron branchpoint RNA by yeast Msl5 and selective effects of interfacial mutations on splicing of yeast pre-mRNAs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/rna
molecule keywords Branchpoint-bridging protein
total genus 31
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4walA00
2ANRA 3U1KA 2P2RA 2CTFA 3L7ZC 1ZZKA 1J5KA 5K36G 4IFDG 4WALA 5JEAG 2Z0SA 1DT4A 1VIHA 1KHMA 5C0XG 1DTJA 2BL5A 1X4NA 2HH3A 2CTMA 2QNDA 2CTJA 2DGRA 1ZZIA 2JEBI 2YQRA 4BA2I 4NBQA 1X4MA 2JE6I 1ZTGA 2HH2A 2JA9A 2CTLA 2OPUA 1VIGA 2MJHA 3AEVB 4JVHA 1WVNA 1EC6A 2BA0A 1J4WA 3VKEA 2JEAI 2E3UA 4B8TA 1WE8A 4AM3A 2CPQA 4BA1I 2CTKA 4QMFB 1TUAA 2OPVA 1K1GA 4JVYA 3V69A 4OO1G 2FMRA 2JVZA 2NN6G 1ZZJA 4AIMA 4LIJA 2CTEA 2JZXA 2PY9A 2PQUA 4WANA 2ANNA 2AXYA
chains in the Genus database with same CATH superfamily
3U1KA 2P2RA 4K0KH 2CTFA 1ZZKA 4WALA 2K1HA 4JI0H 2FFMA 3EZJA 1DT4A 5C0XG 2BL5A 1X4NA 4JI1H 4H8AA 4EC5A 4BA2I 1S03G 2OPUA 1EC6A 4OCHA 1I6UA 5LL6b 2CWHA 3GKUA 1IBMH 4NXNH 4DR5H 4AM3A 3OETA 2CPQA 5IT9W 4QMFB 1AN7A 3J81W 2ZM6H 3V69A 1XNRH 2JVZA 4DV1H 2UUAH 2UXCH 4NZTM 1X0AA 2UUBH 3RF2A 2X06A 4DV7H 4G08A 1N36H 3T1HH 2ANRA 4DUZH 4YHHH 4DR7H 1N32H 5K36G 4IFDG 1PQXA 3KDGA 4FJSA 2Z0SA 1VIHA 2E5LH 2FPHX 2CTMA 5LMNH 1WHRA 3T1YH 2ZQEA 1N34H 4B3SH 2JEBI 1WTJA 2HHHH 4OO1G 1X4MA 1XRHA 2JA9A 2MJHA 1SEIA 1XMOH 4JI7H 4YY3H 1WVNA 2G8YA 4DUYH 1HNZH 4JI8H 4B8TA 4B8CD 4PDBA 4DV3H 2LF0A 4LF4H 4OX9H 2CPMA 1TUAA 4LF7H 1FJGH 4GKKH 2LTMA 4JI3H 1NXUA 2M8WA 2FMRA 2NN6G 3SB1A 4DV2H 4AIMA 1HNXH 2JZXA 2PY9A 3NCVA 2VQEH 1S20A 1J5EH 4DV4H 2ANNA 1XNQH 3GR5A 4JYAH 2VQFH 1J5KA 2UXDH 2UUCH 2UXBH 1V8CA 3OTOH 1IBLH 1X9ZA 3JAMW 4NZRM 2PT7G 1HR0H 1DTJA 5FLXW 1ODHA 2UU9H 1KHMA 2HH3A 2QNDA 2CTJA 2LRRA 2YQRA 4NBQA 3UOEA 2HH2A 5LMUH 4LF5H 3AEVB 2VKCA 4LFAH 4GKJH 1J4WA 3VKEA 2JEAI 4B3TH 2E3UA 4DR6H 5A2QW 4KHPH 3J80W 1HNWH 2CTKA 2OPVA 1K1GA 4LFBH 4JI2H 1FKAH 4X62H 4DR3H 4B3MH 5BR8H 3FAUA 1V9NA 2D9IA 4X66H 1ZZJA 4E9JA 4NXMH 4DV6H 4JI4H 4B3RH 1XMQH 2AXYA 4DR1H 4JI5H 4JI6H 3GABA 3L7ZC 4DV5H 1IBKH 2O4CA 2Y3MA 5JEAG 3QD7X 5DT9A 5IWAH 1Z2IA 2CWFA 2DGRA 1ZZIA 2JE6I 1ZTGA 3J7AK 4DR4H 4JV5H 2CTLA 2M6QA 1VIGA 4JVHA 1N33H 4LF8H 4FJUA 2BA0A 4AQYH 4LF6H 4DV0H 1WE8A 4X64H 4OD6A 4DR2H 4BA1I 2F4VH 1F0XA 4JVYA 3OSSD 3KDKA 1VBIA 1UG8A 3I0PA 1I94H 2LTLA 4LF9H 4LFCH 4LIJA 2CTEA 2PQUA 4WANA 4X65H 2A1SA 1MSZA
chains in the Genus database with same CATH topology
2ANRA 3U1KA 2P2RA 2CTFA 3L7ZC 1ZZKA 1J5KA 5K36G 4IFDG 4WALA 5JEAG 2Z0SA 1DT4A 1VIHA 1KHMA 5C0XG 1DTJA 2BL5A 1X4NA 2HH3A 2CTMA 2QNDA 2CTJA 2DGRA 1ZZIA 2JEBI 2YQRA 4BA2I 4NBQA 1X4MA 2JE6I 1ZTGA 2HH2A 2JA9A 2CTLA 2OPUA 1VIGA 2MJHA 3AEVB 4JVHA 1WVNA 1EC6A 2BA0A 1J4WA 3VKEA 2JEAI 2E3UA 4B8TA 1WE8A 4AM3A 2CPQA 4BA1I 2CTKA 4QMFB 1TUAA 2OPVA 1K1GA 4JVYA 3V69A 4OO1G 2FMRA 2JVZA 2NN6G 1ZZJA 4AIMA 4LIJA 2CTEA 2JZXA 2PY9A 2PQUA 4WANA 2ANNA 2AXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ANR A;  3U1K A;  2P2R A;  2CTF A;  3L7Z C;  1ZZK A;  1J5K A;  5K36 G;  4IFD G;  4WAL A;  5JEA G;  2Z0S A;  1DT4 A;  1VIH A;  1KHM A;  5C0X G;  1DTJ A;  2BL5 A;  1X4N A;  2HH3 A;  2CTM A;  2QND A;  2CTJ A;  2DGR A;  1ZZI A;  2JEB I;  2YQR A;  4BA2 I;  4NBQ A;  1X4M A;  2JE6 I;  1ZTG A;  2HH2 A;  2JA9 A;  2CTL A;  2OPU A;  1VIG A;  2MJH A;  3AEV B;  4JVH A;  1WVN A;  1EC6 A;  2BA0 A;  1J4W A;  3VKE A;  2JEA I;  2E3U A;  4B8T A;  1WE8 A;  4AM3 A;  2CPQ A;  4BA1 I;  2CTK A;  4QMF B;  1TUA A;  2OPV A;  1K1G A;  4JVY A;  3V69 A;  4OO1 G;  2FMR A;  2JVZ A;  2NN6 G;  1ZZJ A;  4AIM A;  4LIJ A;  2CTE A;  2JZX A;  2PY9 A;  2PQU A;  4WAN A;  2ANN A;  2AXY A; 
#chains in the Genus database with same CATH topology
 3U1K A;  2P2R A;  4K0K H;  2CTF A;  1ZZK A;  4WAL A;  2K1H A;  4JI0 H;  2FFM A;  3EZJ A;  1DT4 A;  5C0X G;  2BL5 A;  1X4N A;  4JI1 H;  4H8A A;  4EC5 A;  4BA2 I;  1S03 G;  2OPU A;  1EC6 A;  4OCH A;  1I6U A;  5LL6 b;  2CWH A;  3GKU A;  1IBM H;  4NXN H;  4DR5 H;  4AM3 A;  3OET A;  2CPQ A;  5IT9 W;  4QMF B;  1AN7 A;  3J81 W;  2ZM6 H;  3V69 A;  1XNR H;  2JVZ A;  4DV1 H;  2UUA H;  2UXC H;  4NZT M;  1X0A A;  2UUB H;  3RF2 A;  2X06 A;  4DV7 H;  4G08 A;  1N36 H;  3T1H H;  2ANR A;  4DUZ H;  4YHH H;  4DR7 H;  1N32 H;  5K36 G;  4IFD G;  1PQX A;  3KDG A;  4FJS A;  2Z0S A;  1VIH A;  2E5L H;  2FPH X;  2CTM A;  5LMN H;  1WHR A;  3T1Y H;  2ZQE A;  1N34 H;  4B3S H;  2JEB I;  1WTJ A;  2HHH H;  4OO1 G;  1X4M A;  1XRH A;  2JA9 A;  2MJH A;  1SEI A;  1XMO H;  4JI7 H;  4YY3 H;  1WVN A;  2G8Y A;  4DUY H;  1HNZ H;  4JI8 H;  4B8T A;  4B8C D;  4PDB A;  4DV3 H;  2LF0 A;  4LF4 H;  4OX9 H;  2CPM A;  1TUA A;  4LF7 H;  1FJG H;  4GKK H;  2LTM A;  4JI3 H;  1NXU A;  2M8W A;  2FMR A;  2NN6 G;  3SB1 A;  4DV2 H;  4AIM A;  1HNX H;  2JZX A;  2PY9 A;  3NCV A;  2VQE H;  1S20 A;  1J5E H;  4DV4 H;  2ANN A;  1XNQ H;  3GR5 A;  4JYA H;  2VQF H;  1J5K A;  2UXD H;  2UUC H;  2UXB H;  1V8C A;  3OTO H;  1IBL H;  1X9Z A;  3JAM W;  4NZR M;  2PT7 G;  1HR0 H;  1DTJ A;  5FLX W;  1ODH A;  2UU9 H;  1KHM A;  2HH3 A;  2QND A;  2CTJ A;  2LRR A;  2YQR A;  4NBQ A;  3UOE A;  2HH2 A;  5LMU H;  4LF5 H;  3AEV B;  2VKC A;  4LFA H;  4GKJ H;  1J4W A;  3VKE A;  2JEA I;  4B3T H;  2E3U A;  4DR6 H;  5A2Q W;  4KHP H;  3J80 W;  1HNW H;  2CTK A;  2OPV A;  1K1G A;  4LFB H;  4JI2 H;  1FKA H;  4X62 H;  4DR3 H;  4B3M H;  5BR8 H;  3FAU A;  1V9N A;  2D9I A;  4X66 H;  1ZZJ A;  4E9J A;  4NXM H;  4DV6 H;  4JI4 H;  4B3R H;  1XMQ H;  2AXY A;  4DR1 H;  4JI5 H;  4JI6 H;  3GAB A;  3L7Z C;  4DV5 H;  1IBK H;  2O4C A;  2Y3M A;  5JEA G;  3QD7 X;  5DT9 A;  5IWA H;  1Z2I A;  2CWF A;  2DGR A;  1ZZI A;  2JE6 I;  1ZTG A;  3J7A K;  4DR4 H;  4JV5 H;  2CTL A;  2M6Q A;  1VIG A;  4JVH A;  1N33 H;  4LF8 H;  4FJU A;  2BA0 A;  4AQY H;  4LF6 H;  4DV0 H;  1WE8 A;  4X64 H;  4OD6 A;  4DR2 H;  4BA1 I;  2F4V H;  1F0X A;  4JVY A;  3OSS D;  3KDK A;  1VBI A;  1UG8 A;  3I0P A;  1I94 H;  2LTL A;  4LF9 H;  4LFC H;  4LIJ A;  2CTE A;  2PQU A;  4WAN A;  4X65 H;  2A1S A;  1MSZ A; 
#chains in the Genus database with same CATH homology
 2ANR A;  3U1K A;  2P2R A;  2CTF A;  3L7Z C;  1ZZK A;  1J5K A;  5K36 G;  4IFD G;  4WAL A;  5JEA G;  2Z0S A;  1DT4 A;  1VIH A;  1KHM A;  5C0X G;  1DTJ A;  2BL5 A;  1X4N A;  2HH3 A;  2CTM A;  2QND A;  2CTJ A;  2DGR A;  1ZZI A;  2JEB I;  2YQR A;  4BA2 I;  4NBQ A;  1X4M A;  2JE6 I;  1ZTG A;  2HH2 A;  2JA9 A;  2CTL A;  2OPU A;  1VIG A;  2MJH A;  3AEV B;  4JVH A;  1WVN A;  1EC6 A;  2BA0 A;  1J4W A;  3VKE A;  2JEA I;  2E3U A;  4B8T A;  1WE8 A;  4AM3 A;  2CPQ A;  4BA1 I;  2CTK A;  4QMF B;  1TUA A;  2OPV A;  1K1G A;  4JVY A;  3V69 A;  4OO1 G;  2FMR A;  2JVZ A;  2NN6 G;  1ZZJ A;  4AIM A;  4LIJ A;  2CTE A;  2JZX A;  2PY9 A;  2PQU A;  4WAN A;  2ANN A;  2AXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...