4WALA

Crystal structure of selenomethionine msl5 protein in complex with rna at 2.2 a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
b'PTKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSVKEGKNASDLPPGAMNFEDPLHCLIMADSEDKMQKGIKVCQNIMIKAVTSPEGQNDLKRGQLRELAELNGTLREDNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Branchpoint-bridging protein
molecule tags Protein binding/rna
source organism Saccharomyces cerevisiae
publication title Structural basis for recognition of intron branchpoint RNA by yeast Msl5 and selective effects of interfacial mutations on splicing of yeast pre-mRNAs.
pubmed doi rcsb
total genus 31
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4walA00
3L7ZC 2P2RA 3VKEA 4JVYA 2DGRA 4WANA 1ZZIA 4QMFB 1X4MA 2JZXA 2BL5A 4AIMA 4LIJA 5C0XG 2CTKA 1ZZKA 1J5KA 3AEVB 4NBQA 2NN6G 2CTJA 1TUAA 2MJHA 2JE6I 2CPQA 2YQRA 2ANNA 4OO1G 1WVNA 5JEAG 4WALA 1DTJA 2JVZA 4B8TA 2AXYA 4IFDG 1X4NA 2FMRA 1EC6A 2PQUA 2HH2A 2HH3A 4JVHA 2CTLA 2OPVA 1J4WA 1ZTGA 2JA9A 2CTEA 5K36G 1DT4A 1K1GA 1ZZJA 3V69A 2JEAI 2PY9A 1VIHA 2QNDA 2Z0SA 2OPUA 2BA0A 4AM3A 2JEBI 2E3UA 1KHMA 2CTFA 2CTMA 3U1KA 4BA2I 1WE8A 4BA1I 2ANRA 1VIGA
chains in the Genus database with same CATH superfamily
2HHHH 1Z2IA 2DGRA 4JI8H 1UG8A 1X4MA 5DT9A 2UUBH 2BL5A 4AIMA 4DV7H 2CTKA 1VBIA 4GKKH 2FPHX 1J5KA 1XNQH 3KDGA 2E5LH 3GABA 2JE6I 5LMUH 4LF8H 1XRHA 4YHHH 4B3SH 4NXMH 2UXDH 4OO1G 2D9IA 4LF4H 5JEAG 3OTOH 4LF6H 3EZJA 4YY3H 1V8CA 2FMRA 1AN7A 4B3RH 1WHRA 4X62H 4GKJH 4DV1H 4DR1H 4X66H 4LF5H 4DR3H 4JYAH 2PY9A 2UUCH 2CWHA 2X06A 1X0AA 2M8WA 3GR5A 1KHMA 1HNXH 2CTFA 2ZQEA 4BA2I 4BA1I 4DR5H 1VIGA 3L7ZC 2VKCA 3OETA 1IBKH 1N36H 2G8YA 2UUAH 2CPMA 5C0XG 1ZZKA 1X9ZA 2O4CA 2VQFH 2FFMA 4OCHA 2MJHA 4FJUA 1MSZA 1S03G 4DV4H 2CPQA 2YQRA 5LL6b 1HNZH 1WTJA 2ANNA 4LFBH 5A2QW 4LFCH 2PT7G 4B8TA 2AXYA 1SEIA 4LFAH 4X64H 2UXCH 2PQUA 2HH2A 1F0XA 4JI3H 4JVHA 2OPVA 2UU9H 4DR2H 3UOEA 1K1GA 4EC5A 3V69A 4JI6H 2JEAI 1VIHA 3QD7X 2M6QA 3RF2A 2E3UA 2LRRA 4NZRM 4DUZH 4DV6H 4JI0H 4E9JA 3T1HH 4JI2H 2CWFA 2P2RA 1N34H 4H8AA 4DR7H 4K0KH 4B3TH 4X65H 4JVYA 4FJSA 4DR6H 4WANA 2LTMA 4NXNH 1IBLH 3AEVB 2NN6G 2CTJA 4JI5H 4KHPH 1ODHA 4LF7H 1XMOH 2A1SA 1WVNA 3OSSD 4JI1H 1HR0H 3FAUA 4WALA 4LF9H 1DTJA 2JVZA 5BR8H 3T1YH 3KDKA 1XMQH 4IFDG 1I6UA 4G08A 4AQYH 1J4WA 1PQXA 3NCVA 2CTEA 3J80W 1FJGH 1ZZJA 1I94H 2QNDA 4JV5H 2OPUA 2BA0A 5FLXW 5IT9W 2JEBI 1HNWH 4OD6A 1WE8A 4B8CD 3VKEA 2ANRA 4NBQA 2ZM6H 1IBMH 4QMFB 2JZXA 4DUYH 4LIJA 3I0PA 2K1HA 3GKUA 4DV3H 4OX9H 1TUAA 2UXBH 3SB1A 1V9NA 4PDBA 5LMNH 2VQEH 1XNRH 2F4VH 1X4NA 1EC6A 1J5EH 4DV5H 1NXUA 2HH3A 1FKAH 2CTLA 1ZTGA 5IWAH 4DV2H 1S20A 2JA9A 3JAMW 4DV0H 4DR4H 1N33H 5K36G 4JI4H 1DT4A 4NZTM 3J81W 2LTLA 2Z0SA 2LF0A 3J7AK 4AM3A 4JI7H 2CTMA 3U1KA 4B3MH 1N32H 1ZZIA 2Y3MA
chains in the Genus database with same CATH topology
3L7ZC 2P2RA 3VKEA 4JVYA 2DGRA 4WANA 1ZZIA 4QMFB 1X4MA 2JZXA 2BL5A 4AIMA 4LIJA 5C0XG 2CTKA 1ZZKA 1J5KA 3AEVB 4NBQA 2NN6G 2CTJA 1TUAA 2MJHA 2JE6I 2CPQA 2YQRA 2ANNA 4OO1G 1WVNA 5JEAG 4WALA 1DTJA 2JVZA 4B8TA 2AXYA 4IFDG 1X4NA 2FMRA 1EC6A 2PQUA 2HH2A 2HH3A 4JVHA 2CTLA 2OPVA 1J4WA 1ZTGA 2JA9A 2CTEA 5K36G 1DT4A 1K1GA 1ZZJA 3V69A 2JEAI 2PY9A 1VIHA 2QNDA 2Z0SA 2OPUA 2BA0A 4AM3A 2JEBI 2E3UA 1KHMA 2CTFA 2CTMA 3U1KA 4BA2I 1WE8A 4BA1I 2ANRA 1VIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7Z C;  2P2R A;  3VKE A;  4JVY A;  2DGR A;  4WAN A;  1ZZI A;  4QMF B;  1X4M A;  2JZX A;  2BL5 A;  4AIM A;  4LIJ A;  5C0X G;  2CTK A;  1ZZK A;  1J5K A;  3AEV B;  4NBQ A;  2NN6 G;  2CTJ A;  1TUA A;  2MJH A;  2JE6 I;  2CPQ A;  2YQR A;  2ANN A;  4OO1 G;  1WVN A;  5JEA G;  4WAL A;  1DTJ A;  2JVZ A;  4B8T A;  2AXY A;  4IFD G;  1X4N A;  2FMR A;  1EC6 A;  2PQU A;  2HH2 A;  2HH3 A;  4JVH A;  2CTL A;  2OPV A;  1J4W A;  1ZTG A;  2JA9 A;  2CTE A;  5K36 G;  1DT4 A;  1K1G A;  1ZZJ A;  3V69 A;  2JEA I;  2PY9 A;  1VIH A;  2QND A;  2Z0S A;  2OPU A;  2BA0 A;  4AM3 A;  2JEB I;  2E3U A;  1KHM A;  2CTF A;  2CTM A;  3U1K A;  4BA2 I;  1WE8 A;  4BA1 I;  2ANR A;  1VIG A; 
#chains in the Genus database with same CATH topology
 2HHH H;  1Z2I A;  2DGR A;  4JI8 H;  1UG8 A;  1X4M A;  5DT9 A;  2UUB H;  2BL5 A;  4AIM A;  4DV7 H;  2CTK A;  1VBI A;  4GKK H;  2FPH X;  1J5K A;  1XNQ H;  3KDG A;  2E5L H;  3GAB A;  2JE6 I;  5LMU H;  4LF8 H;  1XRH A;  4YHH H;  4B3S H;  4NXM H;  2UXD H;  4OO1 G;  2D9I A;  4LF4 H;  5JEA G;  3OTO H;  4LF6 H;  3EZJ A;  4YY3 H;  1V8C A;  2FMR A;  1AN7 A;  4B3R H;  1WHR A;  4X62 H;  4GKJ H;  4DV1 H;  4DR1 H;  4X66 H;  4LF5 H;  4DR3 H;  4JYA H;  2PY9 A;  2UUC H;  2CWH A;  2X06 A;  1X0A A;  2M8W A;  3GR5 A;  1KHM A;  1HNX H;  2CTF A;  2ZQE A;  4BA2 I;  4BA1 I;  4DR5 H;  1VIG A;  3L7Z C;  2VKC A;  3OET A;  1IBK H;  1N36 H;  2G8Y A;  2UUA H;  2CPM A;  5C0X G;  1ZZK A;  1X9Z A;  2O4C A;  2VQF H;  2FFM A;  4OCH A;  2MJH A;  4FJU A;  1MSZ A;  1S03 G;  4DV4 H;  2CPQ A;  2YQR A;  5LL6 b;  1HNZ H;  1WTJ A;  2ANN A;  4LFB H;  5A2Q W;  4LFC H;  2PT7 G;  4B8T A;  2AXY A;  1SEI A;  4LFA H;  4X64 H;  2UXC H;  2PQU A;  2HH2 A;  1F0X A;  4JI3 H;  4JVH A;  2OPV A;  2UU9 H;  4DR2 H;  3UOE A;  1K1G A;  4EC5 A;  3V69 A;  4JI6 H;  2JEA I;  1VIH A;  3QD7 X;  2M6Q A;  3RF2 A;  2E3U A;  2LRR A;  4NZR M;  4DUZ H;  4DV6 H;  4JI0 H;  4E9J A;  3T1H H;  4JI2 H;  2CWF A;  2P2R A;  1N34 H;  4H8A A;  4DR7 H;  4K0K H;  4B3T H;  4X65 H;  4JVY A;  4FJS A;  4DR6 H;  4WAN A;  2LTM A;  4NXN H;  1IBL H;  3AEV B;  2NN6 G;  2CTJ A;  4JI5 H;  4KHP H;  1ODH A;  4LF7 H;  1XMO H;  2A1S A;  1WVN A;  3OSS D;  4JI1 H;  1HR0 H;  3FAU A;  4WAL A;  4LF9 H;  1DTJ A;  2JVZ A;  5BR8 H;  3T1Y H;  3KDK A;  1XMQ H;  4IFD G;  1I6U A;  4G08 A;  4AQY H;  1J4W A;  1PQX A;  3NCV A;  2CTE A;  3J80 W;  1FJG H;  1ZZJ A;  1I94 H;  2QND A;  4JV5 H;  2OPU A;  2BA0 A;  5FLX W;  5IT9 W;  2JEB I;  1HNW H;  4OD6 A;  1WE8 A;  4B8C D;  3VKE A;  2ANR A;  4NBQ A;  2ZM6 H;  1IBM H;  4QMF B;  2JZX A;  4DUY H;  4LIJ A;  3I0P A;  2K1H A;  3GKU A;  4DV3 H;  4OX9 H;  1TUA A;  2UXB H;  3SB1 A;  1V9N A;  4PDB A;  5LMN H;  2VQE H;  1XNR H;  2F4V H;  1X4N A;  1EC6 A;  1J5E H;  4DV5 H;  1NXU A;  2HH3 A;  1FKA H;  2CTL A;  1ZTG A;  5IWA H;  4DV2 H;  1S20 A;  2JA9 A;  3JAM W;  4DV0 H;  4DR4 H;  1N33 H;  5K36 G;  4JI4 H;  1DT4 A;  4NZT M;  3J81 W;  2LTL A;  2Z0S A;  2LF0 A;  3J7A K;  4AM3 A;  4JI7 H;  2CTM A;  3U1K A;  4B3M H;  1N32 H;  1ZZI A;  2Y3M A; 
#chains in the Genus database with same CATH homology
 3L7Z C;  2P2R A;  3VKE A;  4JVY A;  2DGR A;  4WAN A;  1ZZI A;  4QMF B;  1X4M A;  2JZX A;  2BL5 A;  4AIM A;  4LIJ A;  5C0X G;  2CTK A;  1ZZK A;  1J5K A;  3AEV B;  4NBQ A;  2NN6 G;  2CTJ A;  1TUA A;  2MJH A;  2JE6 I;  2CPQ A;  2YQR A;  2ANN A;  4OO1 G;  1WVN A;  5JEA G;  4WAL A;  1DTJ A;  2JVZ A;  4B8T A;  2AXY A;  4IFD G;  1X4N A;  2FMR A;  1EC6 A;  2PQU A;  2HH2 A;  2HH3 A;  4JVH A;  2CTL A;  2OPV A;  1J4W A;  1ZTG A;  2JA9 A;  2CTE A;  5K36 G;  1DT4 A;  1K1G A;  1ZZJ A;  3V69 A;  2JEA I;  2PY9 A;  1VIH A;  2QND A;  2Z0S A;  2OPU A;  2BA0 A;  4AM3 A;  2JEB I;  2E3U A;  1KHM A;  2CTF A;  2CTM A;  3U1K A;  4BA2 I;  1WE8 A;  4BA1 I;  2ANR A;  1VIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...