4WALA

Crystal structure of selenomethionine msl5 protein in complex with rna at 2.2 a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
PTKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSVKEGKNASDLPPGAMNFEDPLHCLIMADSEDKMQKGIKVCQNIMIKAVTSPEGQNDLKRGQLRELAELNGTLREDNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/rna
molecule keywords Branchpoint-bridging protein
publication title Structural basis for recognition of intron branchpoint RNA by yeast Msl5 and selective effects of interfacial mutations on splicing of yeast pre-mRNAs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 31
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4walA00
2P2RA 1X4NA 3V69A 2JZXA 2ANRA 2OPUA 4BA1I 2MJHA 2CTMA 1VIHA 1ZZKA 2OPVA 5JEAG 2JE6I 4LIJA 1ZTGA 4WANA 2JEAI 2CTEA 2QNDA 2HH3A 4WALA 5C0XG 1TUAA 1KHMA 4QMFB 3U1KA 1WVNA 4B8TA 4IFDG 4OO1G 2PQUA 1VIGA 1DTJA 2CTLA 2E3UA 4NBQA 5K36G 2Z0SA 2FMRA 3VKEA 2DGRA 1ZZIA 2YQRA 2BA0A 2PY9A 4JVHA 1WE8A 4JVYA 2CTKA 3L7ZC 2CTFA 1J5KA 2JEBI 2JVZA 2ANNA 1J4WA 3AEVB 2CPQA 4BA2I 1DT4A 2HH2A 1EC6A 2CTJA 2NN6G 1X4MA 1ZZJA 1K1GA 4AIMA 2BL5A 4AM3A 2AXYA 2JA9A
chains in the Genus database with same CATH superfamily
4X62H 3NCVA 2Y3MA 2CPMA 1X4NA 2ANRA 5LMNH 1IBKH 4GKJH 4JYAH 2MJHA 1VIHA 4OD6A 1ZTGA 2M8WA 4JI3H 5C0XG 5BR8H 1KHMA 4JV5H 1WVNA 4DR2H 2PQUA 1DTJA 2VKCA 5A2QW 4K0KH 3T1HH 2Z0SA 1XNQH 2D9IA 4OX9H 4DR4H 2K1HA 1V8CA 2YQRA 2BA0A 1ZZIA 4JI5H 4KHPH 1WE8A 4DV5H 1J5KA 2UXDH 2JEBI 1J4WA 1Z2IA 2LF0A 1HNXH 1PQXA 4X64H 3JAMW 2CTJA 1FJGH 4DV0H 2UUAH 4AM3A 3J7AK 4DV7H 3V69A 2JZXA 2F4VH 2OPUA 4BA1I 4NXNH 4DR1H 2O4CA 2CWFA 2OPVA 4EC5A 5JEAG 5LMUH 1UG8A 2CTEA 3GKUA 1FKAH 3UOEA 2A1SA 2VQEH 4QMFB 3U1KA 4X66H 3KDKA 4AQYH 4IFDG 4OO1G 1VIGA 5DT9A 4PDBA 2E3UA 3KDGA 2FMRA 1XMOH 1N34H 4JVHA 2LTLA 1HNZH 4GKKH 2G8YA 2CTKA 3L7ZC 4FJUA 2UUBH 1N32H 2ANNA 1IBLH 2M6QA 1V9NA 3AEVB 2UXCH 3I0PA 5LL6b 2PT7G 1S20A 4BA2I 4LFBH 1AN7A 1DT4A 4B3TH 1ZZJA 3EZJA 2LTMA 1IBMH 1N33H 3OETA 3GABA 4JI7H 2P2RA 1HR0H 4LF5H 4DV6H 4DUZH 4NZTM 4DR6H 4X65H 4B3RH 1ZZKA 5FLXW 1F0XA 2JEAI 3GR5A 2CWHA 2QNDA 4WALA 4DR5H 1TUAA 1N36H 3SB1A 4FJSA 4JI1H 2FPHX 3OSSD 4DV4H 1XRHA 4NBQA 1XMQH 5K36G 3VKEA 2DGRA 3QD7X 4LF6H 2PY9A 4DR7H 1J5EH 4JI4H 4JVYA 1I6UA 1WTJA 4LFCH 2JVZA 4DUYH 4DV1H 3RF2A 4LFAH 2CPQA 3T1YH 4LF8H 1XNRH 1HNWH 2X06A 3FAUA 1K1GA 5IT9W 2BL5A 4H8AA 5IWAH 1I94H 1ODHA 3J80W 2JA9A 4E9JA 2ZQEA 2UXBH 4DV2H 2CTMA 4B3SH 2JE6I 4LIJA 4DR3H 4WANA 4JI8H 4LF4H 2HH3A 4NXMH 1SEIA 4LF7H 3J81W 2FFMA 4B8TA 2ZM6H 4LF9H 2HHHH 2CTLA 1WHRA 4JI6H 4NZRM 4B3MH 2VQFH 4JI0H 2UUCH 3OTOH 1X0AA 2UU9H 2CTFA 1X9ZA 1NXUA 2E5LH 1MSZA 1S03G 2LRRA 2HH2A 4B8CD 2NN6G 4YHHH 4DV3H 1VBIA 1X4MA 4OCHA 1EC6A 4G08A 4JI2H 4YY3H 2AXYA 4AIMA
chains in the Genus database with same CATH topology
2P2RA 1X4NA 3V69A 2JZXA 2ANRA 2OPUA 4BA1I 2MJHA 2CTMA 1VIHA 1ZZKA 2OPVA 5JEAG 2JE6I 4LIJA 1ZTGA 4WANA 2JEAI 2CTEA 2QNDA 2HH3A 4WALA 5C0XG 1TUAA 1KHMA 4QMFB 3U1KA 1WVNA 4B8TA 4IFDG 4OO1G 2PQUA 1VIGA 1DTJA 2CTLA 2E3UA 4NBQA 5K36G 2Z0SA 2FMRA 3VKEA 2DGRA 1ZZIA 2YQRA 2BA0A 2PY9A 4JVHA 1WE8A 4JVYA 2CTKA 3L7ZC 2CTFA 1J5KA 2JEBI 2JVZA 2ANNA 1J4WA 3AEVB 2CPQA 4BA2I 1DT4A 2HH2A 1EC6A 2CTJA 2NN6G 1X4MA 1ZZJA 1K1GA 4AIMA 2BL5A 4AM3A 2AXYA 2JA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P2R A;  1X4N A;  3V69 A;  2JZX A;  2ANR A;  2OPU A;  4BA1 I;  2MJH A;  2CTM A;  1VIH A;  1ZZK A;  2OPV A;  5JEA G;  2JE6 I;  4LIJ A;  1ZTG A;  4WAN A;  2JEA I;  2CTE A;  2QND A;  2HH3 A;  4WAL A;  5C0X G;  1TUA A;  1KHM A;  4QMF B;  3U1K A;  1WVN A;  4B8T A;  4IFD G;  4OO1 G;  2PQU A;  1VIG A;  1DTJ A;  2CTL A;  2E3U A;  4NBQ A;  5K36 G;  2Z0S A;  2FMR A;  3VKE A;  2DGR A;  1ZZI A;  2YQR A;  2BA0 A;  2PY9 A;  4JVH A;  1WE8 A;  4JVY A;  2CTK A;  3L7Z C;  2CTF A;  1J5K A;  2JEB I;  2JVZ A;  2ANN A;  1J4W A;  3AEV B;  2CPQ A;  4BA2 I;  1DT4 A;  2HH2 A;  1EC6 A;  2CTJ A;  2NN6 G;  1X4M A;  1ZZJ A;  1K1G A;  4AIM A;  2BL5 A;  4AM3 A;  2AXY A;  2JA9 A; 
#chains in the Genus database with same CATH topology
 4X62 H;  3NCV A;  2Y3M A;  2CPM A;  1X4N A;  2ANR A;  5LMN H;  1IBK H;  4GKJ H;  4JYA H;  2MJH A;  1VIH A;  4OD6 A;  1ZTG A;  2M8W A;  4JI3 H;  5C0X G;  5BR8 H;  1KHM A;  4JV5 H;  1WVN A;  4DR2 H;  2PQU A;  1DTJ A;  2VKC A;  5A2Q W;  4K0K H;  3T1H H;  2Z0S A;  1XNQ H;  2D9I A;  4OX9 H;  4DR4 H;  2K1H A;  1V8C A;  2YQR A;  2BA0 A;  1ZZI A;  4JI5 H;  4KHP H;  1WE8 A;  4DV5 H;  1J5K A;  2UXD H;  2JEB I;  1J4W A;  1Z2I A;  2LF0 A;  1HNX H;  1PQX A;  4X64 H;  3JAM W;  2CTJ A;  1FJG H;  4DV0 H;  2UUA H;  4AM3 A;  3J7A K;  4DV7 H;  3V69 A;  2JZX A;  2F4V H;  2OPU A;  4BA1 I;  4NXN H;  4DR1 H;  2O4C A;  2CWF A;  2OPV A;  4EC5 A;  5JEA G;  5LMU H;  1UG8 A;  2CTE A;  3GKU A;  1FKA H;  3UOE A;  2A1S A;  2VQE H;  4QMF B;  3U1K A;  4X66 H;  3KDK A;  4AQY H;  4IFD G;  4OO1 G;  1VIG A;  5DT9 A;  4PDB A;  2E3U A;  3KDG A;  2FMR A;  1XMO H;  1N34 H;  4JVH A;  2LTL A;  1HNZ H;  4GKK H;  2G8Y A;  2CTK A;  3L7Z C;  4FJU A;  2UUB H;  1N32 H;  2ANN A;  1IBL H;  2M6Q A;  1V9N A;  3AEV B;  2UXC H;  3I0P A;  5LL6 b;  2PT7 G;  1S20 A;  4BA2 I;  4LFB H;  1AN7 A;  1DT4 A;  4B3T H;  1ZZJ A;  3EZJ A;  2LTM A;  1IBM H;  1N33 H;  3OET A;  3GAB A;  4JI7 H;  2P2R A;  1HR0 H;  4LF5 H;  4DV6 H;  4DUZ H;  4NZT M;  4DR6 H;  4X65 H;  4B3R H;  1ZZK A;  5FLX W;  1F0X A;  2JEA I;  3GR5 A;  2CWH A;  2QND A;  4WAL A;  4DR5 H;  1TUA A;  1N36 H;  3SB1 A;  4FJS A;  4JI1 H;  2FPH X;  3OSS D;  4DV4 H;  1XRH A;  4NBQ A;  1XMQ H;  5K36 G;  3VKE A;  2DGR A;  3QD7 X;  4LF6 H;  2PY9 A;  4DR7 H;  1J5E H;  4JI4 H;  4JVY A;  1I6U A;  1WTJ A;  4LFC H;  2JVZ A;  4DUY H;  4DV1 H;  3RF2 A;  4LFA H;  2CPQ A;  3T1Y H;  4LF8 H;  1XNR H;  1HNW H;  2X06 A;  3FAU A;  1K1G A;  5IT9 W;  2BL5 A;  4H8A A;  5IWA H;  1I94 H;  1ODH A;  3J80 W;  2JA9 A;  4E9J A;  2ZQE A;  2UXB H;  4DV2 H;  2CTM A;  4B3S H;  2JE6 I;  4LIJ A;  4DR3 H;  4WAN A;  4JI8 H;  4LF4 H;  2HH3 A;  4NXM H;  1SEI A;  4LF7 H;  3J81 W;  2FFM A;  4B8T A;  2ZM6 H;  4LF9 H;  2HHH H;  2CTL A;  1WHR A;  4JI6 H;  4NZR M;  4B3M H;  2VQF H;  4JI0 H;  2UUC H;  3OTO H;  1X0A A;  2UU9 H;  2CTF A;  1X9Z A;  1NXU A;  2E5L H;  1MSZ A;  1S03 G;  2LRR A;  2HH2 A;  4B8C D;  2NN6 G;  4YHH H;  4DV3 H;  1VBI A;  1X4M A;  4OCH A;  1EC6 A;  4G08 A;  4JI2 H;  4YY3 H;  2AXY A;  4AIM A; 
#chains in the Genus database with same CATH homology
 2P2R A;  1X4N A;  3V69 A;  2JZX A;  2ANR A;  2OPU A;  4BA1 I;  2MJH A;  2CTM A;  1VIH A;  1ZZK A;  2OPV A;  5JEA G;  2JE6 I;  4LIJ A;  1ZTG A;  4WAN A;  2JEA I;  2CTE A;  2QND A;  2HH3 A;  4WAL A;  5C0X G;  1TUA A;  1KHM A;  4QMF B;  3U1K A;  1WVN A;  4B8T A;  4IFD G;  4OO1 G;  2PQU A;  1VIG A;  1DTJ A;  2CTL A;  2E3U A;  4NBQ A;  5K36 G;  2Z0S A;  2FMR A;  3VKE A;  2DGR A;  1ZZI A;  2YQR A;  2BA0 A;  2PY9 A;  4JVH A;  1WE8 A;  4JVY A;  2CTK A;  3L7Z C;  2CTF A;  1J5K A;  2JEB I;  2JVZ A;  2ANN A;  1J4W A;  3AEV B;  2CPQ A;  4BA2 I;  1DT4 A;  2HH2 A;  1EC6 A;  2CTJ A;  2NN6 G;  1X4M A;  1ZZJ A;  1K1G A;  4AIM A;  2BL5 A;  4AM3 A;  2AXY A;  2JA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...