2CPQA

Solution structure of the n-terminal kh domain of human fxr1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
91
structure length
91
Chain Sequence
GSSGSSGTKQLAAAFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIYGESADAVKKARGFLEFVEDFIQVPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fragile X mental retardation syndrome related protein 1, iso
publication title Solution structure of the N-terminal KH domain of human FXR1
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 13
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2cpqA01
3V69A 2CTMA 2PY9A 1X4MA 2PQUA 1EC6A 2QNDA 1ZZJA 2JA9A 2E3UA 1DTJA 2OPVA 2FMRA 2ANNA 1X4NA 1ZZKA 2DGRA 1TUAA 5C0XG 2CPQA 2YQRA 1VIGA 1ZZIA 1ZTGA 4BA2I 4JVYA 4OO1G 1KHMA 2CTFA 1VIHA 3U1KA 2HH3A 2JEAI 1J4WA 1DT4A 2HH2A 2JEBI 2Z0SA 4WALA 1WE8A 2JZXA 4AIMA 1WVNA 4B8TA 2MJHA 2JE6I 4AM3A 4QMFB 2P2RA 2CTLA 2CTEA 3AEVB 2CTJA 5JEAG 3L7ZC 2JVZA 4JVHA 4WANA 2OPUA 1K1GA 5K36G 2BA0A 4IFDG 2ANRA 4NBQA 2BL5A 3VKEA 1J5KA 4BA1I 4LIJA 2CTKA 2AXYA 2NN6G
chains in the Genus database with same CATH superfamily
1SEIA 1MSZA 1X0AA 4FJUA 2FPHX 2QNDA 5BR8H 4LFBH 4X64H 3RF2A 2D9IA 2G8YA 3NCVA 5LMUH 2CPQA 2YQRA 4OO1G 4OCHA 2ZQEA 1VIHA 3U1KA 1N32H 3QD7X 5IT9W 5DT9A 4LF4H 2HH2A 4B3TH 1Z2IA 1S20A 2ZM6H 2F4VH 4YY3H 1XNRH 4QMFB 4B3SH 4NXMH 3AEVB 1IBLH 4WANA 2JVZA 1V9NA 3EZJA 5IWAH 2HHHH 2PT7G 4EC5A 1ODHA 4JI2H 4DR6H 4IFDG 4B8CD 4DV5H 4BA1I 4JI1H 4JI8H 1XNQH 2CTKA 4X65H 4DUYH 1IBMH 3V69A 4DV6H 2PY9A 1EC6A 2A1SA 4JI4H 1ZZJA 2E3UA 1F0XA 5A2QW 1WTJA 2OPVA 5C0XG 1ZZIA 4DV7H 1KHMA 4BA2I 1VBIA 3OTOH 4GKJH 4JI6H 2O4CA 1WHRA 1IBKH 4X62H 1WVNA 4B8TA 2JE6I 2VQFH 4AM3A 4K0KH 1I6UA 4JI7H 4KHPH 3L7ZC 3GKUA 3GABA 4DV1H 4JVHA 3I0PA 2LF0A 2ANRA 2X06A 3VKEA 4JV5H 4JI5H 4LIJA 2M8WA 2NN6G 2E5LH 2UXBH 3KDGA 3J80W 4LF5H 1XRHA 4NZRM 2FFMA 2CTMA 1X4MA 2PQUA 1N34H 3GR5A 2JA9A 1DTJA 1HR0H 2LTLA 2ANNA 4LFCH 4DR1H 5FLXW 2DGRA 2VQEH 4YHHH 4DV0H 4DR3H 3SB1A 2JEAI 4DR2H 1J4WA 3FAUA 1DT4A 2Z0SA 4FJSA 3T1HH 4AIMA 2UUCH 1XMOH 4LFAH 4NXNH 1HNWH 1V8CA 2MJHA 4GKKH 1X9ZA 2CPMA 4JI0H 4PDBA 2CTLA 4AQYH 4DUZH 4JYAH 4LF9H 5JEAG 4NZTM 4X66H 4E9JA 2OPUA 5K36G 2K1HA 3J7AK 3OETA 5LMNH 5LL6b 1N36H 1XMQH 4B3MH 1J5EH 2Y3MA 4LF7H 4H8AA 4B3RH 3JAMW 2UUAH 1PQXA 2CWFA 2FMRA 2CWHA 3UOEA 2UU9H 1X4NA 1ZZKA 1ZTGA 1TUAA 4JVYA 2VKCA 1VIGA 2LRRA 1S03G 4DV3H 2CTFA 2HH3A 2LTMA 1HNZH 4LF6H 2JEBI 4WALA 1WE8A 2JZXA 1HNXH 1NXUA 4JI3H 1FJGH 1I94H 4G08A 2P2RA 2CTEA 4DR5H 3KDKA 1FKAH 2CTJA 4OD6A 4DV4H 1N33H 1K1GA 3OSSD 1AN7A 2BA0A 1UG8A 4LF8H 4DR4H 4OX9H 2UXDH 4NBQA 4DR7H 2BL5A 3T1YH 2M6QA 1J5KA 3J81W 2UUBH 2AXYA 4DV2H 2UXCH
chains in the Genus database with same CATH topology
3V69A 2CTMA 2PY9A 1X4MA 2PQUA 1EC6A 2QNDA 1ZZJA 2JA9A 2E3UA 1DTJA 2OPVA 2FMRA 2ANNA 1X4NA 1ZZKA 2DGRA 1TUAA 5C0XG 2CPQA 2YQRA 1VIGA 1ZZIA 1ZTGA 4BA2I 4JVYA 4OO1G 1KHMA 2CTFA 1VIHA 3U1KA 2HH3A 2JEAI 1J4WA 1DT4A 2HH2A 2JEBI 2Z0SA 4WALA 1WE8A 2JZXA 4AIMA 1WVNA 4B8TA 2MJHA 2JE6I 4AM3A 4QMFB 2P2RA 2CTLA 2CTEA 3AEVB 2CTJA 5JEAG 3L7ZC 2JVZA 4JVHA 4WANA 2OPUA 1K1GA 5K36G 2BA0A 4IFDG 2ANRA 4NBQA 2BL5A 3VKEA 1J5KA 4BA1I 4LIJA 2CTKA 2AXYA 2NN6G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V69 A;  2CTM A;  2PY9 A;  1X4M A;  2PQU A;  1EC6 A;  2QND A;  1ZZJ A;  2JA9 A;  2E3U A;  1DTJ A;  2OPV A;  2FMR A;  2ANN A;  1X4N A;  1ZZK A;  2DGR A;  1TUA A;  5C0X G;  2CPQ A;  2YQR A;  1VIG A;  1ZZI A;  1ZTG A;  4BA2 I;  4JVY A;  4OO1 G;  1KHM A;  2CTF A;  1VIH A;  3U1K A;  2HH3 A;  2JEA I;  1J4W A;  1DT4 A;  2HH2 A;  2JEB I;  2Z0S A;  4WAL A;  1WE8 A;  2JZX A;  4AIM A;  1WVN A;  4B8T A;  2MJH A;  2JE6 I;  4AM3 A;  4QMF B;  2P2R A;  2CTL A;  2CTE A;  3AEV B;  2CTJ A;  5JEA G;  3L7Z C;  2JVZ A;  4JVH A;  4WAN A;  2OPU A;  1K1G A;  5K36 G;  2BA0 A;  4IFD G;  2ANR A;  4NBQ A;  2BL5 A;  3VKE A;  1J5K A;  4BA1 I;  4LIJ A;  2CTK A;  2AXY A;  2NN6 G; 
#chains in the Genus database with same CATH topology
 1SEI A;  1MSZ A;  1X0A A;  4FJU A;  2FPH X;  2QND A;  5BR8 H;  4LFB H;  4X64 H;  3RF2 A;  2D9I A;  2G8Y A;  3NCV A;  5LMU H;  2CPQ A;  2YQR A;  4OO1 G;  4OCH A;  2ZQE A;  1VIH A;  3U1K A;  1N32 H;  3QD7 X;  5IT9 W;  5DT9 A;  4LF4 H;  2HH2 A;  4B3T H;  1Z2I A;  1S20 A;  2ZM6 H;  2F4V H;  4YY3 H;  1XNR H;  4QMF B;  4B3S H;  4NXM H;  3AEV B;  1IBL H;  4WAN A;  2JVZ A;  1V9N A;  3EZJ A;  5IWA H;  2HHH H;  2PT7 G;  4EC5 A;  1ODH A;  4JI2 H;  4DR6 H;  4IFD G;  4B8C D;  4DV5 H;  4BA1 I;  4JI1 H;  4JI8 H;  1XNQ H;  2CTK A;  4X65 H;  4DUY H;  1IBM H;  3V69 A;  4DV6 H;  2PY9 A;  1EC6 A;  2A1S A;  4JI4 H;  1ZZJ A;  2E3U A;  1F0X A;  5A2Q W;  1WTJ A;  2OPV A;  5C0X G;  1ZZI A;  4DV7 H;  1KHM A;  4BA2 I;  1VBI A;  3OTO H;  4GKJ H;  4JI6 H;  2O4C A;  1WHR A;  1IBK H;  4X62 H;  1WVN A;  4B8T A;  2JE6 I;  2VQF H;  4AM3 A;  4K0K H;  1I6U A;  4JI7 H;  4KHP H;  3L7Z C;  3GKU A;  3GAB A;  4DV1 H;  4JVH A;  3I0P A;  2LF0 A;  2ANR A;  2X06 A;  3VKE A;  4JV5 H;  4JI5 H;  4LIJ A;  2M8W A;  2NN6 G;  2E5L H;  2UXB H;  3KDG A;  3J80 W;  4LF5 H;  1XRH A;  4NZR M;  2FFM A;  2CTM A;  1X4M A;  2PQU A;  1N34 H;  3GR5 A;  2JA9 A;  1DTJ A;  1HR0 H;  2LTL A;  2ANN A;  4LFC H;  4DR1 H;  5FLX W;  2DGR A;  2VQE H;  4YHH H;  4DV0 H;  4DR3 H;  3SB1 A;  2JEA I;  4DR2 H;  1J4W A;  3FAU A;  1DT4 A;  2Z0S A;  4FJS A;  3T1H H;  4AIM A;  2UUC H;  1XMO H;  4LFA H;  4NXN H;  1HNW H;  1V8C A;  2MJH A;  4GKK H;  1X9Z A;  2CPM A;  4JI0 H;  4PDB A;  2CTL A;  4AQY H;  4DUZ H;  4JYA H;  4LF9 H;  5JEA G;  4NZT M;  4X66 H;  4E9J A;  2OPU A;  5K36 G;  2K1H A;  3J7A K;  3OET A;  5LMN H;  5LL6 b;  1N36 H;  1XMQ H;  4B3M H;  1J5E H;  2Y3M A;  4LF7 H;  4H8A A;  4B3R H;  3JAM W;  2UUA H;  1PQX A;  2CWF A;  2FMR A;  2CWH A;  3UOE A;  2UU9 H;  1X4N A;  1ZZK A;  1ZTG A;  1TUA A;  4JVY A;  2VKC A;  1VIG A;  2LRR A;  1S03 G;  4DV3 H;  2CTF A;  2HH3 A;  2LTM A;  1HNZ H;  4LF6 H;  2JEB I;  4WAL A;  1WE8 A;  2JZX A;  1HNX H;  1NXU A;  4JI3 H;  1FJG H;  1I94 H;  4G08 A;  2P2R A;  2CTE A;  4DR5 H;  3KDK A;  1FKA H;  2CTJ A;  4OD6 A;  4DV4 H;  1N33 H;  1K1G A;  3OSS D;  1AN7 A;  2BA0 A;  1UG8 A;  4LF8 H;  4DR4 H;  4OX9 H;  2UXD H;  4NBQ A;  4DR7 H;  2BL5 A;  3T1Y H;  2M6Q A;  1J5K A;  3J81 W;  2UUB H;  2AXY A;  4DV2 H;  2UXC H; 
#chains in the Genus database with same CATH homology
 3V69 A;  2CTM A;  2PY9 A;  1X4M A;  2PQU A;  1EC6 A;  2QND A;  1ZZJ A;  2JA9 A;  2E3U A;  1DTJ A;  2OPV A;  2FMR A;  2ANN A;  1X4N A;  1ZZK A;  2DGR A;  1TUA A;  5C0X G;  2CPQ A;  2YQR A;  1VIG A;  1ZZI A;  1ZTG A;  4BA2 I;  4JVY A;  4OO1 G;  1KHM A;  2CTF A;  1VIH A;  3U1K A;  2HH3 A;  2JEA I;  1J4W A;  1DT4 A;  2HH2 A;  2JEB I;  2Z0S A;  4WAL A;  1WE8 A;  2JZX A;  4AIM A;  1WVN A;  4B8T A;  2MJH A;  2JE6 I;  4AM3 A;  4QMF B;  2P2R A;  2CTL A;  2CTE A;  3AEV B;  2CTJ A;  5JEA G;  3L7Z C;  2JVZ A;  4JVH A;  4WAN A;  2OPU A;  1K1G A;  5K36 G;  2BA0 A;  4IFD G;  2ANR A;  4NBQ A;  2BL5 A;  3VKE A;  1J5K A;  4BA1 I;  4LIJ A;  2CTK A;  2AXY A;  2NN6 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...