2CPQA

Solution structure of the n-terminal kh domain of human fxr1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
91
structure length
91
Chain Sequence
GSSGSSGTKQLAAAFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIYGESADAVKKARGFLEFVEDFIQVPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Fragile X mental retardation syndrome related protein 1, iso
publication title Solution structure of the N-terminal KH domain of human FXR1
rcsb
source organism Homo sapiens
total genus 13
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2cpqA01
1EC6A 1K1GA 4BA1I 4JVYA 2NN6G 5JEAG 2CTKA 2JA9A 1TUAA 2MJHA 2PY9A 1ZZKA 2QNDA 2Z0SA 2HH3A 3VKEA 4LIJA 2CTLA 2YQRA 4OO1G 2HH2A 5K36G 2JVZA 2ANNA 2CTEA 1DTJA 2CTFA 2JZXA 3V69A 4JVHA 1ZZIA 1WVNA 2DGRA 1J4WA 4B8TA 3U1KA 2AXYA 2BA0A 2JE6I 2CPQA 4NBQA 4BA2I 2PQUA 4WANA 1ZZJA 4WALA 1J5KA 4AM3A 1DT4A 4IFDG 2OPUA 2CTMA 2BL5A 2FMRA 4AIMA 3AEVB 2E3UA 2ANRA 1X4MA 1X4NA 1WE8A 1VIHA 2OPVA 2JEBI 2JEAI 2P2RA 1VIGA 1KHMA 4QMFB 5C0XG 2CTJA 1ZTGA 3L7ZC
chains in the Genus database with same CATH superfamily
4BA1I 4AQYH 5LMNH 3EZJA 4JI1H 2K1HA 1ODHA 4LFCH 1ZZKA 2QNDA 4LIJA 2YQRA 1HNXH 1MSZA 2JVZA 2X06A 4DR6H 4DR3H 2UXCH 4DV4H 4B3MH 4FJUA 1DTJA 2JZXA 4NXNH 2PT7G 1V9NA 1WVNA 1J4WA 3GR5A 2CWFA 1N32H 2UXBH 4LF6H 3I0PA 4LF9H 2LTMA 4BA2I 2CPMA 1ZZJA 5IWAH 1PQXA 1V8CA 3OETA 2CTMA 2ZM6H 2UUBH 4LF5H 4JI6H 2Y3MA 1VIHA 2CWHA 1VIGA 4PDBA 4LF8H 4DR2H 2CTJA 1EC6A 1K1GA 3T1HH 4JVYA 4YHHH 1J5EH 4DR7H 5JEAG 4JI7H 4DR4H 2VQFH 5A2QW 2FFMA 2CTLA 1XRHA 1Z2IA 1IBKH 2FPHX 2HH2A 3J80W 5K36G 1XNRH 2ANNA 3FAUA 4DV0H 1VBIA 3KDGA 3V69A 4DV6H 4NZTM 2LTLA 4B8TA 2BA0A 4EC5A 2ZQEA 5BR8H 4OX9H 2F4VH 4FJSA 5LL6b 1HNZH 4NBQA 2PQUA 4GKJH 4WANA 1J5KA 2O4CA 4LFAH 4LF7H 4DV1H 4DV5H 1XMOH 2ANRA 3AEVB 1X4MA 2M6QA 2LF0A 4B8CD 1WE8A 2OPVA 4DR5H 1N34H 4DV3H 1IBLH 4X66H 3OTOH 4GKKH 1KHMA 4QMFB 4OCHA 5C0XG 2PY9A 3L7ZC 4G08A 1FKAH 4LF4H 2NN6G 1X0AA 2CTKA 4DUYH 1TUAA 2MJHA 3VKEA 2UXDH 3GABA 4JV5H 3SB1A 1N36H 1HNWH 1IBMH 4YY3H 4H8AA 2CTFA 2A1SA 4DV7H 1ZZIA 2VKCA 2AXYA 1HR0H 2E5LH 4E9JA 2CPQA 4NXMH 3T1YH 4WALA 3NCVA 4AM3A 4JI5H 4IFDG 4B3RH 2FMRA 4AIMA 1X9ZA 4X65H 3UOEA 1I6UA 2JEBI 2UU9H 2LRRA 4JI4H 5IT9W 1ZTGA 2UUCH 4JYAH 1F0XA 5DT9A 4DR1H 4X64H 4JI3H 1XNQH 1N33H 4DUZH 1S20A 2JA9A 1UG8A 2Z0SA 1S03G 2HH3A 1FJGH 4KHPH 1SEIA 1AN7A 3J81W 4OO1G 4X62H 3J7AK 3JAMW 3GKUA 1XMQH 5FLXW 2CTEA 3KDKA 1WHRA 4B3TH 4JI8H 4JVHA 1WTJA 4NZRM 2UUAH 2DGRA 3U1KA 4LFBH 5LMUH 2JE6I 2HHHH 4OD6A 4B3SH 4K0KH 3QD7X 2D9IA 1DT4A 2OPUA 2G8YA 2BL5A 2VQEH 4JI0H 2E3UA 2M8WA 1X4NA 4JI2H 1I94H 2JEAI 2P2RA 3RF2A 3OSSD 4DV2H 1NXUA
chains in the Genus database with same CATH topology
1EC6A 1K1GA 4BA1I 4JVYA 2NN6G 5JEAG 2CTKA 2JA9A 1TUAA 2MJHA 2PY9A 1ZZKA 2QNDA 2Z0SA 2HH3A 3VKEA 4LIJA 2CTLA 2YQRA 4OO1G 2HH2A 5K36G 2JVZA 2ANNA 2CTEA 1DTJA 2CTFA 2JZXA 3V69A 4JVHA 1ZZIA 1WVNA 2DGRA 1J4WA 4B8TA 3U1KA 2AXYA 2BA0A 2JE6I 2CPQA 4NBQA 4BA2I 2PQUA 4WANA 1ZZJA 4WALA 1J5KA 4AM3A 1DT4A 4IFDG 2OPUA 2CTMA 2BL5A 2FMRA 4AIMA 3AEVB 2E3UA 2ANRA 1X4MA 1X4NA 1WE8A 1VIHA 2OPVA 2JEBI 2JEAI 2P2RA 1VIGA 1KHMA 4QMFB 5C0XG 2CTJA 1ZTGA 3L7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EC6 A;  1K1G A;  4BA1 I;  4JVY A;  2NN6 G;  5JEA G;  2CTK A;  2JA9 A;  1TUA A;  2MJH A;  2PY9 A;  1ZZK A;  2QND A;  2Z0S A;  2HH3 A;  3VKE A;  4LIJ A;  2CTL A;  2YQR A;  4OO1 G;  2HH2 A;  5K36 G;  2JVZ A;  2ANN A;  2CTE A;  1DTJ A;  2CTF A;  2JZX A;  3V69 A;  4JVH A;  1ZZI A;  1WVN A;  2DGR A;  1J4W A;  4B8T A;  3U1K A;  2AXY A;  2BA0 A;  2JE6 I;  2CPQ A;  4NBQ A;  4BA2 I;  2PQU A;  4WAN A;  1ZZJ A;  4WAL A;  1J5K A;  4AM3 A;  1DT4 A;  4IFD G;  2OPU A;  2CTM A;  2BL5 A;  2FMR A;  4AIM A;  3AEV B;  2E3U A;  2ANR A;  1X4M A;  1X4N A;  1WE8 A;  1VIH A;  2OPV A;  2JEB I;  2JEA I;  2P2R A;  1VIG A;  1KHM A;  4QMF B;  5C0X G;  2CTJ A;  1ZTG A;  3L7Z C; 
#chains in the Genus database with same CATH topology
 4BA1 I;  4AQY H;  5LMN H;  3EZJ A;  4JI1 H;  2K1H A;  1ODH A;  4LFC H;  1ZZK A;  2QND A;  4LIJ A;  2YQR A;  1HNX H;  1MSZ A;  2JVZ A;  2X06 A;  4DR6 H;  4DR3 H;  2UXC H;  4DV4 H;  4B3M H;  4FJU A;  1DTJ A;  2JZX A;  4NXN H;  2PT7 G;  1V9N A;  1WVN A;  1J4W A;  3GR5 A;  2CWF A;  1N32 H;  2UXB H;  4LF6 H;  3I0P A;  4LF9 H;  2LTM A;  4BA2 I;  2CPM A;  1ZZJ A;  5IWA H;  1PQX A;  1V8C A;  3OET A;  2CTM A;  2ZM6 H;  2UUB H;  4LF5 H;  4JI6 H;  2Y3M A;  1VIH A;  2CWH A;  1VIG A;  4PDB A;  4LF8 H;  4DR2 H;  2CTJ A;  1EC6 A;  1K1G A;  3T1H H;  4JVY A;  4YHH H;  1J5E H;  4DR7 H;  5JEA G;  4JI7 H;  4DR4 H;  2VQF H;  5A2Q W;  2FFM A;  2CTL A;  1XRH A;  1Z2I A;  1IBK H;  2FPH X;  2HH2 A;  3J80 W;  5K36 G;  1XNR H;  2ANN A;  3FAU A;  4DV0 H;  1VBI A;  3KDG A;  3V69 A;  4DV6 H;  4NZT M;  2LTL A;  4B8T A;  2BA0 A;  4EC5 A;  2ZQE A;  5BR8 H;  4OX9 H;  2F4V H;  4FJS A;  5LL6 b;  1HNZ H;  4NBQ A;  2PQU A;  4GKJ H;  4WAN A;  1J5K A;  2O4C A;  4LFA H;  4LF7 H;  4DV1 H;  4DV5 H;  1XMO H;  2ANR A;  3AEV B;  1X4M A;  2M6Q A;  2LF0 A;  4B8C D;  1WE8 A;  2OPV A;  4DR5 H;  1N34 H;  4DV3 H;  1IBL H;  4X66 H;  3OTO H;  4GKK H;  1KHM A;  4QMF B;  4OCH A;  5C0X G;  2PY9 A;  3L7Z C;  4G08 A;  1FKA H;  4LF4 H;  2NN6 G;  1X0A A;  2CTK A;  4DUY H;  1TUA A;  2MJH A;  3VKE A;  2UXD H;  3GAB A;  4JV5 H;  3SB1 A;  1N36 H;  1HNW H;  1IBM H;  4YY3 H;  4H8A A;  2CTF A;  2A1S A;  4DV7 H;  1ZZI A;  2VKC A;  2AXY A;  1HR0 H;  2E5L H;  4E9J A;  2CPQ A;  4NXM H;  3T1Y H;  4WAL A;  3NCV A;  4AM3 A;  4JI5 H;  4IFD G;  4B3R H;  2FMR A;  4AIM A;  1X9Z A;  4X65 H;  3UOE A;  1I6U A;  2JEB I;  2UU9 H;  2LRR A;  4JI4 H;  5IT9 W;  1ZTG A;  2UUC H;  4JYA H;  1F0X A;  5DT9 A;  4DR1 H;  4X64 H;  4JI3 H;  1XNQ H;  1N33 H;  4DUZ H;  1S20 A;  2JA9 A;  1UG8 A;  2Z0S A;  1S03 G;  2HH3 A;  1FJG H;  4KHP H;  1SEI A;  1AN7 A;  3J81 W;  4OO1 G;  4X62 H;  3J7A K;  3JAM W;  3GKU A;  1XMQ H;  5FLX W;  2CTE A;  3KDK A;  1WHR A;  4B3T H;  4JI8 H;  4JVH A;  1WTJ A;  4NZR M;  2UUA H;  2DGR A;  3U1K A;  4LFB H;  5LMU H;  2JE6 I;  2HHH H;  4OD6 A;  4B3S H;  4K0K H;  3QD7 X;  2D9I A;  1DT4 A;  2OPU A;  2G8Y A;  2BL5 A;  2VQE H;  4JI0 H;  2E3U A;  2M8W A;  1X4N A;  4JI2 H;  1I94 H;  2JEA I;  2P2R A;  3RF2 A;  3OSS D;  4DV2 H;  1NXU A; 
#chains in the Genus database with same CATH homology
 1EC6 A;  1K1G A;  4BA1 I;  4JVY A;  2NN6 G;  5JEA G;  2CTK A;  2JA9 A;  1TUA A;  2MJH A;  2PY9 A;  1ZZK A;  2QND A;  2Z0S A;  2HH3 A;  3VKE A;  4LIJ A;  2CTL A;  2YQR A;  4OO1 G;  2HH2 A;  5K36 G;  2JVZ A;  2ANN A;  2CTE A;  1DTJ A;  2CTF A;  2JZX A;  3V69 A;  4JVH A;  1ZZI A;  1WVN A;  2DGR A;  1J4W A;  4B8T A;  3U1K A;  2AXY A;  2BA0 A;  2JE6 I;  2CPQ A;  4NBQ A;  4BA2 I;  2PQU A;  4WAN A;  1ZZJ A;  4WAL A;  1J5K A;  4AM3 A;  1DT4 A;  4IFD G;  2OPU A;  2CTM A;  2BL5 A;  2FMR A;  4AIM A;  3AEV B;  2E3U A;  2ANR A;  1X4M A;  1X4N A;  1WE8 A;  1VIH A;  2OPV A;  2JEB I;  2JEA I;  2P2R A;  1VIG A;  1KHM A;  4QMF B;  5C0X G;  2CTJ A;  1ZTG A;  3L7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...