2X06A

Sulfolactate dehydrogenase from methanocaldococcus jannaschii
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
344
structure length
344
Chain Sequence
b'MILKPENEKKLIIDVLKKFGVPEEDAKITADVFVDADLKGFTSHGIGRFPQYITALKLGNINPKPDIKIVKESPATAVIDGDLGLGQVVGKKAMELAIKKAKNVGVGVVATRNANHFGIAGYYSELAMNQDMIGITITNTEPAMAPFGGKEKILGTNPIAIAFKGNKYKFSLDMATASIARGKILEALRKKIKIPEGCAVDKDGKPTTDPAKALEGCILPFGGPKGYGLALAIEMLSAIGGAEVGTKVKGTANPEERCTKGDLFIAINPEFFMGKEEFKRKVDELLDEIKNSEPAEGFEILIPGEIEERNKMKRKDGFEIDKNLYNQLKEICNELGLNIEDYIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-SULFOLACTATE DEHYDROGENASE
publication title Methanoarchaeal Sulfolactate Dehydrogenase: Prototype of a New Family of Nadh-Dependent Enzymes.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Oxidoreductase
total genus 104
structure length 344
sequence length 344
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.337: L-2-hydroxycarboxylate dehydrogenase (NAD(+)).
pdb deposition date 2009-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 2x06A01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 2x06A02
1Z2IA 2G8YA 1X0AA 4FJSA 3UOEA 1XRHA 1WTJA 4H8AA 2CWFA 2CWHA 3I0PA 4FJUA 1NXUA 1S20A 1VBIA 1V9NA 2X06A
chains in the Genus database with same CATH superfamily
2NN6G 3AEVB 4JI6H 2JVZA 4JI8H 1UG8A 1DT4A 1X9ZA 2LTLA 2CTMA 4DV2H 1HNZH 2BL5A 4QMFB 2CTFA 4KHPH 2CTLA 2CPMA 1WVNA 4DV6H 4DR6H 1X4MA 3JAMW 2ZQEA 2M6QA 2LF0A 2Z0SA 2QNDA 4X66H 1HNXH 2PQUA 2Y3MA 2CTKA 1XMQH 4EC5A 2F4VH 2D9IA 5LMNH 3GABA 1I94H 4OD6A 2JA9A 4LFCH 1J5EH 5FLXW 1KHMA 1ZZKA 2M8WA 2E3UA 2G8YA 3NCVA 3OTOH 4LF6H 2ANNA 4YHHH 5A2QW 4X62H 2ANRA 2YQRA 1WTJA 5K36G 4LIJA 4OX9H 5BR8H 4B8CD 4AQYH 4B3MH 3J7AK 1ODHA 4FJSA 4DUZH 2E5LH 2DGRA 3L7ZC 3FAUA 1IBMH 4GKKH 3U1KA 1N36H 2JEAI 1S20A 4JI3H 1VBIA 4JI4H 1K1GA 4JI0H 4LF8H 1I6UA 1WHRA 2CTEA 1FKAH 2UXCH 4JVHA 3RF2A 4OCHA 4NXMH 2X06A 1SEIA 1N33H 1Z2IA 2OPUA 5LL6b 2AXYA 4B3RH 3T1YH 1VIGA 2OPVA 1ZZIA 2FMRA 1F0XA 1DTJA 2PY9A 1HR0H 4B3SH 4JVYA 3SB1A 2O4CA 4JI5H 2CTJA 5IWAH 4DV5H 1IBKH 2FPHX 3I0PA 1J4WA 2UXBH 4DR2H 3QD7X 2UXDH 4X65H 1J5KA 3OETA 4JYAH 1XRHA 1V8CA 3J80W 4FJUA 4NBQA 1WE8A 4NZTM 5C0XG 4DR3H 1V9NA 2BA0A 3V69A 4B3TH 4YY3H 4AM3A 2PT7G 1ZZJA 2JEBI 4K0KH 1S03G 4X64H 1XMOH 4DUYH 3EZJA 4LF9H 3VKEA 1HNWH 3T1HH 4JI1H 1XNRH 2FFMA 1MSZA 4DV7H 4LF5H 3OSSD 4JI2H 4JV5H 4LF7H 1EC6A 2JZXA 4DV3H 3GR5A 3KDKA 2CPQA 2P2RA 2HHHH 3UOEA 4DR5H 1ZTGA 4DV0H 4DR7H 5IT9W 1X4NA 4WANA 4IFDG 1PQXA 1FJGH 2VQFH 1N34H 1N32H 5LMUH 4G08A 4LFAH 3KDGA 2CWHA 4NZRM 3GKUA 2VKCA 4BA1I 2HH3A 1NXUA 2K1HA 4DV4H 5DT9A 4DR1H 3J81W 2UU9H 2JE6I 1XNQH 4LF4H 2MJHA 2HH2A 2ZM6H 1X0AA 2LTMA 1TUAA 4AIMA 2CWFA 4BA2I 5JEAG 4NXNH 4OO1G 4GKJH 4WALA 4LFBH 2LRRA 4B8TA 4JI7H 1AN7A 4DV1H 4H8AA 2UUBH 4DR4H 4PDBA 2UUCH 4E9JA 2VQEH 1IBLH 2UUAH 2A1SA 1VIHA
chains in the Genus database with same CATH topology
1Z2IA 2G8YA 1X0AA 4FJSA 3UOEA 1XRHA 1WTJA 4H8AA 2CWFA 2CWHA 3I0PA 4FJUA 1NXUA 1S20A 1VBIA 1V9NA 2X06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2I A;  2G8Y A;  1X0A A;  4FJS A;  3UOE A;  1XRH A;  1WTJ A;  4H8A A;  2CWF A;  2CWH A;  3I0P A;  4FJU A;  1NXU A;  1S20 A;  1VBI A;  1V9N A;  2X06 A; 
#chains in the Genus database with same CATH topology
 2NN6 G;  3AEV B;  4JI6 H;  2JVZ A;  4JI8 H;  1UG8 A;  1DT4 A;  1X9Z A;  2LTL A;  2CTM A;  4DV2 H;  1HNZ H;  2BL5 A;  4QMF B;  2CTF A;  4KHP H;  2CTL A;  2CPM A;  1WVN A;  4DV6 H;  4DR6 H;  1X4M A;  3JAM W;  2ZQE A;  2M6Q A;  2LF0 A;  2Z0S A;  2QND A;  4X66 H;  1HNX H;  2PQU A;  2Y3M A;  2CTK A;  1XMQ H;  4EC5 A;  2F4V H;  2D9I A;  5LMN H;  3GAB A;  1I94 H;  4OD6 A;  2JA9 A;  4LFC H;  1J5E H;  5FLX W;  1KHM A;  1ZZK A;  2M8W A;  2E3U A;  2G8Y A;  3NCV A;  3OTO H;  4LF6 H;  2ANN A;  4YHH H;  5A2Q W;  4X62 H;  2ANR A;  2YQR A;  1WTJ A;  5K36 G;  4LIJ A;  4OX9 H;  5BR8 H;  4B8C D;  4AQY H;  4B3M H;  3J7A K;  1ODH A;  4FJS A;  4DUZ H;  2E5L H;  2DGR A;  3L7Z C;  3FAU A;  1IBM H;  4GKK H;  3U1K A;  1N36 H;  2JEA I;  1S20 A;  4JI3 H;  1VBI A;  4JI4 H;  1K1G A;  4JI0 H;  4LF8 H;  1I6U A;  1WHR A;  2CTE A;  1FKA H;  2UXC H;  4JVH A;  3RF2 A;  4OCH A;  4NXM H;  2X06 A;  1SEI A;  1N33 H;  1Z2I A;  2OPU A;  5LL6 b;  2AXY A;  4B3R H;  3T1Y H;  1VIG A;  2OPV A;  1ZZI A;  2FMR A;  1F0X A;  1DTJ A;  2PY9 A;  1HR0 H;  4B3S H;  4JVY A;  3SB1 A;  2O4C A;  4JI5 H;  2CTJ A;  5IWA H;  4DV5 H;  1IBK H;  2FPH X;  3I0P A;  1J4W A;  2UXB H;  4DR2 H;  3QD7 X;  2UXD H;  4X65 H;  1J5K A;  3OET A;  4JYA H;  1XRH A;  1V8C A;  3J80 W;  4FJU A;  4NBQ A;  1WE8 A;  4NZT M;  5C0X G;  4DR3 H;  1V9N A;  2BA0 A;  3V69 A;  4B3T H;  4YY3 H;  4AM3 A;  2PT7 G;  1ZZJ A;  2JEB I;  4K0K H;  1S03 G;  4X64 H;  1XMO H;  4DUY H;  3EZJ A;  4LF9 H;  3VKE A;  1HNW H;  3T1H H;  4JI1 H;  1XNR H;  2FFM A;  1MSZ A;  4DV7 H;  4LF5 H;  3OSS D;  4JI2 H;  4JV5 H;  4LF7 H;  1EC6 A;  2JZX A;  4DV3 H;  3GR5 A;  3KDK A;  2CPQ A;  2P2R A;  2HHH H;  3UOE A;  4DR5 H;  1ZTG A;  4DV0 H;  4DR7 H;  5IT9 W;  1X4N A;  4WAN A;  4IFD G;  1PQX A;  1FJG H;  2VQF H;  1N34 H;  1N32 H;  5LMU H;  4G08 A;  4LFA H;  3KDG A;  2CWH A;  4NZR M;  3GKU A;  2VKC A;  4BA1 I;  2HH3 A;  1NXU A;  2K1H A;  4DV4 H;  5DT9 A;  4DR1 H;  3J81 W;  2UU9 H;  2JE6 I;  1XNQ H;  4LF4 H;  2MJH A;  2HH2 A;  2ZM6 H;  1X0A A;  2LTM A;  1TUA A;  4AIM A;  2CWF A;  4BA2 I;  5JEA G;  4NXN H;  4OO1 G;  4GKJ H;  4WAL A;  4LFB H;  2LRR A;  4B8T A;  4JI7 H;  1AN7 A;  4DV1 H;  4H8A A;  2UUB H;  4DR4 H;  4PDB A;  2UUC H;  4E9J A;  2VQE H;  1IBL H;  2UUA H;  2A1S A;  1VIH A; 
#chains in the Genus database with same CATH homology
 1Z2I A;  2G8Y A;  1X0A A;  4FJS A;  3UOE A;  1XRH A;  1WTJ A;  4H8A A;  2CWF A;  2CWH A;  3I0P A;  4FJU A;  1NXU A;  1S20 A;  1VBI A;  1V9N A;  2X06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...