4BA2I

Archaeal exosome (rrp4-rrp41(d182a)-rrp42) bound to inorganic phosphate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
226
structure length
213
Chain Sequence
SQEIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGNKSMYETLTSCSIFVANNGRIWATCSRFSEEILIEAIRKIENELTDRIKQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
publication title Crystal Structure of a 9-Subunit Archaeal Exosome in Pre-Catalytic States of the Phosphorolytic Reaction.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 40
structure length 213
sequence length 226
ec nomenclature
pdb deposition date 2012-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ba2I01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ba2I02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4ba2I03
1J4WA 2EJFC 4DV2Q 3T53B 4MZ9A 4DV1Q 5M3FG 2UXBL 2KCTA 3FKIH 4A3IH 4X65Q 1H9JA 4OWXB 1X65A 4JI3Q 3KFUA 4WJ3M 4OX9L 1EOVA 3CCJA 5JJIA 1LTLA 3PSIA 4DV5Q 4HJ5A 2GVBA 4QJFA 1VQBA 3PF5A 2JE6I 1VQHA 4DUZL 1J6QA 5IP9G 2VNUD 4DNRB 1I94L 5IY0A 1L1OA 3ICEA 3GTOH 2DGRA 3NBHB 4DUYQ 1GO3E 1VQFA 3U58A 4NXMQ 1Z9FA 1GUSA 1NMGA 4GLVB 2PQAA 1GM5A 3VKEA 3QG1A 1YNNC 5KNDA 2QEXA 1KIXA 1ZYRC 1T5EA 1WFQA 2ZTDA 1HZ9A 1J5KA 4IFDJ 1L0WA 1VQ7A 3HOXG 3F8TA 1WVNA 2JXMB 2UXCL 4P71A 4A3JH 1A63A 4JVYA 4BBSG 5AJ3Q 4OO1G 1EQQA 3CP0A 4DR4Q 4HIKA 4A3MH 4P75A 4X66L 1SR3A 1HNWL 2CW0C 4GN5A 4LFCQ 4LF6Q 2DGYA 1C7YA 2B63G 5A35A 1FGUA 1GD7A 3LGJA 1GUNA 3K0XA 4K0KL 1KQSA 2E74C 1N36Q 1V9PA 4GN3B 4PZ8A 3HFZB 1Y69U 2VY3A 2CKZB 1OXVA 1VQJA 3KF6A 2MO1A 1CKOA 3F2BA 3OW2A 3D4RA 5HY6A 2XTIA 2FMRA 4BY1G 4XTCS 3E9IA 3CCLA 5JJKA 2MNAA 1N34Q 1IBML 3JAMi 4DR7Q 2R93G 4YCWA 2Q2UA 2ZJRA 1VIHA 5FJ8H 3MEFA 4GOPB 1BBUA 3UE0A 1CFMA 1Y1WH 2ES2A 1PV4A 3J81i 3OPOA 1IXRA 3FMCA 3ZJYC 4JI5L 1Q1EA 3S16H 4YCVA 2ZJQA 3VDYA 2JQOA 5C44G 3CCEA 3MXNB 4B3RQ 2OPUA 1N32Q 1YJWA 2IX0A 4DPGA 4GLAC 3S15H 4GNXA 5IP7G 4IQZA 1XNQL 2N49A 4BA2I 1FR3A 4HJ7A 2NVYH 2K4KA 4C2MH 3HKSA 1EC6A 1Q8KA 3GQBA 1IBLQ 1QVGA 1K8GA 2HT1A 4POFA 1C0AA 1X3GA 1XMQQ 1E7ZA 4YWLA 4YHHQ 3DLLA 1E2ZA 3GTLH 4X62Q 1VS0A 4AYBE 1PH7A 4A93G 2BA1A 4JOIC 3DM3A 5EAYA 4JI1L 2WB1G 3GTJH 4JBKA 2BDOA 3A8IE 4L5QA 4A3GG 1OTCA 2O5JC 1XMOQ 3UE1A 1Y1VH 1YHBA 4AQYL 1HNZQ 2D5DA 5IWAL 1IBKQ 1V1QA 2IT1A 2K5NA 2E8GA 4RCNA 2UXBQ 1HH2P 2EIFA 2PPBC 5GAEC 1PMRA 4JBMA 1LABA 4NBQA 4OX9Q 3QIAA 3WWVA 2JA8H 3KF8B 4KKTA 2LXJA 1EIYB 3I4NH 4A3EH 1EWIA 2WAQG 4DR6L 3I7FA 5JEAG 2Z6KC 2I5LX 3HOVG 2JA5H 2K5VA 1H9RA 4H13C 2QA4A 4PMWA 1I94Q 1JJCB 1E2VA 4DV3L 1Q90A 4P72A 2AUKA 3JC66 1UE6A 4A3JG 4XIGS 3HOWH 4A3CH 1QVCA 1K83H 4B3MQ 4KLKA 4A3MG 2PQUA 3HOUH 4EX5A 3ULJA 1C9OA 4AH6A 2K75A 2I5MX 2BE5C 3H3VI 1XJVA 1JJ2A 4GS3A 1WOCA 3CRKC 2HH3A 1TWAH 5M3MH 3OTOL 2I0QA 4I7ZC 1VQLA 1TU2B 3I4OA 4IPCA 3L2PA 3AEVB 1M90C 4LF4L 4LK1C 3K8AA 4X66Q 3PO3G 2R92G 4NXNL 1WCMH 1OXSC 2PMZE 2ANRA 4GOPA 1K9MC 2KHJA 3M4OH 2JEAI 5KNBA 1PH8A 4JVHA 3K7UC 2JA6H 2I5HA 2FXQA 4FDBA 3M4QA 3I2ZA 3CC4A 4H44C 4JK1C 1Y1WG 4BXXG 3AYHB 4LNQA 3RNUA 4LF9L 2ZT9C 1KC8C 3HOYG 4IFDH 4JV5L 2UUAL 2RHSB 1QJOA 4L5SA 5C3EH 3NE5B 2CCZA 2F4VL 5DLQE 4IOAA 2JJQA 5GQOA 2DUDA 4LF8L 5LMUL 1LM0A 1VQAA 2Q2IA 5BR8Q 1CSQA 2Q2HA 5C4XG 4LUVA 1CI3M 1TXYA 2DNEA 1MKHA 2JZXA 1EWHA 4JI6L 1IW7D 2IHEA 2QGQA 2VL6A 4DV0L 2N3SA 2AUJD 1YZ6A 3OOCA 4UP8A 3CCQA 1OXTA 4BBRH 4IJLA 4Y52H 4P73A 2N8NA 3W1BA 2JA7H 1I6VC 3IFTA 1A8VA 4UY8C 4LW1A 1XNQQ 5C0XJ 2Z0SA 5C0XG 1ONLA 4AYBG 3S1QH 4JYAL 4QGUA 4HIMA 4KMUC 1VQIA 3GO5A 2UXDL 5BN4A 3G4SA 1Y1VG 4IO9A 1JT8A 2ZJPA 4DR3L 1FYCA 1KRSA 2RHQB 3F1ZA 4DR5Q 3BZKA 2NVQH 4R4CA 1WE8A 3BJUA 2UUBL 1AE2A 3UDIA 4JI1Q 3PO2H 3PF4A 1XNRQ 4YCUA 2K7VA 3S14H 1UE7A 3GDEA 2JA8G 1Q12A 4AQYQ 5IWAQ 2VQFL 4A3BH 5FLMG 3D0FA 1YHAA 3A0JA 4L5RC 1D7QA 4JI0L 3A7LA 4JCVE 1X56A 2KBNA 1IL2A 4LUOA 1E24A 3CD6A 1YHQA 2JVZA 2JEBI 4R4OA 4O0AA 2A6HC 3E9HA 3PGZA 4DV4Q 5K36H 4AIMA 4DR6Q 1Y8OB 3I56A 4LFBL 3AEVA 4DK3C 4A3FH 2F52A 1TUAA 4A76A 3H0GH 2CFMA 4DV3Q 1G291 3GTQH 1K8OA 3RN5A 4YY3L 2MQHA 3W3AA 1FL0A 1T9HA 3A5ZB 4QQBX 4R1JA 1S3OA 3TS2A 4KHPQ 3ND9A 1E2WA 3EBEA 3OYYA 2IY5B 1KHIA 3HOZG 2LXKA 3UDXA 1QZHA 5E7NA 2EJGC 4IPHA 4G7OC 1HNXL 2Q2TA 1UE1A 4LWCA 4B3TL 2A8VA 3VR4A 3OTOQ 4TQUS 1VIGA 4LF4Q 1B9NA 3RZOH 4LF7L 4NXNQ 5H1SE 4MTNA 1Q81C 5M5XH 3EN2A 2HIVA 5J3BA 2VUMG 5C3EG 3H15A 1YBYA 2Y0SE 5IYBH 1KXLA 1SROA 3ULPA 1CKMA 4LF9Q 2K32A 4DAMA 4JV5Q 2CTEA 1K8MA 2F4VQ 4BBRG 3U4ZA 2MJHA 4LF8Q 2B8FA 5LMUQ 2YTYA 3J80i 1HR0W 1CUKA 2E75C 4WALA 2D2CC 3EIVA 3S24A 2BE5D 1X6OA 1X9NA 1B9MA 4JI6Q 1PH4A 3FP9A 1P16A 3S1MH 2VS1A 3ERSX 1YNJC 4DV0Q 3N6RA 4GKJL 1VQ8A 3U50C 3QJYA 1Q46A 1H9KA 1WYDA 1GHKA 4KI0A 1GUOA 1PFSA 3KLRA 3CW2C 1HCZA 3PUWA 2AWOA 3PO2G 2YYZA 1O7IA 3EQLC 5GAHC 1YIJA 4IJHA 4X6AH 4OXPA 4C3JH 4IOCA 2F3IA 3WDNA 3FKIG 4A3IG 1HJPA 4JYAQ 1ZZIA 3M85A 2UXDQ 1FVIA 2N78A 3VR6A 2ATWA 4DR3Q 4A3BG 1SRUA 4OGQC 1WI5A 1VQGA 2UUBQ 1DCZA 1CKNB 1LUZA 3CCVA 5JJLA 3CMAA 5HGQA 2NN6H 5JEAJ 3U4VA 3CF5A 2K5HA 1YJNA 4JI3L 3S2HH 1DXMA 4KN7C 4LF5L 5K36G 1R9TH 2VQFQ 3L0OA 2MFIA 4QMFB 2MO0A 3RZDH 1H95A 5C0XH 1NY4A 3RN2A 2KENA 5LMNW 4WJ4A 4A3FG 1AH9A 2OQKA 5M3FH 3CC2A 1N33L 4DUZQ 3TS0A 4DR2L 1PH9A 4RMFA 4JBWA 2R7ZH 2A6EC 1MJCA 1KD1C 1VQCA 4LFAL 3U9SA 3STBC 1SE8A 3NENA 1X3FA 1DGSA 4HIDA 2YV5A 2ZM6L 3SGIA 1JMCA 1HPCA 1X54A 4LFBQ 1EUJA 3RLOA 2RF4A 4BA1I 1L1OC 3AFPA 4UP9A 2OTLA 5IP9H 4PV1C 3FPPA 2A68C 1SLJA 2OTJA 3CXCA 4C3IH 2NVTH 1X55A 4YY3Q 1GUTA 2ZTEA 2AXYA 4TVAB 3KJOA 3CRLC 1IYJB 2UXCQ 4EQ5A 5BN3A 1E22A 1VDZA 2Q8IB 1XTDA 1VQ4A 1PHJA 1N9WA 3CCUA 3D31A 5BN5A 1I5FA 3J80c 1X4MA 1H9SB 3CCSA 2D0PA 2UUCL 2AHOB 1HNWQ 2E2JH 1VQPA 1HNXQ 1I3QH 3PIPA 3J7ZC 3K7AH 2E76C 4B3TQ 1VQDA 1QZGA 2R7FA 3H94A 3HOXH 4K0KQ 2NZOA 1JE5A 3M7NA 4DK6C 1N36L 1X3EA 4BBSH 1EQRA 4OO1H 3A8JE 1K1GA 4LF7Q 5FJ8G 1PH5A 3KLWA 1DD2A 2A6HD 2Y0SG 4Y7NH 2B63H 4A75A 2VZAA 1ASYA 1O7LA 2YTVA 3A7AB 1OXUA 2V1CC 3BU2A 2CTFA 4DR7L 1IBMQ 2NVXH 1Y8NB 4A3LH 3ULLA 3AB9A 3G71A 2HHHL 4NPSA 3NEMA 2JA9A 2YQRA 2A1AA 4BY1H 2DNCA 3M3YH 1XPOA 3A74A 4X64L 1N8RC 5IE8A 4JI5Q 2YTXA 1NJIC 1ZZJA 4UP7A 3HKZE 3HGBA 3KYHC 1UWVA 1EIFA 2BH2A 1E3PA 1K3RA 2BL5A 2LSSA 1GVPA 1HZCA 1KAWA 1Q1BA 2BH8A 1CKNA 2WP8J 1CSPA 3A5UA 3M4YA 2P2RA 4GKJQ 4JOIA 4GLXA 4DNIA 2AKWB 2K50A 2EQSA 5FLXc 1VQMA 4GNXC 4QIWE 4YWMA 1YI2A 5C44H 2CTLA 1M1KC 4YWKA 1GJXA 4X62L 3S17H 2PNRC 1S40A 3CCMA 4IPDA 5IP7H 2NN6G 3KOJA 3GTGH 3UDGA 3PIOA 3IKJA 1YJ9A 1HR0L 2OQ0A 4A3KH 1PH3A 3MFYA 3I55A 3PCOB 2AWNA 1V8QA 4NB3A 1IZ6A 4JI7L 1L2FA 3E0EA 2K14A 3I4NG 4A3EG 1GHJA 3VR2A 2VQEL 5C4JH 1PVOA 4IFDI 4A93H 2OCEA 3T56B 2QNDA 2R7ZG 2JA5G 3T1YL 4OWTB 1W3SA 1SMXA 1DT4A 4JI4L 2Z6KA 1PYSB 2EDGA 4A3GH 5GAGC 3GD7A 1QUQB 3W1GA 4LF5Q 1RL2A 1K73C 2DN8A 1JB7A 3HOWG 4TKOB 4A3CG 3J7A5 1SFOH 3KDFB 1N33Q 5M5YH 3SE0A 3HOUG 4DR2Q 1ASZA 1HQMC 1YITA 3PUZA 3F2DA 2WAQE 1H9SA 2HH2A 1NE3A 4LFAQ 3K81C 2F1MA 1I50H 1FJGL 2D62A 2ZM6Q 5M3MG 4APVA 2RCNA 2AMCB 2GN5A 2H5XA 4DNTB 3SDZA 1PYBA 4B3ML 1NBWA 3F2CA 5IYDH 5JEAH 4HJAA 1IYVA 4POGA 3HOVH 4KHZA 1KL9A 4HJ9A 1WCMG 4B3SL 2A19A 1CTMA 5LMNL 3V69A 4JI8L 1IW7C 2B29A 2JA6G 3GTKH 1YVCA 2K52A 3VA7A 3TQYA 3RR5A 3W5OA 3LWUA 2XGTA 3S1RH 2UUCQ 2HQLA 1HZBA 2CTKA 2KCCA 4ME3A 4LIJA 2CQOA 1O78A 1VQNA 1U0LA 1XPRA 3A8KE 1HZAA 4MNOA 3MXUA 4IFDG 3T1HL 1VQ9A 3T51B 2UU9L 2O5IC 3B6YA 4ALPA 4DV7L 4A3LG 2IX1A 3BG3A 2CTJA 1J5EL 3GTMH 2V4DA 4GOPC 2A69C 4KKSA 2A6ED 3PO3H 2R92H 1S72A 1YNXA 1Q86C 3STBD 5IYCH 1PH2A 2OPVA 3K80C 4C3HH 4HR7B 1P8LA 1BKBA 4DR1L 2UUAQ 4DV6L 2IHFA 1Q82C 1KHMA 5BR8L 2HHHQ 2E3UA 2A68D 1NTGA 3BZCA 2JA7G 4H0LC 3HKZG 4BXXH 4GKKL 1ZKOA 3KJPA 4DAYB 4LJZC 4A3DH 1BDOA 3L7ZC 4X64Q 3HOYH 1Z7TA 2E5LL 1VF7A 3I4LA 4O2DA 4QY7A 1A0IA 1DTJA 4G7HC 2PCFB 5IT9c 4JG2A 1Z47A 3BDOA 3PUYA 3IRBA 2D0OA 5C4XH 1G51A 3NELA 1TWFH 1PA6A 4KN4C 4A3KG 1VQEA 4DK1A 4JI2L 1BBWA 2EXDA 3I4MH 2B8GA 4BY7H 4A4IA 3S2DH 1A62A 3H3VH 1QUQA 4DR5L 1SMYC 1RIPA 3PUVA 1ZTGA 5M5WH 1D8LA 2VW9A 1HR0Q 4JC0A 1XNRL 4DV2L 4DV1L 1NMFA 3KDFA 1ZZKA 4L5TA 2E2HH 3Q8DA 2K33A 4DK0A 4X65L 1UEBA 2ANNA 1JJGA 2KA7A 1EYGA 4JI7Q 1TWGH 5GROA 2R7DA 5ELNA 1GUGA 1XPUA 2VQEQ 4DV5L 1V43A 3TRZA 3RLFA 4JI0Q 3UDFA 1AE3A 3AQQA 3T1YQ 5KNCA 4B8TA 1Y8PB 2PI2E 3DXJC 4JI4Q 1MIUA 3H0GG 2GVAA 4PG3A 1LYLA 4DV4L 2ZTCA 4DUYL 2JK8A 1Y14B 5FLMH 1K8AC 2LMCB 4NXML 5IYDG 5ELOA 1X4NA 3VR5A 3AFQA 2HIXA 3VR3A 3CPWA 3FHWA 3M4PA 1FJGQ 1PH6A 1VQ6A 2R6GA 1H9MA 1E1OA 4R4IA 3JAMc 3J81j 4G7ZC 4KHPL 1MJEA 5AJ3L 1SN8A 2YU9H 2PNHA 2KCMA 3ND8A 4DR4L 5GADC 1L1OB 4UPAA 3ER0A 2B3GA 2ASBA 4B3SQ 2BA0A 2ALYB 4LFCL 4LF6L 4HIOA 1W2BA 3J81c 5LMNQ 4JI8Q 4QL5A 4RG1A 3LNNA 1VCIA 1B70B 3P20A 2PQAB 3I73A 3TZUA 2NN6I 4PZ7A 1IYUA 1QVFA 2C35B 3PUXA 4L8JA 1GKHA 5IYBG 2KHIA 2L5TA 2WFWA 1U5KA 1PH1A 3PV0A 5IYCG 3CMEA 3HOZH 1Z6HA 4GN4B 4JBJA 3CPFA 3T1HQ 5C0XI 4IPGA 2UU9Q 1N34L 4DV7Q 1OXXK 1K0RA 1J5EQ 4J15A 1Q7YC 1B7YB 3I72A 1YEZA 1I6HH 1VQKA 3CC7A 1TWHH 3G48A 3U1KA 1KRTA 2EVBA 4A3DG 3S1NH 4R4TA 3M9BA 4WANA 2VUMH 4DR1Q 4P74A 3CCRA 4DV6Q 2CWAA 1VQ5A 1WJJA 2E2IH 2CPQA 1TKWB 1TWCH 2OWOA 3RLNA 2CWPA 2QF7A 3KF6B 2R93H 1UE5A 1A6XA 2PI2A 4GKKQ 4B3RL 4OONA 1N32L 2ID0A 1EFWA 3CAMA 2E5LQ 4LUZA 3OW7A 4GZYC 1E1TA 3I4MG 4BY7G 1IBLL 2PY9A 2CTMA 4DKAC 1XMQL 4YHHL 3GTPH 2L15A 4R4QA 2NZHA 1VQOA 4H02A 1LACA 1VF5C 4PZ6A 3G6EA 4JI2Q 1BVSA 4OO1I 1B8AA 3CQZH 4AM3A 3TREA 2A69D 2EJMA 4KKUA 4OWWB 1XMOL 4GNXB 1HNZL 1HTPA 4HJ8A 3TEHB 2WB1E 1IBKL 1G6PA
chains in the Genus database with same CATH superfamily
1HHVA 2H1EA 2SDFA 1J4WA 1R4QB 2EJFC 3GV3A 4DV2Q 4MZ9A 3T53B 4DV1Q 1MSZA 5FO7B 5M3FG 3HOVB 1AEXA 1JWMD 2UXBL 2KCTA 4YY3H 5G3LF 2KQ3A 2LTLA 3FKIH 4A3IH 4U68A 5LL6S 4X65Q 2B2UA 1H9JA 4Q5VA 1B2TA 4OWXB 2D9IA 1X65A 4JI3Q 3CHBD 4FF4A 3KFUA 4WJ3M 2UXCH 5EKLA 4OX9L 1RCVD 1EOVA 3CCJA 4A3JB 5JJIA 1LTLA 3TN2A 3GTKB 1RTOA 3PSIA 4KY7A 4DV5Q 3HEJA 4HJ5A 1S4ZA 1I4RA 3JAMW 2GVBA 3MXGA 4QJFA 5CR3A 1VQBA 3PF5A 3S1RB 2JE6I 4A3MB 1VQHA 1HNWH 3FVQA 4DUZL 2OF1A 1J6QA 3K59A 1RJTA 1PQXA 5IP9G 4B3TH 1K0SA 4JPBW 2VNUD 4DNRB 1I94L 4K0KH 2NUCA 5IY0A 1L1OA 1QWYA 4ZUJA 3ICEA 4JVZA 2PO4A 2NYZD 3GTOH 3NBHB 2DGRA 4DUYQ 4FXGC 1GO3E 4QMGA 1VQFA 1MHWC 4XYQA 3NTIA 3OWFA 2F0DA 3U58A 4NXMQ 1Z9FA 1O7YA 2EY5A 1GUSA 1MGSA 1NMGA 4GLVB 5JPNC 4MN3A 3NTKA 2JN4A 2PQAA 3GTMB 5FO9B 2X69A 3PO3B 2R92B 1GM5A 3VKEA 2HDMA 3QG1A 1YNNC 2X6GA 4H7BA 4C1NI 5KNDA 4OELB 2QEXA 1KIXA 3NQIA 3QOLA 1ZYRC 1T5EA 1WFQA 1SMYD 1IBMH 2ZTDA 1HZ9A 1J5KA 1S20A 4IFDJ 1D5ZC 1L0WA 1VQ7A 3HOXG 3F8TA 1WVNA 2JXMB 2UXCL 4P71A 5DM63 4A3JH 4FYDA 1A63A 4JVYA 4BBSG 5AJ3Q 3VYTA 3KDGA 4FVMA 4OO1G 3KLSA 3CP0A 1EQQA 4DR4Q 1BCPF 3H09A 2ICEC 4HIKA 4A3MH 4P75A 1OO9B 2PZWA 4X66L 1SR3A 1HNWL 3EVQA 2CW0C 4GN5A 4LFCQ 4LF6Q 3VA5A 2DGYA 1C7YA 2B63G 5A35A 1PDQA 1FGUA 4JI5H 1GD7A 5IODA 3HOYB 3H6MA 3S16B 1WD0A 3LGJA 1LT4D 1GUNA 1QCBD 3K0XA 3F2UA 4K0KL 1KQSA 3HP3A 3TP7A 2E74C 1F2YA 1N36Q 2SEBD 1M8AA 1EZ8A 2RQXA 1DOKA 1S03G 2RSOA 1V9PA 1KLUD 1PXUA 5CV8A 4GN3B 2RVLA 4PZ8A 3HFZB 1Y69U 2VY3A 1GOZA 1DOLA 2CKZB 1XNQH 1OXVA 1VQJA 5C4XB 3KF6A 4BS9A 2MO1A 1LTID 3KLSX 2NVYB 1TWFB 1CKOA 3F2BA 3OW2A 3D4RA 3OSOA 2XTIA 5HY6A 5CYUA 2KJXA 2FMRA 4BY1G 4XTCS 5EPLA 4K6LA 3E9IA 1XYIA 3CCLA 1JOQA 5JJKA 5COYA 2MNAA 1N34Q 3ITPA 3TMEA 3DMUA 1HTLD 1Q8IA 1IBML 3JAMi 2C5CA 4DR7Q 2R93G 4YCWA 1SBBB 3E5SA 4CJ0B 2Q2UA 3S2DB 2ZJRA 1VIHA 5C6AA 2K03A 5FJ8H 3MEFA 1EIHA 4ZYSA 4GOPB 1BBUA 3UE0A 1CFMA 1JWUD 1TVXA 5CV4A 5M5WB 4KY5A 1Y1WH 2ES2A 1EL0A 2RCFA 3GTJB 1PV4A 3J81i 3OPOA 2RA4A 2E2HB 1IXRA 3FMCA 4AYBB 3ZJYC 1CA5A 1S5CD 4JI5L 1Q1EA 3S16H 4YCVA 4AQYH 2ZJQA 1TWGB 3VDYA 2JQOA 1ILPA 5C44G 2B2TC 3R2TA 3CCEA 2KVMA 4KV6A 3MXNB 1UNSA 2FFKB 4B3RQ 2RKSA 2OPUA 5J1ZA 1N32Q 1YJWA 2F0EA 2XRQD 2IX0A 4DPGA 4GLAC 2EYOA 3S15H 4GNXA 5IP7G 4OHJA 5D65A 4IQZA 1XNQL 2N49A 2F0OA 4BA2I 1QILA 1FR3A 4HJ7A 2NVYH 2K4KA 4C2MH 3HKSA 3DWAA 3GKUA 1EC6A 2HQEA 3R93A 5K5PA 4LF5H 1HXYD 1Q8KA 3GQBA 1IBLQ 4I7AA 1QVGA 2JA8B 1K8GA 2HT1A 2MHVA 4POFA 4CDEC 1C0AA 4X3KA 3GP7A 1I4GA 2PQEA 3OETA 3L9AX 5ELFA 1X3GA 4DR6H 1D5XC 1JOKA 1SE2A 4K2LA 1XMQQ 1E7ZA 4YWLA 1RDPD 1N33H 4ZAIA 4YHHQ 2ZQEA 4FNFA 3DLLA 1E2ZA 3CKIB 3GTLH 4X62Q 2XSCA 1VS0A 5EBDA 1AW7A 4AYBE 1PH7A 4A93G 4NZRM 1EEFD 2BA1A 4JOIC 3R8BA 1F0XA 2F0QA 4IUUA 5CC4A 5CV5A 2L11A 3DM3A 5EAYA 4JI1L 4F87A 5KIXA 4LFAH 2WB1G 4G08A 3GTJH 4DV3H 4JBKA 3K0YA 1G6ZA 3K57A 4E9JA 3J7AV 2BDOA 3A8IE 4L5QA 4A3GG 3SXHA 1OTCA 2O5JC 5LL6b 1XMOQ 3UE1A 2D9UA 1QG7A 1Y1VH 1YHBA 4AQYL 5IGEA 1HNZQ 2QDLA 2BDNA 3NBHA 2D5DA 5IWAL 1IBKQ 4OIKA 1AFPA 5HGTA 2LFNA 2CQAA 1V1QA 3D6WA 1FD7D 2YU9B 5FKAC 3J80E 2LTMA 2IT1A 2K5NA 5EGTA 2E8GA 4RCNA 2UXBQ 1HH2P 4CDFC 1DJRD 2EIFA 2PPBC 1I4QA 5GAEC 1PMRA 4JBMA 2OEOA 1JCKB 2J7ZA 1LABA 4NBQA 1B50A 3K58A 1F2ZA 4OX9Q 1HQRD 3NCVA 3QIAA 4QB4A 3WWVA 1TWAB 2JA8H 3KF8B 4KKTA 1Q3LA 2LXJA 1PTOB 1EIYB 5EPJA 5J22A 2WKDA 4A3EH 3I4NH 1EWIA 2WAQG 1BNZA 4LF4H 2UUCH 2EPBA 4DR6L 3I7FA 2L9HA 5KRUA 2LF0A 1STGA 4IUQA 4NXNH 2XNAC 5JEAG 2Z6KC 2I5LX 3HOVG 5ELCA 5IGBA 2JA5H 2K5VA 1H9RA 3HOZB 4H13C 2QA4A 1WTOA 4PMWA 1I94Q 1X3QA 1JJCB 1WTWA 2AQ1B 4CDCC 3MC0B 4IZ8A 1E2VA 2QKIC 5C5MA 1Q90A 3DWPA 4DV3L 4P72A 4NZTM 3SK5A 2AUKA 2PMZB 4M1UB 3JC66 1UE6A 4A3JG 1D1IA 4XIGS 3HOWH 1V1PB 1U4PA 4A3CH 5T1GA 2HUGA 2F0WA 1RD9D 1QVCA 1K83H 4B3MQ 4KLKA 4A3MG 1STNA 1HFNA 2PQUA 3HOUH 3QOJA 4KK7A 4EX5A 1TWHB 3ULJA 1C9OA 1TS4A 3MHBA 1QNKA 4LF9H 1JICA 4AH6A 2K75A 2I5MX 2BE5C 5J39A 1JORA 3HG9A 5KEEA 3H3VI 1XJVA 3S1NB 2UUAH 4B9WA 1JJ2A 4GS3A 3QR8A 1WOCA 3DWQA 3CRKC 1KDAA 2VUMB 2HH3A 1U9RA 5DAUA 1TWAH 5M3MH 1AN7A 5LMUH 3OTOL 1LTTD 1PTOH 2OT2A 2I0QA 2E2IB 4OD6A 4I7ZC 1VQLA 1TU2B 1TWCB 3I4OA 4IPCA 3L2PA 3AEVB 1PRTD 3UI2A 4ZQ3A 1M90C 3E0JA 4LF4L 4LK1C 1TIID 3K8AA 4X66Q 2LRRA 3QD7X 5EPKA 2HCCA 1UUPA 3PO3G 2R92G 4X64H 4NXNL 1WCMH 5C5LA 3KBXA 4JI6H 1OXSC 2PMZE 2ANRA 3S9WA 4GOPA 1R4PB 1K9MC 2HD3A 2KHJA 1CZGA 3M4OH 2VKCA 3R3OA 2JEAI 5KNBA 1EY0A 3V96A 1PH8A 4JVHA 3A54A 3K7UC 2JA6H 1RODA 1CQFA 4BBRB 4DGZA 4HCSA 5FLXE 3G7LA 2I5HA 2FXQA 4FDBA 3M4QA 3QO2A 3I2ZA 3CC4A 4H44C 5CMDA 4JK1C 4DXGA 4WRDA 4PMBA 1Y1WG 4BXXG 1EYAA 3AYHB 3MXNA 4XYOA 4LNQA 3RNUA 3K6OA 1SDFA 4LF9L 2ZT9C 1KC8C 3HOYG 4IFDH 5JOBA 4JV5L 1B4OA 3V05A 2UUAL 4EC5A 2RHSB 1QJOA 3CQZB 4L5SA 1SEIA 1ODHA 5EKIA 1LLRD 5C3EH 5E3FA 3NE5B 2CCZA 2F4VL 1D1KA 5DLQE 4IOAA 2JJQA 5GQOA 2DUDA 4LF8L 4B9XA 4RH6A 5LMUL 1LM0A 2UUBH 1VQAA 1YNND 1HR0H 2Q2IA 1LT5D 5BR8Q 1CSQA 1X3PA 2K05A 4K2KA 2Q2HA 5C4XG 5T1IA 4LUVA 3PO2B 1ZYRD 1CI3M 4JW0A 5KYLA 1TXYA 5LL6X 1MKHA 2DNEA 2IX3A 2JZXA 3FKIB 1EEID 4A3IB 1EWHA 4J8QA 1IW7D 2IHEA 2QGQA 4JI6L 3W2DA 1SYGA 1A3TA 3BDCA 2VL6A 4DV0L 1QOHA 2N3SA 2AUJD 1YZ6A 2X6LA 1NR4A 3OOCA 1DONA 4UP8A 2VQFH 3CCQA 2WACA 1OXTA 1S5BD 4BBRH 4IJLA 4NP5A 4Y52H 4A3BB 3SB1A 4P73A 4ZUIA 2N8NA 1BUVT 1DYQA 1EU3A 4JI0H 2CW0D 3IL8A 3W1BA 2JA7H 1I6VC 3IFTA 1A8VA 4UY8C 2FJ2A 3T1YH 1O80A 4LW1A 1XNQQ 5C0XJ 3MAQA 2Z0SA 3EFXD 3SK6A 2KHSA 3SK4A 4MIUA 5I4DA 4F8MA 1KLGD 5FLXL 1ONLA 4B8CD 2L55A 1XTCD 4AYBG 3S1QH 1EIGA 1AP0A 4JYAL 4QGUA 4HIMA 4KMUC 3NWSA 1SE4A 1VQIA 3GO5A 4KD4A 2UXDL 1QE6A 5ELDA 5BN4A 2NBFA 3GTOB 3D3RA 3G4SA 1Y1VG 4IO9A 1SNCA 1JT8A 2ZJPA 4DR3L 1FYCA 1KRSA 2RHQB 3Q6SA 3VYUA 3F1ZA 2WINB 4DR5Q 3BZKA 2NVQH 4S3SA 4LFBH 2IL8A 4R4CA 3ONAB 2X06A 1WE8A 2EZVA 3BJUA 4FXDA 2UUBL 1AE2A 1CM9A 3UDIA 1B3QA 2KCNA 4JI1Q 3FPUB 3PO2H 3NWTA 3PF4A 3C1FA 3Q22A 2EYHA 1XNRQ 2DY7A 1I4XA 4YCUA 2F0VA 2K7VA 3S14H 1UE7A 3GDEA 2B39A 3OIPA 1B3AA 2JA8G 1WTHA 4MHEA 1Q12A 5CORA 1CZWA 5ELEA 4AQYQ 2N55A 5IWAQ 2I07B 2VQFL 4A3BH 1V9NA 1SNPA 5FLMG 1D5MC 2B2WC 3D0FA 1YHAA 3A0JA 4L5RC 1D7QA 4TSSA 3SVMA 4ID6A 1EY6A 4JI0L 1KDBA 2FMCA 2K5QA 3A7LA 2K01A 4JCVE 2NB0A 5I2YA 1X56A 1V1PA 2KBNA 3CU7A 1HNXH 1IL2A 2EY1A 1PRTB 4LUOA 1E24A 2EE1A 3A55A 4LAAA 4RHSA 5TSSA 2Z9HA 3CD6A 1YHQA 2JVZA 4XT3B 2M8WA 2JEBI 4R4OA 1KAAA 2P5ZX 4O0AA 2A6HC 3J81W 3E9HA 3PGZA 1LTGD 4RAUC 4DV4Q 5K36H 4AIMA 3NP8A 4DR6Q 3X3MA 3OIQA 3DM1A 3I8ZA 3RZOB 4LF7H 1Y8OB 1WHRA 2ENBA 2RBMA 3I56A 1LO5D 3M7GA 3KK7A 4LFBL 4RGMA 3AEVA 1GXDC 1X32A 4DK3C 1I4PA 4A3FH 5M5XB 4NW2A 1WTQA 2F52A 1TUAA 3T1HH 1BQQT 1PTOF 4A76A 2FHTA 2UU9H 3H0GH 2CFMA 4DV3Q 2GA4B 1G291 3GTQH 2F0NA 2WKCA 1K8OA 3RN5A 4YY3L 3TP6A 3GR5A 2MQHA 1J5EH 1FNUA 3W3AA 3K5OA 4FXKC 1FL0A 1U4MA 1T9HA 3A5ZB 4QQBX 2IWHA 4R1JA 1S3OA 5ISRA 4C56C 1BR9A 2MP1A 2PW7A 3TS2A 4KHPQ 3ND9A 1E2WA 3EBEA 2XN9C 3OYYA 2IY5B 2NTTA 1KHIA 1K28A 2Y0SB 1VBIA 1E0BA 3HOZG 2LXKA 3UDXA 1Y1WB 1QZHA 2HCIA 5E7NA 2EJGC 4IPHA 4DV6H 4G7OC 1PTOD 1HNXL 1T5XD 1J8IA 1UG8A 3LWEA 3MXPA 2Q2TA 1TY0A 1UE1A 4LWCA 2F03A 4B3TL 2A8VA 2K1HA 3VR4A 2ZXOA 5D3DA 1F9QA 3OTOQ 2F3VA 3NUCA 2KOLA 4TQUS 2F0TA 5IT9E 1VIGA 4XT1B 4LF4Q 3KBGA 1B9NA 2CWFA 3RZOH 4HSVA 2C9OA 1C48A 2FINB 4LF7L 4NXNQ 5H1SE 4DXFA 3S15B 4MTNA 3HZXA 1Q81C 1W6JA 5M5XH 3I3CA 3EN2A 4DA2A 4C2MB 1F2MA 4GKJH 2HIVA 5J3BA 4F88A 1D6EC 1LT6D 1F9RA 2VUMG 2G8YA 3IAYA 5C3EG 3V2TA 3H15A 1YBYA 2F0UA 2EY6A 2EXZA 1AN8A 3U9OA 2Y0SE 1ZEQX 2AQ2B 5IYBH 1G8ZD 1KXLA 4B08A 2F0IA 1SROA 3GTLB 3ULPA 1IL8A 5CBEE 1CKMA 5E4WC 4LF9Q 2K32A 4DAMA 4JV5Q 1O7ZA 2CTEA 1K8MA 4IUTA 4L6TB 3LX0A 2F4VQ 4BBRG 3U4ZA 5JPMC 1IKMA 2MJHA 4LF8Q 1F9PA 2B8FA 5L37A 5LMUQ 2YTYA 1Y1VB 3J80i 1HR0W 1CUKA 2E75C 2B2YA 4WALA 2D2CC 1SNMA 3EIVA 2R3ZA 3S24A 2BE5D 1X6OA 4DV2H 1XXGA 3I90A 1TT2A 4KD3A 2QILA 1MI2A 5KYIA 1X9NA 2N88A 3K5NA 1QB5D 1J9OA 3C1EA 1GUWA 1B9MA 4JI3H 4JI6Q 1PH4A 3FP9A 5EBCA 5JVH3 4NKLA 1P16A 5IT9L 5CV7A 5A2QE 3S1MH 2VS1A 3ERSX 1YNJC 4DV0Q 1WTXA 3T13A 3N6RA 5NUCA 4GKJL 1EFID 1VQ8A 3U50C 3QJYA 2XWJB 1Q46A 2KECA 1H9KA 1SYBA 3RF2A 1WYDA 3I4NB 1PZJD 4KI0A 4A3EB 3URYA 1GHKA 1GUOA 1PFSA 3KLRA 3CW2C 1HCZA 3PUWA 1L0YB 1PZKD 2B2VC 1F9SA 2AWOA 4DR2H 3PO2G 2YYZA 2Z4IA 4DN4M 3G6JB 1O7IA 3EQLC 3T16A 5GAHC 1YIJA 4IJHA 4X6AH 4OXPA 4RCOA 4C3JH 2R7ZB 4IOCA 2F3IA 2JA5B 3WDNA 3FKIG 4A3IG 1HJPA 2IJ0A 4JYAQ 3DEPA 1U4LA 4U673 1ZZIA 3M85A 2UXDQ 1EWCA 4BWGB 3NSWA 1FVIA 3FAUA 2N78A 3VR6A 3MA2B 2ATWA 4DR3Q 4OIJA 4HEDA 4DAPA 2ZM6H 5DM73 2EY2A 4A3BG 2M2LA 5JVG3 3JAME 1SRUA 1WI5A 4OGQC 3HOWB 1VQGA 2HDLA 2UUBQ 2TSSA 4K5VA 1DCZA 1TY2A 1IHZA 5EKKA 1K83B 4ULLA 3NHHA 1CKNB 1LUZA 3CCVA 3HOUB 5JJLA 3CMAA 5HGQA 2NN6H 5JEAJ 1A3VA 3VYRA 3BYYB 4C3IB 2ZXRA 4FP5D 3SEBA 3U4VA 1NUCA 2K6AA 3CF5A 1UEAB 2K5HA 1YJNA 4JI3L 3S2HH 3J81E 1FKAH 1DXMA 1HFGA 1W6KA 4KN7C 4WJWA 4LF5L 5K36G 1R9TH 2VQFQ 4RGOS 3L0OA 2LKVA 5M3MB 2MFIA 4QMFB 2BCOA 2MO0A 1KNAA 3RZDH 1H95A 1L0XB 5C0XH 1NY4A 5IGGA 5I2XA 1S5ED 2A73B 1MD2D 5A2QL 3RN2A 2PZUA 2B2UC 5F2DA 2KENA 3SK8A 4OL7A 5LMNW 4WJ4A 4A3FG 4KY6A 2OQKA 1ENCA 5M3FH 3CC2A 4O1NA 5I9PA 1N33L 1AH9A 4DUZQ 5I6WA 3TS0A 1I3QB 2EYPA 1BCPC 4DR2L 1PH9A 4RMFA 1WCMB 5C4ZA 4JBWA 1EYDA 4K6DA 1LTAD 2R7ZH 2A6EC 3J7AK 1KABA 3M4OB 1MJCA 1KD1C 1VQCA 4LFAL 3U9SA 3STBC 1N36H 4RA8A 4RKLA 4ZKCB 2JA6B 1SE8A 3NENA 1X3FA 1ICFB 1DGSA 2IPKD 1F2LA 1KNEA 3DUZA 3MVVA 4HIDA 2YV5A 1NR2A 2ZM6L 3SGIA 1JMCA 4XDXA 1SYFA 1PRTF 1HPCA 4L63B 1X54A 4LFBQ 1EUJA 3RLOA 2RF4A 1Z2IA 2IW3A 4BA1I 1L1OC 1XX8A 3AFPA 5IOCA 4UP9A 2EYFA 2OTLA 5IP9H 4PV1C 5LHY1 1VMCA 2O2LD 1ET9A 1STEA 2WIIB 3Q0AA 3FPPA 2A68C 1SLJA 4R8NA 2OTJA 3CXCA 4C3IH 1N34H 3H91A 3JAML 2NVTH 1X55A 4YY3Q 1GUTA 4ZRZA 4N9TA 2ZTEA 4TRDA 4DR7H 4IUVA 2AXYA 4TVAB 4QF4A 3KJOA 3CRLC 2NVXB 2QEJC 1IYJB 5C3EB 2UXCQ 4EQ5A 5BN3A 1E22A 1VDZA 3OHXC 2SNSA 2Q8IB 1XTDA 1VQ4A 1PHJA 4ZCKA 2HHHH 1N9WA 2CH4A 3RUZA 3CCUA 3D31A 5BN5A 3J81L 1I5FA 3J80c 3BS1A 1X4MA 1H9SB 3CCSA 1ML0D 3TP8A 2D0PA 3NK9A 2UUCL 2CHBD 1SXTA 2AHOB 1HNWQ 2WV6D 4UDUC 2E2JH 1VQPA 1I3QH 1HNXQ 3PIPA 3J7ZC 3K7AH 2E76C 1JQYD 1EYCA 4B3TQ 1VQDA 4KJOA 1QZGA 2G9HD 2R7FA 3H94A 3HOXH 1M4VA 4K0KQ 2NZOA 1UAPA 1JE5A 3M7NA 4DK6C 1N36L 1X3EA 5C3XA 5I6YA 2CVRA 4BBSH 1EQRA 4G4KA 4OO1H 2F0FA 3A8JE 1NCVA 4X3SA 4YIJA 5C4HA 2O4XA 1K1GA 4PDBA 4LF7Q 2JA7B 5FJ8G 1BXTA 1PLFA 3HKZB 1PH5A 3KLWA 1DD2A 2A6HD 1SJHD 2Y0SG 4Y7NH 2B63H 5IGFA 1WD1A 4A75A 2E2DC 2VZAA 3RD4A 1ASYA 1O7LA 2YTVA 2XVSA 4N8X1 3K5LA 2JP1A 3S1QB 1STAA 3A7AB 1OXUA 2V1CC 3BU2A 3BVGA 2CTFA 2PW5A 4DR7L 1IBMQ 2NVXH 4YHHH 1Y8NB 4A3LH 3EA6A 3ULLA 4X62H 3DEOA 1HA6A 2K5DA 4ZLTF 3AB9A 2NVQB 1A3UA 2A1SA 1LTRD 3G71A 2HHHL 3NTHA 4NPSA 1ESFA 3GTGB 4QIWB 3NEMA 1B53A 4A3KB 2B2TA 1XWEA 2JA9A 4OCHA 2YQRA 2A1AA 3Q24A 4BY1H 2DNCA 3M3YH 1XPOA 3A74A 4X64L 2O4CA 3S14B 2Z1CA 1N8RC 5IE8A 4JI5Q 4JI7H 1HNZH 2YTXA 4EQNA 1NJIC 1ZZJA 4UP7A 2FFMA 3HKZE 3HGBA 2XWBB 3KYHC 1IBKH 1PZID 4Z9CB 1UWVA 4H8AA 1EIFA 2F0GA 2VQEH 1G2SA 2BH2A 2DY8A 4ILWA 1E3PA 3BZDB 5C4JB 4XQQA 1K3RA 4ZKBB 2M9VA 2BL5A 1PFMA 2MPMA 2VB3X 3T4AC 3UOEA 2LSSA 1GVPA 1HZCA 1RKNA 4N9PA 1BOSA 1KAWA 4UAIA 3D4DA 1Q1BA 4JI4H 2BH8A 5CGKA 1TS3A 1CKNA 2WP8J 1CSPA 3A5UA 3M4YA 2P2RA 2ZXPA 3OMGA 4GKJQ 4JOIA 4GLXA 2FMMA 5E4XA 4DNIA 2AKWB 1EZ6A 2K50A 2EQSA 5FLXc 2CPMA 1VQMA 4GNXC 4QIWE 4YWMA 3GV6A 5C44H 1YI2A 4G57A 1STHA 2CTLA 3PQIA 1I6UA 1M1KC 1TS2A 2F0LA 4YWKA 5DT9A 1SNQA 1GJXA 4X62L 4V190 3S17H 2PNRC 3KF8A 1S40A 3CCMA 4IPDA 5IP7H 2NN6G 3KOJA 3GTGH 1I94H 3UDGA 2VB2X 5FK9C 3PIOA 5EQ0A 3IKJA 1YJ9A 4DU9A 1HR0L 4A3FB 2OQ0A 4A3KH 1PH3A 2J4XA 3MFYA 3I55A 3HS0C 3PCOB 4HSPA 2LS01 3X3NA 1FJGH 1STYA 2AWNA 3H0GB 4F7XA 5CV6A 3GTQB 4MTKA 2RDGA 1V8QA 4NB3A 4KJNA 1IZ6A 1JR0D 4JI7L 3BYTB 1L2FA 3E0EA 2K14A 3I4NG 4A3EG 4B3MH 1JWSD 1GHJA 4ABNA 3VR2A 2VQEL 5D14A 5C4JH 4HMIA 3QB3A 1PVOA 4IFDI 1PRTC 4RFBA 4A93H 4XXEA 2OCEA 1SSOA 3T56B 1SNDA 2QNDA 2R7ZG 4B3SH 5FO8B 2JA5G 3T1YL 3L3OC 4OWTB 1W3SA 5HURA 5LMNH 1SMXA 2JYOA 1DT4A 4JI4L 2Z6KA 1PYSB 2QDBA 2EDGA 4FF1A 3NBIA 4JI8H 1BF4A 1IBKL 5GAGC 3GD7A 4M8AA 1QUQB 3J7AF 4A3GH 4IALA 2QCPX 3W1GA 4LF5Q 1RL2A 1ET6A 2Z8LA 2NWGA 2DN8A 1K73C 1JB7A 2VXWA 5C3WA 1ILQA 4X66H 3HOWG 4TKOB 3WOEA 4A3CG 3J7A5 1NNXA 1SFOH 3KDFB 1N33Q 5JAVA 3J80W 5M5YH 3SE0A 3HOUG 4DR2Q 1ASZA 1YNJD 1HQMC 1YITA 5G3LD 3IFDA 1A2TA 4C3IG 3PUZA 3F2DA 2WAQE 2F0JA 2Q8RE 2EYJA 1H9SA 2RSNA 2HH2A 1NE3A 2SOBA 4LFAQ 1MBYA 1MSHA 3MTSA 3GABA 3I0PA 3K81C 1I50H 2F1MA 1FJGL 4DV7H 2D62A 4RKBA 2F0PA 2ZM6Q 5M3MG 4APVA 4CKEA 2RCNA 3BDLA 2AMCB 2GN5A 2H5XA 4DNTB 1PYBA 3SDZA 4B3ML 1NBWA 4K8JA 2A5HA 3F2CA 5IYDH 5JEAH 4CJ1B 4HJAA 2LY7A 1IYVA 4R8IA 4POGA 3HOVH 4O42A 2XIWA 4KHZA 4NMZA 4EGVA 1KL9A 4HJ9A 5D3IB 3EROA 1WCMG 2K04A 1SAPA 2PYKA 4C3HB 3PIO3 2G5DA 4B3SL 2A19A 4RGTA 4DR1H 2J0TD 2DJGC 1CTMA 4HN7A 5LMNL 4CDDC 2G9DA 4R9WA 3V69A 4JI8L 1IW7C 2B29A 2JA6G 2H4OA 3GTKH 1YVCA 2K52A 3VA7A 3TQYA 3RR5A 4KTAA 3ERQA 4N8FA 3W5OA 4K5WA 5BR8H 2XGTA 3LWUA 3S1RH 2NTSA 1EY5A 4GKKH 2UUCQ 2HQLA 1HZBA 1WTPA 2CTKA 5DEHA 2KCCA 4FJSA 4ME3A 4LIJA 4A3DB 3TZDA 2CQOA 2E5LH 5KGUA 5IGDA 2A74C 1O78A 1VQNA 2K1BA 1U0LA 1XPRA 3A8KE 1HZAA 1JB3A 4MNOA 3MXUA 3BVZA 4IFDG 4FJUA 3S1MB 5DNFA 2L0CA 2KEDA 4HAEA 1BBXC 3T1HL 1VQ9A 3FRPB 3T51B 2UU9L 4IURA 2O5IC 3B6YA 4ALPA 4DV7L 4A3LG 1CT1D 2IX1A 3H3VC 1QNUA 1SEBD 3BG3A 5FOBB 2CTJA 1J5EL 3GTMH 1BCPD 2V4DA 4HTHA 4GOPC 1S5DD 2A69C 4KKSA 3P75A 2A6ED 3ZYYX 3PO3H 2R92H 2XRSD 1S72A 1SYDA 1RTNA 1YNXA 1Q86C 3STBD 5IYCH 4JI2H 4C3JB 1RF2D 1PH2A 1WTJA 1B1ZA 2OPVA 3K80C 4C3HH 4HR7B 1P8LA 3SR1A 1LTBD 3I4MB 1BKBA 4DR1L 4PQXA 2UUAQ 4BY7B 4DV6L 2IHFA 4DR5H 5FLXW 1Q82C 2CWHA 1NSNS 3HRZC 1KHMA 1EOTA 2MJ8A 1EY4A 5BR8L 2HHHQ 2E3UA 4JI1H 1EY7A 1NTGA 2A68D 3BZCA 4WORA 3HKZG 4H0LC 4XQJA 2JA7G 1HUNA 3BVMA 3FDTA 4K14A 1G91A 1XNRH 4BXXH 4GKKL 4DV1H 4RGNA 1ZKOA 3KJPA 4DAYB 4LJZC 3TP5A 5CBAE 4A3DH 1BDOA 3L7ZC 1FNWA 2EYLA 3TSSA 4X64Q 4X65H 3HOYH 1Z7TA 2E5LL 1B44D 1VF7A 1I4HA 1PFBA 1PFNA 3I4LA 4O2DA 3C3LA 3S2HB 2M00A 4QY7A 1AZPA 1A0IA 1KTKA 4FF3A 1DTJA 5IWAH 4G7HC 2PCFB 2K28A 3NXWA 4DV5H 1R9TB 4WFN3 5IT9c 4JG2A 1Z47A 3BDOA 4UHVA 3WOFA 3RZDB 1HA5A 3PUYA 1HUMA 4CKBA 3IRBA 2D0OA 5C4XH 2KUMA 1G51A 1FGBD 3NELA 1TWFH 1PA6A 1VMPA 4KN4C 5M3FB 4A3KG 1V8CA 1VQEA 4DK1A 1JOOA 2L1BA 4EQPA 4JI2L 3EZJA 1BBWA 4DV4H 5IGCA 4DUYH 2DJFC 2EXDA 3I4MH 1ENFA 2B8GA 4BY7H 4QUFA 3OSSD 1FNVA 4A4IA 3S2DH 4EVOA 1A62A 4NXMH 1EY9A 3H3VH 1QUQA 4DR5L 1SMYC 1WTVA 1RIPA 3AU7A 4IUPA 4I65A 3R2IA 3PUVA 2F0KA 3D4WA 1ZTGA 5M5WH 1D8LA 2VW9A 4CBVA 1HR0Q 4JC0A 1XNRL 4CGYB 2B2WA 4DV2L 1V1OA 4DV1L 1NMFA 3KDFA 1ZZKA 4L5TA 2E2HH 1LT3D 3Q8DA 2K33A 4DK0A 1MSGA 2SNMA 1HRJA 4RWSC 2NVTB 4X65L 1UEBA 2ANNA 1JJGA 1NXUA 1PTOC 2KA7A 2I46A 1EYGA 4JI7Q 1CA6A 1TWGH 5GROA 2R7DA 4KHPH 5AFWA 4HMJA 5ELNA 1GUGA 3P1HA 1EQTA 4IUNA 1XPUA 2VQEQ 2MGSA 3OWEB 4DV5L 5EJWA 1DZ1A 1V43A 4DR4H 3PMFA 3TRZA 3J7YW 3RLFA 2Q8TA 4JI0Q 3UDFA 2PT7G 1F77A 1AE3A 2F0SA 3AQQA 3MZ5A 4LF6H 3T1YQ 4LFCH 1SYCA 3MEHA 5KNCA 3NQTA 4B8TA 1Y8PB 2EYMA 2PI2E 2E2JB 3DXJC 4JI4Q 1X9ZA 4OEMB 1MIUA 3H0GG 1CK1A 3OTOH 3K7AB 2GVAA 4PG3A 2FPHX 2Y3MA 1LYLA 4DV4L 2ZTCA 5E1FA 4DUYL 1II3A 4P2CB 3HOXB 2JK8A 1Y14B 1X0AA 5FLMH 2KEEA 4BBSB 1K8AC 2LMCB 4NXML 5IYDG 4NDXA 5ELOA 1X4NA 3VR5A 3AFQA 2K5WA 2R61A 3MFGA 4DAVA 2HIXA 2QW7A 4Y7NB 3VR3A 1BCPB 3CPWA 2B63B 3FHWA 3QWNA 1AZQA 3MWYW 1KDCA 3M4PA 1FJGQ 1DM0B 4CKCA 1PH6A 1WTRA 2F0HA 4EQOA 1VQ6A 3FEWX 2R6GA 3RMHA 1H9MA 1DOMA 1E1OA 4R4IA 3JAMc 3J81j 4G7ZC 4KHPL 4LMQD 3E6ZX 5M9OA 5AJ3L 1SN8A 1MJEA 2RDHA 3KUPA 2ICIA 1I6HB 4J6HA 2YU9H 2PNHA 2KCMA 3ND8A 4DR4L 2TMPA 5GADC 1L1OB 4UPAA 4JV5H 4FF2A 3ER0A 2B3GA 2ASBA 4B3SQ 2BA0A 1K3BC 2ALYB 4PMCA 4LFCL 4LF6L 4HIOA 1W2BA 4BY1B 3J81c 5LMNQ 2F4VH 3M3YB 4FO2A 4JI8Q 3J80L 4QL5A 4RG1A 3LNNA 3E3XA 4ME5A 4ODGA 4LF8H 3K5MA 1VCIA 1B70B 1EY8A 3P20A 2PQAB 2M6QA 3I73A 1JE4A 3OMCA 3TZUA 2R93B 2NN6I 3P7JA 4PZ7A 1IYUA 1QVFA 3AMUA 2C35B 3PUXA 4L8JA 4B3RH 1GKHA 5IYBG 1N32H 2KHIA 4Q0FA 4RHRA 2L5TA 1CHPD 2WFWA 4DF7A 1U5KA 1PH1A 1LV9A 3PV0A 1RHPA 1SJED 5IYCG 3CMEA 3HOZH 1SE3A 2Z6BA 1Z6HA 4DV0H 4C3HG 4GN4B 1D2BA 4JBJA 1CHQD 1C4QA 3Q23A 1IBLH 3CPFA 3T1HQ 4QUCA 4DAYA 5C0XI 4IPGA 2Z4HA 2UU9Q 2F0MA 1ESRA 3C2PA 1LTSD 1N34L 4DV7Q 1C8CA 1ZXTA 1OXXK 1K0RA 1J5EQ 1XMQH 5IT9W 1BO0A 5C44B 1IKLA 4J15A 2PZTA 1Q7YC 1B7YB 3I72A 3GTPB 4J1MA 1YEZA 1I6HH 1VQKA 1ICWA 1NAPA 3CC7A 3S17B 4E6IA 1TWHH 3G48A 2L4NA 1XRHA 4CHTB 3D8GA 3KDKA 1KRTA 3U1KA 3D6CA 2EVBA 4PNYA 4A3DG 4JYAH 2UXDH 3S1NH 3N52A 1SYEA 4R4TA 3DHQA 3M9BA 4ZK9B 4WANA 2L12A 4DR3H 2VUMH 4DR1Q 4P74A 1S5FD 3CCRA 4DV6Q 2F3WA 2CWAA 1TS5A 4K5XA 1VQ5A 1XMOH 1WJJA 1G2TA 2E2IH 1SNOA 2AQ3B 2CPQA 5ELBA 1TKWB 1TWCH 2OXPA 2OWOA 3RLNA 3KF6B 2CWPA 2QF7A 2R93H 5JJZA 4IN3A 4HCEA 2F4IA 1UE5A 1A6XA 2PI2A 3NPPA 4GKKQ 4B3RL 4OONA 1N32L 2UXBH 4A93B 1A15A 2ID0A 3TDQA 3EJIA 1EFWA 1JC7A 4V0BA 3CAMA 4C3JG 3I91A 2WB1B 2E5LQ 1U4RA 4LUZA 4C1NK 3OW7A 4GZYC 1E1TA 2B2VA 4OX9H 1PYWD 2B2YC 3I4MG 3TBIB 4A3GB 4BY7G 2EOTA 2NZ1D 1IBLL 3PIP3 2PY9A 1STBA 2CTMA 4QCLA 1A2UA 2BOSA 3SHLA 4DKAC 1XMQL 1ENAA 4YHHL 4DUZH 1SFOB 3GTPH 4X3TA 2L15A 1EU4A 4DFAA 3VYSA 2RDFA 5M5YB 4R4QA 2NZHA 4X3UA 1VQOA 5IIFA 4H02A 1LACA 4CJ2C 2CH4W 1VF5C 3O13A 4PZ6A 3G6EA 4JI2Q 3A56A 4XQNA 1BVSA 4OO1I 1B8AA 5A2QW 1WVLA 5CV9A 3I70A 3CQZH 1EQVA 4AM3A 1I50B 3TREA 4KHVA 2A69D 2EJMA 2JSOA 4K8IA 1CQVA 4KKUA 5I9OA 4OWWB 3C46A 1TR5A 1XMOL 1TQOA 2WAQB 4GNXB 1HNZL 1HTPA 2MUYA 4HJ8A 3TEHB 2WB1E 5C0XG 1G6PA
chains in the Genus database with same CATH topology
1HHVA 2H1EA 2SDFA 1J4WA 1R4QB 2EJFC 3GV3A 4DV2Q 3T53B 4MZ9A 4DV1Q 5FO7B 3HOVB 5M3FG 1AEXA 1JWMD 2UXBL 2KCTA 5G3LF 2KQ3A 3FKIH 4A3IH 4U68A 5LL6S 4X65Q 2B2UA 1H9JA 4Q5VA 1B2TA 4OWXB 4FF4A 1X65A 3CHBD 4JI3Q 3KFUA 4WJ3M 5EKLA 4OX9L 1RCVD 1EOVA 3CCJA 4A3JB 5JJIA 3TN2A 3GTKB 1LTLA 1RTOA 3PSIA 4KY7A 4DV5Q 3HEJA 4HJ5A 1S4ZA 1I4RA 2GVBA 3MXGA 4QJFA 5CR3A 1VQBA 3PF5A 3S1RB 2JE6I 4A3MB 1VQHA 3FVQA 4DUZL 2OF1A 3K59A 1J6QA 1RJTA 5IP9G 2VNUD 4DNRB 1I94L 2NUCA 5IY0A 1L1OA 1QWYA 4ZUJA 3ICEA 2PO4A 2NYZD 3GTOH 3NBHB 2DGRA 4DUYQ 4FXGC 1GO3E 4QMGA 1VQFA 4XYQA 3NTIA 3OWFA 2F0DA 3U58A 4NXMQ 1Z9FA 1O7YA 2EY5A 1GUSA 1MGSA 1NMGA 5JPNC 4GLVB 4MN3A 3NTKA 2PQAA 3GTMB 5FO9B 2X69A 3PO3B 2R92B 1GM5A 3VKEA 2HDMA 3QG1A 1YNNC 2X6GA 4H7BA 4C1NI 5KNDA 2QEXA 1KIXA 3NQIA 3QOLA 1ZYRC 1T5EA 1WFQA 1SMYD 2ZTDA 1HZ9A 1J5KA 4IFDJ 1D5ZC 1L0WA 1VQ7A 3HOXG 3F8TA 1WVNA 2JXMB 2UXCL 4P71A 5DM63 4A3JH 4FYDA 1A63A 4JVYA 4BBSG 5AJ3Q 3VYTA 4FVMA 4OO1G 3KLSA 3CP0A 1EQQA 4DR4Q 1BCPF 3H09A 2ICEC 4HIKA 4A3MH 4P75A 1OO9B 2PZWA 4X66L 1SR3A 1HNWL 3EVQA 2CW0C 4GN5A 4LFCQ 4LF6Q 3VA5A 2DGYA 1C7YA 2B63G 5A35A 1PDQA 1FGUA 1GD7A 5IODA 3HOYB 3H6MA 3S16B 1WD0A 3LGJA 1LT4D 1GUNA 1QCBD 3K0XA 3F2UA 4K0KL 1KQSA 3HP3A 3TP7A 2E74C 1F2YA 1N36Q 2SEBD 1M8AA 1EZ8A 2RQXA 1DOKA 2RSOA 1V9PA 1KLUD 1PXUA 5CV8A 4GN3B 2RVLA 4PZ8A 3HFZB 1Y69U 2VY3A 1GOZA 1DOLA 2CKZB 1OXVA 1VQJA 5C4XB 3KF6A 4BS9A 2MO1A 1LTID 3KLSX 2NVYB 1TWFB 1CKOA 3F2BA 3OW2A 3D4RA 3OSOA 2XTIA 5HY6A 5CYUA 2KJXA 2FMRA 4BY1G 4XTCS 5EPLA 4K6LA 1XYIA 3E9IA 3CCLA 1JOQA 5JJKA 5COYA 2MNAA 1N34Q 3ITPA 3TMEA 3DMUA 1HTLD 1Q8IA 1IBML 3JAMi 2C5CA 4DR7Q 2R93G 4YCWA 1SBBB 3E5SA 4CJ0B 2Q2UA 3S2DB 2ZJRA 1VIHA 5C6AA 2K03A 5FJ8H 1EIHA 3MEFA 4ZYSA 4GOPB 1BBUA 3UE0A 1CFMA 1JWUD 1TVXA 5CV4A 5M5WB 4KY5A 1Y1WH 2ES2A 1EL0A 3GTJB 1PV4A 3J81i 3OPOA 2RA4A 2E2HB 1IXRA 3FMCA 4AYBB 3ZJYC 1CA5A 1S5CD 4JI5L 1Q1EA 3S16H 4YCVA 2ZJQA 1TWGB 3VDYA 2JQOA 1ILPA 5C44G 2B2TC 3R2TA 3CCEA 2KVMA 4KV6A 3MXNB 1UNSA 2FFKB 4B3RQ 2RKSA 2OPUA 5J1ZA 1N32Q 1YJWA 2F0EA 2XRQD 2IX0A 4DPGA 4GLAC 2EYOA 3S15H 4GNXA 5IP7G 4OHJA 5D65A 4IQZA 1XNQL 2N49A 2F0OA 4BA2I 1QILA 1FR3A 4HJ7A 2NVYH 2K4KA 4C2MH 3HKSA 3DWAA 1EC6A 2HQEA 3R93A 5K5PA 1HXYD 1Q8KA 3GQBA 1IBLQ 1QVGA 2JA8B 1K8GA 2HT1A 2MHVA 4POFA 1C0AA 4X3KA 3GP7A 1I4GA 2PQEA 3L9AX 5ELFA 1X3GA 1D5XC 1JOKA 1SE2A 4K2LA 1XMQQ 1E7ZA 4YWLA 1RDPD 4ZAIA 4YHHQ 4FNFA 3DLLA 1E2ZA 3CKIB 3GTLH 4X62Q 2XSCA 1VS0A 5EBDA 1AW7A 4AYBE 1PH7A 4A93G 1EEFD 2BA1A 4JOIC 3R8BA 2F0QA 4IUUA 5CC4A 5CV5A 2L11A 4F87A 3DM3A 5EAYA 4JI1L 5KIXA 2WB1G 3GTJH 4JBKA 3K0YA 1G6ZA 3K57A 3J7AV 2BDOA 3A8IE 4L5QA 4A3GG 3SXHA 1OTCA 2O5JC 1XMOQ 3UE1A 2D9UA 1QG7A 1Y1VH 1YHBA 4AQYL 5IGEA 1HNZQ 2BDNA 3NBHA 2D5DA 5IWAL 1IBKQ 4OIKA 1AFPA 5HGTA 2LFNA 2CQAA 1V1QA 3D6WA 1FD7D 2YU9B 5FKAC 3J80E 2IT1A 2K5NA 5EGTA 2E8GA 4RCNA 2UXBQ 1HH2P 1DJRD 2EIFA 2PPBC 1I4QA 5GAEC 1PMRA 4JBMA 2OEOA 1JCKB 2J7ZA 1LABA 4NBQA 1B50A 3K58A 1F2ZA 4OX9Q 1HQRD 3QIAA 4QB4A 3WWVA 1TWAB 2JA8H 3KF8B 4KKTA 1Q3LA 2LXJA 1PTOB 1EIYB 5EPJA 5J22A 2WKDA 4A3EH 3I4NH 1EWIA 2WAQG 1BNZA 2EPBA 4DR6L 3I7FA 2L9HA 5KRUA 1STGA 4IUQA 2XNAC 5JEAG 2Z6KC 2I5LX 3HOVG 5ELCA 5IGBA 2JA5H 2K5VA 1H9RA 3HOZB 4H13C 1WTOA 2QA4A 4PMWA 1I94Q 1X3QA 1WTWA 1JJCB 2AQ1B 3MC0B 4IZ8A 1E2VA 2QKIC 5C5MA 1Q90A 3DWPA 4DV3L 4P72A 3SK5A 2AUKA 2PMZB 4M1UB 3JC66 1UE6A 4A3JG 1D1IA 4XIGS 3HOWH 1V1PB 1U4PA 4A3CH 5T1GA 2HUGA 2F0WA 1RD9D 1QVCA 1K83H 4B3MQ 4KLKA 4A3MG 1STNA 1HFNA 2PQUA 3HOUH 3QOJA 4KK7A 4EX5A 1TWHB 3ULJA 1C9OA 1TS4A 3MHBA 1QNKA 1JICA 4AH6A 2K75A 2I5MX 2BE5C 5J39A 1JORA 3HG9A 5KEEA 3H3VI 1XJVA 3S1NB 4B9WA 1JJ2A 4GS3A 1WOCA 3DWQA 3CRKC 1KDAA 2VUMB 2HH3A 1U9RA 5DAUA 1TWAH 5M3MH 3OTOL 1LTTD 1PTOH 2OT2A 2E2IB 2I0QA 4I7ZC 1VQLA 1TU2B 1TWCB 3I4OA 4IPCA 3L2PA 3AEVB 1PRTD 3UI2A 4ZQ3A 1M90C 3E0JA 4LF4L 4LK1C 1TIID 3K8AA 4X66Q 5EPKA 2HCCA 1UUPA 3PO3G 2R92G 4NXNL 5C5LA 1WCMH 3KBXA 1OXSC 2PMZE 2ANRA 3S9WA 4GOPA 1R4PB 1K9MC 2KHJA 1CZGA 3M4OH 3R3OA 2JEAI 5KNBA 1EY0A 3V96A 1PH8A 4JVHA 3A54A 3K7UC 2JA6H 1RODA 1CQFA 4BBRB 4DGZA 4HCSA 5FLXE 3G7LA 2I5HA 2FXQA 4FDBA 3M4QA 3QO2A 3I2ZA 3CC4A 4H44C 5CMDA 4JK1C 4DXGA 4WRDA 4PMBA 1Y1WG 4BXXG 1EYAA 3MXNA 3AYHB 4XYOA 4LNQA 3RNUA 3K6OA 1SDFA 4LF9L 2ZT9C 1KC8C 3HOYG 4IFDH 5JOBA 4JV5L 1B4OA 3V05A 2UUAL 2RHSB 1QJOA 3CQZB 4L5SA 5EKIA 1LLRD 5C3EH 5E3FA 3NE5B 2CCZA 2F4VL 1D1KA 5DLQE 4IOAA 2JJQA 5GQOA 2DUDA 4LF8L 4B9XA 4RH6A 5LMUL 1LM0A 1VQAA 1YNND 2Q2IA 1LT5D 5BR8Q 1X3PA 2K05A 1CSQA 4K2KA 2Q2HA 5C4XG 5T1IA 3PO2B 4LUVA 1ZYRD 1CI3M 5KYLA 5LL6X 1TXYA 2DNEA 1MKHA 2IX3A 2JZXA 3FKIB 1EEID 4A3IB 1EWHA 4J8QA 1IW7D 2IHEA 2QGQA 4JI6L 3W2DA 1SYGA 1A3TA 3BDCA 2VL6A 4DV0L 1QOHA 2N3SA 2AUJD 2X6LA 1YZ6A 1NR4A 3OOCA 1DONA 4UP8A 3CCQA 2WACA 1OXTA 1S5BD 4BBRH 4NP5A 4IJLA 4Y52H 4A3BB 4ZUIA 4P73A 2N8NA 1BUVT 1DYQA 1EU3A 2CW0D 3IL8A 3W1BA 2JA7H 1I6VC 3IFTA 1A8VA 4UY8C 2FJ2A 1O80A 4LW1A 1XNQQ 5C0XJ 3MAQA 2Z0SA 3EFXD 3SK6A 2KHSA 3SK4A 4MIUA 5I4DA 4F8MA 1KLGD 5FLXL 1ONLA 2L55A 1XTCD 4AYBG 3S1QH 1EIGA 1AP0A 4JYAL 4QGUA 4HIMA 4KMUC 3NWSA 1SE4A 3GO5A 4KD4A 1VQIA 2UXDL 1QE6A 5ELDA 5BN4A 2NBFA 3GTOB 3D3RA 3G4SA 1Y1VG 4IO9A 1SNCA 1JT8A 2ZJPA 4DR3L 1FYCA 1KRSA 2RHQB 3Q6SA 3VYUA 3F1ZA 2WINB 4DR5Q 3BZKA 2NVQH 4S3SA 2IL8A 4R4CA 3ONAB 1WE8A 2EZVA 4FXDA 3BJUA 2UUBL 1AE2A 1CM9A 3UDIA 2KCNA 4JI1Q 3FPUB 3PO2H 3NWTA 3PF4A 3C1FA 3Q22A 2EYHA 1XNRQ 2DY7A 1I4XA 4YCUA 2F0VA 2K7VA 3S14H 1UE7A 3GDEA 2B39A 3OIPA 1B3AA 2JA8G 4MHEA 1Q12A 5CORA 1CZWA 5ELEA 4AQYQ 2N55A 5IWAQ 2I07B 2VQFL 4A3BH 1SNPA 5FLMG 1D5MC 2B2WC 3D0FA 1YHAA 3A0JA 4L5RC 1D7QA 4TSSA 3SVMA 4ID6A 1EY6A 4JI0L 1KDBA 2FMCA 2K5QA 3A7LA 2K01A 4JCVE 2NB0A 5I2YA 1X56A 1V1PA 2KBNA 3CU7A 1IL2A 2EY1A 1PRTB 4LUOA 1E24A 2EE1A 3A55A 4LAAA 4RHSA 5TSSA 3CD6A 1YHQA 2JVZA 4XT3B 2JEBI 4R4OA 1KAAA 4O0AA 2A6HC 3E9HA 3PGZA 1LTGD 4RAUC 4DV4Q 5K36H 4AIMA 3NP8A 4DR6Q 3X3MA 3OIQA 3DM1A 3I8ZA 3RZOB 1Y8OB 2ENBA 2RBMA 3I56A 1LO5D 3M7GA 3KK7A 4LFBL 4RGMA 3AEVA 1GXDC 1X32A 4DK3C 1I4PA 4A3FH 5M5XB 4NW2A 1WTQA 2F52A 1TUAA 1BQQT 1PTOF 4A76A 2FHTA 3H0GH 2CFMA 4DV3Q 2GA4B 1G291 3GTQH 2F0NA 2WKCA 1K8OA 3RN5A 4YY3L 3TP6A 2MQHA 1FNUA 3W3AA 3K5OA 4FXKC 1FL0A 1U4MA 1T9HA 3A5ZB 4QQBX 2IWHA 4R1JA 1S3OA 5ISRA 4C56C 1BR9A 2MP1A 2PW7A 3TS2A 4KHPQ 3ND9A 1E2WA 3EBEA 2XN9C 3OYYA 2IY5B 2NTTA 1KHIA 2Y0SB 1E0BA 3HOZG 2LXKA 3UDXA 1Y1WB 1QZHA 2HCIA 5E7NA 2EJGC 4IPHA 4G7OC 1PTOD 1HNXL 1T5XD 1J8IA 3LWEA 3MXPA 2Q2TA 1TY0A 1UE1A 4LWCA 2F03A 4B3TL 2A8VA 3VR4A 2ZXOA 5D3DA 1F9QA 3OTOQ 2F3VA 3NUCA 2KOLA 4TQUS 2F0TA 5IT9E 1VIGA 4XT1B 4LF4Q 3KBGA 1B9NA 3RZOH 4HSVA 2C9OA 1C48A 2FINB 4LF7L 4NXNQ 5H1SE 4DXFA 3S15B 4MTNA 3HZXA 1Q81C 1W6JA 5M5XH 3I3CA 3EN2A 4DA2A 4C2MB 1F2MA 2HIVA 5J3BA 4F88A 1D6EC 1LT6D 1F9RA 2VUMG 3IAYA 5C3EG 3V2TA 3H15A 1YBYA 2F0UA 2EY6A 2EXZA 1AN8A 3U9OA 2Y0SE 1ZEQX 2AQ2B 5IYBH 1G8ZD 1KXLA 4B08A 2F0IA 1SROA 3GTLB 3ULPA 1IL8A 5CBEE 1CKMA 5E4WC 4LF9Q 2K32A 4DAMA 4JV5Q 1O7ZA 2CTEA 1K8MA 4IUTA 4L6TB 3LX0A 2F4VQ 4BBRG 3U4ZA 5JPMC 1IKMA 2MJHA 4LF8Q 1F9PA 2B8FA 5LMUQ 2YTYA 1Y1VB 3J80i 1HR0W 1CUKA 2E75C 2B2YA 4WALA 2D2CC 1SNMA 3EIVA 2R3ZA 3S24A 2BE5D 1X6OA 1XXGA 3I90A 1TT2A 4KD3A 2QILA 1MI2A 5KYIA 1X9NA 2N88A 3K5NA 1QB5D 1J9OA 3C1EA 1GUWA 1B9MA 4JI6Q 1PH4A 3FP9A 5EBCA 5JVH3 4NKLA 5IT9L 1P16A 5CV7A 5A2QE 3S1MH 2VS1A 3ERSX 1YNJC 4DV0Q 1WTXA 3T13A 3N6RA 5NUCA 4GKJL 1EFID 1VQ8A 3U50C 3QJYA 2XWJB 1Q46A 2KECA 1H9KA 1SYBA 1WYDA 3I4NB 1PZJD 4KI0A 4A3EB 3URYA 1GHKA 1GUOA 1PFSA 3KLRA 3CW2C 1HCZA 3PUWA 1L0YB 1PZKD 2B2VC 1F9SA 2AWOA 3PO2G 2YYZA 2Z4IA 4DN4M 3G6JB 3T16A 3EQLC 1O7IA 5GAHC 1YIJA 4IJHA 4X6AH 4OXPA 4RCOA 4C3JH 2R7ZB 4IOCA 2JA5B 2F3IA 3WDNA 3FKIG 4A3IG 2IJ0A 1HJPA 4JYAQ 3DEPA 1U4LA 4U673 1ZZIA 3M85A 2UXDQ 1EWCA 4BWGB 3NSWA 1FVIA 2N78A 3VR6A 3MA2B 2ATWA 4DR3Q 4OIJA 4HEDA 4DAPA 5DM73 2EY2A 4A3BG 2M2LA 5JVG3 3JAME 1SRUA 4OGQC 1WI5A 3HOWB 1VQGA 2HDLA 2UUBQ 2TSSA 4K5VA 1DCZA 1TY2A 1IHZA 5EKKA 1K83B 4ULLA 3NHHA 1CKNB 1LUZA 3CCVA 3HOUB 5JJLA 3CMAA 5HGQA 2NN6H 5JEAJ 1A3VA 3VYRA 3BYYB 4C3IB 2ZXRA 4FP5D 3SEBA 3U4VA 1NUCA 2K6AA 3CF5A 1UEAB 2K5HA 1YJNA 4JI3L 3S2HH 3J81E 1DXMA 1HFGA 1W6KA 4KN7C 4WJWA 4LF5L 5K36G 1R9TH 2VQFQ 4RGOS 3L0OA 2LKVA 5M3MB 2MFIA 4QMFB 2BCOA 2MO0A 1KNAA 3RZDH 1H95A 1L0XB 5C0XH 1NY4A 5IGGA 5I2XA 1S5ED 2A73B 1MD2D 5A2QL 3RN2A 2PZUA 2B2UC 5F2DA 2KENA 3SK8A 4OL7A 5LMNW 4WJ4A 4A3FG 4KY6A 2OQKA 1ENCA 5M3FH 3CC2A 4O1NA 5I9PA 1N33L 1AH9A 4DUZQ 5I6WA 3TS0A 1I3QB 2EYPA 1BCPC 4DR2L 1PH9A 4RMFA 1WCMB 5C4ZA 4JBWA 1EYDA 4K6DA 1LTAD 2R7ZH 2A6EC 1KABA 3M4OB 1MJCA 1KD1C 1VQCA 4LFAL 3U9SA 3STBC 4RA8A 4RKLA 4ZKCB 2JA6B 1SE8A 3NENA 1X3FA 2IPKD 1DGSA 1F2LA 1KNEA 3DUZA 3MVVA 4HIDA 2YV5A 1NR2A 2ZM6L 3SGIA 1JMCA 4XDXA 1SYFA 1PRTF 1HPCA 4L63B 1X54A 4LFBQ 1EUJA 3RLOA 2RF4A 2IW3A 4BA1I 1L1OC 1XX8A 3AFPA 5IOCA 4UP9A 2EYFA 2OTLA 5IP9H 4PV1C 5LHY1 1VMCA 2O2LD 1ET9A 1STEA 2WIIB 3Q0AA 3FPPA 2A68C 4R8NA 1SLJA 2OTJA 3CXCA 4C3IH 3H91A 3JAML 2NVTH 1X55A 4YY3Q 1GUTA 4ZRZA 4N9TA 2ZTEA 4TRDA 4IUVA 2AXYA 4TVAB 4QF4A 3KJOA 3CRLC 2NVXB 2QEJC 1IYJB 5C3EB 2UXCQ 4EQ5A 5BN3A 1E22A 1VDZA 3OHXC 2SNSA 2Q8IB 1XTDA 1VQ4A 1PHJA 1N9WA 3RUZA 3CCUA 3D31A 5BN5A 3J81L 1I5FA 3BS1A 3J80c 1X4MA 1H9SB 3CCSA 1ML0D 3TP8A 3NK9A 2D0PA 2UUCL 2CHBD 1SXTA 2AHOB 1HNWQ 2WV6D 4UDUC 2E2JH 1VQPA 1I3QH 1HNXQ 3PIPA 3J7ZC 3K7AH 2E76C 1JQYD 1EYCA 4B3TQ 4KJOA 1VQDA 1QZGA 2G9HD 2R7FA 3H94A 3HOXH 1M4VA 4K0KQ 2NZOA 1UAPA 1JE5A 3M7NA 4DK6C 1N36L 5C3XA 1X3EA 5I6YA 2CVRA 4BBSH 1EQRA 4G4KA 4OO1H 2F0FA 3A8JE 1NCVA 4X3SA 4YIJA 5C4HA 2O4XA 1K1GA 4LF7Q 2JA7B 5FJ8G 1BXTA 1PLFA 3HKZB 1PH5A 3KLWA 1DD2A 2A6HD 1SJHD 2Y0SG 4Y7NH 2B63H 5IGFA 1WD1A 4A75A 2E2DC 2VZAA 3RD4A 1ASYA 1O7LA 2YTVA 2XVSA 3K5LA 2JP1A 3S1QB 1STAA 3A7AB 1OXUA 3BVGA 2V1CC 3BU2A 2CTFA 2PW5A 4DR7L 1IBMQ 2NVXH 1Y8NB 4A3LH 3EA6A 3ULLA 3DEOA 1HA6A 2K5DA 4ZLTF 3AB9A 2NVQB 1A3UA 1LTRD 3G71A 2HHHL 3NTHA 4NPSA 1ESFA 3GTGB 4QIWB 3NEMA 1B53A 4A3KB 2B2TA 1XWEA 2JA9A 2YQRA 2A1AA 3Q24A 4BY1H 2DNCA 3M3YH 1XPOA 3A74A 4X64L 3S14B 2Z1CA 1N8RC 5IE8A 4JI5Q 2YTXA 4EQNA 1NJIC 1ZZJA 4UP7A 3HKZE 3HGBA 2XWBB 3KYHC 1PZID 4Z9CB 1UWVA 2F0GA 1EIFA 1G2SA 2BH2A 2DY8A 4ILWA 1E3PA 3BZDB 5C4JB 4XQQA 1K3RA 4ZKBB 2M9VA 2BL5A 1PFMA 2MPMA 2VB3X 3T4AC 2LSSA 1GVPA 1HZCA 1RKNA 4N9PA 1BOSA 4UAIA 1KAWA 3D4DA 1Q1BA 2BH8A 5CGKA 1TS3A 1CKNA 2WP8J 1CSPA 3A5UA 3M4YA 2P2RA 2ZXPA 3OMGA 4GKJQ 4JOIA 4GLXA 2FMMA 5E4XA 4DNIA 2AKWB 1EZ6A 2K50A 2EQSA 5FLXc 1VQMA 4GNXC 4QIWE 4YWMA 3GV6A 5C44H 1YI2A 4G57A 1STHA 2CTLA 1M1KC 1TS2A 2F0LA 4YWKA 1SNQA 1GJXA 4V190 4X62L 3S17H 2PNRC 3KF8A 1S40A 3CCMA 4IPDA 5IP7H 2NN6G 3KOJA 3GTGH 3UDGA 5FK9C 2VB2X 3PIOA 5EQ0A 3IKJA 1YJ9A 4DU9A 1HR0L 4A3FB 2OQ0A 4A3KH 1PH3A 2J4XA 3MFYA 3I55A 3HS0C 4HSPA 3PCOB 2LS01 3X3NA 1STYA 2AWNA 3H0GB 4F7XA 5CV6A 3GTQB 2RDGA 1V8QA 4NB3A 4KJNA 1IZ6A 1JR0D 4JI7L 3BYTB 1L2FA 3E0EA 2K14A 3I4NG 4A3EG 1JWSD 1GHJA 4ABNA 3VR2A 2VQEL 5D14A 5C4JH 4HMIA 3QB3A 1PVOA 4IFDI 1PRTC 4RFBA 4A93H 4XXEA 2OCEA 1SSOA 3T56B 1SNDA 2QNDA 2R7ZG 5FO8B 2JA5G 3T1YL 3L3OC 4OWTB 1W3SA 5HURA 2JYOA 1SMXA 1DT4A 4JI4L 2Z6KA 1PYSB 2QDBA 2EDGA 4FF1A 3NBIA 1BF4A 1IBKL 3J7AF 3GD7A 4M8AA 1QUQB 5GAGC 4A3GH 4IALA 2QCPX 3W1GA 4LF5Q 1RL2A 1ET6A 2Z8LA 2NWGA 2DN8A 1K73C 1JB7A 2VXWA 5C3WA 1ILQA 3HOWG 4TKOB 3WOEA 4A3CG 3J7A5 1SFOH 3KDFB 1N33Q 5JAVA 5M5YH 3SE0A 3HOUG 4DR2Q 1ASZA 1YNJD 1HQMC 1YITA 5G3LD 3IFDA 1A2TA 4C3IG 3PUZA 3F2DA 2F0JA 2WAQE 2Q8RE 2EYJA 1H9SA 2RSNA 2HH2A 1NE3A 2SOBA 4LFAQ 1MBYA 1MSHA 3MTSA 3K81C 2F1MA 1I50H 1FJGL 2D62A 4RKBA 2F0PA 2ZM6Q 5M3MG 4APVA 4CKEA 2RCNA 3BDLA 2AMCB 2GN5A 2H5XA 4DNTB 3SDZA 1PYBA 4B3ML 1NBWA 4K8JA 2A5HA 3F2CA 5IYDH 5JEAH 4CJ1B 4HJAA 2LY7A 1IYVA 4R8IA 4POGA 3HOVH 4O42A 2XIWA 4KHZA 4NMZA 4EGVA 1KL9A 4HJ9A 5D3IB 3EROA 1WCMG 2K04A 1SAPA 2PYKA 4C3HB 3PIO3 4B3SL 4RGTA 2A19A 2J0TD 1CTMA 4HN7A 5LMNL 2G9DA 4R9WA 3V69A 4JI8L 1IW7C 2B29A 2JA6G 2H4OA 3GTKH 1YVCA 2K52A 3VA7A 3TQYA 3RR5A 4KTAA 3ERQA 3W5OA 4K5WA 3LWUA 2XGTA 3S1RH 2NTSA 1EY5A 2UUCQ 2HQLA 1HZBA 1WTPA 2CTKA 5DEHA 2KCCA 4ME3A 4LIJA 4A3DB 3TZDA 2CQOA 5KGUA 5IGDA 2A74C 1O78A 1VQNA 2K1BA 1U0LA 1XPRA 3A8KE 1HZAA 1JB3A 4MNOA 3MXUA 3BVZA 4IFDG 3S1MB 5DNFA 2L0CA 2KEDA 4HAEA 1BBXC 3T1HL 1VQ9A 3FRPB 3T51B 2UU9L 4IURA 2O5IC 3B6YA 4ALPA 4DV7L 4A3LG 1CT1D 2IX1A 3H3VC 1QNUA 1SEBD 3BG3A 5FOBB 2CTJA 1J5EL 3GTMH 1BCPD 2V4DA 4HTHA 4GOPC 1S5DD 2A69C 4KKSA 3P75A 2A6ED 3ZYYX 3PO3H 2R92H 2XRSD 1S72A 1SYDA 1RTNA 1YNXA 1Q86C 3STBD 5IYCH 4C3JB 1RF2D 1PH2A 1B1ZA 2OPVA 3K80C 4C3HH 4HR7B 1P8LA 3SR1A 1LTBD 3I4MB 1BKBA 4DR1L 4PQXA 4BY7B 2UUAQ 4DV6L 2IHFA 1Q82C 1NSNS 3HRZC 1KHMA 1EOTA 2MJ8A 1EY4A 5BR8L 2HHHQ 2E3UA 1EY7A 2A68D 4WORA 4XQJA 1NTGA 4H0LC 3BZCA 3HKZG 2JA7G 1HUNA 3BVMA 3FDTA 4K14A 1G91A 4BXXH 4GKKL 4RGNA 1ZKOA 3KJPA 4DAYB 4LJZC 3TP5A 5CBAE 4A3DH 1BDOA 3L7ZC 1FNWA 2EYLA 3TSSA 4X64Q 3HOYH 1Z7TA 2E5LL 1B44D 1VF7A 1I4HA 1PFBA 1PFNA 3I4LA 3C3LA 4O2DA 3S2HB 2M00A 1AZPA 4QY7A 1KTKA 4FF3A 1A0IA 1DTJA 4G7HC 2PCFB 2K28A 3NXWA 1R9TB 4WFN3 5IT9c 4JG2A 1Z47A 3BDOA 3WOFA 3RZDB 1HA5A 3PUYA 1HUMA 4CKBA 3IRBA 2D0OA 5C4XH 2KUMA 1G51A 1FGBD 3NELA 1TWFH 1PA6A 1VMPA 4KN4C 5M3FB 4A3KG 1VQEA 4DK1A 1JOOA 2L1BA 4EQPA 4JI2L 1BBWA 5IGCA 2EXDA 3I4MH 1ENFA 2B8GA 4BY7H 4QUFA 1FNVA 4A4IA 3S2DH 4EVOA 1A62A 1EY9A 3H3VH 1QUQA 4DR5L 1SMYC 1WTVA 1RIPA 3AU7A 4IUPA 4I65A 3R2IA 3PUVA 2F0KA 3D4WA 1ZTGA 5M5WH 1D8LA 2VW9A 4CBVA 1HR0Q 4JC0A 1XNRL 4CGYB 2B2WA 4DV2L 1V1OA 4DV1L 1NMFA 3KDFA 1ZZKA 4L5TA 2E2HH 1LT3D 3Q8DA 2K33A 4DK0A 1MSGA 2SNMA 1HRJA 4RWSC 2NVTB 4X65L 1UEBA 2ANNA 1JJGA 1PTOC 2KA7A 2I46A 1EYGA 4JI7Q 1CA6A 1TWGH 5GROA 2R7DA 5AFWA 4HMJA 5ELNA 1GUGA 3P1HA 1EQTA 4IUNA 1XPUA 2VQEQ 2MGSA 3OWEB 4DV5L 5EJWA 1DZ1A 1V43A 3PMFA 3TRZA 3J7YW 3RLFA 2Q8TA 4JI0Q 3UDFA 1F77A 1AE3A 2F0SA 3AQQA 3MZ5A 3T1YQ 1SYCA 3MEHA 5KNCA 3NQTA 4B8TA 1Y8PB 2EYMA 2PI2E 2E2JB 3DXJC 4JI4Q 1MIUA 3H0GG 1CK1A 3K7AB 2GVAA 4PG3A 1LYLA 4DV4L 2ZTCA 5E1FA 4DUYL 1II3A 4P2CB 3HOXB 2JK8A 1Y14B 5FLMH 2KEEA 4BBSB 1K8AC 2LMCB 4NXML 5IYDG 4NDXA 5ELOA 1X4NA 3VR5A 3AFQA 2K5WA 2R61A 3MFGA 4DAVA 2HIXA 4Y7NB 3VR3A 1BCPB 2B63B 3CPWA 3QWNA 1AZQA 3FHWA 3MWYW 1KDCA 3M4PA 1FJGQ 1DM0B 4CKCA 1PH6A 1WTRA 2F0HA 4EQOA 1VQ6A 3FEWX 2R6GA 3RMHA 1H9MA 1DOMA 1E1OA 4R4IA 3JAMc 3J81j 4G7ZC 4KHPL 4LMQD 3E6ZX 5M9OA 5AJ3L 1SN8A 1MJEA 2RDHA 3KUPA 2ICIA 1I6HB 4J6HA 2YU9H 2PNHA 2KCMA 3ND8A 4DR4L 2TMPA