4BA2I

Archaeal exosome (rrp4-rrp41(d182a)-rrp42) bound to inorganic phosphate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
226
structure length
213
Chain Sequence
SQEIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGNKSMYETLTSCSIFVANNGRIWATCSRFSEEILIEAIRKIENELTDRIKQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
publication title Crystal Structure of a 9-Subunit Archaeal Exosome in Pre-Catalytic States of the Phosphorolytic Reaction.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase/rna
total genus 40
structure length 213
sequence length 226
ec nomenclature
pdb deposition date 2012-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ba2I01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ba2I02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4ba2I03
1IYUA 2UUBQ 3GTMH 3U58A 5HY6A 2DUDA 2JA8H 2OTJA 3VR3A 3GTLH 3S2HH 4OONA 1XPUA 1GUGA 3KFUA 1J6QA 1SN8A 3F1ZA 2KHIA 1K8OA 1C9OA 3UDFA 3CP0A 4JI3L 4IOCA 3FPPA 3CRLC 4K0KQ 1CFMA 5IYCH 5JEAJ 5C0XI 1YNXA 2AKWB 1AE2A 1E22A 3GTQH 4A3JG 3M4PA 1YHAA 1HNWQ 3TS0A 1T5EA 1XMOL 5LMUQ 1SMYC 4DV0L 4GNXB 4FDBA 3H3VI 1H9MA 2MFIA 3NENA 2UXDQ 3GDEA 2UXCQ 2ZJPA 2JVZA 1K8GA 3AQQA 3T1HL 1X9NA 1LYLA 1B7YB 4LJZC 3PO2H 1N8RC 2OQ0A 4DK0A 4LUVA 4AYBE 3CCSA 4QL5A 4WJ4A 1EQRA 4A3MH 4A3FG 4DNTB 2QA4A 2IX1A 2JK8A 2PPBC 2ANNA 4A3GG 3PUZA 4QQBX 4WANA 2XGTA 1N36L 2K33A 4JBMA 2IY5B 3HOWH 2YYZA 3M4YA 3AEVB 3ICEA 3HOZH 1JE5A 2MNAA 4DV6Q 1QVFA 4DKAC 2D0PA 1VQ9A 1K1GA 5H1SE 3AEVA 2B29A 1HCZA 2N8NA 4DR6L 2VZAA 4YY3Q 2JXMB 1DT4A 1CKMA 3KDFA 1NTGA 3WWVA 2K5VA 4C3HH 3RLFA 1I94Q 1DGSA 1S40A 3BDOA 2N78A 5JJLA 4JVYA 1VQHA 2ANRA 1PH7A 3HKZE 3W1GA 5A35A 2F4VL 3NEMA 5C0XJ 2A6ED 1VQCA 4BBRH 2JA6H 2E76C 1KD1C 2EQSA 2VNUD 5GAHC 5C4XG 2KA7A 4PZ6A 3OW7A 3HKSA 4DPGA 4LF7L 4X66Q 2FMRA 2JJQA 1J5KA 3Q8DA 2HH2A 2O5IC 4DAYB 2CWPA 5M3FH 1VS0A 5FLXc 3M4OH 1GUNA 1HPCA 3NE5B 4BY1H 1VQJA 3EIVA 1Q7YC 4IOAA 3D4RA 2JA8G 5IE8A 4AQYQ 4IFDG 1VQ8A 1KHMA 3S17H 1Y8PB 5KNBA 3T1YQ 4GZYC 3HOVH 2BE5C 2ALYB 4A93H 1VQ6A 3M85A 1V1QA 1L1OB 4JI7L 1B70B 4IPCA 4PMWA 3F2BA 4BA1I 1Z9FA 3H0GG 1FR3A 4KN7C 1QUQB 1X3EA 4KKTA 2FXQA 3S2DH 3D0FA 1HZ9A 1Y1WG 2AWNA 1PH4A 4X64L 1QUQA 4G7OC 3PO2G 4EX5A 3LWUA 4A3CG 4DV1Q 3CCRA 4R1JA 3P20A 2OCEA 2PCFB 4B8TA 1WCMH 4A3MG 3BZKA 1KIXA 4LFCL 4XIGS 1VDZA 4JYAL 3GTJH 2KCTA 2GVAA 4H0LC 5BR8Q 4DV3Q 3TS2A 2ATWA 4NPSA 1VQBA 1XJVA 4Y7NH 1K3RA 1JJ2A 3HOWG 4DNRB 1Y8OB 1YBYA 4DR2L 3E0EA 3CC4A 4A3IH 2B63H 3F2CA 1GM5A 3EQLC 2RHQB 4B3SL 2PQAB 5IP7H 4X62Q 2HT1A 2K50A 3RLNA 4KMUC 1WI5A 4DNIA 1B9MA 2IHEA 4JI1Q 2JZXA 5AJ3L 1RL2A 2YU9H 2ZTEA 2BDOA 4TVAB 4HJ5A 2PMZE 3K81C 1MJEA 4IPDA 4DUYQ 4GOPB 1QVGA 3A74A 1H9SB 1TKWB 2ES2A 1YHQA 1L0WA 2UUCQ 2WAQE 4IJHA 4LF9L 4QMFB 3J7A5 3E9IA 4BBRG 2MQHA 1NJIC 2UU9L 1IW7D 3U1KA 2D5DA 1Q82C 4AYBG 2ZM6L 1Z47A 4IPGA 4YWKA 2K5NA 2HQLA 1NY4A 2A68C 3K8AA 1X6OA 1CTMA 3E9HA 5M3FG 1PA6A 1Y1VH 1N32L 1HNZL 4H13C 4A3FH 4PV1C 3MXNB 1SFOH 3A5UA 1R9TH 4GN4B 2L5TA 3MXUA 1QVCA 3KOJA 2YV5A 4A76A 3HOVG 3BG3A 2E2HH 2BL5A 4GKJL 2N3SA 1HR0W 1YITA 5M5XH 1VQMA 4KI0A 4NXNL 1A8VA 3RN5A 2AUKA 1UEBA 2IHFA 3GTGH 4DV7Q 3QJYA 4GLAC 4A75A 2UXBQ 2QGQA 1EFWA 1YJWA 3K7UC 2OWOA 4LK1C 5M5YH 1ONLA 3ULJA 1VQEA 5ELNA 2VQFQ 1LACA 4DR5L 2JEBI 3HKZG 1J5EL 2EIFA 2NN6H 3OTOQ 3K80C 3PUYA 3VKEA 1WCMG 3ND9A 4GLVB 4LNQA 1Q1EA 3TREA 3SGIA 1XPOA 1Z7TA 5C4XH 4OO1G 2K7VA 4P71A 4A3BH 3BU2A 2CTEA 3I73A 3G48A 3ND8A 1K73C 3I4NH 2E5LL 1K8MA 4A3IG 1PYSB 2B63G 2E74C 1M1KC 2NVQH 3OPOA 1IBMQ 5LMNW 1EUJA 5IP7G 1YVCA 5FJ8H 3HOXH 4IFDH 4HIDA 4X65L 4UPAA 2DGYA 4JI4Q 4L5QA 3UE1A 1SROA 2NVYH 2CQOA 4DR4Q 1KRSA 4JC0A 2CWAA 1KXLA 3PGZA 1S72A 2JA5H 4QY7A 1LABA 1A62A 2CKZB 3RLOA 1IBKL 1FJGL 5FLMH 1OXUA 1IBLL 4BY7H 3H0GH 3S24A 1ZKOA 1E24A 5BN5A 2EVBA 1Y1WH 3S15H 3CRKC 4OWWB 3W5OA 2K4KA 2R7FA 3FP9A 4B3RQ 2A69C 2NZHA 4YHHQ 5DLQE 2DNEA 4LF4L 1H9RA 1N33L 3T53B 3GD7A 4JV5L 4GKKQ 4PZ7A 4A3CH 3ULLA 1HNXQ 1X3FA 3I2ZA 1Y1VG 2WB1E 1K9MC 3WDNA 4BA2I 4H44C 3PUVA 1E2ZA 3RR5A 4DR3L 4LF8Q 5M3MG 4LFAL 4LF5L 4GN5A 5IWAL 2BA1A 1HR0L 3J81i 3LGJA 4JI8Q 4DV2L 4JG2A 3AYHB 5C44G 2B8GA 3RZOH 3A8KE 1XNQL 2F1MA 1CI3M 4L5RC 4JI0L 2I5MX 2K5HA 3KYHC 1OXXK 1EOVA 1XNRQ 1Y14B 1YI2A 1Q81C 3KDFB 3T51B 1WJJA 2Q8IB 1KAWA 2HHHL 2H5XA 1XMQL 1B9NA 2YTXA 5JEAH 1DXMA 2R92G 4OXPA 2UUAQ 4OGQC 3F2DA 3DXJC 1KC8C 3CCUA 2MJHA 5K36H 2DNCA 4DV4L 2WAQG 2ZTDA 2Q2HA 4DR7Q 2NN6G 4JI6Q 3BZCA 4DR1L 1KRTA 2RCNA 2CTFA 1I3QH 1GVPA 1UE6A 4Y52H 1DD2A 4JBWA 2P2RA 3U9SA 5KNCA 2AWOA 4A3BG 3KLRA 4JI2L 3V69A 4B3TL 1HQMC 3I4NG 5KNDA 4QIWE 2VW9A 2GVBA 5LMNL 2K14A 3K7AH 3L2PA 1LTLA 3EN2A 2R93G 4DUZQ 2JQOA 1M90C 4NXML 1IXRA 3TQYA 1ZZKA 5FJ8G 3PF5A 2JEAI 3HOXG 3TZUA 4RCNA 4OX9L 1OXTA 1ASYA 4YCUA 1D8LA 2Y0SE 4JI3Q 1N34L 2JA5G 2VQEL 4H02A 2BE5D 4UP9A 5FLMG 4BY7G 1XMOQ 3RN2A 4JI5L 2NN6I 4JBJA 4DV0Q 3AB9A 2R7ZG 5GAEC 3A0JA 5C3EH 4HJ9A 1QZGA 3M3YH 4C2MH 1VQKA 3T1HQ 1X65A 3OOCA 2A6HC 1UE7A 1P16A 4JV5Q 2B3GA 3NELA 3L7ZC 2PY9A 3KF8B 1Q1BA 1OXVA 2EJMA 5IP9H 2E3UA 4UY8C 1HJPA 1NMFA 1YIJA 1JJCB 4DK3C 2D2CC 3VR5A 3QG1A 1ZZIA 2LXKA 3PF4A 1I6VC 1N36Q 1K0RA 4OO1H 4IFDI 1GO3E 3ULPA 3GTOH 1GHJA 2AMCB 5EAYA 4LUOA 4OWXB 4APVA 2D0OA 3CCQA 2IX0A 1HZAA 4X6AH 4KHPL 4A3LG 1PH5A 1A6XA 3ER0A 4B3ML 3S16H 4DR6Q 5JEAG 2PNRC 4R4CA 1FVIA 2DN8A 5C4JH 1PHJA 2UUBL 4HIOA 3CCJA 5K36G 4YWMA 1X4MA 4ALPA 3HFZB 3S1NH 1FL0A 1I50H 2OTLA 3FHWA 3CCVA 2CPQA 3CMEA 2AUJD 4I7ZC 4HIMA 4K0KL 3CMAA 4G7HC 2PNHA 4NBQA 3IKJA 3J81j 2F4VQ 1Q90A 1W3SA 1HNWL 1FYCA 5LMUL 4JCVE 3QIAA 1EQQA 2WB1G 4LF7Q 4GNXC 1VQ7A 1IW7C 4O2DA 3PIOA 4IJLA 1H95A 2QEXA 1C0AA 1NMGA 2UXDL 2UXCL 1VQFA 3HOYH 2GN5A 2PQUA 3J81c 4J15A 5GQOA 1EWHA 5M3MH 1C7YA 1CSQA 2CW0C 2Z6KC 1AE3A 3PUWA 4NB3A 3H15A 1PVOA 2HIXA 5C44H 1MJCA 3STBD 2A19A 2A8VA 1HZCA 1YEZA 2KENA 4KHZA 2VS1A 4JI7Q 1T9HA 2LMCB 2NVXH 2RHSB 1ZYRC 4IFDJ 1K8AC 1V9PA 2XTIA 1MIUA 3CD6A 1G6PA 1K83H 4BBSH 3J7ZC 5C3EG 3VR4A 1EIYB 4DV6L 3JC66 1GJXA 4LW1A 2R92H 4X64Q 1LM0A 3PV0A 3T56B 1UE1A 1TU2B 2EXDA 5BN3A 1A0IA 1VIGA 3L0OA 1ZTGA 4YY3L 5IP9G 5C0XG 1FGUA 1SRUA 1I94L 1YZ6A 4LFCQ 3IRBA 1O78A 4JYAQ 5IYDG 1W2BA 1D7QA 1A63A 3CPWA 3I4LA 4GN3B 1DCZA 2AHOB 4QJFA 4RG1A 4PG3A 3N6RA 4KKSA 1TWAH 1RIPA 2ID0A 2IT1A 1BBWA 4DR2Q 1TWGH 3ERSX 1HZBA 3J80c 3DLLA 4X66L 2R93H 4DAMA 2CTMA 1VQ5A 2ZJRA 3HOUG 3CC7A 4B3SQ 3GTKH 2LXJA 2Y0SG 2BH2A 2KCMA 2ZJQA 4A3DG 1ZZJA 1UWVA 3I4MH 3FKIH 1VQNA 5AJ3Q 4G7ZC 2E8GA 3KLWA 2WFWA 3I56A 3PIPA 2NVTH 4RMFA 3A8IE 4AQYL 3U4VA 1PFSA 2K75A 1Z6HA 2HH3A 3T1YL 2EDGA 2L15A 4HJAA 3B6YA 3KJPA 4LWCA 2R7ZH 4LF9Q 2UU9Q 3IFTA 1L1OC 4P75A 4A3EH 1E2VA 5BN4A 2OPUA 2YTVA 4MZ9A 3PSIA 1GUOA 2ZM6Q 1KQSA 4R4OA 2A69D 1JB7A 1G291 1VQDA 4OO1I 2CTKA 3UDXA 4JBKA 3SE0A 3HOYG 3PO3G 4TQUS 1OXSC 2PI2E 4GNXA 1N32Q 2A1AA 2KBNA 5JJKA 2CCZA 1HNZQ 4BXXH 4KKUA 4GLXA 1EYGA 1TWFH 1KL9A 4DV1L 4OWTB 5IYBH 1JMCA 2VUMG 2D62A 4C3JH 2B8FA 2ZT9C 1N9WA 1BKBA 3FMCA 4HR7B 4R4TA 3W1BA 3CXCA 2VL6A 4WALA 4GKJQ 3H94A 1X54A 1P8LA 5BR8L 2Q2IA 1VF7A 4DV3L 2YTYA 2Z6KA 1I6HH 4NXNQ 3D31A 1VF5C 4XTCS 2OQKA 4IPHA 1NE3A 1GD7A 4A3LH 4BBSG 3M4QA 2CTJA 1OTCA 4LFBL 4JVHA 1X3GA 1Q46A 3G4SA 4A3KH 1SMXA 1O7LA 1PH2A 3RZDH 1GKHA 2OPVA 2QF7A 1VIHA 1Y69U 4X62L 4DR5Q 1J5EQ 3CCEA 2CFMA 3CPFA 4MNOA 2C35B 3CF5A 2N49A 1VQGA 1TUAA 4JI1L 1TWHH 3PCOB 1X55A 2Q2TA 1VQPA 3TRZA 4DUYL 4YCVA 1PV4A 4GOPC 4DK1A 1AH9A 4AIMA 2V4DA 1IL2A 1HH2P 5IT9c 3S1MH 2A6EC 4QGUA 2UUCL 1IYJB 4R4IA 1QJOA 1PH8A 3LNNA 3K0XA 3ZJYC 2E2IH 1E7ZA 2E5LQ 1VQAA 2O5JC 1BVSA 3GO5A 4DV5L 1EIFA 4TKOB 1YNJC 3DM3A 3VR6A 4P74A 3A7AB 2R6GA 4DK6C 4HIKA 3I7FA 2JA7H 1KHIA 3W3AA 3I55A 2NZOA 1EWIA 3OW2A 2YQRA 3EBEA 1YNNC 5GAGC 3I4MG 2RF4A 4X65Q 3FKIG 5GADC 1CKOA 4O0AA 1SLJA 3J80i 1X4NA 1VQOA 3VA7A 2DGRA 1VQLA 2JA9A 4L5SA 2F3IA 1ASZA 1IBKQ 1FJGQ 1Q86C 1IBLQ 3JAMc 4LF6L 1PMRA 5IYCG 1HTPA 1V8QA 4A3EG 1PH3A 5E7NA 4MTNA 5ELOA 1CSPA 3S1QH 4IO9A 1SE8A 4JOIC 4DV7L 2UXBL 1SR3A 2MO0A 5IY0A 1E1OA 4LF4Q 1N33Q 1S3OA 1L1OA 2I0QA 2A6HD 3SDZA 3CAMA 1NBWA 5J3BA 4LIJA 1GHKA 1UE5A 5C0XH 2LSSA 1BDOA 2VQFL 3UDIA 1PH1A 4BXXG 1VQ4A 1I5FA 4DR3Q 5IYDH 1V43A 2WP8J 5IYBG 1WFQA 2K52A 1U5KA 4LFAQ 3OTOL 4LF5Q 3H3VH 5GROA 1GUTA 5IWAQ 3A7LA 1HR0Q 3GQBA 3VR2A 4AH6A 4DV2Q 1LUZA 1XNQQ 3CQZH 2KCCA 3HGBA 1IYVA 1GUSA 3S14H 4JI0Q 4JK1C 4POFA 4PZ8A 3GTPH 2CTLA 1H9KA 3HOUH 1U0LA 3RNUA 4L5TA 2HHHQ 4YWLA 3HOZG 4POGA 2QNDA 4A3DH 3A8JE 1B8AA 1JT8A 1XMQQ 1IBML 4LFBQ 1QZHA 1E3PA 4A3KG 4KLKA 1CKNB 2AXYA 4DV4Q 1L2FA 4C3IH 4JI4L 4DR1Q 1H9JA 1CKNA 4IQZA 1XTDA 3UDGA 1E2WA 4DR4L 2PQAA 5HGQA 2Z0SA 3MFYA 4L8JA 2I5HA 4YCWA 4A3JH 4HJ8A 3U4ZA 2E2JH 1WOCA 3OYYA 1WYDA 1JJGA 4ME3A 4JI2Q 4B3TQ 4GOPA 2JA6G 3VDYA 3PO3H 1H9SA 4B3RL 4DV5Q 5LMNQ 4YHHL 3AFPA 2E75C 2A68D 5M5WH 1YJNA 3KF6B 4NXMQ 4GKKL 2JA7G 1VCIA 3M7NA 1IZ6A 1HNXL 2VUMH 3U50C 1G51A 1PH6A 4OX9Q 3PUXA 5JJIA 3KF6A 4BY1G 3I4OA 2MO1A 2JE6I 3CW2C 3AFQA 1N34Q 4LF8L 2Q2UA 4P73A 2VQEQ 4A3GH 2F52A 1BBUA 4LUZA 3STBC 4JI5Q 4LF6Q 4JI8L 1Q12A 2EJGC 4KN4C 1J4WA 4A93G 4EQ5A 4GS3A 1YHBA 3UE0A 3BJUA 2EJFC 1XNRL 3CC2A 1EC6A 1VQIA 2BH8A 3JAMi 3MEFA 4P72A 3G71A 1X56A 1Y8NB 4UP7A 4JOIA 1PH9A 2ZTCA 2UUAL 4AM3A 3CCMA 3A5ZB 1XPRA 2K32A 3F8TA 3I72A 2V1CC 2HIVA 4DR7L 2BA0A 2PI2A 4JI6L 2ASBA 1WVNA 4UP8A 1CUKA 3TEHB 2R7DA 2VY3A 3G6EA 1WE8A 3KJOA 3S1RH 3NBHB 1TWCH 4A4IA 3M9BA 1TXYA 2I5LX 4HJ7A 3CCLA 4KHPQ 1Q8KA 1E1TA 1YJ9A 4B3MQ 1O7IA 1MKHA 2KHJA 1DTJA 4R4QA 4WJ3M 1PYBA 4DUZL
chains in the Genus database with same CATH superfamily
3O13A 1IYUA 2EYMA 2UUBQ 1V9NA 5C3EB 5AFWA 3KUPA 1V1OA 5EPLA 3U58A 3GTMH 2KCNA 4U68A 5HY6A 3H91A 2DUDA 5E1FA 2JA8H 1NR2A 2OTJA 3VR3A 3GTLH 3S2HH 1DZ1A 2LRRA 2EY2A 4OONA 4C3IG 1XPUA 1GUGA 4C2MB 1ENAA 3KFUA 3BVMA 1J6QA 1SN8A 3MFGA 3F1ZA 2KHIA 1C9OA 3UDFA 1K8OA 4LFCH 4UHVA 3CP0A 3L9AX 3OSSD 3HKZB 3H09A 4JI3L 4JYAH 5EPJA 2CPMA 4IOCA 4HSPA 3FPPA 3CRLC 4K0KQ 1CFMA 3N52A 5IYCH 5JEAJ 5C0XI 2PZUA 1YNXA 1PZKD 4DF7A 2AKWB 4UAIA 4ZLTF 1XXGA 2L12A 1AE2A 1E22A 1LTSD 3GTQH 4WRDA 1ICFB 4A3JG 1B1ZA 3M4PA 4IUNA 1YHAA 3NWTA 3TS0A 1HNWQ 1T5EA 1XMOL 3MXGA 1EWCA 5LMUQ 1F9PA 3RMHA 1SMYC 4DV0L 4GNXB 4FDBA 4FF3A 3H3VI 1EY7A 1H9MA 3FEWX 3J7AF 4DR2H 2MFIA 3NENA 1RD9D 3WOEA 2UXDQ 3GDEA 2UXCQ 1RODA 2SDFA 3MEHA 1U4MA 2ZJPA 2JVZA 1B3AA 1K8GA 3K0YA 3OMGA 1SXTA 3AQQA 5CV8A 3GTOB 3TBIB 4B3SH 3T1HL 1I4XA 5IGDA 1X9NA 1LYLA 1B7YB 2A74C 4LJZC 3PO2H 1JOQA 1N8RC 4FNFA 1EIGA 1WD1A 2OQ0A 1CA5A 4JI4H 4DK0A 4XQJA 5KYIA 4LUVA 4AYBE 3CCSA 5EGTA 3GTPB 4QL5A 4RA8A 3HOUB 4WJ4A 1EQRA 2Y0SB 4A3MH 4A3FG 1PTOF 4DNTB 4CHTB 1MI2A 3S16B 5DT9A 2QA4A 2IX1A 2JK8A 4A3DB 2PPBC 2G5DA 2ANNA 2H4OA 1PZID 4A3GG 5E3FA 3PUZA 4QQBX 5FO8B 1F2ZA 4WANA 2XGTA 1N36L 5C4JB 4FF1A 2K33A 2EXZA 4JBMA 2EE1A 2XWBB 2IY5B 3HOWH 4LF9H 4CDFC 2YYZA 2UU9H 3M4YA 5A2QL 3SR1A 3S1NB 1I50B 1KDBA 3Q6SA 3AEVB 3ICEA 3Q23A 3HOZH 1JE5A 3J81W 1R4PB 2MNAA 4R8IA 4DV6Q 2FINB 1QVFA 2SNMA 4DKAC 2D0PA 1VQ9A 2IJ0A 1K1GA 5H1SE 2F0EA 3AEVA 2B29A 1HCZA 2XRSD 1SSOA 2N8NA 4DR6L 1N32H 2J7ZA 2VZAA 1EEID 4YY3Q 2JXMB 4XT1B 1DT4A 1CKMA 1O7ZA 3KDFA 1NTGA 3WWVA 5I6WA 2M2LA 3CU7A 1C48A 2K5VA 4C3HH 3RLFA 3PIO3 1I94Q 5KGUA 1DGSA 3HOYB 1DYQA 1S40A 3BDOA 1PRTD 1KAAA 4RWSC 3KBXA 2N78A 3A56A 5JJLA 1EL0A 4JVYA 1VQHA 1SJHD 3EA6A 2ANRA 1LLRD 2JSOA 1PH7A 3EFXD 3HKZE 3VA5A 4FVMA 3W1GA 5M3MB 5A35A 4CJ2C 3UI2A 2VUMB 2F4VL 1V1PB 3NEMA 5C0XJ 1VQCA 2A6ED 3SK6A 4BBRH 2JA6H 4E9JA 2E76C 1KD1C 2EQSA 2VNUD 4NXNH 5GAHC 4RFBA 1STHA 4RKBA 2RBMA 5C4XG 1RCVD 2KA7A 1F9QA 1QNKA 4PZ6A 3OW7A 1EYAA 1NR4A 3HKSA 1XNRH 2CHBD 4DPGA 4LF7L 4X66Q 1TS5A 4N9TA 2FMRA 1WVLA 2JJQA 1J5KA 3Q8DA 1SE3A 2F0WA 1G2SA 2O5IC 2HH2A 4V0BA 5CYUA 4DAYB 3MZ5A 2CWPA 3Q0AA 2NVXB 3MHBA 5M3FH 5EPKA 1VS0A 5FLXc 5IGGA 3M4OH 2X06A 1BNZA 1GUNA 1HPCA 3NE5B 1YNND 4O1NA 4BY1H 2BCOA 3HS0C 4G57A 2X6GA 4BBSB 2F0MA 4DR5H 1VQJA 3EIVA 4DAYA 3S9WA 5IGEA 1Q7YC 4IOAA 2XRQD 1J5EH 2OEOA 3D4RA 2JA8G 4FXGC 5IE8A 3PMFA 4AQYQ 4IFDG 1VQ8A 5M9OA 1SNPA 1B4OA 1KHMA 3S17H 1Y8PB 1E0BA 4FP5D 5KNBA 3T1YQ 4FF4A 3SK5A 3HOVH 4GZYC 2BE5C 2WAQB 2ALYB 3BYYB 4C1NI 4A93H 1VQ6A 1JC7A 3M85A 1V1QA 1L1OB 4CJ1B 4JI7L 1B70B 2AQ1B 4IPCA 1WHRA 2CVRA 4PMWA 4BA1I 4QB4A 3F2BA 1STAA 2F0IA 3R93A 3TP6A 1Z9FA 1SJED 4PMBA 3H0GG 1FR3A 1BR9A 4K14A 1K0SA 1QUQB 1X3EA 4KN7C 4KKTA 2FXQA 3S2DH 3GKUA 3D0FA 1D5XC 2QKIC 5C6AA 4CJ0B 1HZ9A 2K03A 1Y1WG 4IZ8A 2E5LH 1W6KA 4WORA 5JPNC 1QILA 2AWNA 4KY5A 2VB2X 1T5XD 3C3LA 3LWEA 1PH4A 4X64L 3NP8A 1QUQA 4DUZH 4EC5A 2FHTA 1TWAB 4G7OC 5FO7B 1SEBD 4EVOA 3S1RB 3ERQA 3PO2G 1TWGB 4EX5A 3LWUA 4PMCA 4QF4A 3K5OA 4DV1Q 4A3CG 2N55A 3CCRA 1SE4A 2R93B 4R1JA 3P20A 2SNSA 2OCEA 2PCFB 3IAYA 4B8TA 4CDEC 1WCMH 4A3MG 3BZKA 1KIXA 4LFCL 4X3SA 2RQXA 4XIGS 4U673 1VDZA 4JYAL 3GTJH 2F3WA 2KCTA 3BYTB 2X69A 4XYQA 3I4MB 2GVAA 3FKIB 3KF8A 2NBFA 4H0LC 5BR8Q 4DV3Q 2PW5A 3TS2A 1FJGH 2ATWA 4NPSA 2R3ZA 1XMOH 1VQBA 2MP1A 1MSZA 4XYOA 1XJVA 1S20A 1JWSD 1Q3LA 2TMPA 2Z4HA 1HA6A 4Y7NH 1SYDA 2HQEA 2F0PA 3I3CA 1K3RA 2PT7G 1F2MA 4CBVA 1JJ2A 3HOWG 2NVTB 4HMJA 5FOBB 2DY7A 4K2KA 3K5MA 4PNYA 4DNRB 3J81L 3PIP3 1Y8OB 1YBYA 4DR2L 4ZUIA 5CC4A 2F3VA 1BCPC 3E0EA 5I9PA 3CC4A 4A3IH 5E4WC 2B63H 3F2CA 2R7ZB 3VYTA 5I6YA 1PTOH 5C5MA 1GM5A 4LF4H 1OO9B 1N33H 2RHQB 3EQLC 4O42A 2QEJC 1RJTA 4B3SL 1TY0A 4F7XA 2G8YA 1TY2A 3SK4A 4JV5H 2PQAB 1JWMD 5IP7H 1M4VA 4A3EB 2KUMA 2D9IA 2FMMA 4X62Q 2HT1A 3HEJA 4L5RC 2K50A 3RLNA 4HCEA 1G6ZA 4KMUC 1WI5A 3SEBA 1B2TA 4DNIA 2NYZD 1B9MA 1AW7A 5JVG3 2IHEA 1O7YA 4JI1Q 1PRTB 4C3HG 1K3BC 2JZXA 2F0VA 1SEIA 2PYKA 5AJ3L 1RL2A 1ICWA 2YU9H 2ZTEA 2BDOA 1UG8A 4TVAB 4HMIA 1I4RA 4HJ5A 2PMZE 3K81C 1MJEA 4LF5H 4IPDA 1N36H 4DUYQ 4GOPB 4FXDA 2K5DA 1QVGA 3A74A 5IWAH 1H9SB 1UEAB 1TKWB 2ES2A 1TWFB 1YHQA 2LF0A 2LKVA 1SE2A 4JVZA 1L0WA 2UUCQ 2WAQE 5JPMC 4IJHA 4LF9L 4QMFB 3J7A5 2HCCA 3E9IA 2LFNA 4DGZA 4BBRG 2MQHA 1NJIC 2UU9L 1XNQH 4C3JB 1IW7D 4CKEA 3SHLA 1VMCA 3U1KA 4KK7A 2D5DA 4JI0H 1LTTD 3V96A 1Q82C 1WTRA 1XX8A 4AYBG 1NCVA 2ZM6L 3LX0A 1Z47A 4IPGA 4YWKA 2K5NA 1I6HB 4ZQ3A 1EOTA 2HQLA 1NY4A 2A68C 1IL8A 3K8AA 1XMQH 1X6OA 1CTMA 3E9HA 5M3FG 1TS2A 1PA6A 1Y1VH 1N32L 5I9OA 3FDTA 4RCOA 1HNZL 4H13C 2X6LA 4A3FH 3K59A 3MXNB 4PV1C 1SFOH 3A5UA 4DV4H 1R9TH 2QW7A 4GN4B 1KLGD 2L5TA 4A3KB 4DR1H 1CQVA 3PQIA 3MXUA 3RZDB 3E0JA 2AQ2B 1QVCA 3KOJA 2YV5A 5JJZA 4A76A 3I91A 3HOVG 1MHWC 1PQXA 1WTJA 3BG3A 2F4VH 2E2HH 2BL5A 4GKJL 2N3SA 1HR0W 1YITA 3NQIA 2G9HD 4ZUJA 1F2YA 4HSVA 5M5XH 1VQMA 3SK8A 4KI0A 3V2TA 4NXNL 1A8VA 1RHPA 1TWHB 2B39A 3MVVA 3RN5A 4V190 2AUKA 2M6QA 2L55A 1UEBA 2IHFA 3GTGH 4DV7Q 3QJYA 4GLAC 4A75A 4JI2H 2UXBQ 4B3TH 2QGQA 1TQOA 1EFWA 5CGKA 3VYSA 1YJWA 2GA4B 3K7UC 5LMNH 2OWOA 2ZXPA 4LK1C 5M5YH 3S1MB 2PQEA 1B3QA 1ONLA 4EGVA 3RF2A 1KDCA 3ULJA 1STGA 1VQEA 5ELNA 2VQFQ 4NXMH 2JA6B 1LACA 1CHPD 5ELFA 4DR5L 2JEBI 3HKZG 2C9OA 1J5EL 1IKLA 3I70A 1SNQA 2EIFA 2F4IA 2F0OA 4OX9H 2NN6H 1EZ6A 4QMGA 3OTOQ 4F87A 3K80C 3PUYA 1K28A 2B2YC 3VKEA 1WCMG 3ND9A 4GLVB 2JA7B 4MTKA 4LNQA 1Q1EA 3TREA 4P2CB 3SGIA 5F2DA 2FJ2A 1XPOA 5ELCA 1Z7TA 2AQ3B 3TP5A 3M4OB 4ZKCB 3GABA 1A2TA 5C4XH 1HUNA 4OD6A 4XT3B 1JOOA 4JI5H 2IW3A 4OO1G 1EU3A 2M9VA 2K7VA 4P71A 4A3BH 1F9RA 3BU2A 2CTEA 3I73A 3G48A 4OELB 3ND8A 1AN8A 1K73C 3I4NH 4ZYSA 2E5LL 1K8MA 2Z8LA 4WFN3 4A3IG 1PYSB 2B63G 2E74C 1M1KC 2NVQH 3OPOA 4PQXA 1IBMQ 1SYEA 2F03A 2P5ZX 5LMNW 1SYFA 2EY5A 1EUJA 5IP7G 1SAPA 2Z6BA 1DJRD 1WTXA 3KDKA 1YVCA 5FJ8H 1EQTA 4H7BA 3EVQA 3S1QB 3HOXH 4IFDH 4HIDA 2OT2A 1EY9A 4X65L 4UPAA 2DGYA 4I65A 4JI4Q 4L5QA 3UE1A 1LT4D 1SROA 2NVYH 2CQOA 5CV4A 3X3NA 4DR4Q 1KRSA 4FF2A 3G7LA 4JC0A 2CWAA 1KXLA 3PGZA 4OIKA 4NMZA 1S72A 4QY7A 2JA5H 1LABA 1CHQD 1A62A 2CKZB 3RLOA 1IBKL 2I46A 1FJGL 5FLMH 1OXUA 2KQ3A 2NB0A 1IBLL 4N8FA 4BY7H 3H0GH 3S24A 1ZKOA 5I2YA 1E24A 5BN5A 1L0XB 2EVBA 1Y1WH 3S15H 3Q22A 1RKNA 3CRKC 5TSSA 4OWWB 2QDLA 1CZWA 3W5OA 4QIWB 4J6HA 2K4KA 4OEMB 2R7FA 3FP9A 1NXUA 2F0HA 4B3RQ 4NZRM 2A69C 2NZHA 4YHHQ 3J80E 5DLQE 3GTJB 4KY7A 1A3VA 2E2DC 2DNEA 1WTVA 4LF4L 4KHPH 4ILWA 1H9RA 1N33L 3T53B 3CQZB 3GD7A 4JV5L 4GKKQ 4B3MH 2RDFA 3S14B 4PZ7A 4MHEA 4K2LA 4A3CH 3ULLA 1HNXQ 1UNSA 1X3FA 3I2ZA 1Y1VG 2WB1E 4ZK9B 1F2LA 2OF1A 1K9MC 3WDNA 2RDGA 4BA2I 2F0TA 3OSOA 1QCBD 4H44C 2CQAA 3PUVA 2UUBH 1JWUD 1E2ZA 3RR5A 3K58A 4DR3L 1RDPD 4LF8Q 2KECA 5M3MG 1QG7A 3BDCA 4LFAL 4LF5L 2EYFA 5ELEA 2DJGC 1PFNA 4GN5A 4RKLA 1LT5D 5IWAL 2LY7A 1C4QA 4K0KH 2BA1A 2EZVA 1HR0L 1S5DD 5C4ZA 3J81i 3LGJA 4JI8Q 4MIUA 4DV2L 4JG2A 3AYHB 5C44G 4C3IB 5J22A 4ZAIA 2B8GA 2D9UA 3RZOH 1HNWH 1I4QA 3A8KE 1XNQL 2F1MA 1CI3M 5LMUH 2RA4A 2ZM6H 2J4XA 2N88A 1CA6A 2I5MX 1MBYA 4JI0L 4IUUA 2K5HA 3KYHC 1OXXK 4ZKBB 5CORA 1EOVA 1XNRQ 1Y14B 1YI2A 1Q81C 3KDFB 2CH4W 3T51B 1WJJA 2Q8IB 1KAWA 5CV7A 2UXDH 1GUWA 2UXCH 1W6JA 4A3JB 3NBIA 2HHHL 2Y3MA 2H5XA 2E2JB 3KLSX 1XMQL 1B9NA 1QOHA 3NUCA 2YTXA 5JEAH 1DXMA 2R92G 1HNZH 2A73B 4OXPA 2UUAQ 5IOCA 4OGQC 3F2DA 3DXJC 3P75A 1LT6D 1KC8C 1F77A 3CCUA 2EY6A 2MJHA 2FFKB 2EYPA 3PO3B 5K36H 2DNCA 4DV4L 2WAQG 2K6AA 2ZTDA 2Q2HA 4DR7Q 1EYDA 2NN6G 4JI6Q 5M5WB 2B2WC 3BZCA 3QB3A 4DR1L 3R8BA 1KRTA 2WV6D 5CV5A 2RCNA 3DWAA 2CTFA 1I3QH 4GKJH 2L0CA 1GVPA 1UE6A 5J39A 4XQQA 1BXTA 1QB5D 3D8GA 4Y52H 4CGYB 4JBWA 1DD2A 2ICEC 5I2XA 2P2RA 1CK1A 1KNAA 3E6ZX 3U9SA 3KLSA 1BOSA 5FK9C 5KNCA 2AWOA 4XXEA 1SFOB 4DXGA 1R9TB 5G3LD 4A3BG 3KLRA 1G91A 2PZWA 4JI2L 3V69A 4A3GB 1YNJD 4B3TL 1TR5A 1AEXA 1HQMC 4B08A 3I4NG 5KNDA 4DV6H 4QIWE 2EOTA 2GVBA 2VW9A 5LMNL 1SDFA 2K14A 3K7AH 3L2PA 4R9WA 2F0QA 1LTLA 2NTTA 3EN2A 2R93G 4DUZQ 2JQOA 5KEEA 1M90C 4NXML 1EY0A 1IXRA 3TQYA 1HQRD 1ZZKA 5FJ8G 3PF5A 3D6WA 2JEAI 3HOXG 4ULLA 1BUVT 3GR5A 3TZUA 4RCNA 1EIHA 3C1FA 4OX9L 5CBAE 1S03G 1OXTA 2NWGA 3A55A 4YCUA 1ASYA 1D8LA 3QR8A 2Y0SE 4JI3Q 1N34L 1MSHA 2JA5G 4F88A 5M5YB 2VQEL 3IFDA 4H02A 3G6JB 2BE5D 3J80W 4UP9A 1B53A 3BZDB 2IX3A 5FLMG 4BY7G 1XMOQ 3RN2A 4JI5L 2KEDA 2NN6I 4JBJA 5IT9E 4DV0Q 3Q24A 4RHSA 2L1BA 3AB9A 2R7ZG 5GAEC 3A0JA 1TIID 3HG9A 3J7YW 2CWHA 3UOEA 5C3EH 1RTNA 2B2TC 5LL6S 5IGFA 4HJ9A 4X66H 1QZGA 3P1HA 1X32A 3M3YH 4C2MH 1VQKA 3T1HQ 1X65A 3OOCA 2A6HC 1UE7A 3VYRA 4E6IA 1P16A 1IHZA 5C4XB 1TWCB 4JV5Q 1IKMA 2B3GA 4MN3A 4X65H 3NELA 3L7ZC 2PY9A 3KF8B 5JAVA 1KLUD 1Q1BA 1AZPA 1D6EC 4N9PA 1OXVA 2EJMA 5IP9H 2E3UA 5FLXE 2O4CA 4UY8C 3P7JA 1HJPA 1NMFA 4JPBW 1YIJA 1M8AA 1JJCB 4QUCA 2G9DA 1G8ZD 1WD0A 1ENFA 4DK3C 2D2CC 3VR5A 5LL6X 3QG1A 1ZZIA 2LXKA 1IBKH 3PF4A 1U4PA 1IBLH 3T1YH 4C3JG 1I6VC 1N36Q 1K0RA 1DOLA 4IUPA 4OO1H 3GTMB 4PDBA 4IFDI 3JAME 1GO3E 2JA8B 3ULPA 3GTOH 1GHJA 3GTLB 2AMCB 3GV6A 3S2HB 5EAYA 4LUOA 2EYHA 3RD4A 3QD7X 4OWXB 1BCPD 4XDXA 1EYCA 4APVA 2D0OA 3CCQA 2IX0A 3DEPA 1HZAA 4ABNA 3GTQB 4X6AH 4KHPL 4A3LG 2O2LD 1PH5A 2QILA 1A6XA 3ER0A 4B3ML 3S16H 1I4PA 3H0GB 3I8ZA 3K6OA 4DR6Q 1F9SA 5JEAG 2PNRC 4LAAA 4R4CA 1FVIA 3DHQA 3WOFA 2DN8A 1Y1WB 2NUCA 2RSOA 4FJSA 5C4JH 1PHJA 4DR3H 4FO2A 2UUBL 2LS01 4HIOA 3CCJA 3TZDA 5K36G 4YWMA 3T4AC 5EBCA 4LFAH 1X4MA 1PRTF 4ALPA 3HFZB 2EY1A 1I4GA 1S4ZA 3S1NH 1FL0A 1I50H 2OTLA 2WACA 3FHWA 3CCVA 2CPQA 1QNUA 1HR0H 3CMEA 2AUJD 1QWYA 4I7ZC 4HIMA 3PO2B 4K0KL 3CMAA 4DV2H 4G7HC 4DFAA 2CH4A 2PNHA 1SYCA 3MXPA 4NBQA 3IKJA 5J1ZA 3J81j 2F4VQ 1STNA 1FKAH 3RUZA 2B2WA 1Q90A 3OETA 1W3SA 1HNWL 4A3MB 1FYCA 4L63B 5LMUL 4JCVE 3QIAA 1EQQA 3D4WA 2WB1G 4LF7Q 4GNXC 1VQ7A 4TRDA 1IW7C 4O2DA 3PIOA 4IJLA 4OL7A 2HHHH 3V05A 1H95A 2QEXA 1C0AA 1NMGA 4JW0A 3T13A 3NTHA 3H3VC 2UXDL 2UXCL 1VQFA 2RCFA 2M8WA 2A5HA 3SB1A 4LFBH 3HOYH 2Q8RE 4K8JA 2GN5A 2PQUA 2FPHX 3HOWB 4KY6A 3J81c 1EQVA 5CR3A 1LV9A 2QDBA 4J15A 4X62H 3HOZB 5GQOA 5NUCA 5T1GA 1EWHA 5M3MH 1C7YA 3DM1A 3MWYW 1CSQA 5IT9W 1S5BD 1UUPA 2VKCA 2ZXRA 2CW0C 2Z6KC 5DNFA 4DUZL 4JI1H 1AE3A 1X3QA 4NZTM 3PUWA 4NB3A 4CKBA 4OHJA 5ELBA 2VB3X 3H15A 2XN9C 1PVOA 1PTOD 1TS4A 2XNAC 2HIXA 3J80L 4DUYH 4HTHA 3TMEA 5C44H 1D5ZC 1MJCA 3STBD 2A19A 2A8VA 1L0YB 1HZCA 4HAEA 1YEZA 2KENA 2VS1A 4KHZA 2EYLA 4JI7Q 1A3UA 1T9HA 4C3HB 1ET9A 2LMCB 2NVXH 2K05A 5D3DA 2UUCH 2RHSB 1ZYRC 4IFDJ 2DJFC 1K8AC 1V9PA 2ZXOA 1EY8A 2XWJB 1PXUA 1MIUA 2XTIA 3CD6A 2EYOA 1G6PA 1K83H 2R61A 3J7ZC 4BBSH 4J8QA 5FLXW 4DV5H 1KABA 3VR4A 5C3EG 1EIYB 1A15A 3F2UA 4DV6L 3JC66 1GJXA 1EY4A 4LW1A 2R92H 4EQOA 1ESFA 4X64Q 3DWQA 1LM0A 3HZXA 4BBRB 1JB3A 1BO0A 3PV0A 3T56B 4IUTA 5T1IA 3OWEB 3NWSA 1R4QB 1UE1A 1TU2B 2B2TA 2EXDA 4K6DA 3FAUA 5BN3A 3URYA 1A0IA 4AYBB 1VIGA 3L0OA 3JAMW 4Q0FA 1ZTGA 4YY3L 5IP9G 5C0XG 3QWNA 1FGUA 5I4DA 1SRUA 1I94L 1N34H 1XTCD 1YZ6A 2WIIB 4LFCQ 3IRBA 2VQEH 1O78A 1NAPA 2O4XA 1XYIA 4JYAQ 5M3FB 1ODHA 2L4NA 2BOSA 5IYDG 1W2BA 1ET6A 4BY1B 4QUFA 2H1EA 1D7QA 1A63A 3QO2A 4LF6H 3CPWA 5JVH3 3I4LA 4GN3B 1DCZA 2AHOB 4QJFA 4RHRA 4X3TA 4RG1A 4LMQD 5COYA 4PG3A 3N6RA 4KKSA 3BVZA 3KDGA 1TWAH 2PZTA 1RIPA 5EJWA 3S17B 2ID0A 2IT1A 4RGOS 5ISRA 1BBWA 4RGNA 1BCPB 4DR2Q 1WTOA 3KK7A 1TWGH 4IUVA 3ERSX 4DN4M 3EZJA 1HZBA 1VBIA 3HOVB 4DV7H 1EZ8A 1HUMA 2KVMA 3J80c 1D1IA 4X66L 3DLLA 2UXBH 2R93H 4DAMA 2CTMA 1SYGA 1VQ5A 4A93B 2IPKD 2ZJRA 3HOUG 2VXWA 3CC7A 4B3SQ 3GTKH 2LXJA 2WINB 2Y0SG 3H6MA 1MSGA 2BH2A 3OIPA 3NBHA 2KCMA 4CKCA 2KEEA 2ZJQA 4A3DG 1EU4A 1ZZJA 1UWVA 3I4MH 1X0AA 1II3A 3FKIH 3S2DB 2VQFH 3TN2A 5IIFA 3GV3A 2TSSA 2F0LA 1ZEQX 1VQNA 1PLFA 5AJ3Q 2E8GA 2JN4A 4G7ZC 1FGBD 1AFPA 3KLWA 2WFWA 3I56A 3PIPA 2NVTH 4RMFA 3A8IE 4AQYL 3U4VA 3J7AV 3OTOH 2HDMA 1PFSA 2K75A 2PO4A 3M3YB 1Z6HA 1FNUA 1Q8IA 2HH3A 5CV9A 3T1YL 2B2UC 2EPBA 2EDGA 2L15A 1KTKA 1WTQA 4HJAA 3B6YA 3KJPA 4LWCA 5CBEE 2R7ZH 4LF9Q 1D1KA 1SMYD 2UU9Q 3IFTA 3QOJA 1ILQA 1L1OC 1AN7A 1SNMA 4P75A 4A3EH 1WCMB 1JOKA 3NTIA 1E2VA 1CT1D 2F0SA 5BN4A 1GXDC 2OPUA 2YTVA 4MZ9A 2C5CA 1TT2A 3PSIA 1GUOA 2ZM6Q 1KQSA 4R4OA 2A69D 3DEOA 4OCHA 1KDAA 3T16A 1JB7A 1G291 1VQDA 4OO1I 3SVMA 2K01A 2CTKA 1I6UA 3UDXA 3TSSA 3FPUB 2HCIA 4JBKA 4Y7NB 3SE0A 3HOYG 1IBMH 3PO3G 5LL6b 2Z9HA 4TQUS 1OXSC 2PI2E 4GNXA 1N32Q 5LHY1 2A1AA 1A3TA 2KBNA 5JJKA 1X9ZA 2CCZA 4B9XA 3D6CA 1HNZQ 3TDQA 1AP0A 2FMCA 4BXXH 4KKUA 4GLXA 3M7GA 1GOZA 1EYGA 1TWFH 2RDHA 1KL9A 3DUZA 3R3OA 4A3IB 2B63B 5IT9L 4DV1L 4OWTB 5IYBH 3MC0B 2F0NA 1JMCA 4YIJA 2VUMG 2D62A 1PTOB 2F0KA 1FNVA 2B2VC 4C3JH 1JQYD 2B8FA 1A2UA 2ZT9C 5IGBA 4DR4H 1N9WA 1HFGA 1BKBA 3FMCA 4HCSA 3E3XA 1NNXA 1DOMA 4HR7B 4R4TA 3W1BA 3CXCA 2VL6A 1QE6A 4ZRZA 4WALA 1U4LA 5CMDA 1BF4A 3H94A 4GKJQ 4NP5A 2SEBD 1X54A 1P8LA 5BR8L 2BDNA 2Q2IA 1VF7A 4DV3L 1O80A 2YTYA 2Z6KA 4HN7A 1LTBD 4RH6A 5JOBA 1XRHA 1I6HH 2K04A 4NXNQ 3D3RA 2A1SA 3D31A 2L11A 1VF5C 1FD7D 3OHXC 4XTCS 2YU9B 2OQKA 3OMCA 1BQQT 4IPHA 1NE3A 2XVSA 5D14A 1GD7A 5FLXL 4FXKC 3C2PA 4FYDA 4A3LH 4BBSG 3NPPA 3M4QA 1MD2D 3NXWA 2CTJA 4B3RH 1OTCA 4K6LA 4YHHH 3BVGA 4LFBL 4JVHA 1X3GA 1Q46A 2ICIA 3G4SA 4A3KH 1SMXA 2HUGA 1O7LA 1PH2A 3RZDH 1GKHA 5IGCA 3KBGA 3C46A 4HEDA 1D5MC 2OPVA 2QF7A 1VIHA 4GKKH 1Y69U 4KHVA 4X62L 4DR5Q 1HNXH 1J5EQ 3JAML 3CCEA 2KOLA 2CFMA 4KJNA 4RGTA 3CPFA 4EQPA 1SBBB 4MNOA 2C35B 4R8NA 3CF5A 2N49A 1NUCA 1VQGA 1TUAA 1UAPA 3ZYYX 1LO5D 3I90A 4JI1L 5DEHA 1TWHH 1PRTC 3PCOB 4KD3A 4M8AA 4LF8H 1X55A 3NQTA 2Q2TA 4K5VA 1VQPA 3TRZA 1JORA 3D4DA 1Y1VB 4DUYL 4YCVA 5EKLA 1WTHA 1PV4A 4GOPC 1LTAD 5D3IB 4G08A 4DK1A 2B2YA 1AH9A 4AIMA 2V4DA 5L37A 4A3FB 4CDCC 3AU7A 1IL2A 1HH2P 1TS3A 5IT9c 3S1MH 2A6EC 4QGUA 2L9HA 4JI8H 4B8CD 2UUCL 1ML0D 1EFID 1IYJB 1JCKB 1QJOA 4R4IA 1PH8A 1B50A 3LNNA 3K0XA 5E4XA 3ZJYC 2E2IH 5EQ0A 5HGTA 1E7ZA 2E5LQ 1VQAA 4I7AA 2O5JC 1BVSA 1JICA 3GO5A 4DV5L 1EIFA 2E2HB 4TKOB 1YNJC 3DM3A 3VR6A 4P74A 3A7AB 2ZQEA 4H8AA 5C44B 5M5XB 1V1PA 1J9OA 2R6GA 4DK6C 3MTSA 4BS9A 4X3KA 4HIKA 4ME5A 3I7FA 2JA7H 3K5NA 1KHIA 1LT3D 3W3AA 3I55A 2NZOA 1EWIA 3IL8A 3OW2A 3NTKA 2YQRA 3EBEA 3R2TA 4YY3H 1YNNC 3GTGB 5GAGC 3I4MG 2UUAH 2RF4A 4X65Q 3FKIG 5GADC 1CKOA 2F0GA 2Q8TA 4O0AA 1I94H 1SLJA 1FNWA 1U4RA 4NDXA 1K83B 3J80i 1X4NA 2MJ8A 1S5CD 1SNOA 1VQOA 3VA7A 2PMZB 2DGRA 1VQLA 4DR7H 2JA9A 4L5SA 3HRZC 4G4KA 4B9WA 1HFNA 4JI6H 2R92B 4DU9A 2F3IA 1ASZA 1IBKQ 1RF2D 1FJGQ 4ZCKA 4J1MA 1Q86C 1C8CA 1IBLQ 2F0FA 5EKIA 3JAMc 2MUYA 4LF6L 1CM9A 1PMRA 5IYCG 1HTPA 1PFMA 1V8QA 3MAQA 3SXHA 3A54A 4A3EG 2B2UA 1PH3A 5E7NA 1CQFA 1HXYD 4MTNA 1ENCA 2K1BA 5ELOA 1CSPA 3S1QH 4IO9A 3NSWA 1SE8A 4JOIC 4DV7L 1B44D 2UXBL 2LTLA 5KRUA 1SR3A 2MO0A 3OIQA 2JYOA 5IY0A 2RKSA 1E1OA 5HURA 1LTRD 4LF4Q 1N33Q 1S3OA 1ILPA 1L1OA 5EKKA 2I0QA 4RGMA 1G2TA 1WTPA 2A6HD 4IN3A 3SDZA 3CAMA 1WTWA 1NBWA 5J3BA 4A3BB 1DONA 4LIJA 1GHKA 1UE5A 5C0XH 1EEFD 5A2QE 2IL8A 2LSSA 1BDOA 3HP3A 2VQFL 2NZ1D 3UDIA 3I4NB 4KJOA 1PH1A 4BXXG 1VQ4A 1I5FA 3NHHA 4AQYH 4DR3Q 5IYDH 1V43A 1D2BA 3I0PA 2DY8A 2WP8J 5IYBG 2NVQB 1WFQA 4DXFA 2K52A 1U5KA 2WKDA 3CHBD 4LFAQ 2CWFA 3OTOL 4LF5Q 3H3VH 1EY5A 5FKAC 4K8IA 3J7AK 5GROA 4JI3H 1PZJD 3GTKB 1GUTA 5IWAQ 3A7LA 4EQNA 3X3MA 1HR0Q 3GQBA 3VR2A 5DM63 4N8X1 3HOXB 4AH6A 4DV2Q 3FVQA 1LUZA 1F0XA 2FFMA 2B2VA 2Z1CA 1XNQQ 4K5XA 3CQZH 2KCCA 3ONAB 2NVYB 3EROA 3HGBA 1IYVA 1GUSA 3S14H 5ELDA 3CKIB 4DV0H 4JI0Q 4JK1C 1U9RA 4RAUC 4POFA 2JA5B 4PZ8A 2ENBA 3GTPH 2CTLA 1H9KA 3QOLA 3HOUH 1U0LA 4S3SA 2Z4IA 3RNUA 4L5TA 2HHHQ 4YWLA 3TP7A 3HOZG 4POGA 4BY7B 2QNDA 4A3DH 3A8JE 4FJUA 1B8AA 1JT8A 3BS1A 4KTAA 1XMQQ 1IBML 4LFBQ 1MGSA 5KIXA 1E3PA 4A3KG 1QZHA 3T1HH 1AZQA 3S15B 4KLKA 1CKNB 1I4HA 2F0JA 2AXYA 4DV1H 3DMUA 4DV4Q 1L2FA 1STYA 5D65A 4C3IH 3AMUA 4JI4L 4DR1Q 3VYUA 1H9JA 4DAPA 1CKNA 3K57A 4IQZA 1XTDA 4OIJA 3UDGA 1E2WA 2IWHA 4KV6A 4DR4L 1EY6A 3MA2B 2PQAA 4ID6A 5HGQA 2Z0SA 2F0UA 5BR8H 4TSSA 4DV3H 1SYBA 3MFYA 4IURA 4L8JA 1SNDA 2I5HA 4YCWA 4NKLA 4A3JH 2K1HA 4IALA 4HJ8A 3U4ZA 2LTMA 2E2JH 1WOCA 2XIWA 3OYYA 5G3LF 1WYDA 1JJGA 1S5FD 4ME3A 4JI2Q 4NW2A 4B3TQ 4GOPA 2JA6G 3VDYA 4IUQA 4DAVA 4K5WA 3PO3H 1H9SA 4B3RL 4DV5Q 5LMNQ 4YHHL 2KHSA 3AFPA 2E75C 2A68D 5M5WH 1S5ED 5EBDA 1PYWD 1YJNA 3E5SA 3RZOB 3KF6B 3C1EA 4DA2A 5KYLA 1TVXA 1CZGA 2J0TD 3FRPB 4ODGA 4NXMQ 4GKKL 2JA7G 1VCIA 2XSCA 3M7NA 1IZ6A 1HNXL 3DWPA 4DR6H 2VUMH 3U50C 1G51A 3GP7A 2NTSA 1PH6A 1J8IA 1HRJA 1PDQA 2I07B 4OX9Q 3PUXA 2OXPA 5JJIA 5DM73 3KF6A 4BY1G 4C56C 3I4OA 4WJWA 2MO1A 2JE6I 2CW0D 3CW2C 2F0DA 3AFQA 1N34Q 4LF8L 1JE4A 2Q2UA 1LTGD 4P73A 2VQEQ 4A3GH 2F52A 1BBXC 3NK9A 3R2IA 1BBUA 4LUZA 1VMPA 1PTOC 1ZXTA 4KD4A 3MXNA 1ESRA 3STBC 4JI5Q 2MPMA 4L6TB 4LF6Q 4JI8L 1Q12A 2EJGC 4KN4C 1J4WA 5IODA 4A93G 1STBA 1KNEA 1ZYRD 4EQ5A 1HA5A 5A2QW 1XWEA 4XQNA 4GS3A 1YHBA 1I3QB 4LF7H 3UE0A 3BJUA 2EJFC 1XNRL 1DM0B 4BWGB 3K5LA 3CC2A 2EYJA 1EC6A 1VQIA 1SNCA 2BH8A 2PW7A 3JAMi 3MEFA 4QCLA 2JP1A 4P72A 5CV6A 1RTOA 1Z2IA 3G71A 4C1NK 1X56A 3W2DA 1Y8NB 4UP7A 1V8CA 1STEA 4JOIA 2WB1B 2M00A 1PH9A 3L3OC 2ZTCA 2UUAL 4AM3A 3CCMA 4UDUC 2HD3A 3A5ZB 3J81E 1XPRA 5FO9B 2MGSA 2E2IB 2K32A 2RSNA 5C4HA 3F8TA 3I72A 2WKCA 2V1CC 2KJXA 3K7AB 2K28A 2HIVA 5C3XA 1HTLD 2K5QA 4F8MA 2BA0A 2PI2A 4DR7L 4CDDC 4JI6L 5K5PA 1HHVA 5C3WA 4Q5VA 2ASBA 1WVNA 4UP8A 1CUKA 3TEHB 2R7DA 2SOBA 2MHVA 1JR0D 1X3PA 5DAUA 2VY3A 3G6EA 1LTID 4JI7H 1WE8A 3EJIA 3ITPA 3KJOA 3S1RH 3U9OA 3NBHB 1NSNS 1TWCH 4A4IA 3M9BA 3NCVA 1TXYA 2HDLA 2QCPX 1BCPF 4Z9CB 2I5LX 4X3UA 4HJ7A 3TP8A 3OWFA 3CCLA 4KHPQ 1Q8KA 1E1TA 1YJ9A 4B3MQ 4X64H 1DOKA 1O7IA 1MKHA 2RVLA 1PFBA 2KHJA 1DTJA 4R4QA 4WJ3M 3BDLA 1PYBA 4M1UB 2K5WA 5C5LA
chains in the Genus database with same CATH topology
3O13A 1IYUA 2EYMA 2UUBQ 5C3EB 5AFWA 3KUPA 1V1OA 5EPLA 3U58A 3GTMH 2KCNA 4U68A 5HY6A 3H91A 5E1FA 2DUDA 2JA8H 1NR2A 1DZ1A 3VR3A 3GTLH 3S2HH 2OTJA 2EY2A 4OONA 4C3IG 1XPUA 1GUGA 4C2MB 1ENAA 3KFUA 3BVMA 3MFGA 1J6QA 1SN8A 3F1ZA 2KHIA 1K8OA 1C9OA 3UDFA 3CP0A 3L9AX 3HKZB 3H09A 4JI3L 5EPJA 4IOCA 4HSPA 3FPPA 3CRLC 4K0KQ 1CFMA 3N52A 5IYCH 5JEAJ 5C0XI 2PZUA 1YNXA 1PZKD 4DF7A 4ZLTF 4UAIA 2AKWB 1XXGA 2L12A 1AE2A 1E22A 1LTSD 3GTQH 4WRDA 4A3JG 1B1ZA 3M4PA 4IUNA 3NWTA 1YHAA 3TS0A 1HNWQ 1T5EA 1XMOL 3MXGA 1EWCA 5LMUQ 1F9PA 3RMHA 1SMYC 4FF3A 4DV0L 4FDBA 4GNXB 3H3VI 1EY7A 1H9MA 3FEWX 3J7AF 2MFIA 3NENA 1RD9D 3WOEA 2UXDQ 3GDEA 2UXCQ 1RODA 2SDFA 3MEHA 1U4MA 2ZJPA 2JVZA 1B3AA 1K8GA 3K0YA 3OMGA 1SXTA 5CV8A 3AQQA 3GTOB 3TBIB 3T1HL 1I4XA 5IGDA 1X9NA 1LYLA 1B7YB 2A74C 4LJZC 1JOQA 3PO2H 1N8RC 4FNFA 1EIGA 1WD1A 2OQ0A 1CA5A 4DK0A 4XQJA 5KYIA 4LUVA 4AYBE 3CCSA 5EGTA 3GTPB 4QL5A 4RA8A 3HOUB 4WJ4A 1EQRA 2Y0SB 4A3MH 4A3FG 1PTOF 4DNTB 4CHTB 1MI2A 3S16B 2QA4A 2IX1A 2JK8A 4A3DB 2PPBC 2ANNA 2H4OA 1PZID 4A3GG 5E3FA 3PUZA 4QQBX 5FO8B 1F2ZA 4WANA 2XGTA 1N36L 5C4JB 4FF1A 2K33A 2EXZA 4JBMA 2EE1A 2XWBB 2IY5B 3HOWH 2YYZA 3M4YA 5A2QL 3SR1A 3S1NB 1I50B 1KDBA 3Q6SA 3AEVB 3ICEA 3Q23A 3HOZH 1JE5A 1R4PB 2MNAA 4R8IA 4DV6Q 2FINB 1QVFA 2SNMA 4DKAC 2D0PA 1VQ9A 2IJ0A 1K1GA 5H1SE 2F0EA 3AEVA 2B29A 1HCZA 2XRSD 1SSOA 2N8NA 4DR6L 2J7ZA 2VZAA 1EEID 4YY3Q 2JXMB 4XT1B 1DT4A 1CKMA 1O7ZA 3KDFA 1NTGA 5I6WA 3WWVA 2M2LA 3CU7A 1C48A 2K5VA 4C3HH 3RLFA 3PIO3 1I94Q 5KGUA 3HOYB 1DGSA 1DYQA 1S40A 3BDOA 1PRTD 1KAAA 4RWSC 3KBXA 2N78A 3A56A 1EL0A 5JJLA 4JVYA 1VQHA 1SJHD 3EA6A 2ANRA 1LLRD 2JSOA 1PH7A 3EFXD 3HKZE 3VA5A 4FVMA 5M3MB 3W1GA 5A35A 4CJ2C 3UI2A 2VUMB 2F4VL 1V1PB 3NEMA 5C0XJ 2A6ED 1VQCA 3SK6A 4BBRH 2JA6H 2E76C 1KD1C 2EQSA 2VNUD 5GAHC 4RFBA 1STHA 4RKBA 2RBMA 5C4XG 1RCVD 2KA7A 1F9QA 1QNKA 4PZ6A 3OW7A 1EYAA 1NR4A 3HKSA 2CHBD 4DPGA 4LF7L 4X66Q 1TS5A 4N9TA 2FMRA 1WVLA 2JJQA 1J5KA 3Q8DA 1SE3A 2F0WA 1G2SA 2O5IC 2HH2A 4V0BA 5CYUA 4DAYB 3MZ5A 2CWPA 3Q0AA 2NVXB 3MHBA 5M3FH 5EPKA 1VS0A 5FLXc 5IGGA 3M4OH 1BNZA 1GUNA 1HPCA 3NE5B 1YNND 4O1NA 4BY1H 2BCOA 3HS0C 4G57A 2X6GA 4BBSB 2F0MA 1VQJA 4DAYA 3S9WA 3EIVA 5IGEA 1Q7YC 4IOAA 2XRQD 2OEOA 3D4RA 2JA8G 4FXGC 5IE8A 3PMFA 4AQYQ 4IFDG 1VQ8A 5M9OA 1SNPA 1B4OA 1KHMA 3S17H 1Y8PB 1E0BA 4FP5D 5KNBA 3T1YQ 4FF4A 3SK5A 4GZYC 3HOVH 2BE5C 2WAQB 2ALYB 3BYYB 4C1NI 4A93H 1VQ6A 1JC7A 3M85A 1V1QA 1L1OB 4CJ1B 4JI7L 2AQ1B 1B70B 4IPCA 2CVRA 4PMWA 4BA1I 4QB4A 3F2BA 1STAA 2F0IA 3R93A 3TP6A 1Z9FA 1SJED 4PMBA 3H0GG 1FR3A 1BR9A 4K14A 4KN7C 1QUQB 1X3EA 4KKTA 2FXQA 3S2DH 5C6AA 1D5XC 2QKIC 3D0FA 4CJ0B 1HZ9A 2K03A 1Y1WG 4IZ8A 1W6KA 4WORA 5JPNC 1QILA 2AWNA 4KY5A 2VB2X 1T5XD 3C3LA 3LWEA 1PH4A 4X64L 3NP8A 1QUQA 2FHTA 1TWAB 4G7OC 5FO7B 1SEBD 4EVOA 3S1RB 3ERQA 3PO2G 1TWGB 4EX5A 3LWUA 4PMCA 4QF4A 3K5OA 4DV1Q 4A3CG 2N55A 3CCRA 1SE4A 2R93B 4R1JA 3P20A 2SNSA 2OCEA 2PCFB 3IAYA 4B8TA 1WCMH 4A3MG 3BZKA 1KIXA 4LFCL 4X3SA 2RQXA 4XIGS 4U673 1VDZA 4JYAL 3GTJH 2F3WA 2KCTA 3BYTB 2X69A 4XYQA 3I4MB 2GVAA 3FKIB 3KF8A 2NBFA 4H0LC 5BR8Q 4DV3Q 2PW5A 3TS2A 2ATWA 4NPSA 2R3ZA 1VQBA 2MP1A 4XYOA 1XJVA 1Q3LA 1JWSD 2TMPA 2Z4HA 1HA6A 4Y7NH 1SYDA 2HQEA 2F0PA 3I3CA 1K3RA 1F2MA 4CBVA 1JJ2A 2NVTB 3HOWG 4HMJA 5FOBB 2DY7A 4K2KA 3K5MA 4PNYA 4DNRB 3J81L 3PIP3 1Y8OB 1YBYA 4DR2L 4ZUIA 5CC4A 2F3VA 1BCPC 3E0EA 5I9PA 3CC4A 4A3IH 5E4WC 2B63H 3F2CA 2R7ZB 3VYTA 5I6YA 1PTOH 5C5MA 1GM5A 1OO9B 3EQLC 4O42A 2RHQB 2QEJC 1RJTA 4B3SL 1TY0A 4F7XA 1TY2A 3SK4A 2PQAB 1JWMD 5IP7H 1M4VA 4A3EB 2KUMA 2FMMA 4X62Q 2HT1A 3HEJA 4L5RC 2K50A 3RLNA 4HCEA 1G6ZA 4KMUC 1WI5A 3SEBA 1B2TA 4DNIA 2NYZD 1B9MA 1AW7A 5JVG3 2IHEA 1O7YA 4JI1Q 1PRTB 4C3HG 2JZXA 2F0VA 2PYKA 5AJ3L 1RL2A 1ICWA 2YU9H 2ZTEA 2BDOA 4TVAB 4HMIA 1I4RA 4HJ5A 2PMZE 3K81C 1MJEA 4IPDA 4DUYQ 4GOPB 4FXDA 2K5DA 1QVGA 3A74A 1H9SB 1UEAB 1TKWB 2ES2A 1TWFB 1YHQA 2LKVA 1SE2A 1L0WA 2UUCQ 5JPMC 2WAQE 4IJHA 4LF9L 4QMFB 3J7A5 2HCCA 4DGZA 2LFNA 3E9IA 4BBRG 2MQHA 1NJIC 2UU9L 4C3JB 1IW7D 4CKEA 3SHLA 1VMCA 3U1KA 4KK7A 2D5DA 1LTTD 3V96A 1Q82C 1WTRA 1XX8A 4AYBG 1NCVA 2ZM6L 3LX0A 1Z47A 4IPGA 4YWKA 2K5NA 1I6HB 4ZQ3A 1EOTA 2HQLA 1NY4A 2A68C 1IL8A 3K8AA 1X6OA 1CTMA 3E9HA 5M3FG 1TS2A 1PA6A 1Y1VH 1N32L 5I9OA 3FDTA 4RCOA 1HNZL 4H13C 2X6LA 4A3FH 3K59A 4PV1C 3MXNB 1SFOH 3A5UA 1R9TH 4GN4B 1KLGD 2L5TA 4A3KB 1CQVA 3MXUA 3RZDB 3E0JA 2AQ2B 1QVCA 3KOJA 2YV5A 5JJZA 4A76A 3I91A 3HOVG 3BG3A 2E2HH 2BL5A 4GKJL 2N3SA 1HR0W 1YITA 3NQIA 2G9HD 4ZUJA 1F2YA 4HSVA 5M5XH 1VQMA 3SK8A 4KI0A 3V2TA 4NXNL 1A8VA 1RHPA 1TWHB 2B39A 3MVVA 4V190 3RN5A 2AUKA 2L55A 1UEBA 2IHFA 3GTGH 4DV7Q 3QJYA 4GLAC 4A75A 2UXBQ 2QGQA 1TQOA 1EFWA 5CGKA 3VYSA 1YJWA 2GA4B 3K7UC 2OWOA 2ZXPA 4LK1C 3S1MB 5M5YH 2PQEA 1ONLA 4EGVA 1KDCA 3ULJA 1STGA 1VQEA 5ELNA 2VQFQ 2JA6B 1LACA 1CHPD 5ELFA 4DR5L 2JEBI 3HKZG 2C9OA 1J5EL 1IKLA 3I70A 1SNQA 2EIFA 2F4IA 2F0OA 2NN6H 1EZ6A 4QMGA 3OTOQ 4F87A 3K80C 3PUYA 2B2YC 3VKEA 1WCMG 3ND9A 4GLVB 2JA7B 4LNQA 1Q1EA 3TREA 4P2CB 3SGIA 5F2DA 2FJ2A 1XPOA 5ELCA 1Z7TA 2AQ3B 3TP5A 3M4OB 4ZKCB 1A2TA 5C4XH 1HUNA 4XT3B 1JOOA 2IW3A 4OO1G 1EU3A 2M9VA 2K7VA 4P71A 4A3BH 1F9RA 3BU2A 2CTEA 3I73A 3G48A 3ND8A 1AN8A 1K73C 3I4NH 4ZYSA 2E5LL 1K8MA 2Z8LA 4WFN3 4A3IG 1PYSB 2B63G 2E74C 1M1KC 2NVQH 3OPOA 4PQXA 1IBMQ 1SYEA 2F03A 5LMNW 1SYFA 2EY5A 1EUJA 5IP7G 1SAPA 1WTXA 1DJRD 1YVCA 5FJ8H 1EQTA 4H7BA 3EVQA 3S1QB 3HOXH 4IFDH 4HIDA 2OT2A 1EY9A 4X65L 4UPAA 2DGYA 4I65A 4JI4Q 4L5QA 3UE1A 1LT4D 1SROA 2NVYH 5CV4A 2CQOA 3X3NA 4DR4Q 4FF2A 1KRSA 3G7LA 4JC0A 2CWAA 1KXLA 4OIKA 3PGZA 4NMZA 1S72A 4QY7A 2JA5H 1LABA 1CHQD 1A62A 2CKZB 3RLOA 1IBKL 2I46A 1FJGL 5FLMH 1OXUA 2KQ3A 2NB0A 1IBLL 4BY7H 3H0GH 5I2YA 1ZKOA 3S24A 1E24A 5BN5A 1L0XB 2EVBA 1Y1WH 3S15H 3Q22A 1RKNA 3CRKC 5TSSA 4OWWB 1CZWA 3W5OA 4QIWB 4J6HA 2K4KA 2R7FA 3FP9A 2F0HA 4B3RQ 2A69C 2NZHA 4YHHQ 3J80E 3GTJB 5DLQE 4KY7A 1A3VA 2E2DC 2DNEA 1WTVA 4LF4L 4ILWA 1H9RA 1N33L 3T53B 3CQZB 3GD7A 4JV5L 4GKKQ 2RDFA 3S14B 4PZ7A 4MHEA 4K2LA 4A3CH 3ULLA 1HNXQ 1UNSA 1X3FA 3I2ZA 1Y1VG 4ZK9B 2WB1E 1F2LA 2OF1A 1K9MC 3WDNA 2RDGA 4BA2I 2F0TA 3OSOA 1QCBD 4H44C 2CQAA 3PUVA 1JWUD 1E2ZA 3RR5A 3K58A 4DR3L 1RDPD 4LF8Q 2KECA 5M3MG 1QG7A 3BDCA 4LFAL 4LF5L 2EYFA 5ELEA 1PFNA 4GN5A 4RKLA 1LT5D 5IWAL 2LY7A 1C4QA 2BA1A 2EZVA 1HR0L 1S5DD 5C4ZA 3J81i 3LGJA 4JI8Q 4MIUA 4DV2L 4JG2A 3AYHB 5C44G 4C3IB 5J22A 4ZAIA 2B8GA 2D9UA 3RZOH 1I4QA 3A8KE 1XNQL 2F1MA 1CI3M 2RA4A 2J4XA 2N88A 1CA6A 2I5MX 1MBYA 4JI0L 4IUUA 2K5HA 3KYHC 1OXXK 4ZKBB 5CORA 1EOVA 1XNRQ 1Y14B 1YI2A 1Q81C 3KDFB 3T51B 1WJJA 2Q8IB 1KAWA 5CV7A 1GUWA 1W6JA 4A3JB 3NBIA 2HHHL 2H5XA 2E2JB 3KLSX 1XMQL 1B9NA 1QOHA 3NUCA 2YTXA 5JEAH 1DXMA 2R92G 2A73B 4OXPA 2UUAQ 5IOCA 4OGQC 3F2DA 3DXJC 3P75A 1LT6D 1KC8C 1F77A 3CCUA 2EY6A 2MJHA 2FFKB 2EYPA 3PO3B 5K36H 2DNCA 4DV4L 2WAQG 2K6AA 2ZTDA 2Q2HA 4DR7Q 1EYDA 2NN6G 4JI6Q 5M5WB 2B2WC 3BZCA 3QB3A 4DR1L 3R8BA 1KRTA 2WV6D 5CV5A 2RCNA 3DWAA 2CTFA 1I3QH 2L0CA 1GVPA 1UE6A 5J39A 4XQQA 1BXTA 1QB5D 3D8GA 1DD2A 4CGYB 4JBWA 4Y52H 2ICEC 5I2XA 2P2RA 1CK1A 1KNAA 3E6ZX 3U9SA 3KLSA 1BOSA 5FK9C 5KNCA 2AWOA 4XXEA 1SFOB 4DXGA 1R9TB 5G3LD 4A3BG 3KLRA 1G91A 2PZWA 4JI2L 3V69A 4A3GB 1YNJD 4B3TL 1TR5A 1AEXA 1HQMC 4B08A 3I4NG 5KNDA 4QIWE 2EOTA 2GVBA 2VW9A 5LMNL 1SDFA 2K14A 3K7AH 3L2PA 4R9WA 2F0QA 1LTLA 2NTTA 3EN2A 2R93G 4DUZQ 2JQOA 5KEEA 1M90C 4NXML 1EY0A 1IXRA 3TQYA 1HQRD 1ZZKA 5FJ8G 3PF5A 3D6WA 2JEAI 3HOXG 4ULLA 1BUVT 3TZUA 4RCNA 1EIHA 3C1FA 4OX9L 5CBAE 1OXTA 2NWGA 3A55A 4YCUA 1ASYA 1D8LA 2Y0SE 4JI3Q 1N34L 1MSHA 2JA5G 4F88A 5M5YB 2VQEL 3IFDA 4H02A 3G6JB 2BE5D 4UP9A 1B53A 3BZDB 2IX3A 5FLMG 4BY7G 1XMOQ 3RN2A 4JI5L 2KEDA 2NN6I 5IT9E 4JBJA 4DV0Q 3Q24A 4RHSA 2L1BA 3AB9A 2R7ZG 5GAEC 3A0JA 1TIID 3HG9A 3J7YW 5C3EH 1RTNA 2B2TC 5LL6S 5IGFA 4HJ9A 1QZGA 3P1HA 1X32A 3M3YH 4C2MH 1VQKA 3T1HQ 1X65A 3OOCA 2A6HC 3VYRA 4E6IA 1UE7A 1P16A 1IHZA 5C4XB 1TWCB 4JV5Q 1IKMA 2B3GA 4MN3A 3NELA 3L7ZC 2PY9A 3KF8B 5JAVA 1KLUD 1Q1BA 1AZPA 1D6EC 4N9PA 1OXVA 2EJMA 5IP9H 2E3UA 5FLXE 4UY8C 3P7JA 1HJPA 1NMFA 1YIJA 1M8AA 4QUCA 1JJCB 2G9DA 1G8ZD 1WD0A 1ENFA 4DK3C 2D2CC 3VR5A 5LL6X 3QG1A 1ZZIA 2LXKA 3PF4A 1U4PA 4C3JG 1I6VC 1N36Q 1K0RA 1DOLA 4IUPA 4OO1H 3GTMB 4IFDI 3JAME 1GO3E 2JA8B 3ULPA 3GTOH 1GHJA 3GTLB 3S2HB 3GV6A 2AMCB 5EAYA 4LUOA 2EYHA 3RD4A 4OWXB 1BCPD 4XDXA 1EYCA 4APVA 2D0OA 3CCQA 2IX0A 3DEPA 1HZAA 4ABNA 3GTQB 4X6AH 4KHPL 4A3LG 2O2LD 1PH5A 2QILA 1A6XA 3ER0A 4B3ML 3S16H 1I4PA 3H0GB 3I8ZA 3K6OA 4DR6Q 1F9SA 5JEAG 2PNRC 4LAAA 4R4CA 1FVIA 3DHQA 3WOFA 2DN8A 1Y1WB 2NUCA 2RSOA 5C4JH 1PHJA 4FO2A 2UUBL 2LS01 4HIOA 3CCJA 3TZDA 5K36G 4YWMA 3T4AC 5EBCA 1X4MA 1PRTF 4ALPA 3HFZB 2EY1A 1I4GA 1S4ZA 3S1NH 1FL0A 1I50H 2OTLA 2WACA 3FHWA 3CCVA 2CPQA 1QNUA 3CMEA 2AUJD 1QWYA 4I7ZC 3PO2B 4HIMA 4K0KL 3CMAA 4G7HC 4DFAA 2PNHA 1SYCA 3MXPA 4NBQA 3IKJA 5J1ZA 3J81j 2F4VQ 1STNA 3RUZA 2B2WA 1Q90A 1W3SA 1HNWL 4A3MB 1FYCA 4L63B 5LMUL 4JCVE 3QIAA 1EQQA 3D4WA 2WB1G 4LF7Q 4GNXC 1VQ7A 4TRDA 1IW7C 4O2DA 3PIOA 4IJLA 4OL7A 3V05A 1H95A 2QEXA 1C0AA 1NMGA 3T13A 3NTHA 3H3VC 2UXDL 2UXCL 1VQFA 2A5HA 3HOYH 2Q8RE 4K8JA 2GN5A 2PQUA 3HOWB 4KY6A 3J81c 1EQVA 5CR3A 1LV9A 2QDBA 4J15A 3HOZB 5GQOA 5NUCA 5T1GA 1EWHA 5M3MH 1C7YA 3DM1A 3MWYW 1CSQA 1S5BD 1UUPA 2ZXRA 2CW0C 5DNFA 2Z6KC 4DUZL 1AE3A 1X3QA 3PUWA 4NB3A 4CKBA 4OHJA 5ELBA 2VB3X 3H15A 2XN9C 1PVOA 1PTOD 1TS4A 2XNAC 2HIXA 3J80L 4HTHA 3TMEA 5C44H 1D5ZC 1MJCA 3STBD 2A19A 2A8VA 1L0YB 4HAEA 1HZCA 1YEZA 2KENA 4KHZA 2VS1A 2EYLA 4JI7Q 1A3UA 1T9HA 4C3HB 1ET9A 2LMCB 2NVXH 2K05A 5D3DA 2RHSB 1ZYRC 4IFDJ 1K8AC 1V9PA 2ZXOA 1EY8A 2XWJB 1PXUA 1MIUA 2XTIA 3CD6A 2EYOA 1G6PA 2R61A 1K83H 3J7ZC 4BBSH 4J8QA 1KABA 3VR4A 5C3EG 1EIYB 1A15A 3F2UA 4DV6L 3JC66 1GJXA 1EY4A 4LW1A 2R92H 4EQOA 1ESFA 4X64Q 3DWQA 1LM0A 3HZXA 4BBRB 1JB3A 1BO0A 3PV0A 3T56B 4IUTA 5T1IA 3OWEB 3NWSA 1R4QB 1UE1A 1TU2B 2B2TA 4K6DA 2EXDA 5BN3A 3URYA 1A0IA 4AYBB 1VIGA 3L0OA 4Q0FA 1ZTGA 4YY3L 5IP9G 5C0XG 3QWNA 1FGUA 5I4DA 1SRUA 1I94L 1XTCD 1YZ6A 2WIIB 4LFCQ 3IRBA 1O78A 1NAPA 2O4XA 1XYIA 4JYAQ 5M3FB 2L4NA 2BOSA 5IYDG 1W2BA 1ET6A 4BY1B 4QUFA 2H1EA 1D7QA 1A63A 3QO2A 5JVH3 3CPWA 3I4LA 4GN3B 1DCZA 4RHRA 4X3TA 2AHOB 4QJFA 4RG1A 4LMQD 5COYA 4PG3A 3N6RA 4KKSA 3BVZA 1TWAH 2PZTA 1RIPA 5EJWA 3S17B 2ID0A 2IT1A 4RGOS 5ISRA 1WTOA 4RGNA 1BCPB 1BBWA 4DR2Q 3KK7A 1TWGH 4IUVA 3ERSX 4DN4M 1HZBA 3HOVB 1EZ8A 1HUMA 2KVMA 3J80c 1D1IA 4X66L 3DLLA 2R93H 4DAMA 2CTMA 1SYGA 4A93B 1VQ5A 2IPKD 2ZJRA 3HOUG 2VXWA 3CC7A 4B3SQ 3GTKH 2WINB 3H6MA 2LXJA 2Y0SG 1MSGA 2BH2A 3OIPA 3NBHA 4CKCA 2KCMA 2KEEA 2ZJQA 4A3DG 1EU4A 1ZZJA 1UWVA 3I4MH 1II3A 3FKIH 3S2DB 3TN2A 5IIFA 3GV3A 2TSSA 2F0LA 1ZEQX 1VQNA 1PLFA 5AJ3Q 4G7ZC 2E8GA 1FGBD 1AFPA 3KLWA 2WFWA 3I56A 3PIPA 2NVTH 4RMFA 3A8IE 3J7AV 3U4VA 4AQYL 2HDMA 1PFSA 2K75A 2PO4A 3M3YB 1Z6HA 1FNUA 1Q8IA 2HH3A 5CV9A 3T1YL 2B2UC 2EPBA 2EDGA 2L15A 1KTKA 1WTQA 4HJAA 3B6YA 3KJPA 4LWCA 5CBEE 2R7ZH 4LF9Q 1D1KA 1SMYD 2UU9Q 3IFTA 3QOJA 1ILQA 1L1OC 1SNMA 4P75A 4A3EH 1WCMB 1JOKA 3NTIA 1E2VA 1CT1D 2F0SA 5BN4A 1GXDC 2OPUA 2YTVA 4MZ9A 2C5CA 1TT2A 3PSIA 1GUOA 2ZM6Q 1KQSA 4R4OA 2A69D 3DEOA 1KDAA 3T16A 1JB7A 1G291 1VQDA 4OO1I 3SVMA 2K01A 2CTKA 3UDXA 3TSSA 3FPUB 2HCIA 4JBKA 4Y7NB 3SE0A 3HOYG 3PO3G 4TQUS 1OXSC 2PI2E 4GNXA 1N32Q 5LHY1 2A1AA 1A3TA 2KBNA 5JJKA 2CCZA 4B9XA 3D6CA 1HNZQ 3TDQA 1AP0A 2FMCA 4BXXH 4KKUA 4GLXA 3M7GA 1GOZA 1EYGA 1TWFH 2RDHA 3R3OA 3DUZA 4A3IB 1KL9A 2B63B 5IT9L 4DV1L 4OWTB 5IYBH 3MC0B 2F0NA 1JMCA 4YIJA 2VUMG 2D62A 1PTOB 2F0KA 1FNVA 2B2VC 4C3JH 1JQYD 2B8FA 1A2UA 2ZT9C 5IGBA 1N9WA 1HFGA 4HCSA 3FMCA 1BKBA 1DOMA 4HR7B 4R4TA 3W1BA 3CXCA 2VL6A 1QE6A 4ZRZA 4WALA 1U4LA 5CMDA 1BF4A 3H94A 4GKJQ 4NP5A 2SEBD 1X54A 1P8LA 5BR8L 2BDNA 2Q2IA 1VF7A 4DV3L 1O80A 2YTYA 4RH6A 4HN7A 1LTBD 2Z6KA 5JOBA 1I6HH 2K04A 4NXNQ 3D3RA 3D31A 2L11A 1VF5C 1FD7D 3OHXC 4XTCS 2YU9B 3OMCA 2OQKA 1BQQT 4IPHA 1NE3A 2XVSA 5D14A 1GD7A 5FLXL 4FXKC 3C2PA 4FYDA 4A3LH 4BBSG 3NPPA 3M4QA 1MD2D 3NXWA 2CTJA 1OTCA 4K6LA 3BVGA 4LFBL 4JVHA 1X3GA 1Q46A 2ICIA 3G4SA 4A3KH 1SMXA 2HUGA 1O7LA 1PH2A 3RZDH 1GKHA 5IGCA 3KBGA 3C46A 4HEDA 1D5MC 2OPVA 2QF7A 1VIHA 1Y69U 4KHVA 4X62L 4DR5Q 1J5EQ 3JAML 3CCEA 2KOLA 2CFMA 4KJNA 4RGTA 3CPFA 4EQPA 1SBBB 4MNOA 4R8NA 2C35B 3CF5A 2N49A 1NUCA 1VQGA 1TUAA 1UAPA 3ZYYX 1LO5D 3I90A 4JI1L 5DEHA 1TWHH 1PRTC 3PCOB 4KD3A 4M8AA 1X55A 3NQTA 1JORA 4K5VA 1VQPA 2Q2TA 3TRZA 3D4DA 1Y1VB 4DUYL 4YCVA 5EKLA 1PV4A 4GOPC 1LTAD 5D3IB 4DK1A 2B2YA 1AH9A 4AIMA 2V4DA 4A3FB 3AU7A 1IL2A 1HH2P 1TS3A 5IT9c 3S1MH 2A6EC 4QGUA 2L9HA 2UUCL 1ML0D 1EFID 1JCKB 1IYJB 1QJOA 4R4IA 1PH8A 1B50A 3LNNA 3K0XA 5E4XA 3ZJYC 2E2IH 5EQ0A 5HGTA 1E7ZA 2E5LQ 1VQAA 2O5JC 1BVSA 1JICA 3GO5A 4DV5L 1EIFA 2E2HB 4TKOB 1YNJC 3DM3A 3VR6A 4P74A 3A7AB 5C44B 5M5XB 1V1PA 1J9OA 2R6GA 4DK6C 3MTSA 4BS9A 4X3KA 4HIKA 4ME5A 3I7FA 2JA7H 3K5NA 1KHIA 1LT3D 3W3AA 3I55A 2NZOA 1EWIA 3IL8A 3OW2A 3NTKA 2YQRA 3EBEA 3R2TA 1YNNC 3GTGB 5GAGC 3I4MG 2RF4A 4X65Q 3FKIG 5GADC 1CKOA 2F0GA 2Q8TA 4O0AA 1SLJA 1FNWA 1U4RA 4NDXA 1K83B 3J80i 1X4NA 2MJ8A 1S5CD 1SNOA 1VQOA 3VA7A 2PMZB 2DGRA 1VQLA 2JA9A 4L5SA 3HRZC 4G4KA 4B9WA 1HFNA 2R92B 4DU9A 2F3IA 1ASZA 1IBKQ 1RF2D 1FJGQ 4J1MA 1Q86C 1C8CA 1IBLQ 2F0FA 5EKIA 3JAMc 2MUYA 4LF6L 1CM9A 1PMRA 5IYCG 1HTPA 1PFMA 1V8QA 3MAQA 3SXHA 3A54A 4A3EG 2B2UA 1PH3A 5E7NA 1CQFA 1HXYD 4MTNA 1ENCA 2K1BA 5ELOA 1CSPA 3S1QH 4IO9A 3NSWA 1SE8A 4JOIC 4DV7L 1B44D 2UXBL 5KRUA 3OIQA 1SR3A 2MO0A 2JYOA 5IY0A 2RKSA 1E1OA 5HURA 1LTRD 4LF4Q 1N33Q 1ILPA 1S3OA 1L1OA 5EKKA 2I0QA 4RGMA 1G2TA 1WTPA 2A6HD 4IN3A 3SDZA 3CAMA 1WTWA 1NBWA 5J3BA 4A3BB 1DONA 4LIJA 1GHKA 1UE5A 5C0XH 1EEFD 5A2QE 2IL8A 2LSSA 1BDOA 3HP3A 2VQFL 2NZ1D 3UDIA 3I4NB 4KJOA 1PH1A 4BXXG 1VQ4A 1I5FA 3NHHA 4DR3Q 5IYDH 1V43A 1D2BA 2DY8A 2WP8J 2NVQB 5IYBG 1WFQA 4DXFA 2K52A 2WKDA 3CHBD 1U5KA 4LFAQ 3OTOL 4LF5Q 3H3VH 1EY5A 5FKAC 4K8IA 5GROA 1PZJD 3GTKB 1GUTA 5IWAQ 3A7LA 4EQNA 3X3MA 1HR0Q 3GQBA 3VR2A 5DM63 3HOXB 4AH6A 4DV2Q 3FVQA 1LUZA 2B2VA 2Z1CA 1XNQQ 4K5XA 3ONAB 2KCCA 3CQZH 2NVYB 3EROA 3HGBA 1IYVA 1GUSA 3S14H 5ELDA 3CKIB 4JI0Q 4JK1C 1U9RA 4RAUC 2JA5B 4POFA 4PZ8A 2ENBA 3GTPH 2CTLA 1H9KA 3QOLA 3HOUH 1U0LA 4S3SA 2Z4IA 3RNUA 4L5TA 2HHHQ 4YWLA 3TP7A 3HOZG 4POGA 4BY7B 2QNDA 4A3DH 3A8JE 1B8AA 1JT8A 3BS1A 4KTAA 1XMQQ 1IBML 4LFBQ 1MGSA 5KIXA 1E3PA 4A3KG 1QZHA 1AZQA 3S15B 4KLKA 1CKNB 1I4HA 2F0JA 2AXYA 3DMUA 4DV4Q 1L2FA 1STYA 5D65A 4C3IH 3AMUA 4JI4L 4DR1Q 3VYUA 1H9JA 4DAPA 3K57A 1CKNA 4IQZA 1XTDA