4BA2I

Archaeal exosome (rrp4-rrp41(d182a)-rrp42) bound to inorganic phosphate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
226
structure length
213
Chain Sequence
SQEIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGNKSMYETLTSCSIFVANNGRIWATCSRFSEEILIEAIRKIENELTDRIKQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a 9-Subunit Archaeal Exosome in Pre-Catalytic States of the Phosphorolytic Reaction.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase/rna
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
total genus 40
structure length 213
sequence length 226
ec nomenclature
pdb deposition date 2012-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ba2I01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ba2I02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4ba2I03
1PH5A 3VKEA 3TEHB 3H3VI 1YBYA 4GN3B 1VQ9A 3BDOA 2Y0SE 2A19A 1JMCA 4NXML 3L0OA 3CRKC 1R9TH 2YQRA 4P71A 1HPCA 1VF5C 3KF6A 1IYVA 4K0KL 2ZM6Q 4JI4L 1HR0Q 1DCZA 4NXNL 5ELOA 2PMZE 1GUTA 1YHBA 5IYDG 3HOYH 1HNWL 4GOPA 5LMNQ 4A3FG 1X9NA 1BBUA 3I72A 1WI5A 2PQUA 2MO0A 4KLKA 2ANNA 4O0AA 4LF6Q 3D0FA 1Y8PB 2YYZA 1QZHA 3IKJA 2I5HA 2PQAA 1QVGA 5GAGC 4APVA 4LF5Q 2UXDQ 1K8GA 2D2CC 5BN4A 3NBHB 4DR7Q 1GHKA 3KDFA 1QUQB 1Z47A 3S1NH 2AKWB 1J4WA 3GD7A 3KLWA 4YHHL 3A5ZB 4R4OA 2IY5B 1WVNA 2CQOA 2E76C 2RHQB 1QUQA 2K5VA 4Y7NH 1EIYB 3GTQH 2K5NA 3W3AA 3F8TA 4JV5Q 1EYGA 3EBEA 3CCMA 4IFDI 4JI3L 1B9NA 4A3EG 3DXJC 3RLFA 2C35B 2A6HC 3TREA 2XGTA 3LWUA 2E5LQ 2PPBC 1TWFH 4DAYB 2F3IA 4LW1A 3G6EA 4GNXB 2XTIA 1UEBA 3CCEA 2OTLA 1DXMA 1UE6A 4B3SL 4LNQA 4NXMQ 3JAMc 4X6AH 3CCJA 1KIXA 3HOUH 4DV4Q 2DGRA 1C0AA 3JC66 5IWAL 3FHWA 4BBSG 5DLQE 1NTGA 4IFDH 2MJHA 3S14H 5IYCG 1J5EQ 4HR7B 3WWVA 2OPVA 1OXSC 2JXMB 2EXDA 1VQFA 1PH8A 2E2IH 2NVTH 4IOAA 2B29A 4OWWB 1E3PA 4HJAA 4KKUA 4A93H 2CCZA 3HKSA 1WCMH 2NN6G 5HY6A 2D0PA 2RF4A 3ULLA 3CF5A 4JBKA 1E22A 3S1MH 4JVHA 4QL5A 1Y8OB 1EIFA 1Q1BA 2N8NA 2WB1G 1LUZA 3M3YH 1K3RA 1HR0W 4UY8C 3FKIH 3PIOA 1Q7YC 1B7YB 4DR2Q 1FL0A 2A69C 3KLRA 2A68D 1Z9FA 1OXVA 3NENA 5BR8L 4HJ5A 3S2DH 2EDGA 3KYHC 2EQSA 3HFZB 1XNRL 2UXCQ 3ICEA 2UXDL 4K0KQ 4PMWA 4YY3L 4DR1Q 4QGUA 3TQYA 5IYDH 3T1HL 3PUXA 3S24A 4A3FH 4KKSA 4DV2Q 3U50C 1EC6A 4BXXG 1Q46A 4AQYQ 1Y8NB 1GD7A 3AEVB 4NB3A 1H9SB 1I6VC 2EJMA 5C4JH 2VL6A 4DR5Q 1YZ6A 1X54A 3L2PA 3B6YA 5JJIA 3S2HH 1HZBA 1CSPA 3S1QH 3QJYA 4OO1G 2WP8J 1ZZKA 4LF8Q 3T53B 4YCUA 4LWCA 4QY7A 1V8QA 4AM3A 3I7FA 3H94A 1X3FA 1UE7A 1NMGA 2YTYA 4MTNA 1VQGA 2MNAA 2R92H 1MJCA 1NY4A 1IXRA 1YJ9A 1E2WA 1Q86C 1VQLA 2UUBQ 4JG2A 2IT1A 1SFOH 4IJHA 1WE8A 4X62L 5KNBA 2OTJA 2PY9A 4BY7H 1GJXA 1VQDA 1JJGA 2NN6I 3K81C 1J5KA 5ELNA 3RN2A 4IJLA 4DAMA 2WFWA 1MJEA 4LF7Q 4A3LG 3J81i 3U58A 1GVPA 1HNXQ 1N34Q 5IYCH 3GTJH 1K1GA 3A8JE 4GS3A 3F2BA 3HOYG 2CTLA 1VQJA 3AYHB 4YWMA 5M5YH 4GN4B 1YHQA 3CW2C 2KCMA 3SDZA 1SN8A 2YTXA 3GO5A 3D4RA 4C3JH 3CMAA 4LF7L 2JA8H 3HOVG 1HNZQ 4QMFB 3V69A 1O7IA 1LM0A 4HIMA 1DTJA 4A3MG 5JJKA 3I4LA 2CTKA 1VQMA 3VR6A 1N33Q 4XIGS 4WJ4A 1O78A 2Q2TA 2EJGC 3N6RA 4OX9L 2ES2A 2AWOA 2WB1E 2RHSB 3FKIG 2R7ZH 1IBKL 4KHPQ 4LF8L 4B3ML 3K7UC 1GUSA 4DK1A 2L15A 1X3GA 4IO9A 4A3BG 3A8IE 4C2MH 4DUZL 1B70B 2PI2A 5LMUL 3CC4A 4JI4Q 2K52A 2YV5A 3CXCA 3PUVA 1G51A 1WCMG 1H9KA 3PGZA 3CAMA 4JI8L 4DV7Q 4I7ZC 3VA7A 4GZYC 3CQZH 2MO1A 2JEBI 2D0OA 4AH6A 4A76A 1XTDA 5FJ8G 2VZAA 2N49A 4BY7G 1VIHA 4PV1C 2UUAQ 1CUKA 2UXBQ 1YVCA 4JBJA 4IPCA 3PO3H 4B8TA 4IFDJ 3U4VA 2CW0C 2B8GA 4G7HC 2K7VA 5IP7H 1HNXL 1CKMA 4OXPA 5C3EH 2PI2E 4GNXA 1K73C 4B3SQ 3A74A 3OOCA 1CI3M 1P16A 2Z6KA 4LIJA 1VQ5A 2BH2A 1FYCA 4BBRH 4EQ5A 2P2RA 3JAMi 4B3TL 1YIJA 1GM5A 3F1ZA 2F52A 4DR6Q 4DV6L 4YCWA 4DUYQ 5KNDA 1DT4A 1A6XA 2ATWA 2BA0A 4R4IA 1Q82C 4KHZA 1VQIA 1W3SA 2AHOB 4POFA 5M5WH 3J7A5 3GQBA 2NN6H 4DK0A 2CWAA 5IE8A 3NEMA 3F2DA 3AEVA 4BXXH 4TQUS 4L5TA 4A3IG 1IBKQ 2GVAA 2PQAB 1VQPA 3PV0A 1GKHA 3U9SA 1L2FA 5C0XG 1EWIA 2B3GA 3PIPA 4B3MQ 1A62A 4RG1A 4UP9A 2HIVA 1G291 2ANRA 2ALYB 4JOIC 2MQHA 1Y14B 1QZGA 2E3UA 4BBSH 1XNQL 1I6HH 4OX9Q 1KQSA 4KI0A 2Q8IB 1JJCB 1PH1A 2UUCL 1DD2A 1X4NA 5C3EG 1VS0A 4JI5L 1XMOQ 1PH9A 3OTOQ 3TS2A 4OO1I 2R93H 5IP9G 4RMFA 3M4PA 3NELA 3IFTA 4XTCS 1N36L 4LF9L 1UE1A 3U4ZA 3KF6B 4ME3A 1HCZA 3HOZG 4JI0L 1IW7C 2ZTEA 2JEAI 3I56A 3KF8B 1TKWB 1HZAA 1NJIC 2D5DA 1ZZIA 1Q1EA 4JV5L 1KRSA 4MZ9A 3AB9A 2RCNA 2AUJD 3PF4A 4A3DH 4L8JA 4PZ6A 1QVCA 1XPRA 4GKKL 5C0XI 1FGUA 3I73A 1PHJA 1H9SA 1K0RA 4JI6Q 2VY3A 3CCUA 1VQBA 1XPUA 5H1SE 3I4MG 3STBD 4KHPL 2BDOA 3CMEA 2ZTCA 2K5HA 4JYAL 3PCOB 2KCCA 1ASYA 4LF6L 1SROA 1TWHH 3VR5A 3BJUA 4R4QA 3A7LA 3K80C 5IP9H 1TUAA 3HOXH 2KBNA 2VQEQ 5C0XH 2ZJPA 3RZDH 1SR3A 3OYYA 1NBWA 1UWVA 4AYBG 4HJ8A 2BE5D 1M90C 1HR0L 1IBLL 3S16H 2ZM6L 1JT8A 2K33A 3J7ZC 3U1KA 1HNWQ 1B9MA 3ULPA 4IQZA 2HT1A 2AWNA 3E9HA 2HHHL 2VS1A 1N34L 4JVYA 3FPPA 3I2ZA 3CPWA 2JE6I 4IFDG 1PA6A 5IT9c 4JI0Q 1X6OA 2A69D 5M3MH 2BH8A 2E2HH 3H0GH 1H9JA 2JK8A 1U5KA 1S72A 5AJ3Q 2DNEA 4IPDA 4PZ7A 3I4NG 4H0LC 2A1AA 2I5MX 2F1MA 2NVYH 2WAQE 2R93G 2JQOA 1I94L 4GKJQ 2CPQA 1IYJB 3PO3G 1HZ9A 3A7AB 1SE8A 3STBC 4IPGA 4JI5Q 2DUDA 3CC2A 5JJLA 1D7QA 1NMFA 4GOPB 4OO1H 1N36Q 1VQ8A 3VR2A 1FR3A 1Z6HA 3GTMH 3CRLC 1QVFA 2B63G 3RZOH 1PV4A 4JYAQ 4GKKQ 3EIVA 1PH3A 1Y1WH 2OCEA 1KRTA 1VQAA 4A3GH 3HOWH 2Y0SG 2QNDA 2R7FA 4GLVB 1QJOA 1TWAH 1KC8C 1VQHA 2UU9Q 3BG3A 3HKZG 2LXKA 1CKOA 1J5EL 2CTMA 4HIOA 5KNCA 1L1OB 1MIUA 1NE3A 2N78A 2NZOA 4OWTB 5C4XH 1EFWA 2DN8A 4LF4L 4A3LH 4LFAL 2R7ZG 2NZHA 5GAEC 1EUJA 3OPOA 3SE0A 2ZJRA 4HIDA 2QF7A 4YY3Q 4DR1L 3HOWG 2UXCL 2KHIA 3MXNB 3CPFA 3G71A 1BBWA 1XMOL 3H0GG 1DGSA 3MEFA 1V1QA 1Q90A 4JI1L 3F2CA 4A3KH 1XJVA 1N9WA 2H5XA 2OQKA 3UDGA 2CKZB 2EJFC 2N3SA 4PG3A 3RLOA 4ALPA 1FJGQ 3W5OA 2PNHA 3J81c 4C3HH 2I0QA 1BDOA 1I3QH 3I4OA 5BR8Q 4DV7L 1BKBA 4DV0Q 4H02A 2VQFL 2ZT9C 2QEXA 2AMCB 3UDFA 3ND9A 1CFMA 4H13C 1LYLA 3H15A 3MXUA 2VQEL 2VNUD 4DNTB 3VDYA 4GLXA 1PH6A 4BA2I 3ER0A 1T5EA 1IBLQ 4POGA 1D8LA 1YJWA 3CCRA 3PO2G 4A3CH 1J6QA 2K32A 3FMCA 5JEAG 4P74A 1OXXK 4X64L 2AUKA 3VR3A 1GUOA 1PMRA 1YEZA 1SMYC 4BBRG 1M1KC 1I94Q 1EQQA 4JI6L 1T9HA 4GKJL 2CTJA 1E2VA 2O5JC 4NXNQ 2B8FA 4H44C 2JA9A 2IHEA 3HOZH 2IX1A 3TS0A 5FLMH 3T1YL 5AJ3L 1YJNA 4L5QA 4DV3L 1HNZL 1G6PA 3AQQA 1I5FA 1HJPA 2Q2UA 3K7AH 5A35A 2WAQG 4JI2L 5BN3A 1ASZA 2JA7H 4LFBQ 1LACA 2DNCA 4TVAB 2KHJA 3T51B 4OONA 3T1YQ 4A3CG 1E7ZA 1JJ2A 2UXBL 3M4QA 1Y1WG 5M5XH 1KXLA 3PF5A 1ZYRC 3KJPA 1Q81C 4YHHQ 2D62A 4JCVE 5HGQA 3UE0A 5C44G 1YITA 2JJQA 2UUCQ 4L5RC 1V9PA 4KMUC 4X62Q 1VQNA 2B63H 1X4MA 2OQ0A 1Q8KA 2HH2A 2HH3A 3MFYA 4B3RQ 1E2ZA 1ZKOA 1N32Q 4X66L 4DUZQ 5M3FH 3TZUA 3RNUA 2R6GA 5IYBG 4P72A 2JA5G 4DR4Q 4LJZC 1VQCA 3KDFB 4NPSA 1L0WA 5GADC 5FJ8H 4X64Q 3CCQA 2R7DA 2IX0A 1CTMA 5C0XJ 1WJJA 2JA6G 4WALA 2JA8G 1A63A 1ONLA 1Q12A 2JA7G 5C44H 3ZJYC 5IP7G 3ERSX 5M3MG 3W1GA 1X55A 3CCSA 4DV0L 3D31A 1CSQA 2JA5H 5J3BA 1TU2B 3M9BA 4UPAA 1SLJA 3FP9A 4IPHA 5K36G 4DKAC 5LMNW 4DV2L 2V4DA 1KL9A 1Y1VH 2A6ED 1Y69U 4LK1C 4JI1Q 4DR6L 4BA1I 1VQ4A 2JVZA 4X65L 4G7ZC 4G7OC 4QJFA 3K0XA 4MNOA 4LUZA 3W1BA 2ASBA 1I50H 3HOXG 4PZ8A 2GN5A 1K8AC 4BY1H 3OTOL 4LFAQ 3A0JA 4LF9Q 3E0EA 4JI3Q 4DNRB 4A3JH 3CCLA 4LF4Q 4JC0A 1OTCA 4JI8Q 2PNRC 4AIMA 1IBML 2CFMA 2GVBA 2K75A 4QIWE 1YHAA 3Q8DA 4DPGA 4A4IA 3L7ZC 2LMCB 5K36H 3PUZA 1XPOA 4HIKA 2FXQA 2BE5C 1MKHA 2E2JH 4A3DG 1IYUA 2KENA 1EWHA 3KOJA 4DNIA 2JZXA 3G48A 4JI7Q 1PH7A 5BN5A 4LUOA 3J80i 3DM3A 1S40A 2IHFA 2EIFA 4R4TA 3M4OH 3GTGH 3A5UA 4DR5L 1KHMA 2VUMH 2ZJQA 1HZCA 2BL5A 4P75A 4X66Q 1AE3A 2A68C 2CTFA 1KAWA 5IWAQ 4KN7C 3CP0A 1RL2A 4DK3C 4DR3L 3AFPA 2E5LL 1L1OA 1L1OC 1HH2P 4A75A 1K8OA 4GNXC 4DR2L 4Y52H 1IW7D 3WDNA 4FDBA 1CKNB 4LUVA 4BY1G 1VCIA 3LGJA 4IOCA 4A3KG 1H9RA 3QIAA 1SMXA 4JBWA 2YTVA 5GROA 2V1CC 3KJOA 4KKTA 1JB7A 2F4VL 3GTPH 1TWGH 1VIGA 3CC7A 4TKOB 3I55A 2E75C 1WOCA 4QQBX 5C4XG 1TWCH 2NVXH 3KFUA 1PYBA 2K50A 3EN2A 3PUWA 1X56A 4WJ3M 1PYSB 4LFCQ 3VR4A 1P8LA 1AH9A 3OW7A 1YNNC 1O7LA 1LABA 3RR5A 3UDIA 3HOVH 3HOUG 4A3GG 1N32L 1VQ7A 2AXYA 3IRBA 3CD6A 4JK1C 3HGBA 1SRUA 3E9IA 1GO3E 2K14A 1LTLA 3GTLH 2KCTA 3M7NA 1C9OA 1A0IA 1X3EA 1GHJA 3RN5A 3QG1A 4GLAC 1C7YA 3I4NH 3S15H 2ZTDA 1GUNA 1VF7A 1VQEA 4YWKA 3M4YA 1E24A 2DGYA 3I4MH 2A6HD 4YWLA 4UP8A 5GQOA 4AQYL 1PFSA 2LSSA 1KHIA 2HQLA 4JI2Q 3J80c 1TXYA 4DV5L 5EAYA 4HJ7A 4DR3Q 1JE5A 1B8AA 3ND8A 1YI2A 4A3BH 1PH4A 4DUYL 2E74C 4KN4C 4UP7A 2NVQH 4JBMA 4R4CA 2OWOA 1Z7TA 3DLLA 4L5SA 5E7NA 3PSIA 3ULJA 4A93G 2I5LX 1H95A 2Q2IA 3BZKA 4P73A 2O5IC 5IY0A 1S3OA 3LNNA 1VDZA 1OXTA 1V43A 2UUBL 3H3VH 3EQLC 4JI7L 2A8VA 1W2BA 3SGIA 5GAHC 3GTKH 3TRZA 1A8VA 2ID0A 3BZCA 4YCVA 2VUMG 4DK6C 1N8RC 4A3MH 4DR4L 5LMNL 4J15A 2VQFQ 4LFCL 4DV1Q 1XMQQ 2KA7A 1E1OA 1ZZJA 3NE5B 4DR7L 1FVIA 2F4VQ 2BA1A 4B3TQ 3BU2A 3PO2H 2OPUA 1YNJC 5FLMG 4DV6Q 3HKZE 5M3FG 4DV4L 1WFQA 1FJGL 2QA4A 2FMRA 1XNRQ 4AYBE 1HQMC 1K8MA 4X65Q 3T1HQ 1VQOA 2CWPA 1E1TA 3PUYA 1YNXA 4GN5A 4OWXB 4DV5Q 3S1RH 1N33L 1PVOA 3GDEA 2L5TA 4DV3Q 4JOIA 3RLNA 1KD1C 2HHHQ 3S17H 2EVBA 4EX5A 1XNQQ 4OGQC 2UUAL 1RIPA 1VQKA 1IL2A 1BVSA 2HIXA 3OW2A 5FLXc 2UU9L 5JEAH 2VW9A 3K8AA 3M85A 1CKNA 1PH2A 1EOVA 2Z0SA 3UDXA 5LMUQ 1ZTGA 4HJ9A 4WANA 4A3IH 1VQ6A 2CTEA 1X65A 2LXJA 5JEAJ 3T56B 4RCNA 4O2DA 1AE2A 3J81j 1EQRA 4DV1L 1XMQL 3AFQA 4LF5L 1H9MA 3GTOH 2MFIA 2JA6H 4B3RL 3UE1A 3P20A 4A3JG 2Z6KC 2QGQA 2A6EC 1K9MC 2E8GA 3A8KE 1IZ6A 1IBMQ 5IYBH 2YU9H 2Q2HA 1HTPA 1U0LA 2PCFB 4C3IH 3CCVA 2R92G 4GOPC 4LFBL 4A3EH 1OXUA 1UE5A 2K4KA 4NBQA 1K83H 1WYDA 1Y1VG 4R1JA 3G4SA 1GUGA
chains in the Genus database with same CATH superfamily
5JOBA 2BOSA 1XXGA 1QE6A 1JMCA 2HQEA 3L0OA 1D1KA 3DM1A 4P71A 1VF5C 3KF6A 2XRSD 1K83B 3D4DA 1C8CA 1HHVA 4JI4L 3QD7X 1GUTA 2RKSA 2HUGA 3NHHA 1I4RA 1X9NA 2MO0A 2CH4A 3D0FA 3K57A 2I5HA 4LF9H 4APVA 1K8GA 3NBHB 1GHKA 1J5EH 4DV6H 1WVNA 2K5VA 3MTSA 4I7AA 4JV5Q 1B9NA 4ZAIA 4A3EG 1CZWA 2C35B 4A3JB 4WORA 1MGSA 3PIP3 1B3AA 1UE6A 5CR3A 4B3SL 2J0TD 3JAMc 2DGRA 3IL8A 1II3A 3CCJA 2RCFA 4DV4Q 4LF6H 1PFNA 1MBYA 2VQEH 5DLQE 3R8BA 4HR7B 3WWVA 1OXSC 1ZXTA 2D9UA 4HJAA 2RF4A 1A2UA 4JVHA 4QL5A 1Y8OB 1EIFA 1EY5A 1LUZA 3M3YH 1XYIA 4CKBA 1Q7YC 1B7YB 4XQJA 1I94H 2A68D 5IT9W 3ICEA 4YY3L 4ILWA 3T1HL 3T4AC 3PUXA 3S14B 5DM73 1LTSD 3MXNA 4DV2Q 4BXXG 1Q46A 1R4PB 2EJMA 2K03A 2VL6A 5C4JH 4DR5Q 1YZ6A 2OT2A 4KK7A 1ML0D 1X54A 3L2PA 2CPMA 1KLGD 3S2HH 3TZDA 1WTOA 3S1QH 2SEBD 4YCUA 4LWCA 1V8QA 3I7FA 3S1NB 1X3FA 1UE7A 1NMGA 2R92H 5FLXW 1B50A 2MNAA 1TY2A 3TBIB 1XMOH 1SFOH 3NCVA 2HCCA 5C6AA 5KNBA 2F0WA 4BY7H 1GJXA 2LS01 3RN2A 5D3IB 5IGBA 1BOSA 3U58A 2DJGC 1HNXQ 5IYCH 3GTJH 2CTLA 1VQJA 4GN4B 4C3JH 2XWJB 2JA8H 1IKMA 3V69A 1HNZQ 1O7IA 4HIMA 4GKKH 1DTJA 5JJKA 1SJED 2VKCA 4DV4H 1VQMA 3VR6A 4XT1B 4LAAA 2Q2TA 5IIFA 2R7ZH 3K7UC 4EVOA 1GUSA 4V190 1UAPA 5IGGA 1B70B 2YV5A 1G51A 3L9AX 2D0OA 5FJ8G 3JAML 2VZAA 1VIHA 1WTWA 4IPCA 4G7HC 1V1PA 3GTQH 5C3EH 2R93G 5CYUA 2PZWA 2XWBB 1ENFA 3F1ZA 4YCWA 5K5PA 2AHOB 4HCEA 1I4PA 4DK0A 5IE8A 1BO0A 4A3IG 1MD2D 2GVAA 1EY6A 5C0XG 2B3GA 4RG1A 3J81L 1G291 1STGA 2E3UA 1I6HH 2A1SA 3O13A 1X4NA 1PH9A 1XMOQ 1TY0A 3OTOQ 3TS2A 2CVRA 3M4PA 2WB1B 4LF9L 3OSOA 3KF6B 4ME3A 3HOZG 4CKCA 4BY7B 5COYA 5FK9C 1NJIC 1Q1EA 4JV5L 2IJ0A 2RCNA 3VYSA 1EU3A 4PZ6A 1XPRA 1QVCA 5EPJA 4A3DH 5DAUA 3I73A 1RCVD 2R61A 5J1ZA 1PHJA 1I4XA 5AFWA 2VY3A 2JA8B 2ZTCA 4JYAL 2TMPA 4HTHA 1SROA 4R4QA 4OCHA 3K80C 1PLFA 2VQEQ 2R3ZA 2ZJPA 1FD7D 1NBWA 1UWVA 1HR0L 3S16H 2KQ3A 3HEJA 3GTQB 4UHVA 1ESRA 3T16A 3E9HA 4ZKCB 3S17B 4F88A 2XVSA 3I2ZA 3K6OA 2JK8A 1QNUA 5AJ3Q 4IPDA 3I4NG 2F1MA 2NVYH 4X3SA 2KEEA 1IYJB 1HFGA 3STBC 5I6YA 1LTRD 2DUDA 3V96A 1NSNS 3R2TA 1BQQT 1LLRD 2DJFC 4JYAQ 4AQYH 1Y1WH 1S5DD 5JPMC 3J81E 1PRTC 4PNYA 2L9HA 1JB3A 1EQTA 1L1OB 1KDAA 1EFWA 2EZVA 3HOWB 2ZJRA 1S03G 1LT4D 3H0GG 2K05A 1Q90A 4JI1L 5M5WB 1N9WA 2OQKA 3UDGA 4F7XA 2EJFC 2N3SA 3IFDA 2EY5A 1BDOA 1SYFA 4H02A 2VQFL 2F3WA 4H13C 3VDYA 4GLXA 1IBLQ 4POGA 5JJZA 1T5EA 1D8LA 1YJWA 4P74A 1PMRA 1YEZA 1SMYC 4BBRG 1M1KC 1E2VA 1JICA 2EPBA 2B2UA 3DMUA 2A5HA 4DR6H 3EFXD 2LKVA 5EBCA 1I5FA 5I9PA 2Q2UA 4LFBQ 5CORA 1LACA 1RD9D 2KHJA 2X6LA 3T1YQ 2UXBL 1JJ2A 2HDLA 5M5XH 1ILPA 5C44G 1STHA 4X62Q 4G4KA 3GTOB 2OQ0A 2PYKA 1HXYD 2HH2A 1V1OA 3H0GB 1E2ZA 1ZKOA 2NB0A 1QG7A 3MHBA 5IYBG 3F2UA 5JVH3 5FJ8H 4B3TH 3CCQA 2R7DA 1DONA 5IP7G 1PTOD 1X55A 2LRRA 3I70A 4DAPA 1RDPD 4UPAA 3T1HH 1SLJA 3FP9A 4DKAC 5LMNW 5K36G 4RA8A 1VQ4A 3H6MA 2EOTA 4LUZA 1I50H 1PTOF 4PZ8A 1K8AC 3BYTB 3OTOL 4JI3Q 4A3CH 4DNRB 4JC0A 2PNRC 1SYCA 1SNCA 2LMCB 3PUZA 3HOUB 3D3RA 2AQ2B 4NXMH 2BE5C 2N55A 4KJOA 5CV8A 2RBMA 4JI7Q 1TS2A 5BN5A 4NW2A 3E5SA 1ENCA 3J80i 1S40A 3OETA 2IHFA 1AZPA 4DR5L 1HZCA 4X66Q 1AE3A 2A68C 4JYAH 5IWAQ 1KABA 4DR3L 1L1OA 2A74C 4C3IB 1HR0H 1LT3D 4DR2L 1IW7D 3WDNA 4OIJA 3LGJA 4A3KG 5GROA 2NTTA 4IUNA 3CC7A 4DR4H 3I55A 2M6QA 2E75C 1TWCH 2NVXH 3MAQA 1B4OA 1X56A 1F2LA 4WJ3M 4RAUC 4EC5A 1AH9A 1EZ6A 1LABA 3RR5A 1LTBD 5KEEA 2AXYA 1F0XA 1V8CA 3P75A 3CD6A 3HGBA 5KIXA 3L3OC 2Z6BA 2KCTA 1U4LA 1A0IA 1C9OA 3RN5A 1FKAH 1K0SA 1VQEA 2MGSA 1E24A 2IX3A 2A6HD 4UP8A 5GQOA 4K0KQ 4BBSB 4JI2Q 4DV5L 4DR3Q 3SVMA 5EAYA 3BDLA 2UUAH 1B8AA 3ND8A 5C3XA 2QW7A 3DLLA 3ULJA 3PSIA 2I5LX 1CQFA 3BZKA 4P73A 3LNNA 2QDBA 3EQLC 3PMFA 2A8VA 5GAHC 3GTKH 3TRZA 1A8VA 2ID0A 4YCVA 4DK6C 1DJRD 5LMNL 1XMQQ 1ZZJA 5C4XB 1B1ZA 3BU2A 4OL7A 3PO2H 1YNJC 5CV5A 1IBLH 4EQNA 4DV4L 5IGFA 1XNRQ 4X66H 4KY6A 1E1TA 4OWXB 2NVTB 1QILA 4LF8H 2HHHQ 4J8QA 4OGQC 1BVSA 2HIXA 4DUYH 2UU9L 3HOXB 2Z0SA 1NAPA 3UDXA 5LMUQ 1WTJA 4HJ9A 4WANA 1EOTA 1X3PA 2UUBH 1PRTB 3T56B 1EQRA 1XMQL 4LF5L 2MUYA 4LFBH 3UE1A 5J39A 4K6LA 1TWCB 3GTMB 4B8CD 4KY7A 1VMCA 2R92B 2B2YC 4A3EH 1SE3A 1UE5A 4N8FA 1WYDA 1Y1VG 1EL0A 2E5LL 1GUGA 1YBYA 4GN3B 1W6KA 2XSCA 3BDOA 2Y0SE 4N9TA 5CBEE 2YQRA 1WTPA 3MWYW 1X0AA 1DCZA 1YHBA 1HNWL 2DY7A 4GOPA 4A3FB 1BBUA 4BY1B 1WI5A 2ANNA 2C5CA 3S9WA 2PQAA 2B2WC 5BN4A 3KDFA 1Z47A 5DM63 3GTKB 1EIYB 1TVXA 1EYGA 3CCMA 4DFAA 3RLFA 3WOEA 3LWUA 2PPBC 1TWFH 4ZCKA 1Q3LA 4DAYB 4LW1A 4LNQA 3CCEA 4X6AH 4FVMA 1C0AA 4KTAA 5IWAL 2G9DA 4BBSG 3SXHA 2B2YA 1TT2A 2JXMB 2EXDA 1VQFA 2NVTH 2KECA 2B29A 3D8GA 4HAEA 4KKUA 1AZQA 2CCZA 4A93H 1JWUD 4IALA 3S2DB 1F2ZA 1STAA 3S1MH 4FJUA 1PZID 2E2DC 3TP6A 1A3TA 1TWFB 2L55A 1MHWC 5IGCA 3PIOA 2A69C 5CV7A 5BR8L 1Z9FA 1OXVA 3NENA 3KYHC 2EQSA 2CW0D 1STNA 1QNKA 3DUZA 3E0JA 1TWAB 4JI3H 2R93B 2C9OA 3GP7A 4PMBA 1IHZA 4A3EB 1CA6A 4LFCH 3Q0AA 1SYDA 3RUZA 5EQ0A 3EVQA 4B3SH 3AEVB 2J4XA 4CDFC 3B6YA 5JJIA 4A3BB 1IBKH 1HZBA 1SYGA 4OO1G 1ZZKA 4LF8Q 2K28A 3T53B 4QY7A 4AM3A 3H94A 2UXCH 1RF2D 1YJ9A 4JG2A 2IT1A 2PY9A 1ET6A 4ZUJA 5T1IA 2F0HA 4DAMA 4C2MB 1GVPA 1N34Q 1K1GA 3A8JE 4GS3A 3F2BA 3HOYG 4YWMA 2VB2X 3CW2C 3GO5A 4LF7L 1X4MA 1EY8A 1LM0A 1PFBA 3BS1A 3I4LA 3IAYA 1MI2A 2EJGC 3N6RA 2ES2A 1DOKA 3WOFA 2ICEC 4B3ML 4PDBA 4A3BG 1BCPC 2CHBD 3A8IE 5LMUL 2KOLA 1LT5D 3PUVA 2WKCA 4JI8L 3CHBD 5M5XB 1GUWA 2UXBQ 4KHVA 1CUKA 2UUAQ 3PO3H 1SSOA 2EY6A 4JV5H 2A73B 5IP7H 1TWGB 1N33Q 4GKJH 1CI3M 1P16A 1MSHA 4DAYA 4EQ5A 1YIJA 1D1IA 2F0FA 5KNDA 1ZYRD 2ATWA 3VKEA 1QCBD 1VQIA 5M5WH 3J7A5 3AEVA 3F2DA 3NEMA 4BXXH 1IBKQ 3V05A 2PQAB 3GTLB 1VQPA 1L2FA 3PIPA 2HIVA 2MQHA 1Y14B 3NXWA 3HZXA 1XNQL 3NSWA 5HGTA 3Q24A 4OO1I 5FLXL 5IP9G 2NVQB 2L0CA 5D14A 2MP1A 3IFTA 4XTCS 3J7YW 3Q22A 1RJTA 1IW7C 2ZTEA 2JEAI 3R3OA 4LMQD 3RF2A 2F0JA 3KF8B 1KRSA 2XN9C 3AB9A 2EYHA 2B2VA 4DV0H 4FNFA 1U9RA 1KNEA 1JC7A 2PMZB 4JI6Q 4KJNA 3CCUA 1XPUA 1BR9A 5H1SE 3I4MG 4KHPL 5BR8H 3TMEA 2HCIA 2K5HA 2KCCA 3BJUA 2KBNA 2RDGA 3RZDH 1M90C 1SR3A 4OX9Q 5CV4A 4HJ8A 2BE5D 2QEJC 2B2VC 2ZM6L 2F0IA 1XMQH 1HNWQ 3ULPA 3E3XA 4IQZA 2EYMA 2AWNA 3NTKA 4RHSA 2F4VH 3VYTA 3FPPA 3CPWA 1PA6A 1X6OA 2BH8A 1S72A 2X6GA 1U5KA 3I4NB 4PZ7A 2A1AA 2O4XA 4GKJQ 2CPQA 3BZDB 1N32H 3PO3B 4JI5Q 3K0YA 1SE2A 2F0LA 1LTID 1D7QA 1D5ZC 2EY1A 1AEXA 4OO1H 3NP8A 5JAVA 4J1MA 1QVFA 1PV4A 2B63B 4H8AA 3EIVA 1VQAA 1SXTA 3HOWH 2R7FA 5M3MB 1TWAH 1KC8C 2UU9Q 4IUUA 1J8IA 1R9TB 3KDGA 2F0UA 1J5EL 4KY5A 2N78A 2NZOA 2NZ1D 4F87A 2R7ZG 2JYOA 1EUJA 4ID6A 3SE0A 2PW7A 4HIDA 4WJ4A 1FNWA 4JI4H 3MXNB 3G71A 4K2KA 1BBWA 3NK9A 4C3JG 1XMOL 1V1QA 3F2CA 1XJVA 4O42A 2H5XA 4DR6Q 2CKZB 3J81c 1SNDA 3I4OA 3J80L 2ZT9C 5M5YB 1CA5A 4JI8H 3UDFA 4A3GB 3H15A 2Z4IA 4K5WA 4V0BA 3CCRA 1J6QA 1UEAB 3FMCA 4XXEA 1YNND 4RGTA 4GKJL 1EQQA 1T9HA 1BF4A 4A3IB 4NXNQ 2JA9A 4I65A 3HOZH 3NTIA 5NUCA 3T1YL 1HNZL 3KBGA 2Y0SB 3K7AH 5A35A 2RDHA 2TSSA 2DNCA 3T51B 4DR7H 5EJWA 3PF5A 1ZYRC 3KJPA 1HUNA 4L5RC 4JCVE 4LFBL 1YITA 2LTLA 1Q8KA 1JOQA 2HH3A 1I6UA 3PQIA 5M3FH 2SNMA 1EQVA 3RNUA 3M3YB 2NBFA 1CHQD 3EA6A 2JA5G 4LJZC 4X64Q 4CKEA 3M7GA 2IX0A 1CTMA 5C0XJ 2Z8LA 2JA8G 3J7AK 5C44H 5M3MG 1CT1D 3CCSA 1W6JA 3BVMA 2JA5H 1TU2B 2RSNA 1KL9A 4JI1Q 4DR2H 4KHPH 1NNXA 4QJFA 3K0XA 4Y7NB 2ASBA 4BY1H 4L63B 2SDFA 1LTAD 4LFAQ 5TSSA 3A0JA 3E0EA 1V1PB 4A3JH 4LF4Q 1OTCA 4AIMA 2CFMA 2GVBA 1YHAA 2E5LH 3L7ZC 1PDQA 2LY7A 4HIKA 4ABNA 1IYUA 2KENA 4DNIA 1I4QA 4DU9A 1PH7A 2QKIC 2EIFA 4R4TA 3GTGH 3GTJB 2AQ1B 2ZJQA 1KAWA 1LT6D 1Q8IA 3G6JB 1HH2P 2NVXB 4FP5D 3AU7A 1VCIA 2R7ZB 2B39A 4JVZA 1H9RA 3KJOA 2YTVA 4JBWA 2F4VL 1TWGH 4C56C 4TKOB 1JWSD 1WOCA 1X9ZA 1FNUA 5ELBA 1P8LA 1TS4A 3HOVH 5I4DA 1N32L 1HA6A 1VQ7A 2F3VA 3IRBA 1BCPD 3D6WA 4JK1C 4RCOA 1GO3E 2K14A 1LTLA 2ZXRA 3GTLH 3C1EA 1C7YA 1BUVT 3S15H 2ZTDA 4A3KH 4HJ7A 3J80c 2NYZD 1Z2IA 1BCPF 1PH4A 4UP7A 2UU9H 4JBMA 3D6CA 4OIKA 4L5SA 5E7NA 1H95A 4JI6H 2Q2IA 3K59A 3GV6A 2IWHA 3H3VH 1VDZA 1OXTA 4C1NK 2PZUA 1W2BA 2JSOA 1GOZA 4LF5H 1PQXA 4ZRZA 1CK1A 4E9JA 1XNQH 4J15A 2VQFQ 2PZTA 4DV1Q 2UUCH 1GXDC 3OIQA 3SR1A 1FVIA 2F4VQ 2BA1A 1WD0A 2WKDA 2B2TC 3LWEA 5DEHA 4DV6Q 3Q6SA 1WFQA 2QA4A 3SK5A 1HQMC 4X65Q 3T1HQ 2CWPA 4GN5A 1YNXA 4C3IG 3S1RH 1EY7A 1MSZA 3QO2A 4JOIA 3KLSX 3RLNA 1VQKA 2CWFA 3NQIA 4QF4A 2IL8A 1X65A 1DYQA 1O80A 4O2DA 2QILA 1RKNA 1SYEA 4RKBA 2E2IB 2QGQA 4K8JA 2YU9H 1IZ6A 5IYBH 2Q2HA 4IUQA 4UAIA 3S1RB 2Q8RE 2N88A 2PQEA 2R92G 3JAME 3BVGA 1OXUA 1CZGA 4NBQA 5FO9B 3HOVB 2AKWB 1PH5A 3TEHB 3H3VI 1VQ9A 4RFBA 2M8WA 1F9QA 2A19A 4NXML 1R9TH 5M3FB 1CM9A 1IYVA 2Z4HA 2X06A 3VYRA 4K0KL 2ZM6Q 3DHQA 1HR0Q 1NR2A 5ELOA 1EWCA 2PMZE 5LMNQ 2HDMA 1SYBA 1CQVA 2G8YA 3I72A 4FYDA 2RA4A 2PQUA 4LF6Q 2G9HD 5IGEA 2YYZA 1QZHA 5GAGC 4HCSA 3QB3A 5FKAC 2K5QA 4HN7A 4MHEA 1J4WA 3KLWA 3I0PA 3HG9A 4R4OA 4YHHL 2IY5B 4Y7NH 2E76C 2RHQB 1QUQA 1XNRH 4O1NA 4IFDI 4JI3L 1NR4A 3DXJC 2MHVA 2F3IA 4GNXB 4NXMQ 3K5LA 1U4MA 3JC66 3FHWA 1NTGA 3S14H 1J5EQ 4RHRA 1HRJA 3RZDB 1PH8A 2K5WA 4IOAA 2E2IH 1QOHA 5LL6X 1E3PA 1VMPA 3KBXA 4X64H 5HY6A 1WCMH 1RHPA 3NBIA 4HMIA 2D0PA 1AN7A 3ULLA 4NZTM 1E22A 1S5ED 3X3NA 1DM0B 3S2HB 2WB1G 2EYJA 1K3RA 1HR0W 3FKIH 4B9XA 4B08A 4DR2Q 1WHRA 3KLRA 2JN4A 3S2DH 2EDGA 3C2PA 3HFZB 5J22A 2UXCQ 5E3FA 1D5XC 4X3TA 2UXDL 2ICIA 4QGUA 4KKSA 4K8IA 1U4PA 4E6IA 1Y8NB 1EIGA 1GD7A 1I6VC 3TSSA 2HHHH 4ZKBB 1A2TA 3FPUB 4DV5H 1CSPA 3D4WA 3OWEB 2WP8J 3NWSA 4Q5VA 1I3QB 1UUPA 2K5DA 3KLSA 4C1NI 4DR1H 1NY4A 1IXRA 4Q0FA 2UUBQ 2OTJA 3A56A 1AFPA 1VQDA 3J81W 1JJGA 2NN6I 3K81C 1J5KA 4ZQ3A 5ELNA 1SJHD 4LF7Q 2WFWA 2NUCA 3OTOH 3RD4A 3HOYB 5M5YH 1YHQA 3H09A 2NTSA 2YTXA 2F0PA 3D4RA 1EEFD 4DXGA 4A3MB 4U673 3OIPA 4LF4H 1WVLA 1G91A 4OX9L 3FKIB 2AWOA 2WB1E 1JWMD 2RHSB 3ITPA 1X3GA 2F0EA 4TRDA 4DUZL 1NXUA 3CC4A 4JI4Q 2K52A 3PGZA 3HOWG 2F0VA 1EY4A 3PIO3 1RODA 4AH6A 3CQZH 3VA7A 4J6HA 2MO1A 2JEBI 4DV7Q 4C3JB 2N49A 1YNJD 4B8TA 5A2QW 2F0GA 5I6WA 4PQXA 4ZK9B 3U4VA 2CW0C 2B8GA 1HNXL 2K7VA 1CKMA 1PYWD 2PI2E 4GNXA 1K73C 4B3SQ 3A74A 2Z6KA 1VQ5A 3JAMi 2F52A 4DV6L 3N52A 1DT4A 4QMGA 1BCPB 4R4IA 1Q82C 4GKKL 4KHZA 2CWAA 2NN6H 4TQUS 3OHXC 4DF7A 1XRHA 2FFMA 1GKHA 2Z9HA 3U9SA 1EWIA 1EY9A 4UP9A 1QZGA 1F9PA 4BBSH 5LMNH 1KQSA 1PH1A 1JJCB 2UUCL 2FJ2A 1VS0A 5C3EG 5C3EB 2R93H 1LO5D 1Y1WB 1N36L 1UE1A 3U4ZA 3M4OB 3I56A 3EJIA 1FJGH 1HZAA 1ZZIA 3GKUA 4MZ9A 5C0XI 1ODHA 3MXPA 3OWFA 2WACA 2FMCA 1WTVA 1X3QA 3STBD 4QUCA 3CMEA 5ISRA 2L4NA 5KGUA 4LF6L 4C3HG 5JPNC 1TWHH 1EZ8A 3A7LA 5IP9H 1TUAA 1DOMA 2F03A 4KHPQ 3MA2B 4AYBG 1JR0D 5A2QL 1JT8A 2I46A 4DV1H 3HP3A 3H3VC 2FMMA 2HT1A 4LFAH 1DOLA 2VS1A 2HD3A 3OMCA 3FEWX 4R9WA 2A69D 2E2HH 3H0GH 1H9JA 2DNEA 3CQZB 1PFMA 4H0LC 2I5MX 5IT9E 2WAQE 2JQOA 3PO3G 1SE8A 2EYPA 1TWHB 5JJLA 4DN4M 4GOPB 1VQ8A 3VR2A 3GTMH 3CRLC 3RZOH 1ICWA 2OCEA 1EYCA 5HURA 5KYLA 2Y0SG 2QNDA 5CGKA 1CKOA 2CTMA 4HIOA 5KNCA 5C4XH 3J80E 4LF4L 2DN8A 4LFAL 2NZHA 5GAEC 5D65A 3OPOA 3GTGB 2UXCL 2UXDQ 2QF7A 4YY3Q 5C4HA 2KHIA 3CPFA 3MEFA 1DGSA 1JORA 1SDFA 3ONAB 4PG3A 3BYYB 3W5OA 4PMCA 2I0QA 1I3QH 4DV7L 4DV0Q 4R8NA 4CDEC 2QEXA 3KK7A 1CFMA 1SFOB 4DNTB 1JQYD 4G08A 1PH6A 3PO2G 4C3HB 5JEAG 1OXXK 4XDXA 3VR3A 1GUOA 4JI6L 3NPPA 2CTJA 2O5JC 2B8FA 2K1BA 4H44C 2IHEA 3BVZA 5KRUA 4HSPA 1YJNA 1G6PA 3AQQA 2EXZA 2L12A 4B3MH 3GTPB 3S16B 2JA7H 4JI2L 5BN3A 3X3MA 5IWAH 4OONA 2K1HA 1IBMH 4A3CG 1KXLA 2JZXA 3M4QA 1Y1WG 1Q81C 4YHHQ 2D62A 2JJQA 2UUCQ 1VQNA 1V9PA 3MEHA 3SEBA 4CJ0B 4B3RQ 1XWEA 2EYOA 4X66L 1N32Q 4JI5H 1N33H 1EYAA 4DR4Q 2JA5B 1VQCA 3KDFB 5C4JB 4EQOA 3I4MB 3MZ5A 2JA6G 1Q12A 2JA7B 3ZJYC 2LF0A 3ERSX 2E2JB 2WINB 3K5NA 3W1GA 4DV0L 1CSQA 5J3BA 3M9BA 4IPHA 4DV2L 1HNWH 1Y69U 4LK1C 4DR6L 2Y3MA 4BA1I 2JVZA 4G7OC 4MNOA 3W1BA 3W2DA 2GN5A 4NZRM 2B2WA 4NP5A 1T5XD 4R8IA 4X3UA 1SNOA 2K75A 4DPGA 3P7JA 5K36H 1ILQA 3RMHA 1XPOA 2FINB 1EU4A 2E2JH 4QIWB 4A3DG 3PO2B 1JCKB 1NCVA 1EWHA 3KOJA 2VXWA 1TR5A 2PT7G 1BXTA 3M4OH 1KHMA 4MN3A 2VUMH 3EROA 4QB4A 2GA4B 4P75A 2XIWA 4WRDA 2JA6B 2J7ZA 4IUVA 1R4QB 3CP0A 5E4WC 1RL2A 3C3LA 4FF3A 4A75A 4Y52H 2O2LD 5A2QE 4FDBA 1CKNB 4LUVA 5EPKA 4DR7Q 4RKLA 4ULLA 3GTPH 4OX9H 3C1FA 1VBIA 5C4XG 1F2MA 1PZJD 2XNAC 1PYSB 5L37A 3HS0C 3OW7A 1YNNC 3CU7A 3UDIA 4M8AA 3HOUG 1S5CD 1K3BC 1I50B 2BDNA 1VF7A 3I4MH 3M4YA 2DGYA 4JPBW 4YWLA 1N34L 2EYLA 2LSSA 1I6HB 2HQLA 1TXYA 3A55A 4M1UB 4RWSC 2E74C 4R4CA 2OWOA 5CC4A 1Z7TA 4FXKC 3R2IA 2MPMA 2B2TA 3KUPA 4QCLA 5JVG3 2O5IC 1S3OA 5I9OA 2M2LA 2CWHA 3SGIA 3GR5A 2KJXA 5C44B 3BZCA 1B44D 3FVQA 4DR4L 1N8RC 1UG8A 1E1OA 5T1GA 1Y1VB 1EEID 4CJ2C 4DR7L 4IURA 4B3TQ 1S20A 2OPUA 3TP7A 1G2SA 3HRZC 3HKZE 5M3FG 1FJGL 2KUMA 3OMGA 4AYBE 2MJ8A 1K8MA 2WV6D 1VQOA 2M00A 1N33L 4DV5Q 1PVOA 5C4ZA 4CJ1B 4DV3Q 4NXNH 2F0QA 3S17H 4EX5A 2ZQEA 1RIPA 1BBXC 5FLXc 5JEAH 2E2HB 3GABA 2F4IA 3M85A 1PH2A 1EOVA 2F0OA 5G3LF 2RQXA 2LXJA 4LF7H 4RCNA 2ZM6H 1AE2A 5EGTA 2K04A 3DWAA 2MFIA 4B3RL 1E0BA 2Z6KC 4A3JG 2A6EC 2E8GA 4XT3B 1U0LA 4GOPC 2FFKB 1K83H 3MC0B 3QOJA 4DUYQ 3SHLA 3G4SA 4XQQA 4NDXA 2IPKD 1PTOH 2YU9B 3CRKC 3J80W 1HPCA 4CDDC 5IGDA 2K6AA 1STYA 5LHY1 4NXNL 1JE4A 4FXDA 4DV2H 3HOYH 1J9OA 5IYDG 4JI1H 4A3FG 2OF1A 4KLKA 1BNZA 4O0AA 1Y8PB 3IKJA 1QVGA 1EY0A 4BS9A 4LF5Q 2D2CC 1QUQB 3GD7A 3A5ZB 2F0NA 4IN3A 3DEPA 2CQOA 1OO9B 2K5NA 2EY2A 3F8TA 3NBHA 3W3AA 3EBEA 1AN8A 1ENAA 3TREA 1UNSA 2A6HC 2XGTA 2E5LQ 3QWNA 1D2BA 5FO8B 2OTLA 2F0DA 2P5ZX 3G6EA 2XTIA 1F9SA 1UEBA 1DXMA 2WIIB 4EQPA 3OSSD 1KIXA 2F0TA 3HOUH 1ESFA 4JI2H 1XX8A 4IFDH 2MJHA 4KD3A 5IYCG 3NWTA 2XRQD 2F0MA 5IOCA 3DWPA 2OPVA 1C48A 1NUCA 4OWWB 2LTMA 3HKSA 2NN6G 4MTKA 1ET9A 1LV9A 3CF5A 4JBKA 3H91A 1Q1BA 2N8NA 5I2XA 1G6ZA 2FPHX 5EKKA 4UY8C 1FL0A 2PW5A 3U9OA 5CBAE 4HJ5A 2D9IA 1F9RA 1XNRL 4PMWA 4B9WA 4DR1Q 4H7BA 3TQYA 5IYDH 3S24A 4A3FH 3V2TA 4U68A 5G3LD 1EC6A 3U50C 4X65H 2CH4W 3J7AF 4AQYQ 4DGZA 4G57A 1H9SB 4NB3A 1C4QA 4RGMA 4K5XA 1N34H 4OD6A 3QJYA 4DXFA 1PRTD 4RGNA 5LMUH 4MTNA 2YTYA 1HA5A 1VQGA 3R93A 1MJCA 3BDCA 1VQLA 1Q86C 1E2WA 1B2TA 4IJHA 1WE8A 4X62L 4OELB 5CMDA 1PZKD 4IJLA 1A3UA 1MJEA 1PTOC 2RSOA 4A3LG 1HFNA 3J81i 3KDKA 4K6DA 3AYHB 2KCMA 1SN8A 3SDZA 3HOVG 3CMAA 1QB5D 3SK4A 2M9VA 1L0XB 2ZXPA 4A3MG 2CTKA 1LTTD 4XIGS 3QR8A 1O78A 2CQAA 1S5FD 3FKIG 1EFID 2KCNA 1IBKL 4DV3H 4LF8L 1F2YA 4DK1A 2L15A 4IO9A 4FF1A 4C2MH 2L11A 2PI2A 3CXCA 1SE4A 2G5DA 2BH2A 1WCMG 1H9KA 3CAMA 4X3KA 4I7ZC 4GZYC 4CHTB 1EYDA 4BY7G 4BWGB 1XTDA 4A76A 4X62H 4PV1C 1YVCA 4JBJA 4IFDJ 3KF8A 1TS5A 4OXPA 1D5MC 4HSVA 4LIJA 3OOCA 2H4OA 4S3SA 1FYCA 4BBRH 2P2RA 3I90A 5M9OA 4B3TL 1GM5A 3TP5A 1HTLD 1A6XA 3UI2A 1O7ZA 2BA0A 1W3SA 4POFA 2LFNA 1AP0A 3GQBA 4KD4A 3FDTA 4L5TA 2PO4A 3PV0A 4ZUIA 4B3MQ 1A62A 1D6EC 2ANRA 2ALYB 4JOIC 2KVMA 3I8ZA 4KI0A 2Q8IB 1DD2A 4JI5L 3VA5A 4RMFA 3TDQA 3NELA 4KV6A 1HCZA 4JI0L 1M4VA 4HEDA 1S5BD 1IKLA 1TKWB 2JP1A 5LL6S 2D5DA 1QWYA 3S1QB 3PF4A 2AUJD 4L8JA 1IL8A 5E1FA 1FGUA 1PRTF 1H9SA 3I3CA 2B2UC 1K0RA 1B53A 4K2LA 4YIJA 1VQBA 2BDOA 5EBDA 3PCOB 5E4XA 1ASYA 1G8ZD 1WTHA 3VR5A 4CBVA 2NWGA 3HOXH 5C0XH 3MXGA 3OYYA 1IBLL 5C5LA 3U1KA 2K33A 4L6TB 3J7ZC 1B9MA 1WCMB 1TIID 2HHHL 4JVYA 5ELFA 2JE6I 2WAQB 4IFDG 5IT9c 4JI0Q 5M3MH 5DNFA 1SNMA 2KEDA 4CGYB 3MFGA 1DZ1A 5C3WA 4QUFA 3FAUA 1I94L 5FOBB 3RZOB 3NUCA 1HZ9A 3A7AB 4XYQA 1PTOB 4IPGA 3CC2A 4K0KH 3SK8A 1SEIA 4DR3H 1NMFA 1SEBD 4OHJA 1M8AA 4WFN3 1RTNA 1FR3A 1Z6HA 2B63G 4GKKQ 1PH3A 4Z9CB 1KRTA 4A3GH 1SMYD 1CHPD 3ERQA 3J7AV 4GLVB 1MSGA 1QJOA 3SK6A 1VQHA 3HKZB 3BG3A 3HKZG 2LXKA 4FXGC 1MIUA 1NE3A 4OWTB 4WJWA 3DWQA 4AYBB 2QDLA 4A3LH 2Q8TA 4DR1L 3HOZB 4QMFB 1N36Q 2IW3A 1B3QA 1FJGQ 3RLOA 4ALPA 1X32A 2PNHA 4C3HH 5BR8Q 2SNSA 1BKBA 5ELDA 2AMCB 2VQEL 1LYLA 3ND9A 1ZEQX 3MXUA 2VNUD 1V9NA 4FF4A 4BA2I 3ER0A 5D3DA 2K32A 4X64L 1SBBB 2AUKA 1I94Q 2K01A 4IZ8A 4A93B 2IX1A 4RGOS 3TS0A 5FLMH 4XYOA 5AJ3L 4L5QA 4DV3L 1HJPA 2WAQG 4P2CB 1ASZA 1ICFB 4TVAB 2DY8A 1E7ZA 2EE1A 3NQTA 1WD1A 5HGQA 4QQBX 3UE0A 2B63H 4KMUC 3MFYA 3QOLA 4DUZQ 5FO7B 3TZUA 2R6GA 4DV7H 4P72A 4FF2A 4ODGA 4IUTA 4NPSA 4FO2A 1L0WA 5GADC 4IUPA 1KLUD 1WJJA 4WALA 1A63A 1ONLA 3K5MA 2JA7G 3SB1A 3D31A 5ELEA 1I4HA 1A3VA 4NKLA 4BBRB 2V4DA 5FLXE 1Y1VH 2A6ED 3C46A 3ZYYX 1TQOA 4ZYSA 4X65L 4G7ZC 1SNQA 1HNZH 5ELCA 3HOXG 1XTCD 2OEOA 2OXPA 2FHTA 4LF9Q 4K14A 4RH6A 3CCLA 2O4CA 2BCOA 4JI8Q 1IBML 4ZLTF 4FJSA 4QIWE 1SAPA 3Q8DA 4A4IA 1HQRD 4HMJA 5EPLA 1STEA 1FNVA 2FXQA 5IODA 4UDUC 3VYUA 1O7YA 4A3DB 1MKHA 3LX0A 2VUMB 5I2YA 3G48A 3Q23A 2EYFA 4LUOA 3DM3A 1U4RA 1KDBA 3A5UA 2Z1CA 2BL5A 3T13A 2CTFA 4KN7C 4MIUA 3DEOA 3FRPB 4DK3C 1KTKA 3AFPA 1RTOA 1L1OC 5LL6b 1KNAA 4GNXC 1KDCA 1K8OA 1S4ZA 3TP8A 2L1BA 4BY1G 3AMUA 4A3KB 3MVVA 4IOCA 3QIAA 1SMXA 3K7AB 1G2TA 4JI7H 1JB7A 2V1CC 4KKTA 1LTGD 3I91A 4NMZA 5DT9A 1VIGA 1WTXA 5EKIA 2AQ3B 3KFUA 1PYBA 2K50A 2NVYB 3EN2A 4CDCC 3PUWA 3URYA 4DUZH 4LFCQ 1K28A 3VR4A 1I4GA 1AW7A 1O7LA 4A3GG 3K5OA 1PXUA 2I07B 3E9IA 1SRUA 3E6ZX 1X3EA 3I4NH 3M7NA 3S1NH 1GHJA 3QG1A 4GLAC 5F2DA 1JOOA 3EZJA 1GUNA 4DAVA 4DR5H 2VQFH 4YWKA 5KYIA 4AQYL 4A93G 1PFSA 1HUMA 1KHIA 1JE5A 1YI2A 4A3BH 4N8X1 4DUYL 4KN4C 2NVQH 1EIHA 3GV3A 5IY0A 1V43A 5EKLA 2UUBL 2UXDH 4JI7L 4YY3H 2H1EA 4JW0A 5CV9A 3T1YH 1KAAA 2VUMG 2QCPX 4B3RH 2RVLA 4A3MH 2X69A 4LFCL 2ZXOA 4DA2A 2KA7A 2RDFA 3CKIB 3G7LA 3S15B 3P1HA 3JAMW 3NE5B 1TS3A 1WTQA 1N36H 4XQNA 2F0SA 1A15A 5FLMG 1FGBD 4ME5A 4JI0H 3S1MB 2FMRA 1SNPA 3PUYA 3UOEA 3NTHA 3GDEA 2L5TA 1KD1C 2EVBA 5C5MA 1XNQQ 2UUAL 2VB3X 1IL2A 3OW2A 1L0YB 2SOBA 2VW9A 3K8AA 1CKNA 1ZTGA 4TSSA 4A3IH 1VQ6A 3K58A 2CTEA 2UXBH 5JEAJ 4N9PA 3J81j 4F8MA 1JOKA 4DV1L 3AFQA 3GTOH 1H9MA 5CV6A 5IT9L 1WTRA 2JA6H 4YHHH 1HNXH 3P20A 2KHSA 1STBA 3TN2A 2ENBA 1K9MC 3A8KE 4EGVA 3A54A 1IBMQ 2F0KA 1HTPA 4C3IH 2PCFB 3CCVA 2K4KA 4K5VA 4OEMB 1F77A 4R1JA
chains in the Genus database with same CATH topology
5JOBA 2BOSA 1XXGA 1QE6A 1JMCA 2HQEA 3L0OA 1D1KA 3DM1A 4P71A 1VF5C 3KF6A 2XRSD 1K83B 3D4DA 1C8CA 1HHVA 4JI4L 1GUTA 2RKSA 2HUGA 3NHHA 1I4RA 1X9NA 2MO0A 3D0FA 3K57A 2I5HA 4APVA 1K8GA 3NBHB 1GHKA 1WVNA 2K5VA 3MTSA 4JV5Q 1B9NA 4ZAIA 4A3EG 1CZWA 4A3JB 2C35B 4WORA 1MGSA 3PIP3 1B3AA 1UE6A 5CR3A 4B3SL 2J0TD 3JAMc 2DGRA 3IL8A 1II3A 3CCJA 4DV4Q 1PFNA 1MBYA 5DLQE 3R8BA 4HR7B 3WWVA 1OXSC 1ZXTA 2D9UA 4HJAA 2RF4A 1A2UA 4JVHA 4QL5A 1Y8OB 1EY5A 1EIFA 1LUZA 3M3YH 1XYIA 4CKBA 1Q7YC 1B7YB 4XQJA 2A68D 3ICEA 4YY3L 4ILWA 3T1HL 3T4AC 3PUXA 3S14B 5DM73 1LTSD 3MXNA 4DV2Q 4BXXG 1Q46A 1R4PB 2EJMA 2K03A 2VL6A 5C4JH 4DR5Q 2OT2A 4KK7A 1YZ6A 1ML0D 1X54A 3L2PA 1KLGD 3S2HH 3TZDA 1WTOA 3S1QH 2SEBD 4YCUA 4LWCA 1V8QA 3I7FA 3S1NB 1X3FA 1UE7A 1NMGA 2R92H 1B50A 2MNAA 1TY2A 3TBIB 1SFOH 2HCCA 5C6AA 5KNBA 2F0WA 4BY7H 1GJXA 2LS01 3RN2A 5D3IB 5IGBA 1BOSA 3U58A 1HNXQ 5IYCH 3GTJH 2CTLA 1VQJA 4GN4B 4C3JH 2XWJB 1IKMA 2JA8H 3V69A 1HNZQ 1O7IA 4HIMA 1DTJA 5JJKA 1SJED 1VQMA 3VR6A 4XT1B 4LAAA 2Q2TA 5IIFA 2R7ZH 3K7UC 4EVOA 1GUSA 4V190 1UAPA 5IGGA 1B70B 2YV5A 1G51A 3L9AX 2D0OA 5FJ8G 3JAML 2VZAA 1VIHA 1WTWA 4IPCA 4G7HC 1V1PA 3GTQH 5C3EH 2R93G 5CYUA 2PZWA 2XWBB 1ENFA 3F1ZA 4YCWA 5K5PA 2AHOB 4HCEA 1I4PA 4DK0A 5IE8A 1BO0A 4A3IG 1MD2D 2GVAA 1EY6A 5C0XG 2B3GA 3J81L 4RG1A 1G291 1STGA 2E3UA 1I6HH 3O13A 1X4NA 1PH9A 1XMOQ 1TY0A 3OTOQ 3TS2A 2CVRA 3M4PA 2WB1B 4LF9L 3OSOA 3KF6B 4ME3A 3HOZG 4CKCA 4BY7B 5COYA 5FK9C 1NJIC 1Q1EA 4JV5L 2IJ0A 2RCNA 3VYSA 1EU3A 4PZ6A 1XPRA 5EPJA 1QVCA 4A3DH 5DAUA 3I73A 1RCVD 2R61A 5J1ZA 1PHJA 1I4XA 5AFWA 2VY3A 2JA8B 2ZTCA 4JYAL 2TMPA 4HTHA 1SROA 4R4QA 3K80C 1PLFA 2VQEQ 2R3ZA 2ZJPA 1FD7D 1NBWA 1UWVA 1HR0L 3S16H 2KQ3A 3HEJA 3GTQB 1ESRA 3T16A 3E9HA 4ZKCB 3S17B 4F88A 2XVSA 3I2ZA 3K6OA 2JK8A 1QNUA 5AJ3Q 4IPDA 3I4NG 2F1MA 4X3SA 2NVYH 2KEEA 1IYJB 1HFGA 3STBC 5I6YA 1LTRD 2DUDA 3V96A 1NSNS 3R2TA 1BQQT 1LLRD 4JYAQ 1Y1WH 1S5DD 5JPMC 3J81E 1PRTC 4PNYA 2L9HA 1JB3A 1EQTA 1L1OB 1KDAA 1EFWA 2EZVA 3HOWB 2ZJRA 1LT4D 3H0GG 2K05A 1Q90A 4JI1L 5M5WB 1N9WA 2OQKA 3UDGA 4F7XA 2EJFC 2N3SA 3IFDA 2EY5A 1BDOA 1SYFA 4H02A 2VQFL 2F3WA 4H13C 3VDYA 4GLXA 1IBLQ 4POGA 5JJZA 1T5EA 1D8LA 1YJWA 4P74A 1PMRA 1YEZA 1SMYC 4BBRG 1M1KC 1E2VA 1JICA 2EPBA 2B2UA 3DMUA 2A5HA 3EFXD 2LKVA 5EBCA 1I5FA 5I9PA 2Q2UA 4LFBQ 5CORA 1LACA 1RD9D 2X6LA 2KHJA 3T1YQ 2UXBL 1JJ2A 2HDLA 5M5XH 1ILPA 5C44G 1STHA 4X62Q 4G4KA 3GTOB 2PYKA 2OQ0A 1HXYD 2HH2A 1V1OA 3H0GB 1E2ZA 1ZKOA 2NB0A 1QG7A 3MHBA 5IYBG 3F2UA 5JVH3 5FJ8H 3CCQA 2R7DA 1DONA 5IP7G 1PTOD 1X55A 3I70A 4DAPA 1RDPD 4UPAA 1SLJA 3FP9A 4DKAC 5K36G 5LMNW 4RA8A 1VQ4A 3H6MA 2EOTA 4LUZA 1I50H 1PTOF 4PZ8A 1K8AC 3BYTB 3OTOL 4JI3Q 4A3CH 4DNRB 4JC0A 2PNRC 1SYCA 1SNCA 2LMCB 3PUZA 3HOUB 3D3RA 2AQ2B 2BE5C 2N55A 4KJOA 5CV8A 2RBMA 4JI7Q 1TS2A 5BN5A 3E5SA 1ENCA 4NW2A 3J80i 1S40A 2IHFA 1AZPA 4DR5L 1HZCA 4X66Q 1AE3A 2A68C 5IWAQ 1KABA 4DR3L 1L1OA 2A74C 4C3IB 1LT3D 4DR2L 1IW7D 3WDNA 4OIJA 3LGJA 4A3KG 5GROA 2NTTA 4IUNA 3CC7A 3I55A 2E75C 1TWCH 2NVXH 3MAQA 1B4OA 1X56A 1F2LA 4WJ3M 4RAUC 1AH9A 1EZ6A 1LABA 5KEEA 1LTBD 3RR5A 2AXYA 3P75A 3CD6A 3HGBA 5KIXA 3L3OC 2KCTA 1U4LA 1A0IA 1C9OA 3RN5A 1VQEA 2MGSA 2IX3A 1E24A 2A6HD 4UP8A 5GQOA 4BBSB 4K0KQ 4JI2Q 4DV5L 4DR3Q 3SVMA 5EAYA 3BDLA 1B8AA 3ND8A 5C3XA 3DLLA 3ULJA 3PSIA 2I5LX 1CQFA 3BZKA 4P73A 3LNNA 2QDBA 3EQLC 3PMFA 2A8VA 5GAHC 3GTKH 3TRZA 1A8VA 2ID0A 4YCVA 4DK6C 1DJRD 5LMNL 1XMQQ 1ZZJA 5C4XB 1B1ZA 3BU2A 4OL7A 3PO2H 1YNJC 5CV5A 4EQNA 4DV4L 5IGFA 1XNRQ 4KY6A 1E1TA 4OWXB 2NVTB 1QILA 2HHHQ 4J8QA 4OGQC 1BVSA 2HIXA 2UU9L 3HOXB 2Z0SA 1NAPA 3UDXA 5LMUQ 4HJ9A 4WANA 1EOTA 1X3PA 1PRTB 3T56B 1EQRA 1XMQL 4LF5L 2MUYA 3UE1A 5J39A 4K6LA 1TWCB 3GTMB 1VMCA 4KY7A 2R92B 2B2YC 4A3EH 1SE3A 1UE5A 1WYDA 1EL0A 1Y1VG 2E5LL 1GUGA 1YBYA 4GN3B 1W6KA 2XSCA 3BDOA 2Y0SE 4N9TA 5CBEE 2YQRA 1WTPA 3MWYW 1DCZA 1YHBA 1HNWL 2DY7A 4GOPA 4A3FB 1BBUA 4BY1B 1WI5A 2ANNA 2C5CA 3S9WA 2PQAA 2B2WC 5BN4A 3KDFA 1Z47A 5DM63 3GTKB 1EIYB 1TVXA 1EYGA 3CCMA 4DFAA 3RLFA 3WOEA 3LWUA 2PPBC 1TWFH 1Q3LA 4DAYB 4LW1A 4LNQA 3CCEA 4X6AH 4FVMA 1C0AA 4KTAA 5IWAL 2G9DA 4BBSG 3SXHA 2B2YA 1TT2A 2JXMB 2EXDA 1VQFA 2NVTH 2KECA 2B29A 3D8GA 4HAEA 4KKUA 1AZQA 2CCZA 4A93H 1JWUD 4IALA 3S2DB 1F2ZA 1STAA 3S1MH 1PZID 2E2DC 3TP6A 1A3TA 1TWFB 2L55A 5IGCA 3PIOA 2A69C 5CV7A 5BR8L 1Z9FA 1OXVA 3NENA 3KYHC 2EQSA 2CW0D 1STNA 1QNKA 3DUZA 3E0JA 1TWAB 2R93B 2C9OA 3GP7A 4PMBA 1IHZA 4A3EB 1CA6A 3Q0AA 1SYDA 3RUZA 5EQ0A 3EVQA 3AEVB 2J4XA 3B6YA 5JJIA 4A3BB 1HZBA 1SYGA 4OO1G 1ZZKA 4LF8Q 2K28A 3T53B 4QY7A 4AM3A 3H94A 1RF2D 1YJ9A 4JG2A 2IT1A 2PY9A 1ET6A 4ZUJA 5T1IA 2F0HA 4DAMA 4C2MB 1GVPA 1N34Q 1K1GA 3A8JE 4GS3A 3F2BA 3HOYG 4YWMA 2VB2X 3CW2C 3GO5A 4LF7L 1X4MA 1EY8A 1LM0A 1PFBA 3BS1A 3I4LA 3IAYA 1MI2A 2EJGC 3N6RA 2ES2A 1DOKA 3WOFA 2ICEC 4B3ML 4A3BG 1BCPC 2CHBD 3A8IE 5LMUL 2KOLA 1LT5D 3PUVA 2WKCA 4JI8L 3CHBD 5M5XB 1GUWA 2UXBQ 4KHVA 1CUKA 2UUAQ 3PO3H 1SSOA 2EY6A 2A73B 5IP7H 1TWGB 1N33Q 1CI3M 1P16A 1MSHA 4DAYA 4EQ5A 1YIJA 1D1IA 2F0FA 5KNDA 1ZYRD 2ATWA 3VKEA 1QCBD 1VQIA 5M5WH 3J7A5 3AEVA 3F2DA 3NEMA 4BXXH 1IBKQ 3V05A 3GTLB 2PQAB 1VQPA 1L2FA 3PIPA 2HIVA 2MQHA 1Y14B 3NXWA 3HZXA 1XNQL 3NSWA 5HGTA 3Q24A 4OO1I 5FLXL 5IP9G 2NVQB 2L0CA 5D14A 2MP1A 3IFTA 4XTCS 3J7YW 3Q22A 1RJTA 1IW7C 2ZTEA 2JEAI 3R3OA 4LMQD 2F0JA 3KF8B 1KRSA 2XN9C 3AB9A 2EYHA 2B2VA 4FNFA 1U9RA 1KNEA 1JC7A 2PMZB 4JI6Q 4KJNA 3CCUA 1XPUA 1BR9A 5H1SE 3I4MG 4KHPL 3TMEA 2HCIA 2K5HA 2KCCA 3BJUA 2RDGA 2KBNA 3RZDH 1M90C 1SR3A 4OX9Q 5CV4A 4HJ8A 2BE5D 2QEJC 2B2VC 2ZM6L 2F0IA 1HNWQ 3ULPA 4IQZA 2EYMA 2AWNA 3NTKA 4RHSA 3VYTA 3FPPA 3CPWA 1PA6A 1X6OA 2BH8A 1S72A 2X6GA 1U5KA 3I4NB 4PZ7A 2A1AA 2O4XA 4GKJQ 2CPQA 3BZDB 3PO3B 4JI5Q 3K0YA 1SE2A 2F0LA 1LTID 1D7QA 1D5ZC 2EY1A 1AEXA 4OO1H 3NP8A 5JAVA 4J1MA 1QVFA 2B63B 1PV4A 3EIVA 1VQAA 1SXTA 3HOWH 2R7FA 5M3MB 1TWAH 1KC8C 2UU9Q 4IUUA 1J8IA 1R9TB 2F0UA 1J5EL 4KY5A 2N78A 2NZOA 2NZ1D 4F87A 2R7ZG 2JYOA 1EUJA 4ID6A 3SE0A 2PW7A 4HIDA 4WJ4A 1FNWA 3MXNB 3G71A 4K2KA 3NK9A 4C3JG 1BBWA 1XMOL 1V1QA 3F2CA 1XJVA 4O42A 2H5XA 4DR6Q 2CKZB 3J81c 1SNDA 3I4OA 3J80L 2ZT9C 5M5YB 1CA5A 3UDFA 4A3GB 3H15A 2Z4IA 4K5WA 4V0BA 3CCRA 1J6QA 1UEAB 3FMCA 4XXEA 1YNND 4RGTA 4GKJL 1EQQA 1T9HA 1BF4A 4A3IB 4NXNQ 2JA9A 4I65A 3HOZH 3NTIA 5NUCA 3T1YL 1HNZL 3KBGA 2Y0SB 3K7AH 5A35A 2RDHA 2TSSA 2DNCA 3T51B 5EJWA 3PF5A 1ZYRC 3KJPA 1HUNA 4L5RC 4JCVE 4LFBL 1YITA 1JOQA 1Q8KA 2HH3A 5M3FH 2SNMA 1EQVA 3RNUA 3M3YB 2NBFA 1CHQD 3EA6A 2JA5G 4LJZC 4X64Q 4CKEA 3M7GA 2IX0A 1CTMA 5C0XJ 2Z8LA 2JA8G 5C44H 5M3MG 1CT1D 3CCSA 1W6JA 3BVMA 2JA5H 1TU2B 2RSNA 1KL9A 4JI1Q 4QJFA 3K0XA 4Y7NB 2ASBA 4BY1H 4L63B 2SDFA 1LTAD 4LFAQ 5TSSA 3A0JA 3E0EA 1V1PB 4A3JH 4LF4Q 1OTCA 4AIMA 2CFMA 2GVBA 1YHAA 3L7ZC 1PDQA 2LY7A 4HIKA 4ABNA 1IYUA 2KENA 4DNIA 1I4QA 4DU9A 1PH7A 2QKIC 2EIFA 4R4TA 3GTGH 3GTJB 2AQ1B 2ZJQA 1LT6D 1KAWA 1Q8IA 3G6JB 1HH2P 2NVXB 4FP5D 3AU7A 1VCIA 2R7ZB 2B39A 1H9RA 3KJOA 4JBWA 2YTVA 2F4VL 4C56C 1TWGH 4TKOB 1JWSD 1WOCA 1FNUA 5ELBA 1P8LA 1TS4A 3HOVH 5I4DA 1N32L 1HA6A 1VQ7A 2F3VA 3IRBA 1BCPD 3D6WA 4JK1C 4RCOA 1GO3E 2K14A 1LTLA 2ZXRA 3GTLH 3C1EA 1C7YA 1BUVT 3S15H 2ZTDA 4A3KH 4HJ7A 3J80c 2NYZD 1BCPF 1PH4A 4UP7A 4JBMA 3D6CA 4OIKA 4L5SA 5E7NA 1H95A 2Q2IA 3K59A 3GV6A 2IWHA 3H3VH 1VDZA 1OXTA 4C1NK 2PZUA 1W2BA 2JSOA 1GOZA 4ZRZA 1CK1A 4J15A 2VQFQ 2PZTA 4DV1Q 1GXDC 3OIQA 3SR1A 1FVIA 2F4VQ 2BA1A 1WD0A 2WKDA 2B2TC 3LWEA 5DEHA 4DV6Q 3Q6SA 1WFQA 2QA4A 3SK5A 1HQMC 4X65Q 3T1HQ 2CWPA 4GN5A 4C3IG 1YNXA 3S1RH 1EY7A 3QO2A 4JOIA 3KLSX 3RLNA 1VQKA 3NQIA 4QF4A 2IL8A 1X65A 1DYQA 1O80A 4O2DA 2QILA 1RKNA 1SYEA 4RKBA 2E2IB 2QGQA 4K8JA 2YU9H 1IZ6A 5IYBH 2Q2HA 4IUQA 4UAIA 3S1RB 2Q8RE 2N88A 2PQEA 2R92G 3JAME 3BVGA 1OXUA 1CZGA 4NBQA 5FO9B 3HOVB 2AKWB 1PH5A 3TEHB 3H3VI 1VQ9A 4RFBA 1F9QA 2A19A 4NXML 1R9TH 5M3FB 1CM9A 1IYVA 2Z4HA 3VYRA 4K0KL 2ZM6Q 3DHQA 1HR0Q 1NR2A 5ELOA 1EWCA 2PMZE 5LMNQ 2HDMA 1SYBA 1CQVA 3I72A 4FYDA 2RA4A 2PQUA 4LF6Q 2G9HD 5IGEA 2YYZA 1QZHA 5GAGC 4HCSA 3QB3A 5FKAC 2K5QA 4HN7A 4MHEA 1J4WA 3KLWA 3HG9A 4R4OA 4YHHL 2IY5B 4Y7NH 2E76C 2RHQB 1QUQA 4O1NA 4IFDI 4JI3L 1NR4A 3DXJC 2MHVA 2F3IA 4GNXB 4NXMQ 3K5LA 1U4MA 3JC66 3FHWA 1NTGA 3S14H 1J5EQ 4RHRA 1HRJA 3RZDB 1PH8A 2K5WA 4IOAA 2E2IH 1QOHA 5LL6X 1E3PA 1VMPA 3KBXA 5HY6A 3NBIA 1RHPA 4HMIA 1WCMH 2D0PA 3ULLA 1E22A 1S5ED 3X3NA 1DM0B 3S2HB 2WB1G 2EYJA 1K3RA 1HR0W 3FKIH 4B9XA 4B08A 4DR2Q 3KLRA 3S2DH 2EDGA 3C2PA 5J22A 3HFZB 2UXCQ 5E3FA 1D5XC 4X3TA 2UXDL 2ICIA 4QGUA 4KKSA 4K8IA 1U4PA 4E6IA 1Y8NB 1EIGA 1GD7A 1I6VC 3TSSA 4ZKBB 1A2TA 3FPUB 1CSPA 3D4WA 3OWEB 2WP8J 3NWSA 4Q5VA 1I3QB 1UUPA 2K5DA 3KLSA 4C1NI 1NY4A 1IXRA 4Q0FA 2UUBQ 2OTJA 3A56A 1AFPA 1VQDA 1JJGA 2NN6I 3K81C 1J5KA 4ZQ3A 5ELNA 1SJHD 4LF7Q 2WFWA 2NUCA 3RD4A 3HOYB 5M5YH 1YHQA 3H09A 2NTSA 2YTXA 2F0PA 3D4RA 1EEFD 4DXGA 4A3MB 4U673 3OIPA 1WVLA 1G91A 4OX9L 3FKIB 2AWOA 2WB1E 1JWMD 2RHSB 3ITPA 1X3GA 2F0EA 4TRDA 4DUZL 3CC4A 4JI4Q 2K52A 3PGZA 3HOWG 2F0VA 3PIO3 1EY4A 1RODA 3VA7A 3CQZH 4AH6A 4J6HA 2MO1A 2JEBI 4DV7Q 4C3JB 2N49A 1YNJD 4B8TA 2F0GA 5I6WA 4PQXA 4ZK9B 3U4VA 2CW0C 2B8GA 1HNXL 2K7VA 1CKMA 1PYWD 2PI2E 4GNXA 1K73C 4B3SQ 3A74A 2Z6KA 1VQ5A 3JAMi 2F52A 4DV6L 3N52A 1DT4A 4QMGA 1BCPB 4R4IA 1Q82C 4GKKL 4KHZA 2CWAA 2NN6H 4TQUS 3OHXC 4DF7A 1GKHA 3U9SA 1EWIA 1EY9A 4UP9A 1QZGA 1F9PA 4BBSH 1KQSA 1PH1A 1JJCB 2UUCL 2FJ2A 1VS0A 5C3EG 5C3EB 2R93H 1LO5D 1Y1WB 1N36L 1UE1A 3U4ZA 3M4OB 3I56A 3EJIA 1HZAA 1ZZIA 4MZ9A 5C0XI 3MXPA 3OWFA 2WACA 1WTVA 2FMCA 1X3QA 3STBD 4QUCA 3CMEA 5ISRA 2L4NA 5KGUA 4LF6L 4C3HG 5JPNC 1TWHH 1EZ8A 3A7LA 5IP9H 1TUAA 1DOMA 2F03A 4KHPQ 3MA2B 4AYBG 1JR0D 5A2QL 1JT8A 2I46A 3HP3A 3H3VC 2FMMA 2HT1A 1DOLA 2VS1A 3OMCA 3FEWX 4R9WA 2A69D 2E2HH 3H0GH 1H9JA 2DNEA 3CQZB 1PFMA 4H0LC 2I5MX 5IT9E 2WAQE 2JQOA 3PO3G 1SE8A 2EYPA 1TWHB 5JJLA 4DN4M 4GOPB 1VQ8A 3VR2A 3GTMH 3CRLC 3RZOH 1ICWA 2OCEA 1EYCA 5HURA 5KYLA 2Y0SG 2QNDA 5CGKA 1CKOA 2CTMA 4HIOA 5KNCA 5C4XH 3J80E 4LF4L 2DN8A 4LFAL 2NZHA 5GAEC 5D65A 3OPOA 3GTGB 2UXCL 2UXDQ 2QF7A 4YY3Q 5C4HA 2KHIA 3CPFA 3MEFA 1DGSA 1JORA 1SDFA 3ONAB 4PG3A 3BYYB 3W5OA 4PMCA 2I0QA 1I3QH 4DV7L 4DV0Q 4R8NA 2QEXA 3KK7A 1CFMA 1SFOB 4DNTB 1JQYD 1PH6A 3PO2G 4C3HB 5JEAG 1OXXK 4XDXA 3VR3A 1GUOA 4JI6L 3NPPA 2CTJA 2O5JC 2B8FA 2K1BA 4H44C 2IHEA 3BVZA 5KRUA 4HSPA 1YJNA 1G6PA 3AQQA 2EXZA 2L12A 3GTPB 3S16B 2JA7H 4JI2L 5BN3A 3X3MA 4OONA 4A3CG 1KXLA 2JZXA 3M4QA 1Y1WG 1Q81C 4YHHQ 2D62A 2JJQA 2UUCQ 1VQNA 1V9PA 3MEHA 3SEBA 4CJ0B 4B3RQ 1XWEA 2EYOA 4X66L 1N32Q 1EYAA 4DR4Q 2JA5B 1VQCA 3KDFB 5C4JB 4EQOA 3I4MB 3MZ5A 2JA6G 1Q12A 2JA7B 3ZJYC 2E2JB 3ERSX 2WINB 3K5NA 3W1GA 4DV0L 1CSQA 5J3BA 3M9BA 4IPHA 4DV2L 1Y69U 4LK1C 4DR6L 4BA1I 2JVZA 4G7OC 4MNOA 3W1BA 3W2DA 2GN5A 2B2WA 4NP5A 1T5XD 4R8IA 4X3UA 1SNOA 2K75A 4DPGA 3P7JA 5K36H 1ILQA 3RMHA 1XPOA 2FINB 1EU4A 2E2JH 4QIWB 3PO2B 4A3DG 1JCKB 1NCVA 1EWHA 3KOJA 2VXWA 1TR5A 1BXTA 3M4OH 1KHMA 4MN3A 2VUMH 3EROA 4QB4A 2GA4B 4P75A 2XIWA 4WRDA 2JA6B 2J7ZA 4IUVA 1R4QB 3CP0A 5E4WC 3C3LA 1RL2A 4FF3A 4A75A 4Y52H 2O2LD 5A2QE 4FDBA 1CKNB 4LUVA 5EPKA 4DR7Q 4RKLA 4ULLA 3GTPH 3C1FA 5C4XG 1F2MA 1PZJD 2XNAC 1PYSB 3HS0C 3OW7A 1YNNC 3CU7A 3UDIA 4M8AA 3HOUG 1S5CD 1I50B 2BDNA 1VF7A 3I4MH 3M4YA 2DGYA 4YWLA 1N34L 2EYLA 1I6HB 2LSSA 2HQLA 1TXYA 3A55A 4M1UB 4RWSC 2E74C 4R4CA 2OWOA 5CC4A 1Z7TA 4FXKC 3R2IA 2MPMA 2B2TA 3KUPA 4QCLA 5JVG3 2O5IC 1S3OA 5I9OA 2M2LA 3SGIA 2KJXA 5C44B 3BZCA 1B44D 3FVQA 4DR4L 1N8RC 1E1OA 5T1GA 1Y1VB 1EEID 4CJ2C 4DR7L 4IURA 4B3TQ 2OPUA 3TP7A 1G2SA 3HRZC 3HKZE 5M3FG 1FJGL 2KUMA 3OMGA 4AYBE 2MJ8A 1K8MA 2WV6D 1VQOA 2M00A 1N33L 4DV5Q 1PVOA 5C4ZA 4CJ1B 4DV3Q 2F0QA 3S17H 4EX5A 1RIPA 1BBXC 5FLXc 5JEAH 2E2HB 2F4IA 3M85A 1PH2A 5G3LF 2F0OA 1EOVA 2RQXA 2LXJA 4RCNA 1AE2A 5EGTA 2K04A 3DWAA 2MFIA 4B3RL 1E0BA 2Z6KC 4A3JG 2A6EC 2E8GA 4XT3B 1U0LA 4GOPC 2FFKB 1K83H 3MC0B 3QOJA 4DUYQ 3SHLA 3G4SA 4XQQA 4NDXA 2IPKD 1PTOH 2YU9B 3CRKC 1HPCA 5IGDA 2K6AA 1STYA 5LHY1 4NXNL 1JE4A 4FXDA 3HOYH 1J9OA 5IYDG 4A3FG 2OF1A 4KLKA 1BNZA 4O0AA 1Y8PB 3IKJA 1QVGA 1EY0A 4BS9A 4LF5Q 2D2CC 1QUQB 3GD7A 3A5ZB 2F0NA 4IN3A 3DEPA 2CQOA 1OO9B 3NBHA 2EY2A 3W3AA 2K5NA 3F8TA 3EBEA 1AN8A 1ENAA 3TREA 1UNSA 2A6HC 2XGTA 2E5LQ 3QWNA 1D2BA 5FO8B 2OTLA 2F0DA 3G6EA 2XTIA 1F9SA 1UEBA 1DXMA 2WIIB 4EQPA 1KIXA 2F0TA 3HOUH 1ESFA 1XX8A 4IFDH 2MJHA 4KD3A 5IYCG 3NWTA 2XRQD 2F0MA 5IOCA 3DWPA 2OPVA 1C48A 1NUCA 4OWWB 3HKSA 2NN6G 1ET9A 1LV9A 3CF5A 4JBKA 3H91A 1Q1BA 1G6ZA 5I2XA 2N8NA 5EKKA 4UY8C 1FL0A 2PW5A 3U9OA 5CBAE 4HJ5A 1F9RA 1XNRL 4PMWA 4B9WA 4DR1Q 4H7BA 3TQYA 5IYDH 3S24A 4A3FH 3V2TA 4U68A 5G3LD 1EC6A 3U50C 3J7AF 4AQYQ 4DGZA 4G57A 1H9SB 4NB3A 1C4QA 4RGMA 4K5XA 3QJYA 4DXFA 1PRTD 4RGNA 4MTNA 2YTYA 1HA5A 1VQGA 3R93A 1MJCA 3BDCA 1VQLA 1Q86C 1E2WA 1B2TA 4IJHA 1WE8A 4X62L 5CMDA 1PZKD 4IJLA 1A3UA 1MJEA 1PTOC 2RSOA 1HFNA 4A3LG 3J81i 4K6DA 3AYHB 2KCMA 3SDZA 1SN8A 3HOVG 3CMAA 1QB5D 3SK4A 2M9VA 1L0XB 2ZXPA 4A3MG 2CTKA 1LTTD 4XIGS 1O78A 2CQAA 1S5FD 3FKIG 1EFID 2KCNA 1IBKL 4LF8L 1F2YA 4DK1A 2L15A 4FF1A 4IO9A 4C2MH 2L11A 2PI2A 3CXCA 1SE4A 2BH2A 1WCMG 1H9KA 3CAMA 4X3KA 4I7ZC 4GZYC 4CHTB 1EYDA 4BY7G 4BWGB 1XTDA 4A76A 4PV1C 1YVCA 4JBJA 4IFDJ 3KF8A 1TS5A 4OXPA 1D5MC 4HSVA 4LIJA 3OOCA 2H4OA 4S3SA 1FYCA 4BBRH 2P2RA 3I90A 5M9OA 4B3TL 1GM5A 3TP5A 1HTLD 1A6XA 3UI2A 1O7ZA 2BA0A 1W3SA 4POFA 2LFNA 1AP0A 3GQBA 4KD4A 3FDTA 4L5TA 2PO4A 3PV0A 4ZUIA 4B3MQ 1A62A 1D6EC 2ANRA 2ALYB 4JOIC 2KVMA 3I8ZA 4KI0A 2Q8IB 1DD2A 4JI5L 3VA5A 4RMFA 3TDQA 3NELA 4KV6A 1HCZA 4JI0L 1M4VA 4HEDA 1S5BD 1IKLA 1TKWB 2JP1A 5LL6S 2D5DA 1QWYA 3S1QB 3PF4A 2AUJD 4L8JA 1IL8A 5E1FA 1FGUA 1PRTF 1H9SA 2B2UC 3I3CA 4K2LA 1B53A 4YIJA 1K0RA 1VQBA 2BDOA 5EBDA 5E4XA 3PCOB 1ASYA 1G8ZD 3VR5A 4CBVA 2NWGA 3HOXH 5C0XH 3MXGA 3OYYA 1IBLL 5C5LA 3U1KA 2K33A 4L6TB 3J7ZC 1B9MA 1WCMB 1TIID 2HHHL 4JVYA 5ELFA 2JE6I 2WAQB 4IFDG 5IT9c 4JI0Q 5M3MH 5DNFA 1SNMA 2KEDA 4CGYB 3MFGA 1DZ1A 5C3WA 4QUFA 1I94L 5FOBB 3RZOB 3NUCA 1HZ9A 3A7AB 4XYQA 1PTOB 4IPGA 3CC2A 3SK8A 1NMFA 1SEBD 4OHJA 1M8AA 4WFN3 1RTNA 1FR3A 1Z6HA 2B63G 4GKKQ 1PH3A 4Z9CB 1KRTA 4A3GH 1SMYD 1CHPD 3ERQA 3J7AV 4GLVB 1MSGA 1QJOA 3SK6A 1VQHA 3HKZB 3BG3A 3HKZG 2LXKA 4FXGC 1MIUA 1NE3A 4WJWA 4AYBB 3DWQA 4OWTB 4A3LH 2Q8TA 3HOZB 4DR1L 4QMFB 1N36Q 2IW3A 1FJGQ 3RLOA 4ALPA 1X32A 2PNHA 4C3HH 5BR8Q 2SNSA 1BKBA 5ELDA 2AMCB 2VQEL 3ND9A 1LYLA 1ZEQX 3MXUA 2VNUD 4FF4A 4BA2I 3ER0A 5D3DA 2K32A 4X64L 1SBBB 2AUKA 1I94Q 2K01A 4IZ8A 4A93B 2IX1A 4RGOS 3TS0A 5FLMH 4XYOA 5AJ3L 4L5QA