4BA2I

Archaeal exosome (rrp4-rrp41(d182a)-rrp42) bound to inorganic phosphate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
226
structure length
213
Chain Sequence
SQEIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGNKSMYETLTSCSIFVANNGRIWATCSRFSEEILIEAIRKIENELTDRIKQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a 9-Subunit Archaeal Exosome in Pre-Catalytic States of the Phosphorolytic Reaction.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase/rna
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
total genus 40
structure length 213
sequence length 226
ec nomenclature
pdb deposition date 2012-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ba2I01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ba2I02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4ba2I03
2ZM6Q 1XNQQ 4JBWA 1TUAA 2I5HA 1A6XA 5HGQA 1N36Q 1WOCA 5M3FG 4JI2L 2HH2A 3ULJA 2BA1A 3NBHB 4DAMA 2UXCL 4DV2Q 1V43A 3VDYA 1YJNA 2K7VA 1Z6HA 4B3SL 1ZZKA 1YZ6A 1P16A 2A19A 2KBNA 2KCCA 1BKBA 1J4WA 2ANRA 2HT1A 3OTOL 3M4PA 2CFMA 3I55A 1VQLA 3PO3H 1WVNA 4A3DH 2K5NA 1HZAA 4X62L 5C44G 1XJVA 1I6VC 1L1OA 2JQOA 1X65A 2OQ0A 4LUOA 1TWHH 2Z0SA 4AH6A 3CCVA 1VQ4A 2KCTA 3F1ZA 3S16H 2FMRA 2D5DA 4A3CH 1X4MA 4R1JA 4LF9Q 4IJLA 3FMCA 3RLFA 2PNRC 2Z6KA 4QL5A 2O5JC 2LXJA 4DV0Q 4DV3Q 1A62A 1FJGQ 1HNWL 2JJQA 1YNXA 3U4ZA 4A75A 3CAMA 3PF4A 3PUZA 2LSSA 1Y1VG 4IFDJ 2UUBQ 2UUAL 3CQZH 3NENA 3KLWA 4LJZC 3K7UC 4GNXB 1E1TA 1J5EL 1HZCA 1YBYA 4LFBQ 1VIGA 4B3TL 3OOCA 4KMUC 1IZ6A 2K50A 4LUZA 4LWCA 5H1SE 3CRKC 3F2BA 3ER0A 3FKIH 2AMCB 1VQFA 1ZKOA 1UE5A 1OXVA 2NN6G 4QIWE 5M5YH 4XTCS 4B3ML 1XMOL 1G291 4A3MG 3VR4A 4L5RC 2CTEA 3A7AB 5FLXc 2YV5A 2I5MX 3PO3G 2V1CC 2E74C 2CQOA 2NN6I 1FGUA 5C4JH 1DCZA 4IPDA 2NN6H 4BA1I 2A6HD 1IYJB 5IWAL 1V8QA 4LW1A 2RHQB 1L1OC 3A5ZB 2K33A 1QZGA 1PA6A 4JI3L 4YCWA 2UXDQ 4HIMA 1VQPA 2UU9L 2BE5C 3GTMH 4PMWA 2CW0C 4X66L 1SRUA 1YNNC 3PCOB 2OWOA 3AFPA 1N33L 3TS0A 4B3RQ 4X64Q 1YHBA 4DUYQ 4LIJA 1KHIA 3H0GH 1X6OA 3CCRA 2ZJPA 2PY9A 3BU2A 4DR3L 4OO1G 2CWPA 1YITA 4DV6Q 1YIJA 4BA2I 1L0WA 2WFWA 4JI7Q 2L5TA 2HHHQ 2CCZA 3DXJC 3EN2A 4DV5L 1YJWA 3PO2G 5IP9G 3FPPA 3U58A 1GHJA 1OXSC 3HGBA 3BZCA 2PMZE 3GO5A 4HIDA 1SFOH 1VQ8A 2QGQA 2ID0A 3IKJA 4A3FH 2JA7G 1SLJA 4JI8L 4A3CG 1HCZA 1NBWA 4UPAA 2NVXH 4WJ3M 2HQLA 2BH8A 2N49A 5AJ3Q 1H9RA 2WB1G 1M1KC 4IJHA 1PYBA 1VF7A 4MTNA 4PZ8A 3RN2A 1OTCA 2PI2A 2WAQG 1VQJA 4IPCA 2OPVA 1Q86C 1Y1WH 1IBLL 3GD7A 4A3FG 3DLLA 4A3JG 4DV4Q 4JI1L 1GO3E 1AH9A 1ZZJA 5IT9c 5IYDH 4H13C 3ND8A 1KRTA 3CCMA 3M4OH 4DR6Q 2OTJA 4WANA 1Q46A 1UWVA 2FXQA 3FHWA 4A3IH 1K73C 5KNCA 3HOUH 4JYAL 4BY7H 4YWMA 4LFAQ 2MO1A 4X65Q 4HIOA 5JEAJ 4IFDG 3G71A 1Q1BA 1HJPA 1OXTA 1VS0A 4GN3B 1VQMA 3E0EA 1HZBA 3TEHB 1KHMA 2PQAA 2ALYB 5IP9H 1JB7A 2A68D 5M5XH 4IPGA 1K0RA 4TKOB 1TWAH 3ERSX 1EQRA 1HH2P 5LMUL 4GZYC 5M3MH 1X56A 1YI2A 1HNXQ 4TVAB 3RLOA 3F2CA 1IBMQ 4IFDH 2E2IH 4KKUA 1XTDA 3MXUA 3M3YH 1E24A 1I94Q 3GDEA 4BBSG 2ZTCA 4IQZA 1FYCA 1PH9A 4DK1A 2ZTEA 4TQUS 4PZ6A 3CCJA 4JBKA 2B3GA 5IP7H 3PIOA 1HR0L 4PV1C 3TZUA 1JJGA 3KLRA 3CC7A 2JA6H 2KA7A 3CRLC 1MIUA 4POGA 4NXNQ 3F8TA 1QZHA 2E5LL 3CPFA 1AE2A 4JOIA 1K83H 2CTLA 1H9KA 1N32Q 1I50H 3ICEA 1GM5A 4BBRG 3SE0A 4DR7L 2OPUA 3AEVA 2KENA 2A69C 1I5FA 3T51B 4KKSA 1UEBA 1ASYA 4JVYA 1DXMA 2DNEA 1XNRL 2EJGC 4DV2L 1FL0A 1V1QA 2AUKA 3N6RA 4OWWB 1IYUA 3WWVA 4L5TA 1Q12A 4OONA 4LFCL 3CC2A 2HIXA 4DR4Q 2JXMB 1BBWA 1Q82C 3H0GG 3J81i 3HOYG 4LF5L 1V9PA 2VQFL 2EIFA 3CW2C 1X3FA 3Q8DA 4GKKL 1DTJA 3GTKH 4P75A 4GOPC 5FJ8H 1S40A 3STBD 5IYBH 1XMQL 2CTMA 1E1OA 3J80i 2PPBC 1PYSB 1B9NA 2I5LX 2A6ED 1Q1EA 3WDNA 5GADC 2MQHA 3HFZB 3HOUG 4WALA 4LF4L 1BDOA 2VQEQ 4L8JA 3L0OA 5C0XJ 1IBKQ 2D62A 3HKZE 3NE5B 1QUQB 4P71A 3CPWA 3TRZA 4YY3Q 4UP8A 4UP9A 1RIPA 1K9MC 4H02A 5K36H 4JBMA 3A5UA 4L5SA 3RNUA 5M3MG 2LMCB 4OX9L 4BXXG 3SGIA 2XTIA 5BN3A 4RMFA 2NVQH 3TREA 1AE3A 4UP7A 4J15A 3HKZG 3MEFA 3OYYA 4IFDI 1UE7A 3NELA 2R93H 3RN5A 1C0AA 1TWGH 4DNRB 5JEAG 2UUCQ 2MJHA 1NY4A 3G4SA 1EFWA 2YTVA 3KF6B 4JI5Q 3HOZG 1H95A 2DUDA 4O2DA 3J81j 4BY7G 1TWCH 1CSPA 1MJCA 1VQIA 2NVTH 4R4QA 3T1HQ 4JV5L 4LF7L 1GHKA 1X54A 3D31A 3S2DH 1D7QA 4H0LC 1EIYB 1BBUA 4JI3Q 3GTQH 4KHPQ 4P74A 3A8KE 1JE5A 4A3GH 1N34Q 1N33Q 3BZKA 5DLQE 4X64L 4YHHQ 2JA7H 4GLVB 1IW7D 1HR0W 3K0XA 1K8GA 1VIHA 4OWTB 4DR3Q 3M9BA 1HNZQ 5JJIA 4HJ7A 1KXLA 1X9NA 3A7LA 5K36G 4JI7L 5C44H 2NVYH 4IO9A 4GNXA 4A3KG 2JA6G 2PQUA 1H9SA 3RLNA 4C3HH 1X4NA 4DK6C 1U0LA 1LM0A 2R7FA 3QG1A 4DV7Q 3EIVA 3U4VA 4DV3L 1JMCA 3LNNA 1P8LA 2ZTDA 4KN7C 4OXPA 3M7NA 1YEZA 1Z47A 4A4IA 2R7ZG 2UXCQ 2YQRA 3DM3A 4B3SQ 3JAMi 4LF6L 4GS3A 1Y1VH 3W3AA 2QNDA 1GVPA 2MO0A 4LUVA 3OTOQ 1S72A 1CSQA 1VDZA 1IBLQ 4JBJA 4X62Q 1YJ9A 2Q2IA 3UE0A 2AKWB 4DUZL 4JK1C 4LK1C 3HOYH 1TKWB 4HJ9A 2L15A 1JJ2A 3TS2A 3CCSA 1DT4A 1YNJC 3K7AH 2VS1A 4LF9L 4DR5Q 2WP8J 1TXYA 2WB1E 5IYCG 4RG1A 2Z6KC 3T1YQ 2R6GA 1R9TH 5LMNL 2UUBL 3KDFB 4A3KH 1XPRA 3H94A 4NXMQ 1T5EA 3HOVG 4GOPA 3KF6A 1PH4A 3KYHC 2CTFA 3V69A 2N3SA 2F3IA 2F1MA 4LFBL 1IXRA 3RZOH 1J6QA 1K8MA 1W3SA 4AQYL 1HNXL 1XMQQ 1SR3A 2E3UA 1WE8A 3IRBA 1MKHA 2A8VA 2DGYA 3OPOA 4B3MQ 4YWKA 3UDFA 1C7YA 1E2VA 4G7HC 3CP0A 2EVBA 1XMOQ 3I73A 2H5XA 3ULPA 1EWHA 1VQCA 1Y8PB 3CMAA 2O5IC 1ONLA 1U5KA 1KAWA 1Q81C 1MJEA 4GOPB 1PMRA 5BR8Q 3MFYA 2OCEA 1O78A 4A3EH 1PH5A 4DR2Q 4AIMA 4AYBG 3CCQA 2E5LQ 1IW7C 3FP9A 5GAEC 2DNCA 3A74A 3RZDH 2IX0A 1N32L 3K80C 1H9MA 4ALPA 2UXBQ 1ZZIA 2BDOA 2RF4A 2UU9Q 3UE1A 3J80c 1L2FA 4DV1Q 4JI4L 4GKJL 1Q8KA 3EBEA 2ATWA 1Z9FA 5JJLA 2F4VQ 4QY7A 4A3DG 3PUXA 4POFA 4B8TA 3I4OA 3VKEA 2XGTA 5ELNA 4IPHA 4Y7NH 1VQ6A 4A3LG 4DR4L 2K75A 1VQDA 4A3JH 2HHHL 1WJJA 1X55A 3PGZA 2ZM6L 1XNQL 1E2WA 4JI2Q 1WFQA 3K81C 3S1QH 3BJUA 5LMNW 2NZOA 4A93G 3HOWH 1UE1A 1BVSA 4QQBX 1TU2B 2EJFC 3PO2H 3E9HA 3CC4A 5GQOA 4JC0A 4A3GG 2K4KA 4KI0A 4DAYB 1ASZA 5A35A 2Q8IB 3A8IE 3CCLA 2JA8G 2VQEL 1B9MA 2CTJA 1PH7A 2CTKA 1WCMG 2VUMH 2A68C 3IFTA 4K0KQ 1VCIA 2KCMA 1B8AA 1L1OB 4YCVA 2F52A 4YY3L 4HJ8A 4DR1L 2E2HH 4JI6L 2JEBI 1C9OA 3I4LA 1E2ZA 3CXCA 4OO1H 1LACA 3H3VH 3W1GA 4OO1I 3VR3A 3CMEA 3S14H 3P20A 4Y52H 2P2RA 2PNHA 3W1BA 3H15A 4JYAQ 4DV0L 1FJGL 1HQMC 4L5QA 4X65L 4OWXB 3STBC 2OTLA 1KRSA 4BY1G 2IX1A 2IHEA 2JZXA 1NTGA 1OXUA 5IYCH 3KJOA 3KF8B 2R92H 4APVA 2QEXA 4JI0Q 2OQKA 2EQSA 1Y69U 1VQHA 2EXDA 3ZJYC 4BBRH 2K32A 3T1HL 4LF7Q 3UDXA 1KD1C 2BH2A 1VQAA 3M85A 1IBML 2ZT9C 4BY1H 4KHPL 4NB3A 3M4QA 4AYBE 1PVOA 2ZJQA 2LXKA 1N34L 2JA8H 4YHHL 3I4NH 1KIXA 1DD2A 3AFQA 1QVGA 1A8VA 4OGQC 1NMGA 1EIFA 2MNAA 1TWFH 3NEMA 4NXNL 3KJPA 3UDIA 1Y8OB 3PUWA 1LTLA 4A3IG 2GN5A 3CCUA 2B29A 1VQOA 3CD6A 3H3VI 3B6YA 1QUQA 1VQNA 1NMFA 3I4MH 2HH3A 1LYLA 4QMFB 4DK0A 1E3PA 3VR6A 4DNIA 1QVCA 1VQBA 3LGJA 1PH8A 3I4NG 2EDGA 1I6HH 1PH3A 4KKTA 4YCUA 2CKZB 1XNRQ 1K1GA 4A76A 1Y1WG 1PH2A 1K8OA 2JEAI 4DUYL 4PZ7A 5C0XI 2B63H 4JCVE 3I72A 1G51A 4DK3C 3L2PA 4LF6Q 4LF8Q 3VA7A 1FVIA 1WI5A 4IOCA 1GUOA 4KLKA 3U50C 1CTMA 3MXNB 4GLAC 2IT1A 4R4IA 2ES2A 3A0JA 2B8GA 2QF7A 1B7YB 4DV5Q 2RHSB 4A3LH 4GKKQ 4DNTB 2VY3A 3S1RH 1GUGA 1E22A 3AB9A 1N36L 4GN5A 2AWOA 5BN4A 4EX5A 1VQ5A 3L7ZC 4HJ5A 3LWUA 2N78A 4JI8Q 2VZAA 1T9HA 2EJMA 2C35B 1YVCA 5HY6A 1SMXA 2B8FA 1UE6A 5GAGC 3G6EA 5C4XH 1LABA 5IYBG 3T1YL 1IL2A 1GKHA 4LF4Q 1YHAA 3PSIA 5EAYA 1EYGA 2I0QA 4EQ5A 5LMNQ 4LNQA 3I2ZA 3KOJA 1IBKL 3I4MG 2A6EC 1SROA 2K5HA 4GN4B 4HJAA 2JA5H 3KFUA 2DGRA 5M5WH 5C3EG 3PV0A 2KHIA 4DV4L 5IYDG 4RCNA 4HR7B 2Y0SG 1XPOA 1PH6A 1RL2A 3GQBA 5C4XG 3I56A 5J3BA 4QGUA 3S24A 3GTPH 3CCEA 4C2MH 3GTGH 2A1AA 1GUTA 4BXXH 3HOXH 4A3BG 5BN5A 3D4RA 4LFAL 2UUCL 1W2BA 1N8RC 5JJKA 4JI5L 2AXYA 2GVAA 2V4DA 4P73A 2MFIA 2UUAQ 3GTLH 2A6HC 4DR2L 1J5EQ 4KN4C 1EWIA 1HPCA 3UDGA 2VNUD 2JA5G 3D0FA 1PFSA 2AUJD 3M4YA 4I7ZC 3I7FA 3HOXG 1SE8A 5LMUQ 4B3TQ 4JV5Q 3JAMc 2ZJRA 2ASBA 3J7A5 4WJ4A 1EC6A 1CUKA 4JG2A 3S2HH 4XIGS 1G6PA 2VL6A 3A8JE 1Y8NB 3VR2A 2Q2TA 3E9IA 1HR0Q 4P72A 2AHOB 3S15H 1HNZL 3AEVB 5C3EH 1DGSA 1K8AC 2R93G 3BG3A 1SN8A 2NZHA 3KDFA 3OW7A 4FDBA 5GAHC 1A0IA 3ND9A 1XPUA 5IWAQ 2YYZA 1GJXA 1Y14B 3ULLA 4G7OC 3PIPA 3G48A 2UXDL 3GTJH 3CF5A 3S17H 2ANNA 1H9JA 2HIVA 4DV7L 4X66Q 5FLMH 2QA4A 4B3RL 1D8LA 2GVBA 4MZ9A 1VQ7A 2R7ZH 1IYVA 1OXXK 1O7IA 3U9SA 1ZYRC 3QIAA 3T53B 1EOVA 2K52A 5IP7G 3EQLC 3K8AA 5C0XG 1YHQA 4LFCQ 1NJIC 4DV6L 2B63G 5KNDA 4O0AA 2DN8A 3W5OA 4K0KL 2JVZA 2RCNA 3SDZA 2Q2HA 1VQKA 1EUJA 4LF5Q 4DPGA 3S1MH 2JA9A 2E76C 1GD7A 4PG3A 4JOIC 2VQFQ 4DUZQ 4KHZA 2PI2E 4DR1Q 1M90C 4JI6Q 2PQAB 3GTOH 3S1NH 1Q90A 5FJ8G 5M3FH 3BDOA 2E8GA 1H9SB 1X3EA 2K14A 5C0XH 1PH1A 1GUSA 1JJCB 2BA0A 4DR5L 2JK8A 1CKNB 4NBQA 4GLXA 5GROA 1CKMA 5AJ3L 1LUZA 2R7DA 1Q7YC 1QJOA 2BL5A 4BBSH 4IOAA 4C3JH 4DKAC 4X6AH 1FR3A 4A3EG 3AYHB 4ME3A 4MNOA 4NXML 3AQQA 2E75C 1I3QH 3PUVA 2IHFA 4JI0L 1VF5C 4JVHA 1KC8C 2VW9A 4A93H 4JI1Q 1E7ZA 4YWLA 1WYDA 1SMYC 4AQYQ 1B70B 3HOWG 2Y0SE 1PV4A 2D2CC 2N8NA 4NPSA 2JE6I 5IE8A 3PUYA 1K3RA 1EQQA 4OX9Q 4R4OA 1QVFA 1KL9A 4DR6L 1HNWQ 5JEAH 4R4CA 4R4TA 4G7ZC 1NE3A 3TQYA 1PHJA 5ELOA 5KNBA 3RR5A 2CPQA 4C3IH 3PF5A 1CFMA 5E7NA 1X3GA 1VQEA 5BR8L 2KHJA 2IY5B 4A3BH 2CWAA 3HKSA 1Z7TA 4GNXC 1ZTGA 4QJFA 1J5KA 2A69D 3QJYA 3T56B 1HTPA 1KQSA 2UXBL 1CKNA 2AWNA 4UY8C 3HOVH 3FKIG 3J81c 3U1KA 2WAQE 2Q2UA 1N9WA 4DV1L 1I94L 4JI4Q 4GKJQ 1GUNA 3JC66 5FLMG 1VQ9A 2D0OA 3OW2A 4A3MH 4H44C 2F4VL 2R92G 2YTYA 2E2JH 2YU9H 1HZ9A 4LF8L 1WCMH 3F2DA 2YTXA 2VUMG 2D0PA 3HOZH 4DR7Q 1JT8A 1A63A 1CKOA 5IY0A 2PCFB 2BE5D 3J7ZC 1O7LA 4HIKA 1VQGA 1CI3M 1S3OA 2K5VA 4AM3A 3VR5A
chains in the Genus database with same CATH superfamily
1XNQQ 4KJOA 5HGQA 3LWEA 3H3VC 3CKIB 4DAMA 4DV2Q 1V43A 4FF2A 3VDYA 2LTMA 4XQJA 4B3SL 2D9UA 2KBNA 1STNA 4A3DH 2K5NA 4X62L 4DV7H 1XJVA 1I6VC 3KBGA 3RUZA 1PH2A 1G6ZA 5IT9L 2KCTA 3K58A 2D5DA 4A3CH 3QB3A 4IJLA 1XMQQ 2EY5A 2Z6KA 4DV3Q 1HNWL 3D6WA 4DV0Q 5EBCA 1SFOB 4A75A 3CAMA 3RZOB 3J81E 4IFDJ 2JA7B 2JP1A 4LJZC 4GNXB 2DJGC 1RDPD 4B3TL 4KMUC 4LUZA 1U4LA 5H1SE 3CRKC 2OT2A 3FKIH 3MEHA 1TY0A 4RWSC 4A3MG 2PZWA 3GKUA 1G2SA 4RA8A 3AMUA 5IGCA 2PZTA 3A7AB 2CTEA 2YV5A 3PO3G 4BA1I 5IWAL 1S5BD 2RHQB 2F0KA 4HCSA 1JOQA 1EOTA 5AFWA 1SNMA 3S2DB 4B3RQ 2K5QA 4ABNA 1YHBA 1PFNA 1O7ZA 3H0GH 1TS2A 3TP6A 3CCRA 4X66H 3BU2A 1N32H 2ENBA 2CWPA 4X3KA 1CZWA 1L0WA 4BA2I 2WFWA 3EROA 2L5TA 2X69A 4DV5L 5IP9G 5C3WA 4BBSB 2E5LH 1N36H 3HGBA 2X6GA 1C8CA 5JAVA 4HN7A 1VQ8A 2ID0A 1I3QB 4A3CG 4WJ3M 1IBMH 1M1KC 2PO4A 4MTNA 3RN2A 1MI2A 2PI2A 2WAQG 1IKMA 1VQJA 2OPVA 1Q86C 1Y1WH 1RTOA 3DLLA 4A3JG 4DV4Q 4L63B 2ZQEA 2WV6D 2HDLA 1TY2A 2Z9HA 3BYYB 5IYDH 3S15B 2FXQA 3HOUH 4BY7H 4YWMA 5KYLA 1VS0A 1JWSD 3PO2B 5IP9H 2HCCA 5E4XA 1GXDC 1TWAH 4TKOB 1QNKA 5C5LA 1HH2P 1PZJD 1Q7YC 3GTGH 3QD7X 2E2JB 1IBMQ 2R92B 4P2CB 4KKUA 3MXUA 4XQQA 1E24A 3M3YH 5C3EB 1FYCA 1STGA 5IP7H 1HR0L 2A73B 3CRLC 1CHPD 3F8TA 1DM0B 1V9NA 4JOIA 3S16B 2RA4A 1N32Q 1I50H 4KHPH 4BBRG 3K6OA 2A69C 1RKNA 1ESFA 4JVYA 4H8AA 3H6MA 1DXMA 1XNRL 1FL0A 4OWWB 3WWVA 4OONA 1U4MA 5T1IA 1Q82C 2VKCA 4ZRZA 4C3HG 3Q8DA 4GKKL 3K0YA 3D3RA 2KHSA 2O4XA 4KK7A 5FJ8H 3J80i 1NJIC 1M4VA 1B9NA 2I5LX 2A6ED 5CV8A 3J81L 1PRTD 4B9WA 1K9MC 1RIPA 4H02A 2B2VA 4RGNA 2C5CA 3SGIA 4RMFA 5BN3A 2NVQH 1QNUA 4J15A 4IFDI 4DR4H 1JC7A 1XXGA 5FKAC 2MJHA 1H95A 3TSSA 2F0DA 5EPKA 1NR4A 1VQIA 4R4QA 1LTGD 2G9DA 1GHKA 2XSCA 1N33Q 5DLQE 4YHHQ 1EEID 3FEWX 4OWTB 4DR3Q 1X9NA 5LMUH 5ELDA 5CV7A 4JI7L 2JA6G 5CORA 1RD9D 5CYUA 4IUUA 1U9RA 2ICIA 1LM0A 2R7FA 3DWQA 1JMCA 3LNNA 2ZTDA 3NBIA 4KN7C 3UI2A 2YQRA 3I4MB 3DM3A 3KUPA 1ENAA 4C3HB 3OTOQ 1IBLH 2NTTA 3P7JA 1YJ9A 3C1FA 4A3IB 4LK1C 5LL6b 1TKWB 4HJ9A 1SE3A 2KEDA 5CMDA 2WP8J 2R6GA 4N9TA 3JAML 3GTGB 4V190 4A3KH 3X3MA 4KD4A 4GOPA 3V69A 1PH4A 2MJ8A 3KYHC 3C1EA 2F3IA 3OHXC 4LFBL 1IXRA 2F0UA 3E3XA 4IZ8A 2DGYA 3OPOA 2A8VA 4YWKA 5I4DA 4PQXA 3ULPA 1VQCA 1Y8PB 3CMAA 4FXDA 1U5KA 4GOPB 1QCBD 4X64H 1O78A 1PH5A 4WORA 1ML0D 3HOXB 3A74A 2IX0A 2HD3A 2K03A 1ZZIA 1Q8IA 2RF4A 1ILPA 5JJLA 4A3DG 3VKEA 2XGTA 1YNND 4DR4L 1LT3D 2HHHL 1HFNA 1I6UA 1X55A 1XNQL 1AN7A 2TSSA 1WFQA 3K81C 2NZOA 4QQBX 5IGGA 2K1BA 3IAYA 4ZYSA 4A3GG 1XTCD 3A8IE 4X3TA 3PIO3 2LF0A 1B8AA 2F52A 4HJ8A 4DR1L 2E2HH 2JEBI 1C9OA 1E2ZA 4OO1I 3VR3A 5EPLA 2PNHA 4DV0L 4L5QA 2OTLA 1LV9A 1KLGD 3KJOA 4APVA 4JI0Q 1XNRH 2EXDA 3ZJYC 4BBRH 1FNVA 1KD1C 2BH2A 3MZ5A 2IJ0A 2FMCA 4BY1H 2EYLA 3T13A 4NB3A 3M4QA 5HGTA 4KHPL 4AYBE 4LFAH 2ZJQA 1N34L 1J5EH 2F0JA 3G7LA 1A8VA 4OGQC 1EIFA 2UXBH 3NEMA 4NXNL 3MHBA 2EYHA 1VQNA 2F03A 2HH3A 3IFDA 4DK0A 4DNIA 1I6HH 3HEJA 5A2QE 1QILA 2G8YA 2CKZB 1Y1WG 4CKBA 5I9PA 4PZ7A 4DK3C 3L2PA 3VA7A 4NMZA 1V1PB 1CTMA 3U50C 2IT1A 5JVG3 4ZUJA 2B8GA 1B7YB 3S9WA 1B3QA 2Z4IA 2RHSB 3SHLA 4DV5Q 3S1RH 1GUGA 4EX5A 3L7ZC 4DV5H 3LWUA 2F3VA 2F0FA 1SMXA 1I4QA 3TP5A 3RZDB 3PSIA 4NXMH 2I0QA 4EQ5A 3I2ZA 2KVMA 5C4HA 5KEEA 2QDBA 2F0OA 2JA5H 3I4MG 3KFUA 4KD3A 3DUZA 5M5WH 5C3EG 4DV4L 1K3BC 5IYDG 4RCNA 4DV6H 1RL2A 5C4XG 5J3BA 4QGUA 1BXTA 4C2MH 3CU7A 1AP0A 1W2BA 3QO2A 4IN3A 1N8RC 5JJKA 2V4DA 2UUAQ 2A6HC 1J5EQ 1ILQA 1O7YA 1HPCA 4UAIA 4I7ZC 1X0AA 2EYOA 4WJ4A 1K28A 1EC6A 1KDAA 4FP5D 4XIGS 1R4PB 2VL6A 4QB4A 1AN8A 3A8JE 1HR0Q 4M8AA 3TN2A 1DGSA 1SN8A 3A55A 2YYZA 3A56A 1GJXA 1F9QA 3GTJH 3CF5A 4Y7NB 4DV7L 2K6AA 3P1HA 2GVBA 1VQ7A 2R7ZH 3U9SA 2PYKA 3QIAA 1S4ZA 3T53B 1YHQA 1SBBB 3GR5A 3K8AA 5C0XG 3LX0A 5KNDA 2B63G 2DN8A 4K0KL 2JVZA 1VQKA 5ELEA 2PW5A 2E76C 2KECA 4B8TA 2L9HA 4DUZQ 2PI2E 3GTOH 1Q90A 1PTOH 1BO0A 1X3EA 1JR0D 1PH1A 5FO9B 1L0XB 2JK8A 2K5DA 2L1BA 1AZPA 4XQNA 1LUZA 2R7DA 4DR2H 3TDQA 4A3EG 4JI1Q 1F2MA 2R93B 4AQYQ 2K1HA 2D2CC 3PO2G 3L9AX 3NP8A 3PUYA 4R4OA 1PZID 1NE3A 2QEJC 2XIWA 1CFMA 5E7NA 1X3GA 1VQEA 1Z7TA 1ZTGA 2DY8A 1G8ZD 1STHA 1SSOA 2UXBL 3HOVH 1LT6D 5KGUA 2WAQE 1SNPA 3JC66 1VQ9A 1F2YA 3JAMW 2SNSA 1WCMH 2YTXA 1JT8A 4JI6H 1A63A 4E9JA 1CKOA 4RHRA 4HIKA 1O7LA 3NWTA 1VQGA 1EIYB 4Q0FA 1WD1A 4IOAA 1WOCA 4C1NK 3VA5A 2M2LA 3ULJA 2BA1A 3NBHB 1FNUA 1TS5A 2K7VA 1Z6HA 2NVQB 1B2TA 1NUCA 2KCCA 1BKBA 3K5OA 2HT1A 3OTOL 3M4PA 2CH4W 3OIPA 4EQNA 1EY0A 1IKLA 1L1OA 4K8JA 1VQ4A 4AH6A 3F1ZA 2NVYB 2G5DA 3FMCA 3RLFA 4HMJA 5C4ZA 2O5JC 2E2HB 2JJQA 2LSSA 2RSOA 1PZKD 3PUZA 1LTTD 1Y1VG 2JN4A 2HDMA 3K7UC 1E1TA 2IW3A 1HZCA 3S17B 4LFBQ 1G2TA 1VIGA 3OOCA 4ODGA 3ER0A 5IT9E 1ZKOA 1OXVA 2NN6G 5M5YH 4J6HA 4CDEC 4A3MB 4FYDA 4IUQA 3KBXA 3K5MA 1QZGA 2B2WA 4JI3L 1SXTA 2UXDQ 4HIMA 3GTMH 3PCOB 3AFPA 2FFKB 4DUYQ 4C1NI 1EY5A 2FFMA 2PY9A 2EOTA 1SEBD 1A3VA 4OO1G 1BCPC 1SDFA 4PMCA 4ZAIA 2HHHQ 4F87A 3C46A 4HIDA 2M00A 2PMZE 3GO5A 5JVH3 4LF4H 4DV4H 1S5CD 5IODA 4A3FH 2P5ZX 1U4PA 1HCZA 3O13A 2BDNA 3Q24A 1VF7A 4EQOA 1OTCA 3DWAA 4IPCA 1IBLL 2RBMA 4DU9A 3MWYW 4LF9H 1EY7A 5IT9c 2B2UC 1KRTA 3D4WA 3M4OH 4WANA 1Q46A 1UWVA 3FHWA 3MFGA 4A3IH 4JPBW 4HIOA 1HA6A 1SYCA 1VQMA 2WKDA 3E0EA 4LAAA 3TEHB 1KHMA 1JORA 1J9OA 1WHRA 2ALYB 2NTSA 1BR9A 5M5XH 2PW7A 4IPGA 5LMUL 1HNXQ 1EQRA 3OTOH 2HCIA 4IFDH 5DAUA 3RMHA 2EZVA 4DK1A 3CCJA 1WTWA 4PZ6A 1PH9A 1JJGA 3QR8A 3GTPB 5EKIA 2C9OA 3AU7A 4NXNQ 1N34H 2M6QA 1K83H 1JICA 5G3LF 3SE0A 2XWBB 1FGBD 3TZDA 2IPKD 4K2KA 1GOZA 5EKKA 1SJHD 1L0YB 5EPJA 1QG7A 4L5TA 2FMMA 2XN9C 3I3CA 4LFCL 3CC2A 3S1QB 2JXMB 1QOHA 4K5XA 3I90A 2X06A 3MXPA 3HOYG 4OHJA 1RCVD 4N8X1 1EY8A 2EYFA 4P75A 1R4QB 4OX9H 1S40A 3STBD 2F0SA 5GADC 1MSHA 2PPBC 1KABA 1PYSB 3HOUG 3WDNA 4L8JA 3L0OA 3TRZA 4UP9A 5CR3A 4RAUC 1XNQH 1S20A 5E4WC 4YIJA 3MEFA 1UE7A 3NELA 2R93H 1C0AA 1TWGH 5JEAG 5I6YA 2PT7G 1EFWA 3KF6B 2DUDA 1TWCH 1SEIA 1MJCA 5M5YB 4GKJH 2NVTH 1TWHB 3T1HQ 2F0LA 3S2DH 4FXKC 4LF6H 4K0KH 1PRTF 1G91A 3HOZB 4PMBA 4P74A 4KHVA 1PFBA 1DJRD 3BZKA 4X64L 1IW7D 1D1KA 3E6ZX 1KXLA 3GTJB 4EVOA 5C44H 2NVYH 4A3KG 2B2VC 1RJTA 1X4NA 4B9XA 1U0LA 4B3SH 3QG1A 4DV7Q 1TQOA 4DAYA 2Q2TA 2GA4B 2UXCQ 4OXPA 4A4IA 1WTXA 3S1RB 4HSVA 5G3LD 4LF6L 1GVPA 3P75A 5CV5A 4I65A 1VDZA 5CBAE 1SYDA 3NK9A 3V2TA 2B63B 4DUZL 3UE0A 4K5WA 4JK1C 3I0PA 3TS2A 2QW7A 3JAME 3CCSA 1YNJC 4DR7H 1WTHA 2EYJA 2VS1A 4LF9L 1TXYA 3J7AF 3SK8A 1F9SA 3T1YQ 4JI3H 1MHWC 5LMNL 2B39A 1RTNA 2N3SA 3HS0C 3RZOH 4AQYL 1VMPA 5FOBB 1SR3A 5NUCA 1EZ8A 3C2PA 5FO7B 4B3MQ 2SDFA 2EYPA 3CP0A 2EVBA 1XMOQ 2H5XA 1EWHA 3BVMA 4RCOA 2K01A 3M7GA 1PXUA 4DR2Q 4AIMA 2E5LQ 1IW7C 5GAEC 3RZDH 2DNCA 1H9MA 4ZQ3A 1JWMD 1D6EC 2UXBQ 3OSOA 3RF2A 2UU9Q 2PZUA 5EBDA 1HFGA 1Q8KA 2ATWA 4LF5H 3PUXA 4POFA 3MC0B 5ELNA 4Y7NH 1VQ6A 2HUGA 3K57A 1WJJA 3PGZA 5KYIA 1HNZH 3S1QH 5LMNW 1XRHA 2XRQD 3HOWH 2WIIB 3NCVA 1HNWH 4JC0A 2K4KA 2DJFC 4KI0A 4DAYB 5A35A 3CCLA 5I2XA 2VQEL 1PH7A 2A68C 3IFTA 1SMYD 1VCIA 2F0NA 4YCVA 1L1OB 4YY3L 4JI6L 3DM1A 3I4LA 4OO1H 3CMEA 3P20A 2P2RA 2HQEA 1C4QA 2F0WA 3H15A 4X65L 2J0TD 3KF8B 2WINB 2QEXA 2L0CA 2OQKA 1VQHA 2OXPA 3T4AC 4LF7Q 3UDXA 4ULLA 1VQAA 1SAPA 2JA5B 2ZT9C 1PVOA 4DV1H 1DD2A 1QVGA 1NMGA 1BUVT 1TWFH 2MNAA 3KJPA 1S03G 2ICEC 1Y8OB 3PUWA 5IIFA 3CCUA 2K28A 4N8FA 3I4MH 1LYLA 4QMFB 3VR6A 1PH8A 3LGJA 5FK9C 3NWSA 1PH3A 4UHVA 5M5WB 1K1GA 4I7AA 4A76A 4DUYL 2B63H 2R92G 1II3A 4JCVE 4DR6H 4KY5A 4LF8Q 1HHVA 1DYQA 1C48A 3GABA 3M4OB 2ZXPA 5DNFA 4DAVA 1B53A 4A3LH 1F9RA 4GN5A 1QE6A 3TBIB 1VQ5A 4IURA 1T9HA 2EJMA 5GAGC 5HY6A 1UE6A 3G6EA 1EU3A 5C4XH 4K8IA 2CWHA 3URYA 1LABA 3GTMB 1EYGA 4OCHA 1IBKL 4A3FB 2K5HA 2DGRA 3T1YH 1BCPD 3PV0A 3QWNA 1XPOA 5LHY1 4XT3B 3S24A 5IGBA 3CCEA 3GTPH 1NNXA 3HOXH 3S1NB 3HG9A 3D4RA 2SEBD 2UUCL 4JI5L 5CV9A 2GVAA 2Z6BA 4P73A 1SNDA 2OEOA 4KN4C 1EWIA 2Q8RE 5D3IB 1X3PA 3D0FA 4B3TQ 2AUJD 3M4YA 5LMUQ 2FPHX 3BVGA 2MP1A 2F0TA 2J7ZA 3FRPB 3S2HH 5CBEE 5L37A 1EY4A 1JE4A 3VR2A 1HR0H 1EFID 3HP3A 4C3JG 2R93G 3KDFA 4CKCA 1XPUA 5IWAQ 1LTID 3GP7A 3ULLA 4G7OC 3PIPA 4TRDA 4E6IA 2ZXRA 3S17H 2ANNA 2HIVA 1I4RA 5C4JB 5FLMH 1V1OA 4FVMA 2QA4A 4B3RL 5IP7G 1EOVA 4LFCQ 3EQLC 2RCNA 3SDZA 3Q22A 2UUCH 1NCVA 3S1MH 4DPGA 4DV0H 1I94H 4PG3A 4DN4M 5FJ8G 2E8GA 1H9SB 2K14A 5EGTA 1JJCB 2BA0A 4NBQA 4GLXA 1CKMA 2CVRA 2BL5A 4EC5A 1FR3A 3AYHB 4MNOA 2E75C 2E2DC 2IHFA 4JVHA 1VBIA 1KC8C 4YWLA 1WYDA 3HOWG 1B70B 2O2LD 2JA5G 1A15A 5LMNH 3I8ZA 1KTKA 5JEAH 3K59A 4G7ZC 1PHJA 4K6DA 1LTSD 4ZCKA 1J8IA 2NZ1D 5BR8L 4QJFA 3QJYA 2A69D 3GV6A 3EFXD 2Q2UA 2QILA 4XYQA 3J7AV 2F4VL 4A3MH 2YTYA 4Q5VA 3Q0AA 2CWFA 1D5XC 2VUMG 1JOOA 4DUYH 3OMGA 2BE5D 1CI3M 2CW0D 1N36Q 4JI2L 2HH2A 4CKEA 4A3JB 2MPMA 4OD6A 2UXCL 1HNXH 1I50B 3EA6A 4PDBA 1SE4A 4HAEA 2A19A 1HA5A 1J4WA 2ANRA 3I55A 2CFMA 4CHTB 1SE2A 4JI5H 2JQOA 2OQ0A 4LUOA 3S16H 1X4MA 2H4OA 3OWEB 4LF9Q 2PNRC 4JVZA 2LXJA 1YNXA 3U4ZA 1W6KA 3CQZH 3NENA 3KLWA 5D3DA 1YBYA 1CA5A 2K50A 4LWCA 4NZTM 3WOFA 1VQFA 1NAPA 4QIWE 5LL6S 2KUMA 4B3ML 4XTCS 1OO9B 1XMOL 1G291 1CZGA 3VR4A 2CQAA 5FLXc 2I5MX 3OIQA 2V1CC 2CQOA 5C4JH 2NN6H 1PA6A 1V8QA 1L1OC 3BVZA 1Q3LA 2K33A 3SEBA 4QUFA 1VQPA 2UU9L 2BE5C 3FDTA 2CW0C 4X66L 3H91A 1YNNC 1N33L 4R9WA 4LIJA 2F0HA 1X6OA 2EYMA 2ZJPA 2XWJB 3MXGA 4DR3L 3DMUA 4DV6Q 2A1SA 4JI7Q 2Y3MA 3R93A 3PMFA 1NSNS 3EN2A 4MTKA 4O1NA 1YJWA 2RSNA 4ME5A 3U58A 1GHJA 1FNWA 1OXSC 2FHTA 3BZCA 2VUMB 1PDQA 2QGQA 1B50A 1V8CA 1SLJA 4DV3H 2LY7A 2HQLA 2N49A 3FVQA 5AJ3Q 1H9RA 1BQQT 4IALA 1CT1D 4PZ8A 1X9ZA 4NW2A 1JOKA 3BYTB 5CGKA 3GD7A 4CJ2C 1GO3E 5EQ0A 1AH9A 3MA2B 4K14A 4H13C 4DR6Q 2OTJA 3L3OC 1K73C 4X65Q 2MO1A 5F2DA 1Q1BA 1HJPA 4XT1B 1PRTB 1JB7A 2A68D 1K0RA 1JB3A 1X56A 2XNAC 3F2CA 4A3EB 2SOBA 4NZRM 2MUYA 1I94Q 3GDEA 4JYAH 2ZTCA 3BDCA 4IQZA 2ZTEA 4TQUS 2B3GA 3PIOA 3J80W 4PV1C 3TZUA 3CC7A 2KA7A 1MIUA 4BWGB 4POGA 4X65H 4LF7H 4JI7H 1AE2A 2RVLA 4CJ0B 1H9KA 1XYIA 2Z4HA 4CDDC 2KCNA 1GM5A 3ICEA 4DR7L 2OPUA 3AEVA 1WTQA 1UEBA 4KKSA 1ASYA 4DUZH 4LF8H 2DNEA 1EWCA 2EJGC 4DV2L 4HSPA 2AUKA 1N33H 1IYUA 2J4XA 1SYFA 1D5ZC 1Q12A 3VYRA 1PYWD 2HIXA 4DR4Q 4BS9A 1I4XA 4Z9CB 3J81i 1K0SA 4K6LA 3CW2C 1S5DD 1X3FA 2H1EA 1TS3A 2EPBA 2AQ2B 1DTJA 2B2TC 2KQ3A 5IYBH 1XMQL 2CTMA 1E1OA 4DV3L 1HNWQ 3GTQB 3GTOB 1BDOA 5C0XJ 1PTOD 2D62A 1IBKQ 4P71A 4XXEA 1B44D 4FF3A 1AEXA 1ET9A 4L5SA 2ZM6H 3RNUA 5FLXL 4FJSA 4OX9L 1DZ1A 2XTIA 3CQZB 4UP7A 3TREA 4A3BB 1PQXA 1AW7A 5KRUA 4DNRB 2UUCQ 3EVQA 4JI5Q 2YTVA 3HOZG 4BY1B 1B1ZA 4O2DA 2IX3A 3J81j 3K5LA 4BY7G 2D9IA 1XMQH 3UOEA 3Q6SA 3KF8A 4QMGA 1BBUA 3GTQH 4KHPQ 1DONA 3A8KE 1JE5A 1WVLA 3VYSA 1TS4A 1N34Q 3NUCA 4NXNH 2B2YA 4DXGA 2JA7H 1CHQD 5JJIA 2VB2X 4HJ7A 1STEA 1O80A 4IO9A 4DV2H 5D14A 4GNXA 3RLNA 4C3HH 1I4PA 1ZEQX 3EIVA 3U4VA 5M9OA 1P8LA 2R7ZG 1YEZA 1EZ6A 1Z47A 1ZXTA 2RCFA 3M7NA 1F0XA 2F4VH 1DOMA 3JAMi 4GS3A 4RGTA 1Y1VH 2QNDA 2MO0A 4K2LA 4LUVA 1CSQA 1I4HA 2Q2IA 2AKWB 2NVXB 3HOYH 1TWGB 1JJ2A 1CK1A 1NR2A 5IYCG 1I6HB 4X62H 4RG1A 3N52A 4G08A 1R9TH 4IUVA 2UUBL 3KF6A 4X3SA 3MVVA 1K8MA 1J6QA 1LO5D 4DR3H 4ZLTF 3IRBA 4QUCA 1MKHA 1SNQA 3UDFA 1C7YA 2JA7G 1Q81C 1ONLA 5BR8Q 3GV3A 4A3EH 1IHZA 4XDXA 3CCQA 5EJWA 1N32L 3K80C 4ALPA 4ZUIA 3S1MB 3UE1A 1BOSA 1L2FA 3J80c 1STYA 3DEOA 2MGSA 1Z9FA 2G9HD 2F4VQ 3I4OA 2B2UA 2K75A 2X6LA 4A3JH 3A54A 3J81W 1E2WA 3D6CA 1FD7D 4JI2Q 3SXHA 3BJUA 4A93G 1UE1A 1TU2B 3E9HA 1TWCB 3HRZC 4A3KB 1ASZA 2Q8IB 4JI0H 2AQ1B 1XWEA 2CTKA 5IT9W 2VUMH 3SVMA 4K0KQ 5DT9A 3KDGA 2KCMA 1S5FD 3T1HH 1RF2D 4AYBB 3S14H 4H7BA 1VMCA 5IWAH 2N55A 4JYAQ 2NVTB 4OWXB 1KRSA 2AQ3B 4BY1G 2IX1A 2R92H 1OXUA 2EQSA 5J22A 1Y69U 4KY6A 4HCEA 4OEMB 2PMZB 2LFNA 2IWHA 4B3TH 1KNEA 4YHHL 3GTLB 3I4NH 1KIXA 1SYEA 2L11A 4IUNA 1STAA 3UDIA 1LTLA 3M3YB 1WTJA 1E0BA 2RQXA 1QVCA 5FLXW 3I4NG 5BR8H 2EDGA 3SK6A 1D1IA 1K8OA 2JEAI 3HOVB 2E3UA 1G51A 2NB0A 1WI5A 1GUOA 4KLKA 3OETA 3MXNB 1EU4A 2Q8TA 2RKSA 4R4IA 5K5PA 2K05A 2R61A 3NTIA 2QF7A 1Z2IA 2VY3A 2AWOA 4G57A 2M9VA 3E5SA 4HJ5A 4JW0A 1ICFB 1TWFB 2B8FA 3NPPA 3NSWA 1V1PA 4LF4Q 5EAYA 4ILWA 1ODHA 3KOJA 1F2LA 2A6EC 5COYA 2KHIA 1BNZA 2Y0SG 5J1ZA 3I56A 3KK7A 2A1AA 4B3RH 5M5XB 5BN5A 2UXDH 3FKIB 1XX8A 2ZXOA 1PFSA 3HOXG 3I7FA 4JV5Q 3JAMc 2EY2A 1CUKA 4RGOS 1DOLA 1G6PA 3BDLA 1KAAA 4QF4A 3E9IA 2QKIC 4P72A 2AHOB 5E1FA 3S15H 1HNZL 5C3EH 3HOWB 2NZHA 3OW7A 4YY3H 3ND9A 4YHHH 1HXYD 3V05A 4RKBA 2UXDL 2L55A 3R8BA 1H9JA 2M8WA 3NQTA 5C6AA 2UUAH 3WOEA 1D8LA 4MZ9A 2F0IA 3E0JA 1IYVA 1O7IA 1CA6A 2NVXH 1EY6A 3HOUB 3W5OA 3Q23A 4HMIA 2JA9A 4DR1Q 1GD7A 1IBKH 1Y1VB 4JOIC 1M90C 4KHZA 1F2ZA 2PQAB 3I4NB 3BDOA 3KDKA 2CH4A 5C0XH 1GUSA 4F8MA 4DR5L 4FO2A 5GROA 1QJOA 4BBSH 4DKAC 4X6AH 4ME3A 3S14B 4NXML 1I3QH 3PUVA 4JI0L 1NXUA 1PTOB 2VW9A 4A93H 1E7ZA 2XVSA 1PV4A 2N8NA 5IE8A 1K3RA 1EQQA 4OX9Q 1KL9A 4R4CA 5TSSA 4U68A 5CV4A 4C3IH 5IOCA 3K7AB 2IY5B 2CWAA 2IL8A 4GNXC 3NTHA 4DR5H 1J5KA 3T56B 4BY7B 1HTPA 1MBYA 1EQVA 1CKNA 4IUPA 4UY8C 4C3IG 3J81c 5I2YA 1N9WA 4DV1L 4JI4Q 2B2YC 4GKJQ 1GUNA 2D0OA 3OW2A 2E2JH 1HZ9A 3I91A 4X3UA 4FJUA 3F2DA 4WFN3 2Y0SB 4AQYH 1LTAD 1JWUD 4CDFC 3J7ZC 3H09A 1S3OA 1HUNA 3QOJA 2ZM6Q 4JBWA 2I5HA 1A6XA 2EE1A 5M3FG 5LL6X 3EJIA 4OELB 1RHPA 1YJNA 2R3ZA 1ZZKA 2JSOA 1YZ6A 1UAPA 1P16A 2WB1B 1WTRA 1KNAA 4CJ1B 1A3TA 1VQLA 3PO3H 1WVNA 3H0GB 2LTLA 1YNJD 1HZAA 5C44G 3HKZB 4FF4A 1X65A 3CCVA 1TWHH 2Z0SA 1FJGH 2FMRA 4R1JA 3OMCA 4QL5A 4S3SA 4DR1H 1T5XD 1A62A 4J8QA 1FJGQ 3J80L 4CDCC 3PF4A 2UUBQ 2UUAL 3W2DA 3VYTA 1J5EL 2NBFA 1F77A 4ZKCB 1R9TB 1IZ6A 2JYOA 3F2BA 2AMCB 4OL7A 1UE5A 1EIGA 1WTVA 1AZQA 3PO3B 4L5RC 3HOYB 2E74C 5I6WA 1FGUA 2NN6I 1DCZA 4IPDA 2FJ2A 4RFBA 2A6HD 1IYJB 4LW1A 3A5ZB 1KLUD 4YCWA 4EQPA 4PMWA 1SRUA 2OWOA 3TS0A 4HTHA 4X64Q 4QIWB 1KHIA 2F0VA 1WTPA 3ITPA 2WKCA 1EEFD 1YITA 1YIJA 3C3LA 4OIKA 1CQFA 3DEPA 2CCZA 3DXJC 4MIUA 2WAQB 2Z8LA 3FPPA 4Y52H 1TUAA 1SFOH 1K83B 4FNFA 1ESRA 5C44B 1LT4D 3IKJA 4JI8L 4A3GB 1NBWA 4UPAA 4DAPA 4LFBH 2BH8A 2WB1G 4IJHA 1PYBA 1CM9A 3ERQA 3SB1A 1ENCA 4GKKH 3K5NA 4C2MB 4A3FG 1UG8A 4JI1L 3SK4A 1TVXA 1ZZJA 2F0EA 5I9OA 3V96A 3ND8A 3CCMA 1W6JA 1EYDA 4JYAL 5KNCA 5IGDA 4LFAQ 4B8CD 3J7YW 5JEAJ 3G71A 4IFDG 1OXTA 4GN3B 1HZBA 1HQRD 3R2TA 2PQAA 4CBVA 4V0BA 4KTAA 2CTFA 5FO8B 1WTOA 3ERSX 4C3IB 1YI2A 4GZYC 5M3MH 3R2IA 4TVAB 2N88A 4WJWA 3RLOA 2E2IH 2YU9B 1XTDA 4BBSG 3IL8A 1ZYRD 3T16A 1TR5A 4JBKA 3SR1A 4RHSA 3OSSD 2Z1CA 3KLRA 2JA6H 1JQYD 1QZHA 2E5LL 3CPFA 2CTLA 1SYBA 3J80E 2KENA 2I07B 1I5FA 3T51B 4NKLA 2EY1A 4U673 1V1QA 3NQIA 3N6RA 3BZDB 4J1MA 4JV5H 4QCLA 1BBWA 4XYOA 3H0GG 4LF5L 1V9PA 2VQFL 2EIFA 1PFMA 4C3JB 3GTKH 1ET6A 4OIJA 4BBRB 3F2UA 4GOPC 3EZJA 2HHHH 4B08A 1Q1EA 5M3FB 2MQHA 3HFZB 4WALA 4LF4L 2VQEQ 3TP8A 4O42A 3HKZE 5JPMC 3NE5B 1QUQB 3CPWA 4YY3Q 2RDFA 4UP8A 2KJXA 3D8GA 5K36H 4KV6A 4JBMA 2F4IA 3CHBD 3A5UA 4LFCH 5M3MG 2LMCB 2NUCA 4BXXG 3TP7A 1AE3A 3HKZG 3OYYA 3RN5A 4A93B 2K04A 1SYGA 1NY4A 3G4SA 1X32A 2VXWA 1CSPA 4F88A 4JV5L 4LF7L 3R3OA 1X54A 1D7QA 3D31A 3PQIA 4H0LC 4JI3Q 2UU9H 1WD0A 4DXFA 2RDGA 3FAUA 4GLVB 1HR0W 3K0XA 1K8GA 1VIHA 5DEHA 1LTRD 3M9BA 1HNZQ 3A7LA 5K36G 4DA2A 1AFPA 1XMOH 5C3XA 2PQUA 1H9SA 2DY7A 5T1GA 4DK6C 1PTOF 3FPUB 2PQEA 2BOSA 1EIHA 4B3SQ 1MSGA 1TT2A 3W3AA 4ID6A 1S72A 1MD2D 4N9PA 1IBLQ 3OWFA 4JBJA 4X62Q 1DT4A 1EYCA 2L15A 2WACA 3K7AH 4DR5Q 3KLSA 2WB1E 1D2BA 1S5ED 2Z6KC 4JI1H 3HOVG 3KDFB 1XPRA 4NXMQ 3H94A 1T5EA 1BBXC 2F1MA 2A74C 1W3SA 1FKAH 4HEDA 1HNXL 1A2TA 1LT5D 2UXCH 1WE8A 5DM73 1E2VA 4G7HC 3I73A 1ICWA 2O5IC 1MJEA 1KAWA 4EGVA 2K5WA 1TIID 1PMRA 2VQFH 3MFYA 2OCEA 4AYBG 5ELBA 3FP9A 2O4CA 2EXZA 5JJZA 1STBA 1PLFA 2BDOA 4LMQD 2JA8B 4DV1Q 1B3AA 4JI4L 4M1UB 4GKJL 3EBEA 4QY7A 2EY6A 1KDBA 4IPHA 4A3LG 1HRJA 1VQDA 1BCPB 2QDLA 3I70A 4R8IA 2ZM6L 1RODA 5A2QL 2TMPA 1BVSA 2A5HA 2EJFC 3PO2H 4R8NA 3CC4A 5GQOA 2UUBH 3MXNA 1TWAB 2JA8G 2CTJA 1B9MA 4C56C 1WCMG 4RKLA 4TSSA 1I4GA 2KEEA 3SK5A 3CXCA 1LACA 4MHEA 3H3VH 3NHHA 3W1GA 1CQVA 1MGSA 1Y1WB 3W1BA 1FJGL 1HQMC 2JZXA 3PIP3 3STBC 4KJNA 2IHEA 1NTGA 2B2WC 2B2TA 5IYCH 2NYZD 3ZYYX 1LLRD 3U9OA 2RDHA 3T1HL 2F3WA 2K32A 4FXGC 5ELCA 2F0QA 1EQTA 3M85A 1IBML 2FINB 1D5MC 1IL8A 2LXKA 2JA8H 1QB5D 2SNMA 3AFQA 1GUWA 5A2QW 1DOKA 4A3IG 1VQOA 3H3VI 2GN5A 5IGFA 2B29A 5CV6A 4CGYB 3B6YA 1QUQA 1NMFA 1SJED 1E3PA 5KIXA 1VQBA 2MHVA 4KKTA 4YCUA 1XNRQ 2LRRA 2XRSD 5C0XI 5FLXE 2BCOA 2VB3X 1BCPF 3I72A 5J39A 1PRTC 3MAQA 1FVIA 4LF6Q 4IOCA 2F0PA 3S2HB 4MN3A 5ISRA 4GLAC 3ONAB 3GTKB 2ES2A 3A0JA 1SNCA 1EYAA 1WCMB 2L12A 4DNTB 4GKKQ 1E22A 3AB9A 1N36L 5BN4A 2N78A 4JI8Q 2VZAA 2C35B 1YVCA 1QWYA 5IYBG 3T1YL 3BS1A 1IL2A 1GKHA 1MSZA 1YHAA 4LNQA 5LMNQ 4A3GH 5DM63 1SROA 4GN4B 4HJAA 2R7ZB 4DGZA 4HR7B 1PH6A 3GQBA 1B4OA 4NDXA 1UNSA 4A3DB 2JA6B 3MTSA 1GUTA 4BXXH 5E3FA 1ENFA 5ELFA 4LFAL 4A3BG 2AXYA 3VYUA 1UUPA 2MFIA 3GTLH 2E2IB 1HUMA 2OF1A 4DR2L 3G6JB 3UDGA 3NTKA 2VNUD 3J7AK 1SE8A 1U4RA 5C4XB 2ZJRA 2ASBA 3J7A5 4JG2A 5HURA 5JOBA 3DHQA 1Y8NB 3TMEA 3AEVB 1K8AC 1BF4A 3BG3A 5GAHC 4B3MH 4FDBA 5JPNC 1A0IA 1Y14B 3QOLA 4JI2H 3G48A 3X3NA 2VQEH 4K5VA 1KDCA 4IUTA 4X66Q 4DFAA 1X3QA 3CD6A 1OXXK 2K52A 1ZYRC 3DWPA 4PNYA 4DV6L 4O0AA 5CC4A 3D4DA 2Q2HA 4LF5Q 1EUJA 1SNOA 4ZKBB 4KY7A 2VQFQ 4JI6Q 3S1NH 5M3FH 1HTLD 2KOLA 2NWGA 4ZK9B 1CKNB 4F7XA 4G4KA 5AJ3L 1PTOC 4UDUC 4NP5A 4C3JH 1LTBD 3AQQA 4DF7A 4JI8H 1VF5C 1A3UA 1SMYC 2LS01 2Y0SE 4NPSA 2JE6I 1QVFA 4L6TB 1F9PA 4DR6L 1EY9A 1A2UA 4R4TA 5IGEA 3TQYA 2CPQA 5ELOA 3RR5A 3RD4A 3NBHA 5KNBA 4JI4H 3PF5A 4FF1A 5EKLA 2KHJA 5C5MA 4A3BH 2CHBD 3HKSA 2F0GA 2QCPX 1EL0A 2F0MA 4RGMA 3NXWA 4WRDA 1KQSA 2L4NA 3HZXA 2AWNA 1M8AA 3FKIG 3U1KA 3KLSX 1I94L 1JCKB 5D65A 5FLMG 1UEAB 2CPMA 4H44C 2LKVA 2YU9H 5M3MB 4LF8L 2I46A 3HOZH 2D0PA 5IY0A 2PCFB 4DR7Q 2K5VA 4RH6A 4AM3A 3VR5A
chains in the Genus database with same CATH topology
1XNQQ 4KJOA 5HGQA 3LWEA 3H3VC 3CKIB 4DAMA 4DV2Q 1V43A 4FF2A 3VDYA 4XQJA 4B3SL 2D9UA 2KBNA 1STNA 4A3DH 2K5NA 4X62L 1XJVA 1I6VC 3KBGA 3RUZA 1G6ZA 1PH2A 5IT9L 2KCTA 3K58A 2D5DA 4A3CH 3QB3A 4IJLA 1XMQQ 2EY5A 2Z6KA 4DV3Q 1HNWL 3D6WA 4DV0Q 5EBCA 1SFOB 4A75A 3CAMA 3RZOB 3J81E 4IFDJ 2JA7B 2JP1A 4LJZC 4GNXB 1RDPD 4B3TL 4KMUC 4LUZA 1U4LA 5H1SE 3CRKC 2OT2A 3FKIH 3MEHA 1TY0A 4RWSC 4A3MG 2PZWA 1G2SA 4RA8A 3AMUA 5IGCA 2PZTA 3A7AB 2CTEA 2YV5A 3PO3G 4BA1I 5IWAL 1S5BD 2RHQB 2F0KA 4HCSA 1JOQA 1EOTA 5AFWA 1SNMA 3S2DB 4B3RQ 2K5QA 4ABNA 1YHBA 1PFNA 1O7ZA 3H0GH 1TS2A 3TP6A 3CCRA 3BU2A 2ENBA 2CWPA 4X3KA 1CZWA 4BA2I 1L0WA 2WFWA 3EROA 2L5TA 2X69A 4DV5L 5IP9G 5C3WA 4BBSB 3HGBA 2X6GA 1C8CA 5JAVA 4HN7A 1VQ8A 2ID0A 1I3QB 4A3CG 4WJ3M 1M1KC 2PO4A 4MTNA 3RN2A 1MI2A 2PI2A 1IKMA 2WAQG 1VQJA 2OPVA 1Q86C 1Y1WH 1RTOA 3DLLA 4A3JG 4DV4Q 4L63B 2WV6D 2HDLA 1TY2A 3BYYB 5IYDH 3S15B 2FXQA 3HOUH 4BY7H 4YWMA 5KYLA 1VS0A 1JWSD 3PO2B 5IP9H 2HCCA 5E4XA 1GXDC 4TKOB 5C5LA 1QNKA 1TWAH 1HH2P 1PZJD 1Q7YC 3GTGH 2E2JB 2R92B 1IBMQ 4P2CB 4KKUA 3MXUA 4XQQA 1E24A 3M3YH 5C3EB 1FYCA 1STGA 5IP7H 1HR0L 2A73B 3CRLC 1CHPD 3F8TA 1DM0B 4JOIA 3S16B 2RA4A 1N32Q 1I50H 4BBRG 3K6OA 2A69C 1RKNA 1ESFA 4JVYA 3H6MA 1DXMA 1XNRL 1FL0A 4OWWB 3WWVA 4OONA 1U4MA 5T1IA 1Q82C 4ZRZA 4C3HG 3Q8DA 4GKKL 3K0YA 3D3RA 2KHSA 2O4XA 4KK7A 5FJ8H 3J80i 1NJIC 1M4VA 1B9NA 2I5LX 2A6ED 5CV8A 3J81L 1PRTD 4B9WA 1K9MC 1RIPA 4H02A 2B2VA 4RGNA 2C5CA 3SGIA 5BN3A 4RMFA 2NVQH 1QNUA 4J15A 4IFDI 1JC7A 1XXGA 5FKAC 2MJHA 1H95A 3TSSA 2F0DA 5EPKA 1NR4A 1VQIA 4R4QA 1LTGD 2G9DA 1GHKA 2XSCA 1N33Q 5DLQE 4YHHQ 1EEID 3FEWX 4OWTB 4DR3Q 1X9NA 5ELDA 5CV7A 4JI7L 2JA6G 5CORA 1RD9D 5CYUA 4IUUA 1U9RA 2ICIA 3DWQA 1LM0A 2R7FA 1JMCA 3LNNA 3NBIA 4KN7C 3UI2A 2ZTDA 2YQRA 3I4MB 3DM3A 3KUPA 1ENAA 4C3HB 3OTOQ 2NTTA 3P7JA 1YJ9A 3C1FA 4A3IB 4LK1C 1TKWB 4HJ9A 1SE3A 2KEDA 5CMDA 2WP8J 2R6GA 4N9TA 3JAML 3GTGB 4V190 4A3KH 3X3MA 4KD4A 4GOPA 3V69A 1PH4A 2MJ8A 3KYHC 3C1EA 2F3IA 3OHXC 4LFBL 1IXRA 2F0UA 2A8VA 4IZ8A 2DGYA 3OPOA 4YWKA 5I4DA 4PQXA 3ULPA 1VQCA 1Y8PB 3CMAA 4FXDA 1U5KA 4GOPB 1QCBD 1O78A 1PH5A 4WORA 1ML0D 3HOXB 3A74A 2IX0A 2K03A 1ZZIA 1Q8IA 2RF4A 1ILPA 5JJLA 4A3DG 3VKEA 2XGTA 1YNND 4DR4L 1LT3D 2HHHL 1HFNA 1X55A 1XNQL 2TSSA 1WFQA 3K81C 2NZOA 4QQBX 5IGGA 2K1BA 3IAYA 4ZYSA 4A3GG 1XTCD 3A8IE 4X3TA 3PIO3 1B8AA 2F52A 4HJ8A 4DR1L 2E2HH 2JEBI 1C9OA 1E2ZA 4OO1I 3VR3A 5EPLA 2PNHA 4DV0L 4L5QA 2OTLA 1LV9A 1KLGD 3KJOA 4APVA 4JI0Q 2EXDA 3ZJYC 4BBRH 1FNVA 1KD1C 2BH2A 3MZ5A 2IJ0A 2FMCA 4BY1H 2EYLA 3T13A 5HGTA 3M4QA 4NB3A 4KHPL 4AYBE 2ZJQA 1N34L 2F0JA 3G7LA 1A8VA 4OGQC 1EIFA 3NEMA 4NXNL 3MHBA 2EYHA 1VQNA 2F03A 2HH3A 3IFDA 4DK0A 4DNIA 1I6HH 3HEJA 5A2QE 1QILA 2CKZB 1Y1WG 4CKBA 5I9PA 4PZ7A 4DK3C 3L2PA 3VA7A 4NMZA 1V1PB 1CTMA 3U50C 2IT1A 5JVG3 4ZUJA 2B8GA 3S9WA 1B7YB 2Z4IA 3SHLA 2RHSB 4DV5Q 3S1RH 1GUGA 4EX5A 3L7ZC 3LWUA 2F3VA 2F0FA 1SMXA 1I4QA 3TP5A 3RZDB 3PSIA 2I0QA 4EQ5A 5C4HA 2KVMA 5KEEA 3I2ZA 2QDBA 2F0OA 2JA5H 3I4MG 3KFUA 4KD3A 3DUZA 5M5WH 5C3EG 4DV4L 5IYDG 4RCNA 1RL2A 5C4XG 5J3BA 4QGUA 1BXTA 4C2MH 3CU7A 1AP0A 1W2BA 3QO2A 4IN3A 1N8RC 5JJKA 2V4DA 2UUAQ 2A6HC 1J5EQ 1ILQA 1O7YA 1HPCA 4UAIA 4I7ZC 2EYOA 4WJ4A 1EC6A 1KDAA 4FP5D 4XIGS 1R4PB 4QB4A 2VL6A 1AN8A 3A8JE 1HR0Q 4M8AA 3TN2A 1DGSA 1SN8A 3A55A 2YYZA 3A56A 1GJXA 1F9QA 3GTJH 3CF5A 4Y7NB 4DV7L 2K6AA 3P1HA 2GVBA 1VQ7A 2R7ZH 3U9SA 2PYKA 3QIAA 1S4ZA 3T53B 1YHQA 1SBBB 3K8AA 5C0XG 3LX0A 5KNDA 2B63G 2DN8A 4K0KL 2JVZA 1VQKA 5ELEA 2PW5A 2E76C 2KECA 4B8TA 2L9HA 4DUZQ 2PI2E 3GTOH 1Q90A 1PTOH 1BO0A 1X3EA 1JR0D 1PH1A 5FO9B 1L0XB 2JK8A 2K5DA 1AZPA 2L1BA 4XQNA 1LUZA 2R7DA 3TDQA 4A3EG 4JI1Q 1F2MA 2R93B 4AQYQ 2D2CC 3PO2G 3L9AX 3NP8A 3PUYA 4R4OA 1PZID 1NE3A 2QEJC 2XIWA 1CFMA 5E7NA 1X3GA 1VQEA 1Z7TA 1ZTGA 2DY8A 1G8ZD 1STHA 1SSOA 2UXBL 3HOVH 1LT6D 5KGUA 2WAQE 1SNPA 3JC66 1VQ9A 1F2YA 2SNSA 1WCMH 2YTXA 1JT8A 1A63A 1CKOA 4RHRA 4HIKA 1O7LA 3NWTA 1VQGA 1EIYB 4Q0FA 1WD1A 4IOAA 1WOCA 4C1NK 3VA5A 2M2LA 3ULJA 2BA1A 3NBHB 1FNUA 1TS5A 2K7VA 1Z6HA 2NVQB 1B2TA 1NUCA 2KCCA 1BKBA 3K5OA 2HT1A 3OTOL 3M4PA 3OIPA 4EQNA 1EY0A 1IKLA 1L1OA 4K8JA 1VQ4A 4AH6A 3F1ZA 2NVYB 3FMCA 3RLFA 4HMJA 5C4ZA 2O5JC 2E2HB 2JJQA 2RSOA 3PUZA 1PZKD 2LSSA 1LTTD 1Y1VG 2HDMA 3K7UC 3S17B 2IW3A 1E1TA 1HZCA 1G2TA 4LFBQ 1VIGA 3OOCA 4ODGA 3ER0A 5IT9E 1ZKOA 1OXVA 2NN6G 5M5YH 4J6HA 4A3MB 4FYDA 4IUQA 3KBXA 3K5MA 1QZGA 2B2WA 4JI3L 1SXTA 2UXDQ 4HIMA 3GTMH 3PCOB 3AFPA 2FFKB 4DUYQ 4C1NI 1EY5A 2PY9A 2EOTA 1SEBD 1A3VA 4OO1G 1BCPC 1SDFA 4PMCA 4ZAIA 2HHHQ 4F87A 3C46A 4HIDA 2M00A 3GO5A 2PMZE 5JVH3 1S5CD 5IODA 4A3FH 1U4PA 1HCZA 3O13A 2BDNA 3Q24A 1VF7A 4EQOA 1OTCA 3DWAA 4IPCA 1IBLL 2RBMA 4DU9A 3MWYW 1EY7A 5IT9c 2B2UC 1KRTA 3D4WA 3M4OH 4WANA 1Q46A 3MFGA 1UWVA 3FHWA 4A3IH 1HA6A 4HIOA 1SYCA 1VQMA 2WKDA 3E0EA 4LAAA 3TEHB 1KHMA 1JORA 1J9OA 2NTSA 2ALYB 1BR9A 5M5XH 2PW7A 4IPGA 5LMUL 1HNXQ 1EQRA 2HCIA 4IFDH 5DAUA 3RMHA 1WTWA 4DK1A 2EZVA 3CCJA 4PZ6A 1PH9A 1JJGA 3GTPB 5EKIA 2C9OA 3AU7A 4NXNQ 1K83H 1JICA 5G3LF 3SE0A 2XWBB 1FGBD 3TZDA 2IPKD 4K2KA 1GOZA 5EKKA 1SJHD 1L0YB 5EPJA 1QG7A 4L5TA 2FMMA 2XN9C 3I3CA 3S1QB 4LFCL 3CC2A 2JXMB 1QOHA 4K5XA 3I90A 3MXPA 3HOYG 4OHJA 1RCVD 1EY8A 2EYFA 4P75A 1R4QB 1S40A 3STBD 2F0SA 5GADC 1MSHA 2PPBC 1KABA 1PYSB 3HOUG 3WDNA 4L8JA 3L0OA 3TRZA 4UP9A 5CR3A 4RAUC 5E4WC 4YIJA 3MEFA 1UE7A 3NELA 2R93H 1C0AA 1TWGH 5JEAG 5I6YA 1EFWA 3KF6B 2DUDA 1TWCH 1MJCA 5M5YB 2NVTH 1TWHB 3T1HQ 2F0LA 3S2DH 4FXKC 1PRTF 1G91A 3HOZB 4PMBA 4P74A 4KHVA 1PFBA 1DJRD 3BZKA 4X64L 1IW7D 1D1KA 3E6ZX 1KXLA 3GTJB 4EVOA 5C44H 2NVYH 4A3KG 2B2VC 1RJTA 1X4NA 4B9XA 1U0LA 3QG1A 4DV7Q 1TQOA 4DAYA 2Q2TA 2GA4B 2UXCQ 4OXPA 4A4IA 1WTXA 3S1RB 4HSVA 5G3LD 4LF6L 1GVPA 3P75A 5CV5A 4I65A 1VDZA 5CBAE 1SYDA 3NK9A 3V2TA 2B63B 4DUZL 3UE0A 4K5WA 4JK1C 3TS2A 3JAME 3CCSA 1YNJC 2VS1A 2EYJA 4LF9L 1TXYA 3J7AF 3SK8A 1F9SA 3T1YQ 5LMNL 2B39A 1RTNA 2N3SA 3HS0C 3RZOH 4AQYL 1VMPA 5FOBB 1SR3A 5NUCA 1EZ8A 3C2PA 5FO7B 4B3MQ 2SDFA 2EYPA 3CP0A 2EVBA 1XMOQ 2H5XA 1EWHA 3BVMA 4RCOA 2K01A 3M7GA 1PXUA 4DR2Q 4AIMA 2E5LQ 1IW7C 5GAEC 3RZDH 2DNCA 1H9MA 4ZQ3A 1JWMD 1D6EC 2UXBQ 3OSOA 2UU9Q 2PZUA 5EBDA 1HFGA 1Q8KA 2ATWA 3PUXA 4POFA 3MC0B 5ELNA 4Y7NH 1VQ6A 2HUGA 3K57A 1WJJA 3PGZA 5KYIA 3S1QH 5LMNW 2XRQD 3HOWH 2WIIB 4JC0A 2K4KA 4KI0A 4DAYB 3CCLA 5A35A 5I2XA 2VQEL 1PH7A 2A68C 3IFTA 1SMYD 1VCIA 2F0NA 4YCVA 1L1OB 4YY3L 4JI6L 3DM1A 3I4LA 4OO1H 3CMEA 3P20A 2P2RA 2HQEA 1C4QA 2F0WA 3H15A 4X65L 2J0TD 3KF8B 2WINB 2QEXA 2L0CA 2OQKA 2OXPA 3T4AC 1VQHA 4LF7Q 3UDXA 4ULLA 1VQAA 1SAPA 2JA5B 2ZT9C 1PVOA 1DD2A 1QVGA 1NMGA 1BUVT 1TWFH 2MNAA 3KJPA 2ICEC 1Y8OB 3PUWA 5IIFA 3CCUA 2K28A 3I4MH 1LYLA 4QMFB 3VR6A 1PH8A 3LGJA 5FK9C 3NWSA 1PH3A 5M5WB 1K1GA 4A76A 4DUYL 2B63H 2R92G 1II3A 4JCVE 4KY5A 4LF8Q 1HHVA 1DYQA 1C48A 3M4OB 2ZXPA 5DNFA 4DAVA 1B53A 4A3LH 1F9RA 4GN5A 1QE6A 3TBIB 1VQ5A 4IURA 1T9HA 2EJMA 5GAGC 5HY6A 1UE6A 3G6EA 1EU3A 5C4XH 4K8IA 3URYA 1LABA 3GTMB 1EYGA 1IBKL 4A3FB 2K5HA 2DGRA 1BCPD 3PV0A 3QWNA 1XPOA 5LHY1 4XT3B 3S24A 5IGBA 3CCEA 3GTPH 3HOXH 3S1NB 3HG9A 3D4RA 2SEBD 2UUCL 4JI5L 5CV9A 2GVAA 4P73A 1SNDA 2OEOA 4KN4C 1EWIA 2Q8RE 5D3IB 1X3PA 3D0FA 4B3TQ 2AUJD 3M4YA 5LMUQ 3BVGA 2MP1A 2F0TA 2J7ZA 3FRPB 3S2HH 5CBEE 1EY4A 1JE4A 3VR2A 1EFID 3HP3A 4C3JG 2R93G 3KDFA 4CKCA 1XPUA 5IWAQ 1LTID 3GP7A 3ULLA 4G7OC 3PIPA 4TRDA 4E6IA 2ZXRA 3S17H 2ANNA 2HIVA 1I4RA 5C4JB 5FLMH 1V1OA 4FVMA 2QA4A 4B3RL 5IP7G 1EOVA 4LFCQ 3EQLC 3Q22A 3SDZA 2RCNA 1NCVA 3S1MH 4DPGA 4PG3A 4DN4M 5FJ8G 2E8GA 1H9SB 2K14A 5EGTA 1JJCB 2BA0A 4NBQA 4GLXA 1CKMA 2CVRA 2BL5A 1FR3A 3AYHB 4MNOA 2E75C 2E2DC 2IHFA 4JVHA 1KC8C 4YWLA 1WYDA 3HOWG 2O2LD 1B70B 2JA5G 1A15A 3I8ZA 1KTKA 5JEAH 3K59A 4G7ZC 1PHJA 4K6DA 1LTSD 1J8IA 2NZ1D 5BR8L 4QJFA 3QJYA 2A69D 3GV6A 3EFXD 2Q2UA 2QILA 4XYQA 3J7AV 2F4VL 4A3MH 4Q5VA 2YTYA 3Q0AA 1D5XC 2VUMG 1JOOA 3OMGA 2BE5D 1CI3M 2CW0D 1N36Q 4JI2L 2HH2A 4CKEA 4A3JB 2MPMA 2UXCL 1I50B 3EA6A 1SE4A 4HAEA 2A19A 1HA5A 1J4WA 2ANRA 3I55A 2CFMA 4CHTB 1SE2A 2JQOA 2OQ0A 4LUOA 3S16H 1X4MA 2H4OA 3OWEB 4LF9Q 2PNRC 2LXJA 1YNXA 3U4ZA 1W6KA 3CQZH 3NENA 3KLWA 5D3DA 1YBYA 1CA5A 2K50A 4LWCA 3WOFA 1VQFA 1NAPA 5LL6S 4QIWE 2KUMA 4B3ML 4XTCS 1OO9B 1XMOL 1G291 1CZGA 3VR4A 2CQAA 5FLXc 2I5MX 3OIQA 2V1CC 2CQOA 5C4JH 2NN6H 1PA6A 1V8QA 3BVZA 3SEBA 1Q3LA 2K33A 1L1OC 4QUFA 1VQPA 2UU9L 2BE5C 3FDTA 2CW0C 4X66L 3H91A 1YNNC 1N33L 4R9WA 4LIJA 2F0HA 1X6OA 2EYMA 2ZJPA 2XWJB 3MXGA 4DR3L 3DMUA 4DV6Q 4JI7Q 3R93A 3PMFA 1NSNS 4O1NA 3EN2A 1YJWA 2RSNA 4ME5A 3U58A 1GHJA 1FNWA 1OXSC 2FHTA 3BZCA 2VUMB 1PDQA 2QGQA 1B50A 1SLJA 2LY7A 2HQLA 2N49A 3FVQA 5AJ3Q 1H9RA 1BQQT 4IALA 1CT1D 4PZ8A 4NW2A 1JOKA 3BYTB 5CGKA 3GD7A 4CJ2C 1GO3E 5EQ0A 1AH9A 3MA2B 4K14A 4H13C 4DR6Q 2OTJA 3L3OC 1K73C 4X65Q 5F2DA 2MO1A 1Q1BA 1HJPA 4XT1B 1PRTB 1JB7A 2A68D 1K0RA 1JB3A 1X56A 2XNAC 3F2CA 4A3EB 2SOBA 2MUYA 1I94Q 3GDEA 2ZTCA 3BDCA 4IQZA 2ZTEA 4TQUS 2B3GA 3PIOA 4PV1C 3TZUA 3CC7A 2KA7A 1MIUA 4BWGB 4POGA 1AE2A 2RVLA 4CJ0B 1H9KA 1XYIA 2Z4HA 3ICEA 2KCNA 1GM5A 4DR7L 2OPUA 3AEVA 1WTQA 1UEBA 4KKSA 1ASYA 2DNEA 1EWCA 2EJGC 4DV2L 4HSPA 2AUKA 1IYUA 2J4XA 1SYFA 1D5ZC 1Q12A 3VYRA 1PYWD 2HIXA 4DR4Q 4BS9A 1I4XA 4Z9CB 3J81i 4K6LA 3CW2C 1S5DD 1X3FA 2H1EA 1TS3A 2EPBA 2AQ2B 1DTJA 2B2TC 2KQ3A 5IYBH 1XMQL 2CTMA 1E1OA 4DV3L 1HNWQ 3GTQB 3GTOB 1BDOA 5C0XJ 1PTOD 2D62A 1IBKQ 4P71A 4XXEA 1B44D 4FF3A 1AEXA 1ET9A 4L5SA 3RNUA 5FLXL 1DZ1A 4OX9L 2XTIA 3CQZB 4UP7A 3TREA 4A3BB 1AW7A 5KRUA 4DNRB 2UUCQ 3EVQA 4JI5Q 2YTVA 3HOZG 4BY1B 1B1ZA 4O2DA 2IX3A 3K5LA 3J81j 4BY7G 3Q6SA 3KF8A 4QMGA 1BBUA 3GTQH 4KHPQ 1DONA 3A8KE 1JE5A 1WVLA 3VYSA 1TS4A 1N34Q 3NUCA 2B2YA 4DXGA 2JA7H 1CHQD 5JJIA 2VB2X 4HJ7A 1STEA 1O80A 4IO9A 5D14A 4GNXA 3RLNA 4C3HH 1I4PA 1ZEQX 5M9OA 3EIVA 3U4VA 1P8LA 2R7ZG 1ZXTA 1EZ6A 1Z47A 3M7NA 1YEZA 1DOMA 3JAMi 4RGTA 4GS3A 1Y1VH 2QNDA 2MO0A 4K2LA 4LUVA 1CSQA 1I4HA 2Q2IA 2AKWB 2NVXB 3HOYH 1TWGB 1JJ2A 1CK1A 1NR2A 1I6HB 5IYCG 4RG1A 3N52A 1R9TH 4IUVA 2UUBL 3KF6A 4X3SA 3MVVA 1K8MA 1J6QA 1LO5D 4ZLTF 3IRBA 4QUCA 1MKHA 1SNQA 3UDFA 1C7YA 2JA7G 1Q81C 1ONLA 5BR8Q 3GV3A 4A3EH 1IHZA 4XDXA 3CCQA 5EJWA 1N32L 3K80C 4ALPA 4ZUIA 3S1MB 3UE1A 1BOSA 1L2FA 3J80c 1STYA 3DEOA 2MGSA 2G9HD 1Z9FA 2F4VQ 3I4OA 2B2UA 2X6LA 2K75A 4A3JH 3A54A 1E2WA 3D6CA 1FD7D 4JI2Q 3SXHA 3BJUA 4A93G 1UE1A 1TU2B 3HRZC 1TWCB 4A3KB 3E9HA 1ASZA 2Q8IB 2AQ1B 1XWEA 2CTKA 2VUMH 3SVMA 4K0KQ 2KCMA 1S5FD 1RF2D 4AYBB 3S14H 4H7BA 1VMCA 2N55A 4JYAQ 2NVTB 4OWXB 1KRSA 2AQ3B 2IX1A 4BY1G 2R92H 1OXUA 5J22A 1Y69U 2EQSA 4KY6A 4HCEA 2PMZB 2LFNA 2IWHA 1KNEA 3GTLB 4YHHL 3I4NH 1KIXA 1SYEA 2L11A 4IUNA 1STAA 3M3YB 1LTLA 3UDIA 1E0BA 2RQXA 1QVCA 3I4NG 2EDGA 3SK6A 1D1IA 1K8OA 2JEAI 3HOVB 2E3UA 1G51A 2NB0A 1WI5A 1GUOA 4KLKA 3MXNB 1EU4A 5K5PA 2RKSA 2Q8TA 4R4IA 2K05A 2R61A 3NTIA 2QF7A 2VY3A 2AWOA 4G57A 2M9VA 3E5SA 4HJ5A 1TWFB 2B8FA 3NPPA 3NSWA 1V1PA 4LF4Q 5EAYA 4ILWA 3KOJA 1F2LA 2A6EC 5COYA 2KHIA 1BNZA 2Y0SG 5J1ZA 3I56A 3KK7A 2A1AA 5M5XB 5BN5A 3FKIB 1XX8A 2ZXOA 1PFSA 3HOXG 3I7FA 4JV5Q 3JAMc 2EY2A 1CUKA 4RGOS 1DOLA 1G6PA 3BDLA 1KAAA 4QF4A 3E9IA 2QKIC 4P72A 2AHOB 5E1FA 3S15H 1HNZL 5C3EH 3HOWB 2NZHA 3OW7A 3ND9A 1HXYD 3V05A 4RKBA 2UXDL 2L55A 3R8BA 1H9JA 3NQTA 5C6AA 3WOEA 1D8LA 4MZ9A 2F0IA 3E0JA 1IYVA 1CA6A 1O7IA 2NVXH 1EY6A 3HOUB 3Q23A 3W5OA 4HMIA 2JA9A 4DR1Q 1GD7A 1Y1VB 4JOIC 1M90C 4KHZA 1F2ZA 2PQAB 3I4NB 3BDOA 5C0XH 1GUSA 4F8MA 4DR5L 4FO2A 5GROA 1QJOA 4BBSH 4DKAC 4X6AH 4ME3A 3S14B 4NXML 1I3QH 3PUVA 4JI0L 1PTOB 2VW9A 4A93H 1E7ZA 2XVSA 1PV4A 2N8NA 5IE8A 1K3RA 1EQQA 4OX9Q 1KL9A 5TSSA 4R4CA 4U68A 5CV4A 4C3IH 5IOCA 3K7AB 2IY5B 2CWAA 2IL8A 4GNXC 3NTHA 1J5KA 3T56B 4BY7B 1HTPA 1MBYA 1EQVA 1CKNA 4IUPA 4UY8C 4C3IG 3J81c 5I2YA 1N9WA 4DV1L 4JI4Q 2B2YC 4GKJQ 1GUNA 2D0OA 3OW2A 2E2JH 3I91A 4X3UA 1HZ9A 3F2DA 4WFN3 2Y0SB 1LTAD 1JWUD 3J7ZC 3H09A 1S3OA 1HUNA 3QOJA 2ZM6Q 4JBWA 2I5HA 1A6XA 2EE1A 5M3FG 5LL6X 3EJIA 1RHPA 1YJNA 2R3ZA 1ZZKA 2JSOA 1YZ6A 1UAPA 1P16A 2WB1B 1WTRA 1KNAA 4CJ1B 1A3TA 1VQLA 3PO3H 1WVNA 3H0GB 1YNJD 1HZAA 5C44G 3HKZB 4FF4A 1X65A 3CCVA 1TWHH 2Z0SA 2FMRA 4R1JA 3OMCA 4QL5A 4S3SA 1T5XD 1A62A 4J8QA 1FJGQ 3J80L 3PF4A 2UUBQ 2UUAL 3W2DA 3VYTA 1J5EL 2NBFA 1F77A 4ZKCB 1R9TB 1IZ6A 2JYOA 3F2BA 2AMCB 4OL7A 1UE5A 1EIGA 1WTVA 1AZQA 3PO3B 3HOYB 4L5RC 2E74C 5I6WA 2NN6I 1FGUA 1DCZA 4IPDA 2FJ2A 4RFBA 2A6HD 1IYJB 4LW1A 3A5ZB 1KLUD 4YCWA 4EQPA 4PMWA 1SRUA 2OWOA 3TS0A 4HTHA 4X64Q 4QIWB 1KHIA 2F0VA 1WTPA 3ITPA 2WKCA 1EEFD 1YITA 1YIJA 3C3LA 4OIKA 1CQFA 3DEPA 2CCZA 3DXJC 4MIUA 2WAQB 2Z8LA 3FPPA 4Y52H 1TUAA 1SFOH 1K83B 4FNFA 1ESRA 5C44B 1LT4D 3IKJA 4JI8L 4A3GB 4DAPA 1NBWA 4UPAA 2BH8A 2WB1G 4IJHA 1PYBA 1CM9A 3ERQA 1ENCA 3K5NA 4C2MB 4A3FG 4JI1L 3SK4A 1TVXA 1ZZJA 2F0EA 5I9OA 3V96A 3ND8A 3CCMA 1W6JA 1EYDA 4JYAL 5KNCA 5IGDA 4LFAQ 3J7YW 5JEAJ 4IFDG 3G71A 1OXTA 4GN3B 1HZBA 1HQRD 3R2TA 2PQAA 4CBVA 4V0BA 4KTAA 2CTFA 5FO8B 1WTOA 3ERSX 4C3IB 1YI2A 4GZYC 5M3MH 3R2IA 4WJWA 2N88A 2YU9B 4TVAB 3RLOA 2E2IH 1XTDA 4BBSG 3IL8A 1ZYRD 3T16A 1TR5A 4JBKA 3SR1A 4RHSA 2Z1CA 3KLRA 2JA6H 1JQYD 1QZHA 2E5LL 3CPFA 2CTLA 1SYBA 3J80E 2KENA 2I07B 1I5FA 3T51B 4NKLA 2EY1A 4U673 1V1QA 3NQIA 3N6RA 3BZDB 4J1MA 4QCLA 1BBWA 4XYOA 3H0GG 4LF5L 1V9PA 2VQFL 2EIFA 1PFMA 4C3JB 3GTKH 1ET6A 4OIJA 4BBRB 3F2UA 4GOPC 4B08A 1Q1EA 5M3FB 2MQHA 3HFZB 4WALA 4LF4L 2VQEQ 3TP8A 4O42A 5JPMC 3HKZE 3NE5B 1QUQB 3CPWA 4YY3Q 2RDFA 4UP8A 2KJXA 3D8GA 5K36H 4KV6A 4JBMA 2F4IA 3CHBD 3A5UA 5M3MG 2LMCB 2NUCA 4BXXG 3TP7A 1AE3A 3HKZG 3OYYA 3RN5A 4A93B 2K04A 1SYGA 1NY4A 3G4SA 1X32A 2VXWA 1CSPA 4F88A 4JV5L 4LF7L 3R3OA 1X54A 1D7QA 3D31A 4H0LC 4JI3Q 1WD0A 4DXFA 2RDGA 4GLVB 1HR0W 3K0XA 1K8GA 1VIHA 5DEHA 1LTRD 3M9BA 1HNZQ 3A7LA 5K36G 4DA2A 1AFPA 5C3XA 2PQUA 1H9SA 2DY7A 5T1GA 4DK6C 1PTOF 3FPUB 2PQEA 2BOSA 1EIHA 4B3SQ 1MSGA 1TT2A 3W3AA 4ID6A 1S72A 1MD2D 4N9PA 1IBLQ 3OWFA 4JBJA 4X62Q 1DT4A 1EYCA 2L15A 2WACA 3K7AH 4DR5Q 3KLSA 2WB1E 1D2BA 1S5ED 2Z6KC 3HOVG 3KDFB 1XPRA 4NXMQ 3H94A 1T5EA 1BBXC 2F1MA 2A74C 1W3SA 4HEDA 1HNXL 1A2TA 1LT5D 1WE8A 5DM73 1E2VA 4G7HC 3I73A 1ICWA 2O5IC 1MJEA 4EGVA 1KAWA 2K5WA 1TIID 1PMRA 3MFYA 2OCEA 4AYBG 5ELBA 3FP9A 2EXZA 5JJZA 1STBA 1PLFA 2BDOA 4LMQD 2JA8B 4DV1Q 1B3AA 4JI4L 4M1UB 4GKJL 3EBEA 4QY7A 2EY6A 1KDBA 4IPHA 4A3LG 1HRJA 1VQDA 1BCPB 3I70A 4R8IA 2ZM6L 1RODA 5A2QL 2TMPA 1BVSA 2A5HA 2EJFC 3PO2H 4R8NA 3CC4A 5GQOA 3MXNA 1TWAB 2JA8G 2CTJA 1B9MA 4C56C 1WCMG 4RKLA 4TSSA 1I4GA 2KEEA 3SK5A 3CXCA 1LACA 4MHEA 3H3VH 3NHHA 3W1GA 1CQVA