4LIJA

Crystal structure of a far upstream element (fuse) binding protein 1 (fubp1) from homo sapiens at 1.95 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
RSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGLPERSCMLTGTPESVQSAKRLLDQIVEKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Far upstream element-binding protein 1
publication title Crystal structure of a far upstream element (FUSE) binding protein 1 (FUBP1) from Homo sapiens at 1.95 A resolution
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 24
structure length 75
sequence length 75
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4lijA00
1ZZJA 4OO1G 2CTKA 2P2RA 4AM3A 2OPUA 1WVNA 2JZXA 3U1KA 1EC6A 1DT4A 1ZZIA 5C0XG 2CTEA 4IFDG 2BA0A 2DGRA 2FMRA 2CTFA 1VIHA 4NBQA 4WALA 2CTMA 2CTLA 2Z0SA 4AIMA 2JA9A 2JEAI 2MJHA 2AXYA 1WE8A 1J4WA 2NN6G 2E3UA 4B8TA 2PY9A 4JVHA 1ZTGA 2PQUA 4LIJA 2JEBI 2ANNA 1X4MA 2CPQA 1DTJA 4BA2I 5K36G 2CTJA 2JVZA 1KHMA 3V69A 3L7ZC 1TUAA 1VIGA 1X4NA 1K1GA 4JVYA 1ZZKA 4QMFB 1J5KA 2ANRA 2BL5A 2HH2A 4WANA 5JEAG 3VKEA 2YQRA 4BA1I 3AEVB 2OPVA 2QNDA 2HH3A 2JE6I
chains in the Genus database with same CATH superfamily
3GABA 4OCHA 4JYAH 3OETA 4DV5H 4JI0H 3JAMW 2BA0A 4LFAH 1WTJA 3T1HH 1HNZH 2Z0SA 2VKCA 1VBIA 2MJHA 4B3SH 1WE8A 3NCVA 4DR7H 2E3UA 5LMNH 3KDKA 2PQUA 1HNXH 2ANNA 1X4MA 1HNWH 1X0AA 2A1SA 5K36G 1KHMA 4DV1H 1FKAH 1XMQH 3L7ZC 1TUAA 4B3MH 4B3RH 1ZZKA 2UUBH 4NXNH 1I6UA 3QD7X 1X9ZA 2M8WA 1Z2IA 4LF7H 4PDBA 1ZZJA 3OTOH 4LF8H 4FJUA 3J80W 2VQEH 2P2RA 1WVNA 5FLXW 4LF9H 5C0XG 4IFDG 2FMRA 1V9NA 4DV3H 4DR2H 2HHHH 1J5EH 4KHPH 2CTFA 1VIHA 5IWAH 2M6QA 3T1YH 4JI3H 2Y3MA 2JA9A 4JI8H 2CWFA 2AXYA 2PY9A 2UXDH 1S20A 2CPMA 3KDGA 2UUCH 4LF6H 4X65H 1N33H 1XRHA 2CPQA 1DTJA 1NXUA 4JI4H 2PT7G 4JVYA 5IT9W 1IBKH 2HH2A 1S03G 2F4VH 2UUAH 2FFMA 4LF4H 2LRRA 4DV6H 2HH3A 2JE6I 3SB1A 4OO1G 4DR3H 2CWHA 2OPUA 2X06A 3FAUA 4OD6A 1ZZIA 1WHRA 2CTEA 4JI5H 5A2QW 1SEIA 4NBQA 2CTMA 2CTLA 4OX9H 3OSSD 1V8CA 2JEAI 3UOEA 2LTLA 4LFBH 3GKUA 2K1HA 4JVHA 4B8TA 2O4CA 4DR1H 4G08A 4DR5H 1ZTGA 4BA2I 2G8YA 4DV0H 3V69A 4NZTM 4B8CD 1X4NA 3GR5A 1K1GA 4GKKH 4QMFB 1HR0H 2ANRA 3J7AK 4X64H 1IBMH 1ODHA 5JEAG 4B3TH 1FJGH 2YQRA 2ZQEA 4BA1I 4JI6H 4NXMH 4E9JA 5BR8H 4DV2H 2OPVA 2ZM6H 1AN7A 4X66H 4DR4H 4JI7H 1N32H 4EC5A 4DR6H 2CTKA 4AM3A 4GKJH 5DT9A 1XMOH 2JZXA 2LF0A 3U1KA 1EC6A 1DT4A 4NZRM 4X62H 4DV7H 2DGRA 3J81W 4LF5H 4YHHH 4DUYH 4WALA 2VQFH 4AIMA 4JV5H 4DUZH 1MSZA 4LFCH 2UXBH 1I94H 1J4WA 2NN6G 4AQYH 1N36H 2LTMA 2E5LH 4FJSA 1IBLH 4LIJA 2JEBI 2UU9H 1UG8A 5LMUH 4JI2H 2CTJA 2JVZA 1XNQH 2D9IA 2UXCH 1VIGA 4H8AA 3I0PA 4YY3H 1F0XA 5LL6b 1N34H 1J5KA 2FPHX 4K0KH 2BL5A 4DV4H 4WANA 4JI1H 3VKEA 1XNRH 3AEVB 3EZJA 2QNDA 1PQXA 3RF2A
chains in the Genus database with same CATH topology
1ZZJA 4OO1G 2CTKA 2P2RA 4AM3A 2OPUA 1WVNA 2JZXA 3U1KA 1EC6A 1DT4A 1ZZIA 5C0XG 2CTEA 4IFDG 2BA0A 2DGRA 2FMRA 2CTFA 1VIHA 4NBQA 4WALA 2CTMA 2CTLA 2Z0SA 4AIMA 2JA9A 2JEAI 2MJHA 2AXYA 1WE8A 1J4WA 2NN6G 2E3UA 4B8TA 2PY9A 4JVHA 1ZTGA 2PQUA 4LIJA 2JEBI 2ANNA 1X4MA 2CPQA 1DTJA 4BA2I 5K36G 2CTJA 2JVZA 1KHMA 3V69A 3L7ZC 1TUAA 1VIGA 1X4NA 1K1GA 4JVYA 1ZZKA 4QMFB 1J5KA 2ANRA 2BL5A 2HH2A 4WANA 5JEAG 3VKEA 2YQRA 4BA1I 3AEVB 2OPVA 2QNDA 2HH3A 2JE6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZJ A;  4OO1 G;  2CTK A;  2P2R A;  4AM3 A;  2OPU A;  1WVN A;  2JZX A;  3U1K A;  1EC6 A;  1DT4 A;  1ZZI A;  5C0X G;  2CTE A;  4IFD G;  2BA0 A;  2DGR A;  2FMR A;  2CTF A;  1VIH A;  4NBQ A;  4WAL A;  2CTM A;  2CTL A;  2Z0S A;  4AIM A;  2JA9 A;  2JEA I;  2MJH A;  2AXY A;  1WE8 A;  1J4W A;  2NN6 G;  2E3U A;  4B8T A;  2PY9 A;  4JVH A;  1ZTG A;  2PQU A;  4LIJ A;  2JEB I;  2ANN A;  1X4M A;  2CPQ A;  1DTJ A;  4BA2 I;  5K36 G;  2CTJ A;  2JVZ A;  1KHM A;  3V69 A;  3L7Z C;  1TUA A;  1VIG A;  1X4N A;  1K1G A;  4JVY A;  1ZZK A;  4QMF B;  1J5K A;  2ANR A;  2BL5 A;  2HH2 A;  4WAN A;  5JEA G;  3VKE A;  2YQR A;  4BA1 I;  3AEV B;  2OPV A;  2QND A;  2HH3 A;  2JE6 I; 
#chains in the Genus database with same CATH topology
 3GAB A;  4OCH A;  4JYA H;  3OET A;  4DV5 H;  4JI0 H;  3JAM W;  2BA0 A;  4LFA H;  1WTJ A;  3T1H H;  1HNZ H;  2Z0S A;  2VKC A;  1VBI A;  2MJH A;  4B3S H;  1WE8 A;  3NCV A;  4DR7 H;  2E3U A;  5LMN H;  3KDK A;  2PQU A;  1HNX H;  2ANN A;  1X4M A;  1HNW H;  1X0A A;  2A1S A;  5K36 G;  1KHM A;  4DV1 H;  1FKA H;  1XMQ H;  3L7Z C;  1TUA A;  4B3M H;  4B3R H;  1ZZK A;  2UUB H;  4NXN H;  1I6U A;  3QD7 X;  1X9Z A;  2M8W A;  1Z2I A;  4LF7 H;  4PDB A;  1ZZJ A;  3OTO H;  4LF8 H;  4FJU A;  3J80 W;  2VQE H;  2P2R A;  1WVN A;  5FLX W;  4LF9 H;  5C0X G;  4IFD G;  2FMR A;  1V9N A;  4DV3 H;  4DR2 H;  2HHH H;  1J5E H;  4KHP H;  2CTF A;  1VIH A;  5IWA H;  2M6Q A;  3T1Y H;  4JI3 H;  2Y3M A;  2JA9 A;  4JI8 H;  2CWF A;  2AXY A;  2PY9 A;  2UXD H;  1S20 A;  2CPM A;  3KDG A;  2UUC H;  4LF6 H;  4X65 H;  1N33 H;  1XRH A;  2CPQ A;  1DTJ A;  1NXU A;  4JI4 H;  2PT7 G;  4JVY A;  5IT9 W;  1IBK H;  2HH2 A;  1S03 G;  2F4V H;  2UUA H;  2FFM A;  4LF4 H;  2LRR A;  4DV6 H;  2HH3 A;  2JE6 I;  3SB1 A;  4OO1 G;  4DR3 H;  2CWH A;  2OPU A;  2X06 A;  3FAU A;  4OD6 A;  1ZZI A;  1WHR A;  2CTE A;  4JI5 H;  5A2Q W;  1SEI A;  4NBQ A;  2CTM A;  2CTL A;  4OX9 H;  3OSS D;  1V8C A;  2JEA I;  3UOE A;  2LTL A;  4LFB H;  3GKU A;  2K1H A;  4JVH A;  4B8T A;  2O4C A;  4DR1 H;  4G08 A;  4DR5 H;  1ZTG A;  4BA2 I;  2G8Y A;  4DV0 H;  3V69 A;  4NZT M;  4B8C D;  1X4N A;  3GR5 A;  1K1G A;  4GKK H;  4QMF B;  1HR0 H;  2ANR A;  3J7A K;  4X64 H;  1IBM H;  1ODH A;  5JEA G;  4B3T H;  1FJG H;  2YQR A;  2ZQE A;  4BA1 I;  4JI6 H;  4NXM H;  4E9J A;  5BR8 H;  4DV2 H;  2OPV A;  2ZM6 H;  1AN7 A;  4X66 H;  4DR4 H;  4JI7 H;  1N32 H;  4EC5 A;  4DR6 H;  2CTK A;  4AM3 A;  4GKJ H;  5DT9 A;  1XMO H;  2JZX A;  2LF0 A;  3U1K A;  1EC6 A;  1DT4 A;  4NZR M;  4X62 H;  4DV7 H;  2DGR A;  3J81 W;  4LF5 H;  4YHH H;  4DUY H;  4WAL A;  2VQF H;  4AIM A;  4JV5 H;  4DUZ H;  1MSZ A;  4LFC H;  2UXB H;  1I94 H;  1J4W A;  2NN6 G;  4AQY H;  1N36 H;  2LTM A;  2E5L H;  4FJS A;  1IBL H;  4LIJ A;  2JEB I;  2UU9 H;  1UG8 A;  5LMU H;  4JI2 H;  2CTJ A;  2JVZ A;  1XNQ H;  2D9I A;  2UXC H;  1VIG A;  4H8A A;  3I0P A;  4YY3 H;  1F0X A;  5LL6 b;  1N34 H;  1J5K A;  2FPH X;  4K0K H;  2BL5 A;  4DV4 H;  4WAN A;  4JI1 H;  3VKE A;  1XNR H;  3AEV B;  3EZJ A;  2QND A;  1PQX A;  3RF2 A; 
#chains in the Genus database with same CATH homology
 1ZZJ A;  4OO1 G;  2CTK A;  2P2R A;  4AM3 A;  2OPU A;  1WVN A;  2JZX A;  3U1K A;  1EC6 A;  1DT4 A;  1ZZI A;  5C0X G;  2CTE A;  4IFD G;  2BA0 A;  2DGR A;  2FMR A;  2CTF A;  1VIH A;  4NBQ A;  4WAL A;  2CTM A;  2CTL A;  2Z0S A;  4AIM A;  2JA9 A;  2JEA I;  2MJH A;  2AXY A;  1WE8 A;  1J4W A;  2NN6 G;  2E3U A;  4B8T A;  2PY9 A;  4JVH A;  1ZTG A;  2PQU A;  4LIJ A;  2JEB I;  2ANN A;  1X4M A;  2CPQ A;  1DTJ A;  4BA2 I;  5K36 G;  2CTJ A;  2JVZ A;  1KHM A;  3V69 A;  3L7Z C;  1TUA A;  1VIG A;  1X4N A;  1K1G A;  4JVY A;  1ZZK A;  4QMF B;  1J5K A;  2ANR A;  2BL5 A;  2HH2 A;  4WAN A;  5JEA G;  3VKE A;  2YQR A;  4BA1 I;  3AEV B;  2OPV A;  2QND A;  2HH3 A;  2JE6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...