4LIJA

Crystal structure of a far upstream element (fuse) binding protein 1 (fubp1) from homo sapiens at 1.95 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
b'RSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGLPERSCMLTGTPESVQSAKRLLDQIVEKGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Far upstream element-binding protein 1
molecule tags Rna binding protein
source organism Homo sapiens
publication title Crystal structure of a far upstream element (FUSE) binding protein 1 (FUBP1) from Homo sapiens at 1.95 A resolution
rcsb
total genus 24
structure length 75
sequence length 75
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4lijA00
1X4MA 2JVZA 2CTMA 4AIMA 2HH2A 4JVYA 2Z0SA 2CTJA 2CTEA 2CTKA 2AXYA 1VIHA 1TUAA 1ZZKA 2CTFA 2JE6I 5C0XG 1ZZIA 1J5KA 1K1GA 1ZTGA 4LIJA 2E3UA 2FMRA 2DGRA 1WE8A 2OPVA 1ZZJA 2PY9A 1X4NA 4IFDG 2PQUA 4JVHA 4BA2I 2MJHA 2ANNA 3AEVB 5K36G 2ANRA 1VIGA 2JEBI 2NN6G 4QMFB 5JEAG 4BA1I 3VKEA 1DTJA 1WVNA 4WALA 2QNDA 1J4WA 2CTLA 4WANA 2BL5A 2CPQA 2P2RA 1KHMA 1DT4A 2BA0A 2JA9A 1EC6A 4AM3A 2HH3A 3V69A 2JEAI 4NBQA 3U1KA 4OO1G 2JZXA 3L7ZC 2OPUA 2YQRA 4B8TA
chains in the Genus database with same CATH superfamily
2HH2A 4X64H 3J81W 1N32H 4E9JA 5DT9A 2Z0SA 2CTJA 2CTEA 4DV7H 4B3RH 1TUAA 2CTFA 2JE6I 4DV0H 1V9NA 2UXDH 3QD7X 1WE8A 2CWFA 4YHHH 2PT7G 3SB1A 4JYAH 2UUAH 3OTOH 4BA2I 2ZM6H 2LTLA 4JI2H 2VQEH 4QMFB 3T1YH 2UUBH 4X62H 1S03G 4K0KH 2HHHH 1I6UA 2X06A 4WALA 1X0AA 2QNDA 2CTLA 4DV5H 1XMQH 2UXBH 2LRRA 1N34H 2JA9A 4DV3H 4GKJH 1EC6A 1XRHA 3FAUA 4DR7H 3V69A 4JI5H 2JZXA 4LFCH 4X66H 4G08A 4AIMA 3J7AK 4KHPH 4JVYA 2ZQEA 2D9IA 1V8CA 1ZZIA 1K1GA 5LMUH 4H8AA 2CWHA 1SEIA 1ODHA 4LIJA 2E3UA 2FMRA 4DR5H 1IBKH 2DGRA 2OPVA 1ZZJA 2UU9H 4JI3H 2PY9A 2K1HA 4YY3H 2MJHA 2ANNA 2CPMA 2FPHX 4GKKH 3GR5A 2ANRA 3RF2A 5A2QW 4JI0H 1N33H 5JEAG 4BA1I 5IWAH 3VKEA 1DTJA 1WVNA 4OD6A 4DV2H 3NCVA 1NXUA 1PQXA 2P2RA 2BA0A 3UOEA 4LF7H 3J80W 4AM3A 4OCHA 1HR0H 4DR1H 5IT9W 1F0XA 4DR6H 1WTJA 5LL6b 2JVZA 4OX9H 4JI6H 4LFAH 3GABA 1AN7A 2AXYA 2E5LH 1ZTGA 4JVHA 1J5KA 2FFMA 4DUYH 1HNWH 1I94H 5BR8H 4NXNH 1XMOH 3T1HH 1FJGH 1Z2IA 2M8WA 2F4VH 4IFDG 4JI7H 1UG8A 1IBMH 1VIGA 2NN6G 2VKCA 4LF5H 2VQFH 4AQYH 4B8CD 5FLXW 2LTMA 1J4WA 4DV6H 4WANA 2BL5A 4JI8H 1WHRA 4NZRM 4B3MH 3GKUA 3JAMW 4X65H 4JV5H 2HH3A 1HNXH 4NBQA 3U1KA 4LF8H 3EZJA 3L7ZC 2OPUA 4LF9H 1S20A 1X4MA 2CTMA 4DR4H 4DV4H 1XNRH 1VBIA 2CTKA 2G8YA 1VIHA 1ZZKA 2JEAI 3KDGA 1MSZA 1X9ZA 5C0XG 2Y3MA 1IBLH 4PDBA 5LMNH 1XNQH 4EC5A 2M6QA 4B3TH 1X4NA 4LFBH 4FJUA 4DUZH 2PQUA 3OSSD 4NZTM 2LF0A 3AEVB 4DV1H 4LF6H 2UUCH 5K36G 3KDKA 4NXMH 2JEBI 3I0PA 2A1SA 2O4CA 4DR2H 1J5EH 2CPQA 1FKAH 4DR3H 1DT4A 4JI4H 4LF4H 2UXCH 1KHMA 3OETA 1HNZH 4OO1G 4B3SH 4FJSA 1N36H 4JI1H 2YQRA 4B8TA
chains in the Genus database with same CATH topology
1X4MA 2JVZA 2CTMA 4AIMA 2HH2A 4JVYA 2Z0SA 2CTJA 2CTEA 2CTKA 2AXYA 1VIHA 1TUAA 1ZZKA 2CTFA 2JE6I 5C0XG 1ZZIA 1J5KA 1K1GA 1ZTGA 4LIJA 2E3UA 2FMRA 2DGRA 1WE8A 2OPVA 1ZZJA 2PY9A 1X4NA 4IFDG 2PQUA 4JVHA 4BA2I 2MJHA 2ANNA 3AEVB 5K36G 2ANRA 1VIGA 2JEBI 2NN6G 4QMFB 5JEAG 4BA1I 3VKEA 1DTJA 1WVNA 4WALA 2QNDA 1J4WA 2CTLA 4WANA 2BL5A 2CPQA 2P2RA 1KHMA 1DT4A 2BA0A 2JA9A 1EC6A 4AM3A 2HH3A 3V69A 2JEAI 4NBQA 3U1KA 4OO1G 2JZXA 3L7ZC 2OPUA 2YQRA 4B8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4M A;  2JVZ A;  2CTM A;  4AIM A;  2HH2 A;  4JVY A;  2Z0S A;  2CTJ A;  2CTE A;  2CTK A;  2AXY A;  1VIH A;  1TUA A;  1ZZK A;  2CTF A;  2JE6 I;  5C0X G;  1ZZI A;  1J5K A;  1K1G A;  1ZTG A;  4LIJ A;  2E3U A;  2FMR A;  2DGR A;  1WE8 A;  2OPV A;  1ZZJ A;  2PY9 A;  1X4N A;  4IFD G;  2PQU A;  4JVH A;  4BA2 I;  2MJH A;  2ANN A;  3AEV B;  5K36 G;  2ANR A;  1VIG A;  2JEB I;  2NN6 G;  4QMF B;  5JEA G;  4BA1 I;  3VKE A;  1DTJ A;  1WVN A;  4WAL A;  2QND A;  1J4W A;  2CTL A;  4WAN A;  2BL5 A;  2CPQ A;  2P2R A;  1KHM A;  1DT4 A;  2BA0 A;  2JA9 A;  1EC6 A;  4AM3 A;  2HH3 A;  3V69 A;  2JEA I;  4NBQ A;  3U1K A;  4OO1 G;  2JZX A;  3L7Z C;  2OPU A;  2YQR A;  4B8T A; 
#chains in the Genus database with same CATH topology
 2HH2 A;  4X64 H;  3J81 W;  1N32 H;  4E9J A;  5DT9 A;  2Z0S A;  2CTJ A;  2CTE A;  4DV7 H;  4B3R H;  1TUA A;  2CTF A;  2JE6 I;  4DV0 H;  1V9N A;  2UXD H;  3QD7 X;  1WE8 A;  2CWF A;  4YHH H;  2PT7 G;  3SB1 A;  4JYA H;  2UUA H;  3OTO H;  4BA2 I;  2ZM6 H;  2LTL A;  4JI2 H;  2VQE H;  4QMF B;  3T1Y H;  2UUB H;  4X62 H;  1S03 G;  4K0K H;  2HHH H;  1I6U A;  2X06 A;  4WAL A;  1X0A A;  2QND A;  2CTL A;  4DV5 H;  1XMQ H;  2UXB H;  2LRR A;  1N34 H;  2JA9 A;  4DV3 H;  4GKJ H;  1EC6 A;  1XRH A;  3FAU A;  4DR7 H;  3V69 A;  4JI5 H;  2JZX A;  4LFC H;  4X66 H;  4G08 A;  4AIM A;  3J7A K;  4KHP H;  4JVY A;  2ZQE A;  2D9I A;  1V8C A;  1ZZI A;  1K1G A;  5LMU H;  4H8A A;  2CWH A;  1SEI A;  1ODH A;  4LIJ A;  2E3U A;  2FMR A;  4DR5 H;  1IBK H;  2DGR A;  2OPV A;  1ZZJ A;  2UU9 H;  4JI3 H;  2PY9 A;  2K1H A;  4YY3 H;  2MJH A;  2ANN A;  2CPM A;  2FPH X;  4GKK H;  3GR5 A;  2ANR A;  3RF2 A;  5A2Q W;  4JI0 H;  1N33 H;  5JEA G;  4BA1 I;  5IWA H;  3VKE A;  1DTJ A;  1WVN A;  4OD6 A;  4DV2 H;  3NCV A;  1NXU A;  1PQX A;  2P2R A;  2BA0 A;  3UOE A;  4LF7 H;  3J80 W;  4AM3 A;  4OCH A;  1HR0 H;  4DR1 H;  5IT9 W;  1F0X A;  4DR6 H;  1WTJ A;  5LL6 b;  2JVZ A;  4OX9 H;  4JI6 H;  4LFA H;  3GAB A;  1AN7 A;  2AXY A;  2E5L H;  1ZTG A;  4JVH A;  1J5K A;  2FFM A;  4DUY H;  1HNW H;  1I94 H;  5BR8 H;  4NXN H;  1XMO H;  3T1H H;  1FJG H;  1Z2I A;  2M8W A;  2F4V H;  4IFD G;  4JI7 H;  1UG8 A;  1IBM H;  1VIG A;  2NN6 G;  2VKC A;  4LF5 H;  2VQF H;  4AQY H;  4B8C D;  5FLX W;  2LTM A;  1J4W A;  4DV6 H;  4WAN A;  2BL5 A;  4JI8 H;  1WHR A;  4NZR M;  4B3M H;  3GKU A;  3JAM W;  4X65 H;  4JV5 H;  2HH3 A;  1HNX H;  4NBQ A;  3U1K A;  4LF8 H;  3EZJ A;  3L7Z C;  2OPU A;  4LF9 H;  1S20 A;  1X4M A;  2CTM A;  4DR4 H;  4DV4 H;  1XNR H;  1VBI A;  2CTK A;  2G8Y A;  1VIH A;  1ZZK A;  2JEA I;  3KDG A;  1MSZ A;  1X9Z A;  5C0X G;  2Y3M A;  1IBL H;  4PDB A;  5LMN H;  1XNQ H;  4EC5 A;  2M6Q A;  4B3T H;  1X4N A;  4LFB H;  4FJU A;  4DUZ H;  2PQU A;  3OSS D;  4NZT M;  2LF0 A;  3AEV B;  4DV1 H;  4LF6 H;  2UUC H;  5K36 G;  3KDK A;  4NXM H;  2JEB I;  3I0P A;  2A1S A;  2O4C A;  4DR2 H;  1J5E H;  2CPQ A;  1FKA H;  4DR3 H;  1DT4 A;  4JI4 H;  4LF4 H;  2UXC H;  1KHM A;  3OET A;  1HNZ H;  4OO1 G;  4B3S H;  4FJS A;  1N36 H;  4JI1 H;  2YQR A;  4B8T A; 
#chains in the Genus database with same CATH homology
 1X4M A;  2JVZ A;  2CTM A;  4AIM A;  2HH2 A;  4JVY A;  2Z0S A;  2CTJ A;  2CTE A;  2CTK A;  2AXY A;  1VIH A;  1TUA A;  1ZZK A;  2CTF A;  2JE6 I;  5C0X G;  1ZZI A;  1J5K A;  1K1G A;  1ZTG A;  4LIJ A;  2E3U A;  2FMR A;  2DGR A;  1WE8 A;  2OPV A;  1ZZJ A;  2PY9 A;  1X4N A;  4IFD G;  2PQU A;  4JVH A;  4BA2 I;  2MJH A;  2ANN A;  3AEV B;  5K36 G;  2ANR A;  1VIG A;  2JEB I;  2NN6 G;  4QMF B;  5JEA G;  4BA1 I;  3VKE A;  1DTJ A;  1WVN A;  4WAL A;  2QND A;  1J4W A;  2CTL A;  4WAN A;  2BL5 A;  2CPQ A;  2P2R A;  1KHM A;  1DT4 A;  2BA0 A;  2JA9 A;  1EC6 A;  4AM3 A;  2HH3 A;  3V69 A;  2JEA I;  4NBQ A;  3U1K A;  4OO1 G;  2JZX A;  3L7Z C;  2OPU A;  2YQR A;  4B8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...