4LIJA

Crystal structure of a far upstream element (fuse) binding protein 1 (fubp1) from homo sapiens at 1.95 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
RSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGLPERSCMLTGTPESVQSAKRLLDQIVEKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a far upstream element (FUSE) binding protein 1 (FUBP1) from Homo sapiens at 1.95 A resolution
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Far upstream element-binding protein 1
total genus 24
structure length 75
sequence length 75
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4lijA00
2HH3A 1K1GA 4NBQA 4BA2I 1DTJA 4AIMA 2BA0A 2HH2A 1X4MA 2JVZA 2CTFA 2CPQA 2E3UA 4WALA 1WE8A 5K36G 2CTMA 2MJHA 4QMFB 4BA1I 4IFDG 1EC6A 1J4WA 1DT4A 2OPUA 1ZZKA 3U1KA 4OO1G 2PQUA 1TUAA 2CTJA 2JZXA 1WVNA 2OPVA 2CTEA 3AEVB 2JEBI 5C0XG 2NN6G 2P2RA 1J5KA 1ZZIA 5JEAG 2CTKA 2CTLA 2FMRA 4JVYA 1VIHA 2JE6I 3L7ZC 2Z0SA 1ZZJA 4LIJA 3V69A 1VIGA 2JA9A 2ANNA 1KHMA 2ANRA 4JVHA 1ZTGA 2JEAI 4WANA 2AXYA 4AM3A 2QNDA 2YQRA 1X4NA 2BL5A 3VKEA 2PY9A 4B8TA 2DGRA
chains in the Genus database with same CATH superfamily
1MSZA 4JI4H 1XNRH 2CTFA 4DR6H 2UXBH 1XMOH 2LTMA 4YY3H 4GKKH 5A2QW 1HNXH 4KHPH 1V9NA 3U1KA 4OO1G 3J81W 1TUAA 2JZXA 4DV3H 2JEBI 1NXUA 2NN6G 2P2RA 3GABA 4DR5H 3J80W 2UUAH 2FPHX 1HNWH 4JI8H 4JVYA 1Z2IA 4X62H 4DR4H 2D9IA 2JE6I 1IBLH 1ZZJA 2O4CA 4NXMH 3GKUA 5LL6b 4JI5H 3NCVA 4JI7H 4JI0H 4LF5H 2VQFH 4WANA 2VQEH 4B8CD 2AXYA 1PQXA 1X4NA 4LF8H 4JI3H 4JV5H 2DGRA 1AN7A 4JVHA 1K1GA 1DTJA 4B3TH 2X06A 4DR2H 1X4MA 1ODHA 1WE8A 3SB1A 5LMNH 4DR1H 3EZJA 1S03G 2CTMA 4QMFB 3OTOH 2G8YA 3OETA 1N32H 2OPUA 4DV5H 2M8WA 1WTJA 2PQUA 1SEIA 1WVNA 2OPVA 4LF4H 4NZTM 4DUZH 1J5KA 1V8CA 4DV0H 4JI1H 2CTLA 2K1HA 2F4VH 1VIHA 2LRRA 1N34H 2UU9H 3V69A 2HHHH 4B3MH 2JA9A 2ANNA 2ANRA 1ZTGA 1XMQH 4JI6H 2JEAI 5BR8H 4LFCH 3VKEA 1F0XA 2VKCA 1N33H 1XRHA 2HH3A 4NBQA 3KDKA 4BA2I 4JYAH 2M6QA 2BA0A 4OX9H 2HH2A 4WALA 5LMUH 2LTLA 2CPQA 2E3UA 1J5EH 4LF7H 2ZQEA 4DV6H 4X65H 5K36G 1X0AA 4LF9H 2CWHA 4AQYH 1EC6A 2Y3MA 1J4WA 1DT4A 5IWAH 4E9JA 2UUBH 1ZZKA 2UUCH 2LF0A 4PDBA 4LFAH 2CTEA 5DT9A 3AEVB 2FFMA 5C0XG 4YHHH 3OSSD 4B3RH 1IBMH 1ZZIA 2CWFA 5JEAG 2CTKA 4OD6A 1S20A 1UG8A 1X9ZA 4JI2H 3L7ZC 4LIJA 1N36H 4NXNH 4DV4H 3J7AK 4FJSA 2QNDA 4AM3A 4NZRM 2A1SA 1FJGH 1XNQH 4DR3H 1FKAH 3FAUA 3GR5A 4AIMA 5IT9W 1IBKH 2JVZA 4K0KH 3T1HH 4DV1H 2MJHA 4BA1I 2UXCH 4IFDG 2CPMA 4EC5A 4X66H 5FLXW 1I6UA 3T1YH 1VBIA 2CTJA 4DR7H 3I0PA 4FJUA 4DUYH 4LFBH 1I94H 3QD7X 3UOEA 4DV2H 2PT7G 2FMRA 2ZM6H 4H8AA 4B3SH 2Z0SA 2UXDH 1VIGA 2E5LH 1KHMA 1WHRA 4OCHA 4GKJH 3JAMW 3KDGA 1HNZH 4LF6H 4DV7H 1HR0H 4X64H 2YQRA 2BL5A 3RF2A 4G08A 2PY9A 4B8TA
chains in the Genus database with same CATH topology
2HH3A 1K1GA 4NBQA 4BA2I 1DTJA 4AIMA 2BA0A 2HH2A 1X4MA 2JVZA 2CTFA 2CPQA 2E3UA 4WALA 1WE8A 5K36G 2CTMA 2MJHA 4QMFB 4BA1I 4IFDG 1EC6A 1J4WA 1DT4A 2OPUA 1ZZKA 3U1KA 4OO1G 2PQUA 1TUAA 2CTJA 2JZXA 1WVNA 2OPVA 2CTEA 3AEVB 2JEBI 5C0XG 2NN6G 2P2RA 1J5KA 1ZZIA 5JEAG 2CTKA 2CTLA 2FMRA 4JVYA 1VIHA 2JE6I 3L7ZC 2Z0SA 1ZZJA 4LIJA 3V69A 1VIGA 2JA9A 2ANNA 1KHMA 2ANRA 4JVHA 1ZTGA 2JEAI 4WANA 2AXYA 4AM3A 2QNDA 2YQRA 1X4NA 2BL5A 3VKEA 2PY9A 4B8TA 2DGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HH3 A;  1K1G A;  4NBQ A;  4BA2 I;  1DTJ A;  4AIM A;  2BA0 A;  2HH2 A;  1X4M A;  2JVZ A;  2CTF A;  2CPQ A;  2E3U A;  4WAL A;  1WE8 A;  5K36 G;  2CTM A;  2MJH A;  4QMF B;  4BA1 I;  4IFD G;  1EC6 A;  1J4W A;  1DT4 A;  2OPU A;  1ZZK A;  3U1K A;  4OO1 G;  2PQU A;  1TUA A;  2CTJ A;  2JZX A;  1WVN A;  2OPV A;  2CTE A;  3AEV B;  2JEB I;  5C0X G;  2NN6 G;  2P2R A;  1J5K A;  1ZZI A;  5JEA G;  2CTK A;  2CTL A;  2FMR A;  4JVY A;  1VIH A;  2JE6 I;  3L7Z C;  2Z0S A;  1ZZJ A;  4LIJ A;  3V69 A;  1VIG A;  2JA9 A;  2ANN A;  1KHM A;  2ANR A;  4JVH A;  1ZTG A;  2JEA I;  4WAN A;  2AXY A;  4AM3 A;  2QND A;  2YQR A;  1X4N A;  2BL5 A;  3VKE A;  2PY9 A;  4B8T A;  2DGR A; 
#chains in the Genus database with same CATH topology
 1MSZ A;  4JI4 H;  1XNR H;  2CTF A;  4DR6 H;  2UXB H;  1XMO H;  2LTM A;  4YY3 H;  4GKK H;  5A2Q W;  1HNX H;  4KHP H;  1V9N A;  3U1K A;  4OO1 G;  3J81 W;  1TUA A;  2JZX A;  4DV3 H;  2JEB I;  1NXU A;  2NN6 G;  2P2R A;  3GAB A;  4DR5 H;  3J80 W;  2UUA H;  2FPH X;  1HNW H;  4JI8 H;  4JVY A;  1Z2I A;  4X62 H;  4DR4 H;  2D9I A;  2JE6 I;  1IBL H;  1ZZJ A;  2O4C A;  4NXM H;  3GKU A;  5LL6 b;  4JI5 H;  3NCV A;  4JI7 H;  4JI0 H;  4LF5 H;  2VQF H;  4WAN A;  2VQE H;  4B8C D;  2AXY A;  1PQX A;  1X4N A;  4LF8 H;  4JI3 H;  4JV5 H;  2DGR A;  1AN7 A;  4JVH A;  1K1G A;  1DTJ A;  4B3T H;  2X06 A;  4DR2 H;  1X4M A;  1ODH A;  1WE8 A;  3SB1 A;  5LMN H;  4DR1 H;  3EZJ A;  1S03 G;  2CTM A;  4QMF B;  3OTO H;  2G8Y A;  3OET A;  1N32 H;  2OPU A;  4DV5 H;  2M8W A;  1WTJ A;  2PQU A;  1SEI A;  1WVN A;  2OPV A;  4LF4 H;  4NZT M;  4DUZ H;  1J5K A;  1V8C A;  4DV0 H;  4JI1 H;  2CTL A;  2K1H A;  2F4V H;  1VIH A;  2LRR A;  1N34 H;  2UU9 H;  3V69 A;  2HHH H;  4B3M H;  2JA9 A;  2ANN A;  2ANR A;  1ZTG A;  1XMQ H;  4JI6 H;  2JEA I;  5BR8 H;  4LFC H;  3VKE A;  1F0X A;  2VKC A;  1N33 H;  1XRH A;  2HH3 A;  4NBQ A;  3KDK A;  4BA2 I;  4JYA H;  2M6Q A;  2BA0 A;  4OX9 H;  2HH2 A;  4WAL A;  5LMU H;  2LTL A;  2CPQ A;  2E3U A;  1J5E H;  4LF7 H;  2ZQE A;  4DV6 H;  4X65 H;  5K36 G;  1X0A A;  4LF9 H;  2CWH A;  4AQY H;  1EC6 A;  2Y3M A;  1J4W A;  1DT4 A;  5IWA H;  4E9J A;  2UUB H;  1ZZK A;  2UUC H;  2LF0 A;  4PDB A;  4LFA H;  2CTE A;  5DT9 A;  3AEV B;  2FFM A;  5C0X G;  4YHH H;  3OSS D;  4B3R H;  1IBM H;  1ZZI A;  2CWF A;  5JEA G;  2CTK A;  4OD6 A;  1S20 A;  1UG8 A;  1X9Z A;  4JI2 H;  3L7Z C;  4LIJ A;  1N36 H;  4NXN H;  4DV4 H;  3J7A K;  4FJS A;  2QND A;  4AM3 A;  4NZR M;  2A1S A;  1FJG H;  1XNQ H;  4DR3 H;  1FKA H;  3FAU A;  3GR5 A;  4AIM A;  5IT9 W;  1IBK H;  2JVZ A;  4K0K H;  3T1H H;  4DV1 H;  2MJH A;  4BA1 I;  2UXC H;  4IFD G;  2CPM A;  4EC5 A;  4X66 H;  5FLX W;  1I6U A;  3T1Y H;  1VBI A;  2CTJ A;  4DR7 H;  3I0P A;  4FJU A;  4DUY H;  4LFB H;  1I94 H;  3QD7 X;  3UOE A;  4DV2 H;  2PT7 G;  2FMR A;  2ZM6 H;  4H8A A;  4B3S H;  2Z0S A;  2UXD H;  1VIG A;  2E5L H;  1KHM A;  1WHR A;  4OCH A;  4GKJ H;  3JAM W;  3KDG A;  1HNZ H;  4LF6 H;  4DV7 H;  1HR0 H;  4X64 H;  2YQR A;  2BL5 A;  3RF2 A;  4G08 A;  2PY9 A;  4B8T A; 
#chains in the Genus database with same CATH homology
 2HH3 A;  1K1G A;  4NBQ A;  4BA2 I;  1DTJ A;  4AIM A;  2BA0 A;  2HH2 A;  1X4M A;  2JVZ A;  2CTF A;  2CPQ A;  2E3U A;  4WAL A;  1WE8 A;  5K36 G;  2CTM A;  2MJH A;  4QMF B;  4BA1 I;  4IFD G;  1EC6 A;  1J4W A;  1DT4 A;  2OPU A;  1ZZK A;  3U1K A;  4OO1 G;  2PQU A;  1TUA A;  2CTJ A;  2JZX A;  1WVN A;  2OPV A;  2CTE A;  3AEV B;  2JEB I;  5C0X G;  2NN6 G;  2P2R A;  1J5K A;  1ZZI A;  5JEA G;  2CTK A;  2CTL A;  2FMR A;  4JVY A;  1VIH A;  2JE6 I;  3L7Z C;  2Z0S A;  1ZZJ A;  4LIJ A;  3V69 A;  1VIG A;  2JA9 A;  2ANN A;  1KHM A;  2ANR A;  4JVH A;  1ZTG A;  2JEA I;  4WAN A;  2AXY A;  4AM3 A;  2QND A;  2YQR A;  1X4N A;  2BL5 A;  3VKE A;  2PY9 A;  4B8T A;  2DGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...