1X4MA

Solution structure of kh domain in far upstream element binding protein 1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
94
structure length
94
Chain Sequence
b'GSSGSSGHGDGPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEMVLELIRDQGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Far upstream element binding protein 1
publication title Solution structure of KH domain in Far upstream element binding protein 1
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 12
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1x4mA01
1EC6A 4BA1I 4WALA 2P2RA 4QMFB 2JEAI 1DT4A 2QNDA 2ANRA 4WANA 2CPQA 1ZZJA 2HH3A 4JVYA 2JE6I 2OPUA 4AM3A 5C0XG 2CTMA 2CTLA 2Z0SA 2JVZA 2CTKA 1K1GA 1VIGA 2HH2A 3VKEA 1J4WA 2E3UA 2FMRA 2JEBI 3U1KA 2CTFA 2JA9A 3L7ZC 2YQRA 4LIJA 2NN6G 2PY9A 2CTJA 1X4NA 4BA2I 1X4MA 5JEAG 4IFDG 4OO1G 2BA0A 3V69A 1DTJA 2JZXA 2BL5A 1WE8A 3AEVB 4NBQA 1ZTGA 1KHMA 2DGRA 2CTEA 2PQUA 1J5KA 2MJHA 1WVNA 4B8TA 5K36G 4AIMA 1TUAA 1ZZKA 2AXYA 2ANNA 2OPVA 1VIHA 4JVHA 1ZZIA
chains in the Genus database with same CATH superfamily
4OX9H 4DR2H 4BA1I 1EC6A 1S03G 3KDKA 3GKUA 5FLXW 4WANA 2CPQA 4DV5H 4DUYH 2JE6I 1V9NA 3OETA 3T1HH 4DR7H 2Z0SA 4FJUA 2CWFA 1V8CA 1J4WA 4X65H 4JI5H 4AQYH 2FMRA 4LF4H 2CTFA 4B3TH 3L7ZC 4B3MH 2YQRA 2UXCH 2CPMA 1IBMH 5A2QW 1X4NA 2CWHA 1N33H 1AN7A 1X4MA 4KHPH 2UXDH 1DTJA 3RF2A 4NBQA 1KHMA 2DGRA 2LF0A 4DR1H 4B8CD 1FJGH 3KDGA 1J5KA 1XNQH 3SB1A 1ZZKA 2HHHH 4JVHA 4JI2H 2M6QA 2P2RA 2X06A 1XMQH 2JEAI 1DT4A 2QNDA 3FAUA 1X9ZA 2LTMA 1ZZJA 2HH3A 2A1SA 3OSSD 2CTMA 4GKJH 1N32H 2JVZA 4DUZH 4NXMH 1K1GA 2HH2A 4DV6H 1NXUA 4NZTM 4LFCH 4X66H 3EZJA 3OTOH 5LMNH 4BA2I 2NN6G 2G8YA 2Y3MA 4OCHA 5JEAG 2UU9H 2UUCH 4JI7H 1N34H 2JZXA 2BL5A 3AEVB 4K0KH 3J81W 2F4VH 2PQUA 1MSZA 4OD6A 4LFAH 2ZQEA 1XMOH 4PDBA 5IT9W 4B8TA 5K36G 4AIMA 1TUAA 2AXYA 1I94H 4DV2H 2OPVA 1XNRH 1HNWH 1PQXA 1WHRA 5LL6b 4QMFB 1HR0H 3J80W 2VKCA 4YY3H 4H8AA 1HNXH 4JVYA 4X64H 4AM3A 4EC5A 2CTLA 5C0XG 4LF5H 2UUAH 1VIGA 5IWAH 4LFBH 1Z2IA 2JEBI 1WTJA 3I0PA 1IBLH 5LMUH 4B3RH 1J5EH 4NXNH 1VBIA 2CTJA 1UG8A 3JAMW 5BR8H 4IFDG 1XRHA 2BA0A 4DV4H 1ZTGA 4DR6H 4LF7H 2LRRA 4FJSA 1WVNA 2MJHA 4LF8H 2UUBH 4DR3H 4DV3H 2ANNA 2FFMA 1FKAH 1VIHA 4JI3H 4JI1H 4WALA 4LF6H 4DR4H 2ANRA 4LF9H 2UXBH 2M8WA 2OPUA 3T1YH 3UOEA 3J7AK 4YHHH 4JYAH 2K1HA 2CTKA 4JI4H 1I6UA 2VQFH 3VKEA 2E5LH 4JI8H 2E3UA 3NCVA 3U1KA 4E9JA 3GR5A 4DV1H 5DT9A 4JV5H 2PT7G 1S20A 2JA9A 2ZM6H 4DV0H 4GKKH 2D9IA 1SEIA 4LIJA 2FPHX 2O4CA 1ODHA 2PY9A 4DV7H 4OO1G 4X62H 3GABA 3V69A 1WE8A 2VQEH 1N36H 2CTEA 4NZRM 4B3SH 4G08A 1F0XA 3QD7X 2LTLA 4DR5H 1IBKH 4JI6H 1HNZH 4JI0H 1X0AA 1ZZIA
chains in the Genus database with same CATH topology
1EC6A 4BA1I 4WALA 2P2RA 4QMFB 2JEAI 1DT4A 2QNDA 2ANRA 4WANA 2CPQA 1ZZJA 2HH3A 4JVYA 2JE6I 2OPUA 4AM3A 5C0XG 2CTMA 2CTLA 2Z0SA 2JVZA 2CTKA 1K1GA 1VIGA 2HH2A 3VKEA 1J4WA 2E3UA 2FMRA 2JEBI 3U1KA 2CTFA 2JA9A 3L7ZC 2YQRA 4LIJA 2NN6G 2PY9A 2CTJA 1X4NA 4BA2I 1X4MA 5JEAG 4IFDG 4OO1G 2BA0A 3V69A 1DTJA 2JZXA 2BL5A 1WE8A 3AEVB 4NBQA 1ZTGA 1KHMA 2DGRA 2CTEA 2PQUA 1J5KA 2MJHA 1WVNA 4B8TA 5K36G 4AIMA 1TUAA 1ZZKA 2AXYA 2ANNA 2OPVA 1VIHA 4JVHA 1ZZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EC6 A;  4BA1 I;  4WAL A;  2P2R A;  4QMF B;  2JEA I;  1DT4 A;  2QND A;  2ANR A;  4WAN A;  2CPQ A;  1ZZJ A;  2HH3 A;  4JVY A;  2JE6 I;  2OPU A;  4AM3 A;  5C0X G;  2CTM A;  2CTL A;  2Z0S A;  2JVZ A;  2CTK A;  1K1G A;  1VIG A;  2HH2 A;  3VKE A;  1J4W A;  2E3U A;  2FMR A;  2JEB I;  3U1K A;  2CTF A;  2JA9 A;  3L7Z C;  2YQR A;  4LIJ A;  2NN6 G;  2PY9 A;  2CTJ A;  1X4N A;  4BA2 I;  1X4M A;  5JEA G;  4IFD G;  4OO1 G;  2BA0 A;  3V69 A;  1DTJ A;  2JZX A;  2BL5 A;  1WE8 A;  3AEV B;  4NBQ A;  1ZTG A;  1KHM A;  2DGR A;  2CTE A;  2PQU A;  1J5K A;  2MJH A;  1WVN A;  4B8T A;  5K36 G;  4AIM A;  1TUA A;  1ZZK A;  2AXY A;  2ANN A;  2OPV A;  1VIH A;  4JVH A;  1ZZI A; 
#chains in the Genus database with same CATH topology
 4OX9 H;  4DR2 H;  4BA1 I;  1EC6 A;  1S03 G;  3KDK A;  3GKU A;  5FLX W;  4WAN A;  2CPQ A;  4DV5 H;  4DUY H;  2JE6 I;  1V9N A;  3OET A;  3T1H H;  4DR7 H;  2Z0S A;  4FJU A;  2CWF A;  1V8C A;  1J4W A;  4X65 H;  4JI5 H;  4AQY H;  2FMR A;  4LF4 H;  2CTF A;  4B3T H;  3L7Z C;  4B3M H;  2YQR A;  2UXC H;  2CPM A;  1IBM H;  5A2Q W;  1X4N A;  2CWH A;  1N33 H;  1AN7 A;  1X4M A;  4KHP H;  2UXD H;  1DTJ A;  3RF2 A;  4NBQ A;  1KHM A;  2DGR A;  2LF0 A;  4DR1 H;  4B8C D;  1FJG H;  3KDG A;  1J5K A;  1XNQ H;  3SB1 A;  1ZZK A;  2HHH H;  4JVH A;  4JI2 H;  2M6Q A;  2P2R A;  2X06 A;  1XMQ H;  2JEA I;  1DT4 A;  2QND A;  3FAU A;  1X9Z A;  2LTM A;  1ZZJ A;  2HH3 A;  2A1S A;  3OSS D;  2CTM A;  4GKJ H;  1N32 H;  2JVZ A;  4DUZ H;  4NXM H;  1K1G A;  2HH2 A;  4DV6 H;  1NXU A;  4NZT M;  4LFC H;  4X66 H;  3EZJ A;  3OTO H;  5LMN H;  4BA2 I;  2NN6 G;  2G8Y A;  2Y3M A;  4OCH A;  5JEA G;  2UU9 H;  2UUC H;  4JI7 H;  1N34 H;  2JZX A;  2BL5 A;  3AEV B;  4K0K H;  3J81 W;  2F4V H;  2PQU A;  1MSZ A;  4OD6 A;  4LFA H;  2ZQE A;  1XMO H;  4PDB A;  5IT9 W;  4B8T A;  5K36 G;  4AIM A;  1TUA A;  2AXY A;  1I94 H;  4DV2 H;  2OPV A;  1XNR H;  1HNW H;  1PQX A;  1WHR A;  5LL6 b;  4QMF B;  1HR0 H;  3J80 W;  2VKC A;  4YY3 H;  4H8A A;  1HNX H;  4JVY A;  4X64 H;  4AM3 A;  4EC5 A;  2CTL A;  5C0X G;  4LF5 H;  2UUA H;  1VIG A;  5IWA H;  4LFB H;  1Z2I A;  2JEB I;  1WTJ A;  3I0P A;  1IBL H;  5LMU H;  4B3R H;  1J5E H;  4NXN H;  1VBI A;  2CTJ A;  1UG8 A;  3JAM W;  5BR8 H;  4IFD G;  1XRH A;  2BA0 A;  4DV4 H;  1ZTG A;  4DR6 H;  4LF7 H;  2LRR A;  4FJS A;  1WVN A;  2MJH A;  4LF8 H;  2UUB H;  4DR3 H;  4DV3 H;  2ANN A;  2FFM A;  1FKA H;  1VIH A;  4JI3 H;  4JI1 H;  4WAL A;  4LF6 H;  4DR4 H;  2ANR A;  4LF9 H;  2UXB H;  2M8W A;  2OPU A;  3T1Y H;  3UOE A;  3J7A K;  4YHH H;  4JYA H;  2K1H A;  2CTK A;  4JI4 H;  1I6U A;  2VQF H;  3VKE A;  2E5L H;  4JI8 H;  2E3U A;  3NCV A;  3U1K A;  4E9J A;  3GR5 A;  4DV1 H;  5DT9 A;  4JV5 H;  2PT7 G;  1S20 A;  2JA9 A;  2ZM6 H;  4DV0 H;  4GKK H;  2D9I A;  1SEI A;  4LIJ A;  2FPH X;  2O4C A;  1ODH A;  2PY9 A;  4DV7 H;  4OO1 G;  4X62 H;  3GAB A;  3V69 A;  1WE8 A;  2VQE H;  1N36 H;  2CTE A;  4NZR M;  4B3S H;  4G08 A;  1F0X A;  3QD7 X;  2LTL A;  4DR5 H;  1IBK H;  4JI6 H;  1HNZ H;  4JI0 H;  1X0A A;  1ZZI A; 
#chains in the Genus database with same CATH homology
 1EC6 A;  4BA1 I;  4WAL A;  2P2R A;  4QMF B;  2JEA I;  1DT4 A;  2QND A;  2ANR A;  4WAN A;  2CPQ A;  1ZZJ A;  2HH3 A;  4JVY A;  2JE6 I;  2OPU A;  4AM3 A;  5C0X G;  2CTM A;  2CTL A;  2Z0S A;  2JVZ A;  2CTK A;  1K1G A;  1VIG A;  2HH2 A;  3VKE A;  1J4W A;  2E3U A;  2FMR A;  2JEB I;  3U1K A;  2CTF A;  2JA9 A;  3L7Z C;  2YQR A;  4LIJ A;  2NN6 G;  2PY9 A;  2CTJ A;  1X4N A;  4BA2 I;  1X4M A;  5JEA G;  4IFD G;  4OO1 G;  2BA0 A;  3V69 A;  1DTJ A;  2JZX A;  2BL5 A;  1WE8 A;  3AEV B;  4NBQ A;  1ZTG A;  1KHM A;  2DGR A;  2CTE A;  2PQU A;  1J5K A;  2MJH A;  1WVN A;  4B8T A;  5K36 G;  4AIM A;  1TUA A;  1ZZK A;  2AXY A;  2ANN A;  2OPV A;  1VIH A;  4JVH A;  1ZZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...