1X4MA

Solution structure of kh domain in far upstream element binding protein 1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
94
structure length
94
Chain Sequence
GSSGSSGHGDGPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEMVLELIRDQGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Far upstream element binding protein 1
publication title Solution structure of KH domain in Far upstream element binding protein 1
rcsb
source organism Mus musculus
total genus 12
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1x4mA01
2JEBI 4NBQA 2BA0A 5C0XG 1KHMA 4B8TA 2OPVA 1TUAA 2BL5A 3VKEA 2QNDA 2CTKA 2PQUA 2MJHA 4AIMA 2P2RA 4WALA 4OO1G 1VIGA 3U1KA 5JEAG 1X4NA 3L7ZC 2FMRA 2NN6G 4IFDG 5K36G 1DT4A 2CPQA 2AXYA 4JVYA 3V69A 1ZZJA 1WE8A 2ANNA 3AEVB 2HH3A 2JVZA 2E3UA 2DGRA 1J5KA 1ZZKA 2JA9A 2HH2A 4BA1I 1DTJA 2JZXA 2OPUA 4AM3A 1ZZIA 1K1GA 1X4MA 2Z0SA 2ANRA 4BA2I 2JE6I 1ZTGA 2JEAI 4QMFB 1EC6A 2YQRA 4LIJA 2CTJA 2CTFA 1J4WA 2PY9A 4JVHA 2CTLA 4WANA 2CTMA 2CTEA 1VIHA 1WVNA
chains in the Genus database with same CATH superfamily
2JEBI 4G08A 4LFCH 1KHMA 1XRHA 2UUBH 1N33H 4AIMA 4WALA 1FJGH 3SB1A 4JI3H 5JEAG 4LF6H 2M8WA 4DR6H 2FMRA 2CPQA 3QD7X 4GKJH 1Z2IA 1HNXH 3J7AK 4GKKH 1MSZA 3AEVB 4KHPH 3JAMW 2JVZA 4JYAH 1N36H 2E3UA 4B3MH 4DV4H 1SEIA 2VQEH 2HH2A 4JI8H 4LF7H 2CWFA 1HNWH 4AM3A 4H8AA 1PQXA 1ZZIA 1X4MA 4DV0H 4LF9H 2JE6I 2LF0A 2YQRA 3NCVA 2CTJA 2CTFA 4WANA 1HR0H 3OSSD 2UXDH 4NBQA 2UU9H 4JI0H 5C0XG 4DUZH 4B8TA 4AQYH 4JI4H 1S20A 3VKEA 4NXNH 5IWAH 2CTKA 2PQUA 4OX9H 1V9NA 1VIGA 4DV5H 4OCHA 3U1KA 4JI7H 2VKCA 2A1SA 2CPMA 2LRRA 3GABA 4IFDG 2AXYA 4JVYA 1ZZJA 4FJSA 2ANNA 2G8YA 2HH3A 2ZQEA 1X9ZA 1S03G 4LF5H 3UOEA 2VQFH 2X06A 2CWHA 4DV1H 4BA2I 3GR5A 1N32H 4QMFB 4YHHH 1IBLH 4LFBH 2PY9A 1HNZH 4DR3H 4B3TH 2D9IA 4B8CD 1WVNA 5DT9A 1TUAA 1UG8A 2BL5A 5IT9W 3T1HH 1J5EH 2P2RA 1N34H 5LMNH 5FLXW 2M6QA 1WTJA 3L7ZC 4X66H 2UXCH 2NN6G 5LL6b 2ZM6H 1IBMH 4DR4H 1VBIA 1WE8A 3KDKA 5A2QW 4DR1H 4B3SH 2DGRA 1J5KA 1FKAH 1ZZKA 4DV3H 1AN7A 2JA9A 4JI2H 4BA1I 1X0AA 2JZXA 2OPUA 4X62H 2Z0SA 2UXBH 1ZTGA 2FPHX 3OETA 4DUYH 4LF4H 2F4VH 4LFAH 1EC6A 1J4WA 1I94H 2FFMA 2Y3MA 2LTMA 4NZRM 4EC5A 4B3RH 2CTMA 2CTEA 3T1YH 1VIHA 4X64H 2MJHA 2BA0A 3GKUA 4DR2H 2OPVA 4NXMH 1XNRH 2K1HA 4E9JA 2QNDA 4DR7H 4OO1G 4YY3H 4JI1H 1X4NA 1F0XA 4X65H 4DV2H 4JI6H 5K36G 1DT4A 5LMUH 1XNQH 4LF8H 4K0KH 3V69A 4OD6A 2LTLA 3J80W 4DV7H 1V8CA 5BR8H 3OTOH 4DR5H 1ODHA 2HHHH 3J81W 2UUCH 4PDBA 1XMQH 3KDGA 4DV6H 2O4CA 1DTJA 4JV5H 4FJUA 3RF2A 1K1GA 2ANRA 2E5LH 1I6UA 2JEAI 2PT7G 1NXUA 3EZJA 4NZTM 3I0PA 4LIJA 3FAUA 2UUAH 4JVHA 2CTLA 4JI5H 1WHRA 1XMOH 1IBKH
chains in the Genus database with same CATH topology
2JEBI 4NBQA 2BA0A 5C0XG 1KHMA 4B8TA 2OPVA 1TUAA 2BL5A 3VKEA 2QNDA 2CTKA 2PQUA 2MJHA 4AIMA 2P2RA 4WALA 4OO1G 1VIGA 3U1KA 5JEAG 1X4NA 3L7ZC 2FMRA 2NN6G 4IFDG 5K36G 1DT4A 2CPQA 2AXYA 4JVYA 3V69A 1ZZJA 1WE8A 2ANNA 3AEVB 2HH3A 2JVZA 2E3UA 2DGRA 1J5KA 1ZZKA 2JA9A 2HH2A 4BA1I 1DTJA 2JZXA 2OPUA 4AM3A 1ZZIA 1K1GA 1X4MA 2Z0SA 2ANRA 4BA2I 2JE6I 1ZTGA 2JEAI 4QMFB 1EC6A 2YQRA 4LIJA 2CTJA 2CTFA 1J4WA 2PY9A 4JVHA 2CTLA 4WANA 2CTMA 2CTEA 1VIHA 1WVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEB I;  4NBQ A;  2BA0 A;  5C0X G;  1KHM A;  4B8T A;  2OPV A;  1TUA A;  2BL5 A;  3VKE A;  2QND A;  2CTK A;  2PQU A;  2MJH A;  4AIM A;  2P2R A;  4WAL A;  4OO1 G;  1VIG A;  3U1K A;  5JEA G;  1X4N A;  3L7Z C;  2FMR A;  2NN6 G;  4IFD G;  5K36 G;  1DT4 A;  2CPQ A;  2AXY A;  4JVY A;  3V69 A;  1ZZJ A;  1WE8 A;  2ANN A;  3AEV B;  2HH3 A;  2JVZ A;  2E3U A;  2DGR A;  1J5K A;  1ZZK A;  2JA9 A;  2HH2 A;  4BA1 I;  1DTJ A;  2JZX A;  2OPU A;  4AM3 A;  1ZZI A;  1K1G A;  1X4M A;  2Z0S A;  2ANR A;  4BA2 I;  2JE6 I;  1ZTG A;  2JEA I;  4QMF B;  1EC6 A;  2YQR A;  4LIJ A;  2CTJ A;  2CTF A;  1J4W A;  2PY9 A;  4JVH A;  2CTL A;  4WAN A;  2CTM A;  2CTE A;  1VIH A;  1WVN A; 
#chains in the Genus database with same CATH topology
 2JEB I;  4G08 A;  4LFC H;  1KHM A;  1XRH A;  2UUB H;  1N33 H;  4AIM A;  4WAL A;  1FJG H;  3SB1 A;  4JI3 H;  5JEA G;  4LF6 H;  2M8W A;  4DR6 H;  2FMR A;  2CPQ A;  3QD7 X;  4GKJ H;  1Z2I A;  1HNX H;  3J7A K;  4GKK H;  1MSZ A;  3AEV B;  4KHP H;  3JAM W;  2JVZ A;  4JYA H;  1N36 H;  2E3U A;  4B3M H;  4DV4 H;  1SEI A;  2VQE H;  2HH2 A;  4JI8 H;  4LF7 H;  2CWF A;  1HNW H;  4AM3 A;  4H8A A;  1PQX A;  1ZZI A;  1X4M A;  4DV0 H;  4LF9 H;  2JE6 I;  2LF0 A;  2YQR A;  3NCV A;  2CTJ A;  2CTF A;  4WAN A;  1HR0 H;  3OSS D;  2UXD H;  4NBQ A;  2UU9 H;  4JI0 H;  5C0X G;  4DUZ H;  4B8T A;  4AQY H;  4JI4 H;  1S20 A;  3VKE A;  4NXN H;  5IWA H;  2CTK A;  2PQU A;  4OX9 H;  1V9N A;  1VIG A;  4DV5 H;  4OCH A;  3U1K A;  4JI7 H;  2VKC A;  2A1S A;  2CPM A;  2LRR A;  3GAB A;  4IFD G;  2AXY A;  4JVY A;  1ZZJ A;  4FJS A;  2ANN A;  2G8Y A;  2HH3 A;  2ZQE A;  1X9Z A;  1S03 G;  4LF5 H;  3UOE A;  2VQF H;  2X06 A;  2CWH A;  4DV1 H;  4BA2 I;  3GR5 A;  1N32 H;  4QMF B;  4YHH H;  1IBL H;  4LFB H;  2PY9 A;  1HNZ H;  4DR3 H;  4B3T H;  2D9I A;  4B8C D;  1WVN A;  5DT9 A;  1TUA A;  1UG8 A;  2BL5 A;  5IT9 W;  3T1H H;  1J5E H;  2P2R A;  1N34 H;  5LMN H;  5FLX W;  2M6Q A;  1WTJ A;  3L7Z C;  4X66 H;  2UXC H;  2NN6 G;  5LL6 b;  2ZM6 H;  1IBM H;  4DR4 H;  1VBI A;  1WE8 A;  3KDK A;  5A2Q W;  4DR1 H;  4B3S H;  2DGR A;  1J5K A;  1FKA H;  1ZZK A;  4DV3 H;  1AN7 A;  2JA9 A;  4JI2 H;  4BA1 I;  1X0A A;  2JZX A;  2OPU A;  4X62 H;  2Z0S A;  2UXB H;  1ZTG A;  2FPH X;  3OET A;  4DUY H;  4LF4 H;  2F4V H;  4LFA H;  1EC6 A;  1J4W A;  1I94 H;  2FFM A;  2Y3M A;  2LTM A;  4NZR M;  4EC5 A;  4B3R H;  2CTM A;  2CTE A;  3T1Y H;  1VIH A;  4X64 H;  2MJH A;  2BA0 A;  3GKU A;  4DR2 H;  2OPV A;  4NXM H;  1XNR H;  2K1H A;  4E9J A;  2QND A;  4DR7 H;  4OO1 G;  4YY3 H;  4JI1 H;  1X4N A;  1F0X A;  4X65 H;  4DV2 H;  4JI6 H;  5K36 G;  1DT4 A;  5LMU H;  1XNQ H;  4LF8 H;  4K0K H;  3V69 A;  4OD6 A;  2LTL A;  3J80 W;  4DV7 H;  1V8C A;  5BR8 H;  3OTO H;  4DR5 H;  1ODH A;  2HHH H;  3J81 W;  2UUC H;  4PDB A;  1XMQ H;  3KDG A;  4DV6 H;  2O4C A;  1DTJ A;  4JV5 H;  4FJU A;  3RF2 A;  1K1G A;  2ANR A;  2E5L H;  1I6U A;  2JEA I;  2PT7 G;  1NXU A;  3EZJ A;  4NZT M;  3I0P A;  4LIJ A;  3FAU A;  2UUA H;  4JVH A;  2CTL A;  4JI5 H;  1WHR A;  1XMO H;  1IBK H; 
#chains in the Genus database with same CATH homology
 2JEB I;  4NBQ A;  2BA0 A;  5C0X G;  1KHM A;  4B8T A;  2OPV A;  1TUA A;  2BL5 A;  3VKE A;  2QND A;  2CTK A;  2PQU A;  2MJH A;  4AIM A;  2P2R A;  4WAL A;  4OO1 G;  1VIG A;  3U1K A;  5JEA G;  1X4N A;  3L7Z C;  2FMR A;  2NN6 G;  4IFD G;  5K36 G;  1DT4 A;  2CPQ A;  2AXY A;  4JVY A;  3V69 A;  1ZZJ A;  1WE8 A;  2ANN A;  3AEV B;  2HH3 A;  2JVZ A;  2E3U A;  2DGR A;  1J5K A;  1ZZK A;  2JA9 A;  2HH2 A;  4BA1 I;  1DTJ A;  2JZX A;  2OPU A;  4AM3 A;  1ZZI A;  1K1G A;  1X4M A;  2Z0S A;  2ANR A;  4BA2 I;  2JE6 I;  1ZTG A;  2JEA I;  4QMF B;  1EC6 A;  2YQR A;  4LIJ A;  2CTJ A;  2CTF A;  1J4W A;  2PY9 A;  4JVH A;  2CTL A;  4WAN A;  2CTM A;  2CTE A;  1VIH A;  1WVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...