1X4MA

Solution structure of kh domain in far upstream element binding protein 1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
94
structure length
94
Chain Sequence
b'GSSGSSGHGDGPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEMVLELIRDQGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Far upstream element binding protein 1
molecule tags Rna binding protein
source organism Mus musculus
publication title Solution structure of KH domain in Far upstream element binding protein 1
rcsb
total genus 12
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1x4mA01
2PQUA 5K36G 2ANRA 4QMFB 4BA2I 4OO1G 1J4WA 1EC6A 4AM3A 4LIJA 3L7ZC 4WANA 4IFDG 3V69A 2HH2A 2CTFA 1J5KA 2JZXA 1DTJA 2Z0SA 2JVZA 1X4MA 1TUAA 2CTLA 2CTMA 4AIMA 5JEAG 4WALA 2AXYA 2JEAI 1ZZKA 1ZZIA 2DGRA 1X4NA 3VKEA 1VIHA 2MJHA 1KHMA 2PY9A 2BA0A 4NBQA 2JE6I 2NN6G 1WVNA 1ZZJA 3U1KA 2ANNA 2CTJA 4BA1I 4JVYA 2CPQA 3AEVB 2OPVA 2YQRA 1K1GA 2P2RA 2CTEA 2JEBI 4JVHA 2OPUA 1ZTGA 1VIGA 2BL5A 1WE8A 2CTKA 2FMRA 5C0XG 2JA9A 2HH3A 2E3UA 4B8TA 1DT4A 2QNDA
chains in the Genus database with same CATH superfamily
5LL6b 4YY3H 2PQUA 4QMFB 1XRHA 4WANA 4JI0H 1F0XA 3KDGA 1XMOH 2HH2A 2JZXA 2JVZA 4AQYH 4DR4H 1TUAA 4DV1H 4KHPH 1I94H 1N33H 4DUYH 4X66H 4DV2H 1X4NA 2DGRA 2VQFH 2G8YA 1ZZJA 4JI2H 2UUAH 3EZJA 2CTJA 4K0KH 2PT7G 4JI8H 4LFBH 2OPVA 2YQRA 4DR3H 1XNQH 1K1GA 4OD6A 5LMNH 4H8AA 4NXMH 4JVHA 5IT9W 2LF0A 1VIGA 4B3RH 2FMRA 4B3SH 2JA9A 4JV5H 4JYAH 1DT4A 2QNDA 4DR5H 5K36G 4PDBA 4OX9H 3KDKA 4OCHA 2O4CA 4LF7H 4FJUA 1FKAH 3V69A 2CTFA 2HHHH 4LF9H 1J5KA 2A1SA 4EC5A 3OTOH 1DTJA 2CWFA 1HNZH 4YHHH 4DUZH 1X4MA 1XMQH 1IBMH 2E5LH 1X9ZA 3GABA 3GKUA 2CTMA 3NCVA 3UOEA 4AIMA 5JEAG 3J81W 4WALA 4JI4H 2JEAI 1ZZKA 1ZZIA 3VKEA 4DR1H 1VIHA 4JI6H 4GKJH 4DR7H 4DR6H 3GR5A 3J7AK 2ANNA 4NZRM 3OETA 4BA1I 4FJSA 2F4VH 1S03G 1N34H 1FJGH 2VKCA 4LF5H 5FLXW 4DV6H 4NXNH 1WHRA 1MSZA 3QD7X 3RF2A 2ZQEA 1V9NA 3I0PA 4DR2H 1PQXA 2UXCH 2ANRA 1J4WA 1EC6A 4LIJA 4G08A 4DV0H 1XNRH 1I6UA 1HNWH 4LFAH 2LRRA 1HNXH 4GKKH 2CWHA 2CTLA 3T1HH 2D9IA 2CPMA 2MJHA 5DT9A 4X64H 4X65H 2BA0A 4NBQA 5BR8H 4JI3H 4DV5H 1HR0H 1WVNA 3OSSD 3U1KA 4JI1H 4LF8H 4X62H 2CPQA 3FAUA 2Y3MA 3AEVB 4JVYA 4B8CD 2VQEH 2M6QA 3J80W 2P2RA 2CTEA 2JEBI 2OPUA 4LFCH 2CTKA 2BL5A 1WE8A 1SEIA 4DV7H 2HH3A 2E3UA 1UG8A 1IBKH 4NZTM 4B3MH 1S20A 4OO1G 4BA2I 1X0AA 2LTLA 4JI7H 1Z2IA 1IBLH 4AM3A 3L7ZC 2UU9H 4B3TH 1VBIA 2LTMA 4JI5H 2Z0SA 4DV4H 2M8WA 4LF6H 3T1YH 2UXBH 5A2QW 5LMUH 2AXYA 1KHMA 2ZM6H 4DV3H 2UXDH 2JE6I 2NN6G 1WTJA 2X06A 1ODHA 1V8CA 2UUBH 2K1HA 1J5EH 2FFMA 2UUCH 1AN7A 4E9JA 3SB1A 1N32H 5IWAH 1N36H 1ZTGA 2FPHX 4B8TA 4IFDG 5C0XG 1NXUA 3JAMW 2PY9A 4LF4H
chains in the Genus database with same CATH topology
2PQUA 5K36G 2ANRA 4QMFB 4BA2I 4OO1G 1J4WA 1EC6A 4AM3A 4LIJA 3L7ZC 4WANA 4IFDG 3V69A 2HH2A 2CTFA 1J5KA 2JZXA 1DTJA 2Z0SA 2JVZA 1X4MA 1TUAA 2CTLA 2CTMA 4AIMA 5JEAG 4WALA 2AXYA 2JEAI 1ZZKA 1ZZIA 2DGRA 1X4NA 3VKEA 1VIHA 2MJHA 1KHMA 2PY9A 2BA0A 4NBQA 2JE6I 2NN6G 1WVNA 1ZZJA 3U1KA 2ANNA 2CTJA 4BA1I 4JVYA 2CPQA 3AEVB 2OPVA 2YQRA 1K1GA 2P2RA 2CTEA 2JEBI 4JVHA 2OPUA 1ZTGA 1VIGA 2BL5A 1WE8A 2CTKA 2FMRA 5C0XG 2JA9A 2HH3A 2E3UA 4B8TA 1DT4A 2QNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQU A;  5K36 G;  2ANR A;  4QMF B;  4BA2 I;  4OO1 G;  1J4W A;  1EC6 A;  4AM3 A;  4LIJ A;  3L7Z C;  4WAN A;  4IFD G;  3V69 A;  2HH2 A;  2CTF A;  1J5K A;  2JZX A;  1DTJ A;  2Z0S A;  2JVZ A;  1X4M A;  1TUA A;  2CTL A;  2CTM A;  4AIM A;  5JEA G;  4WAL A;  2AXY A;  2JEA I;  1ZZK A;  1ZZI A;  2DGR A;  1X4N A;  3VKE A;  1VIH A;  2MJH A;  1KHM A;  2PY9 A;  2BA0 A;  4NBQ A;  2JE6 I;  2NN6 G;  1WVN A;  1ZZJ A;  3U1K A;  2ANN A;  2CTJ A;  4BA1 I;  4JVY A;  2CPQ A;  3AEV B;  2OPV A;  2YQR A;  1K1G A;  2P2R A;  2CTE A;  2JEB I;  4JVH A;  2OPU A;  1ZTG A;  1VIG A;  2BL5 A;  1WE8 A;  2CTK A;  2FMR A;  5C0X G;  2JA9 A;  2HH3 A;  2E3U A;  4B8T A;  1DT4 A;  2QND A; 
#chains in the Genus database with same CATH topology
 5LL6 b;  4YY3 H;  2PQU A;  4QMF B;  1XRH A;  4WAN A;  4JI0 H;  1F0X A;  3KDG A;  1XMO H;  2HH2 A;  2JZX A;  2JVZ A;  4AQY H;  4DR4 H;  1TUA A;  4DV1 H;  4KHP H;  1I94 H;  1N33 H;  4DUY H;  4X66 H;  4DV2 H;  1X4N A;  2DGR A;  2VQF H;  2G8Y A;  1ZZJ A;  4JI2 H;  2UUA H;  3EZJ A;  2CTJ A;  4K0K H;  2PT7 G;  4JI8 H;  4LFB H;  2OPV A;  2YQR A;  4DR3 H;  1XNQ H;  1K1G A;  4OD6 A;  5LMN H;  4H8A A;  4NXM H;  4JVH A;  5IT9 W;  2LF0 A;  1VIG A;  4B3R H;  2FMR A;  4B3S H;  2JA9 A;  4JV5 H;  4JYA H;  1DT4 A;  2QND A;  4DR5 H;  5K36 G;  4PDB A;  4OX9 H;  3KDK A;  4OCH A;  2O4C A;  4LF7 H;  4FJU A;  1FKA H;  3V69 A;  2CTF A;  2HHH H;  4LF9 H;  1J5K A;  2A1S A;  4EC5 A;  3OTO H;  1DTJ A;  2CWF A;  1HNZ H;  4YHH H;  4DUZ H;  1X4M A;  1XMQ H;  1IBM H;  2E5L H;  1X9Z A;  3GAB A;  3GKU A;  2CTM A;  3NCV A;  3UOE A;  4AIM A;  5JEA G;  3J81 W;  4WAL A;  4JI4 H;  2JEA I;  1ZZK A;  1ZZI A;  3VKE A;  4DR1 H;  1VIH A;  4JI6 H;  4GKJ H;  4DR7 H;  4DR6 H;  3GR5 A;  3J7A K;  2ANN A;  4NZR M;  3OET A;  4BA1 I;  4FJS A;  2F4V H;  1S03 G;  1N34 H;  1FJG H;  2VKC A;  4LF5 H;  5FLX W;  4DV6 H;  4NXN H;  1WHR A;  1MSZ A;  3QD7 X;  3RF2 A;  2ZQE A;  1V9N A;  3I0P A;  4DR2 H;  1PQX A;  2UXC H;  2ANR A;  1J4W A;  1EC6 A;  4LIJ A;  4G08 A;  4DV0 H;  1XNR H;  1I6U A;  1HNW H;  4LFA H;  2LRR A;  1HNX H;  4GKK H;  2CWH A;  2CTL A;  3T1H H;  2D9I A;  2CPM A;  2MJH A;  5DT9 A;  4X64 H;  4X65 H;  2BA0 A;  4NBQ A;  5BR8 H;  4JI3 H;  4DV5 H;  1HR0 H;  1WVN A;  3OSS D;  3U1K A;  4JI1 H;  4LF8 H;  4X62 H;  2CPQ A;  3FAU A;  2Y3M A;  3AEV B;  4JVY A;  4B8C D;  2VQE H;  2M6Q A;  3J80 W;  2P2R A;  2CTE A;  2JEB I;  2OPU A;  4LFC H;  2CTK A;  2BL5 A;  1WE8 A;  1SEI A;  4DV7 H;  2HH3 A;  2E3U A;  1UG8 A;  1IBK H;  4NZT M;  4B3M H;  1S20 A;  4OO1 G;  4BA2 I;  1X0A A;  2LTL A;  4JI7 H;  1Z2I A;  1IBL H;  4AM3 A;  3L7Z C;  2UU9 H;  4B3T H;  1VBI A;  2LTM A;  4JI5 H;  2Z0S A;  4DV4 H;  2M8W A;  4LF6 H;  3T1Y H;  2UXB H;  5A2Q W;  5LMU H;  2AXY A;  1KHM A;  2ZM6 H;  4DV3 H;  2UXD H;  2JE6 I;  2NN6 G;  1WTJ A;  2X06 A;  1ODH A;  1V8C A;  2UUB H;  2K1H A;  1J5E H;  2FFM A;  2UUC H;  1AN7 A;  4E9J A;  3SB1 A;  1N32 H;  5IWA H;  1N36 H;  1ZTG A;  2FPH X;  4B8T A;  4IFD G;  5C0X G;  1NXU A;  3JAM W;  2PY9 A;  4LF4 H; 
#chains in the Genus database with same CATH homology
 2PQU A;  5K36 G;  2ANR A;  4QMF B;  4BA2 I;  4OO1 G;  1J4W A;  1EC6 A;  4AM3 A;  4LIJ A;  3L7Z C;  4WAN A;  4IFD G;  3V69 A;  2HH2 A;  2CTF A;  1J5K A;  2JZX A;  1DTJ A;  2Z0S A;  2JVZ A;  1X4M A;  1TUA A;  2CTL A;  2CTM A;  4AIM A;  5JEA G;  4WAL A;  2AXY A;  2JEA I;  1ZZK A;  1ZZI A;  2DGR A;  1X4N A;  3VKE A;  1VIH A;  2MJH A;  1KHM A;  2PY9 A;  2BA0 A;  4NBQ A;  2JE6 I;  2NN6 G;  1WVN A;  1ZZJ A;  3U1K A;  2ANN A;  2CTJ A;  4BA1 I;  4JVY A;  2CPQ A;  3AEV B;  2OPV A;  2YQR A;  1K1G A;  2P2R A;  2CTE A;  2JEB I;  4JVH A;  2OPU A;  1ZTG A;  1VIG A;  2BL5 A;  1WE8 A;  2CTK A;  2FMR A;  5C0X G;  2JA9 A;  2HH3 A;  2E3U A;  4B8T A;  1DT4 A;  2QND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...