1X4MA

Solution structure of kh domain in far upstream element binding protein 1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
94
structure length
94
Chain Sequence
GSSGSSGHGDGPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEMVLELIRDQGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Far upstream element binding protein 1
publication title Solution structure of KH domain in Far upstream element binding protein 1
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 12
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1x4mA01
2CTJA 2JEAI 2CTEA 2OPVA 5C0XG 4IFDG 1WVNA 3VKEA 4QMFB 2NN6G 1ZTGA 2AXYA 4AM3A 1EC6A 2Z0SA 4JVYA 1TUAA 2CTLA 2MJHA 1WE8A 4B8TA 1J5KA 3AEVB 2ANNA 2E3UA 4BA2I 2BA0A 4BA1I 2JZXA 3L7ZC 1ZZIA 2ANRA 2YQRA 2HH3A 3V69A 2CTFA 1ZZKA 4WANA 2JVZA 1X4NA 4LIJA 4WALA 2PQUA 2JA9A 5K36G 2PY9A 2HH2A 2P2RA 1K1GA 2DGRA 4AIMA 4NBQA 4JVHA 5JEAG 1X4MA 1DT4A 2JE6I 1J4WA 2QNDA 1VIHA 2CPQA 2JEBI 4OO1G 2FMRA 2CTKA 1ZZJA 1DTJA 1VIGA 2BL5A 1KHMA 2OPUA 3U1KA 2CTMA
chains in the Genus database with same CATH superfamily
2CTJA 2JEAI 5C0XG 4QMFB 3QD7X 4AM3A 4JYAH 2FPHX 2CTLA 4DUYH 3GR5A 1WE8A 3KDKA 2LTLA 4LF5H 4JI7H 4X66H 4BA2I 2LRRA 4E9JA 5LMNH 1FJGH 4DR4H 1I6UA 4B3TH 1S20A 3EZJA 5FLXW 4DV7H 1X4NA 3UOEA 2F4VH 4DR6H 4JI4H 2ZQEA 3JAMW 4DV3H 4DV2H 2UXDH 3SB1A 4AQYH 2E5LH 4LF4H 1X4MA 2VQEH 4JI1H 2QNDA 1MSZA 2CPQA 2JEBI 1ZZJA 1IBKH 4JV5H 2UUAH 2Y3MA 2BL5A 2LTMA 1KHMA 2OPUA 4X65H 1SEIA 4DV4H 3FAUA 1XNQH 2UXBH 2CTEA 1UG8A 3J81W 1ZTGA 3VKEA 2G8YA 2AXYA 1HR0H 4DV0H 2LF0A 4B3SH 4X64H 2MJHA 3KDGA 4B8TA 1AN7A 4JI5H 2ZM6H 2X06A 2E3UA 1XMQH 2JZXA 5A2QW 1ZZIA 2PT7G 2D9IA 1N34H 1HNWH 1ZZKA 4X62H 4LF9H 1PQXA 4H8AA 4WANA 1X9ZA 4GKJH 2UU9H 2VKCA 2P2RA 4DV6H 4NZRM 4AIMA 4NBQA 1N32H 2CWHA 4B8CD 4EC5A 1J4WA 2K1HA 2UUBH 2A1SA 1ODHA 1DTJA 5IWAH 2FFMA 1VBIA 4OCHA 2UUCH 4DR7H 3U1KA 5K36G 4LFCH 1FKAH 1WHRA 4JI6H 4IFDG 2O4CA 1F0XA 4FJSA 3GABA 3OSSD 1EC6A 3GKUA 4YHHH 1HNZH 4JI8H 1V9NA 5LL6b 4NZTM 1XNRH 3RF2A 2ANNA 3L7ZC 2HHHH 4JI2H 4JI0H 2JVZA 4DV1H 4LIJA 5BR8H 2JA9A 1NXUA 2PY9A 4NXMH 4B3RH 3T1YH 2DGRA 4JVHA 5JEAG 4LF7H 1DT4A 1IBLH 1VIHA 1V8CA 3OETA 4LF6H 4OO1G 1VIGA 3NCVA 3J80W 1S03G 1Z2IA 4WALA 1HNXH 2CTMA 2CPMA 2OPVA 4YY3H 1WVNA 1I94H 2NN6G 2M8WA 3I0PA 3OTOH 2Z0SA 4DR3H 4JVYA 1TUAA 4NXNH 4OX9H 1J5KA 4DUZH 1IBMH 2M6QA 1XMOH 1J5EH 3AEVB 1N33H 4PDBA 2BA0A 4BA1I 4DR2H 2ANRA 2YQRA 2HH3A 3V69A 2CTFA 1XRHA 4LF8H 4GKKH 3T1HH 4LFBH 2PQUA 2VQFH 5DT9A 2HH2A 4B3MH 1K1GA 4LFAH 1WTJA 2CWFA 4OD6A 4DR5H 2JE6I 5LMUH 2UXCH 4DR1H 2FMRA 2CTKA 4K0KH 4G08A 4KHPH 5IT9W 1X0AA 4JI3H 1N36H 3J7AK 4DV5H 4FJUA
chains in the Genus database with same CATH topology
2CTJA 2JEAI 2CTEA 2OPVA 5C0XG 4IFDG 1WVNA 3VKEA 4QMFB 2NN6G 1ZTGA 2AXYA 4AM3A 1EC6A 2Z0SA 4JVYA 1TUAA 2CTLA 2MJHA 1WE8A 4B8TA 1J5KA 3AEVB 2ANNA 2E3UA 4BA2I 2BA0A 4BA1I 2JZXA 3L7ZC 1ZZIA 2ANRA 2YQRA 2HH3A 3V69A 2CTFA 1ZZKA 4WANA 2JVZA 1X4NA 4LIJA 4WALA 2PQUA 2JA9A 5K36G 2PY9A 2HH2A 2P2RA 1K1GA 2DGRA 4AIMA 4NBQA 4JVHA 5JEAG 1X4MA 1DT4A 2JE6I 1J4WA 2QNDA 1VIHA 2CPQA 2JEBI 4OO1G 2FMRA 2CTKA 1ZZJA 1DTJA 1VIGA 2BL5A 1KHMA 2OPUA 3U1KA 2CTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTJ A;  2JEA I;  2CTE A;  2OPV A;  5C0X G;  4IFD G;  1WVN A;  3VKE A;  4QMF B;  2NN6 G;  1ZTG A;  2AXY A;  4AM3 A;  1EC6 A;  2Z0S A;  4JVY A;  1TUA A;  2CTL A;  2MJH A;  1WE8 A;  4B8T A;  1J5K A;  3AEV B;  2ANN A;  2E3U A;  4BA2 I;  2BA0 A;  4BA1 I;  2JZX A;  3L7Z C;  1ZZI A;  2ANR A;  2YQR A;  2HH3 A;  3V69 A;  2CTF A;  1ZZK A;  4WAN A;  2JVZ A;  1X4N A;  4LIJ A;  4WAL A;  2PQU A;  2JA9 A;  5K36 G;  2PY9 A;  2HH2 A;  2P2R A;  1K1G A;  2DGR A;  4AIM A;  4NBQ A;  4JVH A;  5JEA G;  1X4M A;  1DT4 A;  2JE6 I;  1J4W A;  2QND A;  1VIH A;  2CPQ A;  2JEB I;  4OO1 G;  2FMR A;  2CTK A;  1ZZJ A;  1DTJ A;  1VIG A;  2BL5 A;  1KHM A;  2OPU A;  3U1K A;  2CTM A; 
#chains in the Genus database with same CATH topology
 2CTJ A;  2JEA I;  5C0X G;  4QMF B;  3QD7 X;  4AM3 A;  4JYA H;  2FPH X;  2CTL A;  4DUY H;  3GR5 A;  1WE8 A;  3KDK A;  2LTL A;  4LF5 H;  4JI7 H;  4X66 H;  4BA2 I;  2LRR A;  4E9J A;  5LMN H;  1FJG H;  4DR4 H;  1I6U A;  4B3T H;  1S20 A;  3EZJ A;  5FLX W;  4DV7 H;  1X4N A;  3UOE A;  2F4V H;  4DR6 H;  4JI4 H;  2ZQE A;  3JAM W;  4DV3 H;  4DV2 H;  2UXD H;  3SB1 A;  4AQY H;  2E5L H;  4LF4 H;  1X4M A;  2VQE H;  4JI1 H;  2QND A;  1MSZ A;  2CPQ A;  2JEB I;  1ZZJ A;  1IBK H;  4JV5 H;  2UUA H;  2Y3M A;  2BL5 A;  2LTM A;  1KHM A;  2OPU A;  4X65 H;  1SEI A;  4DV4 H;  3FAU A;  1XNQ H;  2UXB H;  2CTE A;  1UG8 A;  3J81 W;  1ZTG A;  3VKE A;  2G8Y A;  2AXY A;  1HR0 H;  4DV0 H;  2LF0 A;  4B3S H;  4X64 H;  2MJH A;  3KDG A;  4B8T A;  1AN7 A;  4JI5 H;  2ZM6 H;  2X06 A;  2E3U A;  1XMQ H;  2JZX A;  5A2Q W;  1ZZI A;  2PT7 G;  2D9I A;  1N34 H;  1HNW H;  1ZZK A;  4X62 H;  4LF9 H;  1PQX A;  4H8A A;  4WAN A;  1X9Z A;  4GKJ H;  2UU9 H;  2VKC A;  2P2R A;  4DV6 H;  4NZR M;  4AIM A;  4NBQ A;  1N32 H;  2CWH A;  4B8C D;  4EC5 A;  1J4W A;  2K1H A;  2UUB H;  2A1S A;  1ODH A;  1DTJ A;  5IWA H;  2FFM A;  1VBI A;  4OCH A;  2UUC H;  4DR7 H;  3U1K A;  5K36 G;  4LFC H;  1FKA H;  1WHR A;  4JI6 H;  4IFD G;  2O4C A;  1F0X A;  4FJS A;  3GAB A;  3OSS D;  1EC6 A;  3GKU A;  4YHH H;  1HNZ H;  4JI8 H;  1V9N A;  5LL6 b;  4NZT M;  1XNR H;  3RF2 A;  2ANN A;  3L7Z C;  2HHH H;  4JI2 H;  4JI0 H;  2JVZ A;  4DV1 H;  4LIJ A;  5BR8 H;  2JA9 A;  1NXU A;  2PY9 A;  4NXM H;  4B3R H;  3T1Y H;  2DGR A;  4JVH A;  5JEA G;  4LF7 H;  1DT4 A;  1IBL H;  1VIH A;  1V8C A;  3OET A;  4LF6 H;  4OO1 G;  1VIG A;  3NCV A;  3J80 W;  1S03 G;  1Z2I A;  4WAL A;  1HNX H;  2CTM A;  2CPM A;  2OPV A;  4YY3 H;  1WVN A;  1I94 H;  2NN6 G;  2M8W A;  3I0P A;  3OTO H;  2Z0S A;  4DR3 H;  4JVY A;  1TUA A;  4NXN H;  4OX9 H;  1J5K A;  4DUZ H;  1IBM H;  2M6Q A;  1XMO H;  1J5E H;  3AEV B;  1N33 H;  4PDB A;  2BA0 A;  4BA1 I;  4DR2 H;  2ANR A;  2YQR A;  2HH3 A;  3V69 A;  2CTF A;  1XRH A;  4LF8 H;  4GKK H;  3T1H H;  4LFB H;  2PQU A;  2VQF H;  5DT9 A;  2HH2 A;  4B3M H;  1K1G A;  4LFA H;  1WTJ A;  2CWF A;  4OD6 A;  4DR5 H;  2JE6 I;  5LMU H;  2UXC H;  4DR1 H;  2FMR A;  2CTK A;  4K0K H;  4G08 A;  4KHP H;  5IT9 W;  1X0A A;  4JI3 H;  1N36 H;  3J7A K;  4DV5 H;  4FJU A; 
#chains in the Genus database with same CATH homology
 2CTJ A;  2JEA I;  2CTE A;  2OPV A;  5C0X G;  4IFD G;  1WVN A;  3VKE A;  4QMF B;  2NN6 G;  1ZTG A;  2AXY A;  4AM3 A;  1EC6 A;  2Z0S A;  4JVY A;  1TUA A;  2CTL A;  2MJH A;  1WE8 A;  4B8T A;  1J5K A;  3AEV B;  2ANN A;  2E3U A;  4BA2 I;  2BA0 A;  4BA1 I;  2JZX A;  3L7Z C;  1ZZI A;  2ANR A;  2YQR A;  2HH3 A;  3V69 A;  2CTF A;  1ZZK A;  4WAN A;  2JVZ A;  1X4N A;  4LIJ A;  4WAL A;  2PQU A;  2JA9 A;  5K36 G;  2PY9 A;  2HH2 A;  2P2R A;  1K1G A;  2DGR A;  4AIM A;  4NBQ A;  4JVH A;  5JEA G;  1X4M A;  1DT4 A;  2JE6 I;  1J4W A;  2QND A;  1VIH A;  2CPQ A;  2JEB I;  4OO1 G;  2FMR A;  2CTK A;  1ZZJ A;  1DTJ A;  1VIG A;  2BL5 A;  1KHM A;  2OPU A;  3U1K A;  2CTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...