2Y3MA

Structure of the extra-membranous domain of the secretin hofq from actinobacillus actinomycetemcomitans
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
165
structure length
135
Chain Sequence
QNPVFSIRLKQAPLVPTLQQLALAHNTNLIIDTVSLQLENVDLDQLFRSVAKIKQLDLWQENGIYYFTKAQLNTATIKLHFAKASEVMKSLTGGSGSLLSPNGSITFDDRSNLLLIQDEPRSVRNIKKLIKELDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords PROTEIN TRANSPORT PROTEIN HOFQ
publication title The Extra-Membranous Domains of the Competence Protein Hofq Show DNA Binding, Flexibility and a Shared Fold with Type I Kh Domains.
pubmed doi rcsb
source organism Aggregatibacter actinomycetemcomitans
total genus 26
structure length 135
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2y3mA01
3.30.1370.130 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2y3mA02
4E9JA 4G08A 3EZJA 3GR5A 3OSSD 4EC5A 2Y3MA
chains in the Genus database with same CATH superfamily
4JI7H 3J81W 4LFAH 2MJHA 5LL6b 4AQYH 1X0AA 4JI4H 4X64H 2CTJA 4DV3H 4JI6H 5BR8H 4YY3H 1N32H 2CTKA 4DR1H 4JVHA 2UUCH 2PQUA 2ANNA 1AN7A 3QD7X 2E5LH 4LF9H 2O4CA 3GKUA 3JAMW 1X4MA 4JI5H 2CTMA 1S20A 2OPUA 4LF6H 2A1SA 5A2QW 3FAUA 1ZTGA 4B3TH 4OX9H 4X66H 5IT9W 4X65H 4NXNH 4DV5H 2JA9A 1V8CA 4LF7H 1VIHA 2DGRA 4DV7H 2CWFA 4OD6A 4JI0H 3OETA 3J80W 2M6QA 4JI3H 1HNZH 4JI8H 1DT4A 2JE6I 1VIGA 4AIMA 5LMNH 4NXMH 4DV2H 4LF5H 1XRHA 1NXUA 4OO1G 2JEAI 4NZTM 4WALA 5LMUH 1F0XA 2CTFA 1S03G 2BL5A 2Y3MA 1N34H 1XNQH 1EC6A 3U1KA 2UUBH 4E9JA 4B3MH 4LFBH 1HR0H 1UG8A 4GKKH 2NN6G 4DR5H 4LF4H 1FKAH 4FJUA 1TUAA 4DV4H 5DT9A 4BA1I 4DR3H 3KDGA 3T1HH 1PQXA 2X06A 5IWAH 2FFMA 3GABA 2LTLA 1I6UA 4B8TA 2AXYA 4DUZH 5FLXW 4YHHH 4DV0H 4JVYA 4LIJA 1ODHA 4DV1H 4B3SH 4LF8H 1ZZIA 1IBLH 4EC5A 2HH2A 2M8WA 3L7ZC 1J5EH 1N33H 1ZZKA 1VBIA 4QMFB 1HNWH 4K0KH 4JV5H 1KHMA 2CTLA 2UXCH 2ZM6H 2HH3A 2JEBI 2E3UA 3OSSD 4DUYH 4BA2I 2CTEA 1MSZA 2VQEH 1N36H 2YQRA 1WHRA 1X9ZA 2CPMA 2QNDA 2FMRA 1K1GA 2UU9H 2LRRA 2P2RA 2VKCA 1V9NA 2ZQEA 4WANA 3VKEA 5JEAG 2BA0A 1DTJA 2F4VH 4NZRM 1ZZJA 2PY9A 2K1HA 3GR5A 2UXDH 5K36G 2VQFH 4DR2H 3AEVB 3OTOH 5C0XG 4G08A 4X62H 2HHHH 4GKJH 4JYAH 2G8YA 2OPVA 4FJSA 3RF2A 3T1YH 4DR6H 1WTJA 1XNRH 3I0PA 2ANRA 2UUAH 1FJGH 4B3RH 1WVNA 2JZXA 1IBKH 3KDKA 3V69A 3UOEA 2CPQA 2CWHA 1XMQH 4H8AA 4DR4H 2FPHX 4KHPH 1Z2IA 4JI2H 1X4NA 2Z0SA 1XMOH 4DR7H 2JVZA 4AM3A 4LFCH 3NCVA 2PT7G 1I94H 3J7AK 4PDBA 1HNXH 2LF0A 4B8CD 1J5KA 2LTMA 2D9IA 1IBMH 1SEIA 4IFDG 1WE8A 3EZJA 4JI1H 4NBQA 4DV6H 4OCHA 1J4WA 3SB1A 2UXBH
chains in the Genus database with same CATH topology
4JI7H 3J81W 4LFAH 5LL6b 4AQYH 4JI4H 4X64H 4DV3H 4JI6H 5BR8H 4YY3H 1N32H 4DR1H 2UUCH 1AN7A 3QD7X 2E5LH 4LF9H 2O4CA 3JAMW 4JI5H 4LF6H 5A2QW 3FAUA 4B3TH 4OX9H 4X66H 5IT9W 4X65H 4NXNH 4DV5H 4LF7H 4DV7H 4JI0H 4OD6A 3OETA 3J80W 4JI3H 1HNZH 4JI8H 5LMNH 4NXMH 4DV2H 4LF5H 4NZTM 5LMUH 1F0XA 1S03G 2Y3MA 1XNQH 1N34H 2UUBH 4E9JA 4B3MH 4LFBH 1HR0H 4GKKH 4DR5H 4LF4H 1FKAH 4DV4H 5DT9A 4DR3H 3KDGA 3T1HH 5IWAH 3GABA 1I6UA 4DUZH 5FLXW 4YHHH 4DV0H 1ODHA 4DV1H 4B3SH 4LF8H 1IBLH 1J5EH 1N33H 1HNWH 4K0KH 4JV5H 2UXCH 2ZM6H 3OSSD 4DUYH 1N36H 2VQEH 1X9ZA 2UU9H 2VKCA 2ZQEA 2F4VH 4NZRM 3GR5A 2UXDH 2VQFH 4DR2H 3OTOH 4G08A 4X62H 2HHHH 4GKJH 4JYAH 3T1YH 3RF2A 4DR6H 1XNRH 3SB1A 2UUAH 1FJGH 4B3RH 1IBKH 3KDKA 1XMQH 4DR4H 4KHPH 2FPHX 4JI2H 1XMOH 4DR7H 4LFCH 3NCVA 2PT7G 1I94H 3J7AK 4PDBA 1HNXH 2LF0A 4B8CD 1IBMH 2D9IA 1SEIA 3EZJA 4JI1H 4DV6H 4OCHA 4EC5A 2UXBH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E9J A;  4G08 A;  3EZJ A;  3GR5 A;  3OSS D;  4EC5 A;  2Y3M A; 
#chains in the Genus database with same CATH topology
 4JI7 H;  3J81 W;  4LFA H;  2MJH A;  5LL6 b;  4AQY H;  1X0A A;  4JI4 H;  4X64 H;  2CTJ A;  4DV3 H;  4JI6 H;  5BR8 H;  4YY3 H;  1N32 H;  2CTK A;  4DR1 H;  4JVH A;  2UUC H;  2PQU A;  2ANN A;  1AN7 A;  3QD7 X;  2E5L H;  4LF9 H;  2O4C A;  3GKU A;  3JAM W;  1X4M A;  4JI5 H;  2CTM A;  1S20 A;  2OPU A;  4LF6 H;  2A1S A;  5A2Q W;  3FAU A;  1ZTG A;  4B3T H;  4OX9 H;  4X66 H;  5IT9 W;  4X65 H;  4NXN H;  4DV5 H;  2JA9 A;  1V8C A;  4LF7 H;  1VIH A;  2DGR A;  4DV7 H;  2CWF A;  4OD6 A;  4JI0 H;  3OET A;  3J80 W;  2M6Q A;  4JI3 H;  1HNZ H;  4JI8 H;  1DT4 A;  2JE6 I;  1VIG A;  4AIM A;  5LMN H;  4NXM H;  4DV2 H;  4LF5 H;  1XRH A;  1NXU A;  4OO1 G;  2JEA I;  4NZT M;  4WAL A;  5LMU H;  1F0X A;  2CTF A;  1S03 G;  2BL5 A;  2Y3M A;  1N34 H;  1XNQ H;  1EC6 A;  3U1K A;  2UUB H;  4E9J A;  4B3M H;  4LFB H;  1HR0 H;  1UG8 A;  4GKK H;  2NN6 G;  4DR5 H;  4LF4 H;  1FKA H;  4FJU A;  1TUA A;  4DV4 H;  5DT9 A;  4BA1 I;  4DR3 H;  3KDG A;  3T1H H;  1PQX A;  2X06 A;  5IWA H;  2FFM A;  3GAB A;  2LTL A;  1I6U A;  4B8T A;  2AXY A;  4DUZ H;  5FLX W;  4YHH H;  4DV0 H;  4JVY A;  4LIJ A;  1ODH A;  4DV1 H;  4B3S H;  4LF8 H;  1ZZI A;  1IBL H;  4EC5 A;  2HH2 A;  2M8W A;  3L7Z C;  1J5E H;  1N33 H;  1ZZK A;  1VBI A;  4QMF B;  1HNW H;  4K0K H;  4JV5 H;  1KHM A;  2CTL A;  2UXC H;  2ZM6 H;  2HH3 A;  2JEB I;  2E3U A;  3OSS D;  4DUY H;  4BA2 I;  2CTE A;  1MSZ A;  2VQE H;  1N36 H;  2YQR A;  1WHR A;  1X9Z A;  2CPM A;  2QND A;  2FMR A;  1K1G A;  2UU9 H;  2LRR A;  2P2R A;  2VKC A;  1V9N A;  2ZQE A;  4WAN A;  3VKE A;  5JEA G;  2BA0 A;  1DTJ A;  2F4V H;  4NZR M;  1ZZJ A;  2PY9 A;  2K1H A;  3GR5 A;  2UXD H;  5K36 G;  2VQF H;  4DR2 H;  3AEV B;  3OTO H;  5C0X G;  4G08 A;  4X62 H;  2HHH H;  4GKJ H;  4JYA H;  2G8Y A;  2OPV A;  4FJS A;  3RF2 A;  3T1Y H;  4DR6 H;  1WTJ A;  1XNR H;  3I0P A;  2ANR A;  2UUA H;  1FJG H;  4B3R H;  1WVN A;  2JZX A;  1IBK H;  3KDK A;  3V69 A;  3UOE A;  2CPQ A;  2CWH A;  1XMQ H;  4H8A A;  4DR4 H;  2FPH X;  4KHP H;  1Z2I A;  4JI2 H;  1X4N A;  2Z0S A;  1XMO H;  4DR7 H;  2JVZ A;  4AM3 A;  4LFC H;  3NCV A;  2PT7 G;  1I94 H;  3J7A K;  4PDB A;  1HNX H;  2LF0 A;  4B8C D;  1J5K A;  2LTM A;  2D9I A;  1IBM H;  1SEI A;  4IFD G;  1WE8 A;  3EZJ A;  4JI1 H;  4NBQ A;  4DV6 H;  4OCH A;  1J4W A;  3SB1 A;  2UXB H; 
#chains in the Genus database with same CATH homology
 4JI7 H;  3J81 W;  4LFA H;  5LL6 b;  4AQY H;  4JI4 H;  4X64 H;  4DV3 H;  4JI6 H;  5BR8 H;  4YY3 H;  1N32 H;  4DR1 H;  2UUC H;  1AN7 A;  3QD7 X;  2E5L H;  4LF9 H;  2O4C A;  3JAM W;  4JI5 H;  4LF6 H;  5A2Q W;  3FAU A;  4B3T H;  4OX9 H;  4X66 H;  5IT9 W;  4X65 H;  4NXN H;  4DV5 H;  4LF7 H;  4DV7 H;  4JI0 H;  4OD6 A;  3OET A;  3J80 W;  4JI3 H;  1HNZ H;  4JI8 H;  5LMN H;  4NXM H;  4DV2 H;  4LF5 H;  4NZT M;  5LMU H;  1F0X A;  1S03 G;  2Y3M A;  1XNQ H;  1N34 H;  2UUB H;  4E9J A;  4B3M H;  4LFB H;  1HR0 H;  4GKK H;  4DR5 H;  4LF4 H;  1FKA H;  4DV4 H;  5DT9 A;  4DR3 H;  3KDG A;  3T1H H;  5IWA H;  3GAB A;  1I6U A;  4DUZ H;  5FLX W;  4YHH H;  4DV0 H;  1ODH A;  4DV1 H;  4B3S H;  4LF8 H;  1IBL H;  1J5E H;  1N33 H;  1HNW H;  4K0K H;  4JV5 H;  2UXC H;  2ZM6 H;  3OSS D;  4DUY H;  1N36 H;  2VQE H;  1X9Z A;  2UU9 H;  2VKC A;  2ZQE A;  2F4V H;  4NZR M;  3GR5 A;  2UXD H;  2VQF H;  4DR2 H;  3OTO H;  4G08 A;  4X62 H;  2HHH H;  4GKJ H;  4JYA H;  3T1Y H;  3RF2 A;  4DR6 H;  1XNR H;  3SB1 A;  2UUA H;  1FJG H;  4B3R H;  1IBK H;  3KDK A;  1XMQ H;  4DR4 H;  4KHP H;  2FPH X;  4JI2 H;  1XMO H;  4DR7 H;  4LFC H;  3NCV A;  2PT7 G;  1I94 H;  3J7A K;  4PDB A;  1HNX H;  2LF0 A;  4B8C D;  1IBM H;  2D9I A;  1SEI A;  3EZJ A;  4JI1 H;  4DV6 H;  4OCH A;  4EC5 A;  2UXB H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...