2Y3MA

Structure of the extra-membranous domain of the secretin hofq from actinobacillus actinomycetemcomitans
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
165
structure length
135
Chain Sequence
QNPVFSIRLKQAPLVPTLQQLALAHNTNLIIDTVSLQLENVDLDQLFRSVAKIKQLDLWQENGIYYFTKAQLNTATIKLHFAKASEVMKSLTGGSGSLLSPNGSITFDDRSNLLLIQDEPRSVRNIKKLIKELDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN TRANSPORT PROTEIN HOFQ
publication title The Extra-Membranous Domains of the Competence Protein Hofq Show DNA Binding, Flexibility and a Shared Fold with Type I Kh Domains.
pubmed doi rcsb
source organism Aggregatibacter actinomycetemcomitans
molecule tags Transport protein
total genus 26
structure length 135
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2y3mA01
3.30.1370.130 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2y3mA02
3OSSD 3EZJA 4G08A 4E9JA 4EC5A 3GR5A 2Y3MA
chains in the Genus database with same CATH superfamily
2CTFA 2UUBH 4YY3H 4B3TH 1J4WA 4JI7H 2BA0A 2CTMA 4DUZH 2ZQEA 3GR5A 4EC5A 4X66H 4DR7H 4DV0H 1N33H 4FJUA 2M6QA 1XNQH 1N32H 1J5KA 4NXNH 2JEBI 4WANA 2G8YA 2FPHX 3FAUA 1HNZH 4QMFB 1F0XA 1S20A 2CTEA 2LTLA 4DV6H 4B3RH 3JAMW 2K1HA 2HH2A 2HHHH 1IBKH 1PQXA 2PY9A 2Y3MA 2JE6I 5JEAG 5IWAH 2FMRA 1WE8A 2D9IA 2OPVA 3EZJA 2LF0A 4E9JA 2CTKA 4DR6H 4JI1H 4NZRM 1ZZJA 1UG8A 2JA9A 2ANRA 4LF4H 2DGRA 4DR4H 3OTOH 3U1KA 2UXDH 5LMUH 1NXUA 4JI8H 4KHPH 2PQUA 3QD7X 3OSSD 1TUAA 4G08A 2P2RA 2UXCH 2A1SA 2M8WA 1EC6A 1VIGA 2HH3A 2YQRA 4X64H 2O4CA 4NXMH 2ANNA 4X62H 3KDGA 4DR3H 1DT4A 5FLXW 4DR5H 2JEAI 5C0XG 4DUYH 4JV5H 1FJGH 1X0AA 2CPMA 2JZXA 3UOEA 4OCHA 3J7AK 4H8AA 4DV5H 2X06A 2UUCH 3L7ZC 4LFAH 1VBIA 1N34H 2VKCA 2CWFA 1ODHA 1WVNA 2LRRA 4WALA 2JVZA 2PT7G 1X9ZA 1I94H 1FKAH 4LFBH 2NN6G 1IBLH 3SB1A 5DT9A 2FFMA 3J80W 1XMQH 1ZZIA 2UU9H 4LF7H 2LTMA 4B3MH 4DR1H 1IBMH 4GKKH 4DV4H 3T1YH 1V8CA 4JI2H 1MSZA 3T1HH 4B3SH 1Z2IA 2CTJA 4AIMA 1ZTGA 2OPUA 5BR8H 4DV7H 1XMOH 5K36G 5LMNH 4DV2H 1DTJA 4IFDG 1WHRA 5LL6b 4BA2I 1HNXH 3I0PA 1X4MA 3GABA 4OO1G 4JI0H 4LF8H 4LF9H 2Z0SA 4OX9H 4DR2H 4JI3H 3GKUA 2AXYA 4YHHH 1SEIA 1HR0H 2E3UA 3J81W 2MJHA 1X4NA 1J5EH 3NCVA 1N36H 4LF6H 1XRHA 1WTJA 2VQEH 2UUAH 4LFCH 3VKEA 3V69A 5A2QW 4DV3H 4LIJA 4JI4H 4K0KH 2F4VH 1AN7A 4JI6H 1I6UA 4LF5H 2BL5A 1KHMA 2CTLA 1S03G 3KDKA 4B8TA 4AM3A 4JYAH 4NBQA 1HNWH 3RF2A 4PDBA 4B8CD 1ZZKA 4X65H 1VIHA 2CPQA 2QNDA 4BA1I 1XNRH 4JVHA 2ZM6H 2VQFH 2E5LH 4GKJH 4OD6A 4JI5H 4NZTM 1V9NA 4JVYA 3OETA 4DV1H 2CWHA 4AQYH 1K1GA 2UXBH 4FJSA 3AEVB 5IT9W
chains in the Genus database with same CATH topology
2UUBH 4YY3H 4B3TH 4JI7H 4DUZH 2ZQEA 3GR5A 4EC5A 4X66H 4DR7H 4DV0H 1N33H 1XNQH 1N32H 4NXNH 2FPHX 3FAUA 1HNZH 1F0XA 4DV6H 4B3RH 3JAMW 2HHHH 1IBKH 2Y3MA 5IWAH 2D9IA 3EZJA 4DR6H 2LF0A 4E9JA 4JI1H 4NZRM 4LF4H 4DR4H 3OTOH 2UXDH 5LMUH 4JI8H 4KHPH 3QD7X 3OSSD 4G08A 2UXCH 4X64H 2O4CA 4NXMH 4X62H 3KDGA 4DR3H 5FLXW 4DR5H 4DUYH 4JV5H 1FJGH 4OCHA 3J7AK 4DV5H 2UUCH 4LFAH 1N34H 2VKCA 1ODHA 4LFBH 1I94H 2PT7G 1X9ZA 1FKAH 1IBLH 3SB1A 5DT9A 3J80W 1XMQH 2UU9H 4LF7H 4B3MH 4DR1H 1IBMH 4GKKH 4DV4H 3T1YH 4JI2H 3T1HH 4B3SH 5BR8H 4DV7H 1XMOH 5LMNH 4DV2H 5LL6b 1HNXH 3GABA 4JI0H 4LF8H 4LF9H 4OX9H 4DR2H 4JI3H 4YHHH 1SEIA 1HR0H 3J81W 1J5EH 3NCVA 1N36H 4LF6H 2VQEH 2UUAH 4LFCH 5A2QW 4DV3H 4JI4H 4K0KH 2F4VH 1AN7A 4JI6H 1I6UA 4LF5H 1S03G 3KDKA 4JYAH 1HNWH 3RF2A 4PDBA 4B8CD 4X65H 1XNRH 2ZM6H 2VQFH 2E5LH 4GKJH 4OD6A 4JI5H 4NZTM 3OETA 4DV1H 4AQYH 2UXBH 5IT9W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSS D;  3EZJ A;  4G08 A;  4E9J A;  4EC5 A;  3GR5 A;  2Y3M A; 
#chains in the Genus database with same CATH topology
 2CTF A;  2UUB H;  4YY3 H;  4B3T H;  1J4W A;  4JI7 H;  2BA0 A;  2CTM A;  4DUZ H;  2ZQE A;  3GR5 A;  4EC5 A;  4X66 H;  4DR7 H;  4DV0 H;  1N33 H;  4FJU A;  2M6Q A;  1XNQ H;  1N32 H;  1J5K A;  4NXN H;  2JEB I;  4WAN A;  2G8Y A;  2FPH X;  3FAU A;  1HNZ H;  4QMF B;  1F0X A;  1S20 A;  2CTE A;  2LTL A;  4DV6 H;  4B3R H;  3JAM W;  2K1H A;  2HH2 A;  2HHH H;  1IBK H;  1PQX A;  2PY9 A;  2Y3M A;  2JE6 I;  5JEA G;  5IWA H;  2FMR A;  1WE8 A;  2D9I A;  2OPV A;  3EZJ A;  2LF0 A;  4E9J A;  2CTK A;  4DR6 H;  4JI1 H;  4NZR M;  1ZZJ A;  1UG8 A;  2JA9 A;  2ANR A;  4LF4 H;  2DGR A;  4DR4 H;  3OTO H;  3U1K A;  2UXD H;  5LMU H;  1NXU A;  4JI8 H;  4KHP H;  2PQU A;  3QD7 X;  3OSS D;  1TUA A;  4G08 A;  2P2R A;  2UXC H;  2A1S A;  2M8W A;  1EC6 A;  1VIG A;  2HH3 A;  2YQR A;  4X64 H;  2O4C A;  4NXM H;  2ANN A;  4X62 H;  3KDG A;  4DR3 H;  1DT4 A;  5FLX W;  4DR5 H;  2JEA I;  5C0X G;  4DUY H;  4JV5 H;  1FJG H;  1X0A A;  2CPM A;  2JZX A;  3UOE A;  4OCH A;  3J7A K;  4H8A A;  4DV5 H;  2X06 A;  2UUC H;  3L7Z C;  4LFA H;  1VBI A;  1N34 H;  2VKC A;  2CWF A;  1ODH A;  1WVN A;  2LRR A;  4WAL A;  2JVZ A;  2PT7 G;  1X9Z A;  1I94 H;  1FKA H;  4LFB H;  2NN6 G;  1IBL H;  3SB1 A;  5DT9 A;  2FFM A;  3J80 W;  1XMQ H;  1ZZI A;  2UU9 H;  4LF7 H;  2LTM A;  4B3M H;  4DR1 H;  1IBM H;  4GKK H;  4DV4 H;  3T1Y H;  1V8C A;  4JI2 H;  1MSZ A;  3T1H H;  4B3S H;  1Z2I A;  2CTJ A;  4AIM A;  1ZTG A;  2OPU A;  5BR8 H;  4DV7 H;  1XMO H;  5K36 G;  5LMN H;  4DV2 H;  1DTJ A;  4IFD G;  1WHR A;  5LL6 b;  4BA2 I;  1HNX H;  3I0P A;  1X4M A;  3GAB A;  4OO1 G;  4JI0 H;  4LF8 H;  4LF9 H;  2Z0S A;  4OX9 H;  4DR2 H;  4JI3 H;  3GKU A;  2AXY A;  4YHH H;  1SEI A;  1HR0 H;  2E3U A;  3J81 W;  2MJH A;  1X4N A;  1J5E H;  3NCV A;  1N36 H;  4LF6 H;  1XRH A;  1WTJ A;  2VQE H;  2UUA H;  4LFC H;  3VKE A;  3V69 A;  5A2Q W;  4DV3 H;  4LIJ A;  4JI4 H;  4K0K H;  2F4V H;  1AN7 A;  4JI6 H;  1I6U A;  4LF5 H;  2BL5 A;  1KHM A;  2CTL A;  1S03 G;  3KDK A;  4B8T A;  4AM3 A;  4JYA H;  4NBQ A;  1HNW H;  3RF2 A;  4PDB A;  4B8C D;  1ZZK A;  4X65 H;  1VIH A;  2CPQ A;  2QND A;  4BA1 I;  1XNR H;  4JVH A;  2ZM6 H;  2VQF H;  2E5L H;  4GKJ H;  4OD6 A;  4JI5 H;  4NZT M;  1V9N A;  4JVY A;  3OET A;  4DV1 H;  2CWH A;  4AQY H;  1K1G A;  2UXB H;  4FJS A;  3AEV B;  5IT9 W; 
#chains in the Genus database with same CATH homology
 2UUB H;  4YY3 H;  4B3T H;  4JI7 H;  4DUZ H;  2ZQE A;  3GR5 A;  4EC5 A;  4X66 H;  4DR7 H;  4DV0 H;  1N33 H;  1XNQ H;  1N32 H;  4NXN H;  2FPH X;  3FAU A;  1HNZ H;  1F0X A;  4DV6 H;  4B3R H;  3JAM W;  2HHH H;  1IBK H;  2Y3M A;  5IWA H;  2D9I A;  3EZJ A;  4DR6 H;  2LF0 A;  4E9J A;  4JI1 H;  4NZR M;  4LF4 H;  4DR4 H;  3OTO H;  2UXD H;  5LMU H;  4JI8 H;  4KHP H;  3QD7 X;  3OSS D;  4G08 A;  2UXC H;  4X64 H;  2O4C A;  4NXM H;  4X62 H;  3KDG A;  4DR3 H;  5FLX W;  4DR5 H;  4DUY H;  4JV5 H;  1FJG H;  4OCH A;  3J7A K;  4DV5 H;  2UUC H;  4LFA H;  1N34 H;  2VKC A;  1ODH A;  4LFB H;  1I94 H;  2PT7 G;  1X9Z A;  1FKA H;  1IBL H;  3SB1 A;  5DT9 A;  3J80 W;  1XMQ H;  2UU9 H;  4LF7 H;  4B3M H;  4DR1 H;  1IBM H;  4GKK H;  4DV4 H;  3T1Y H;  4JI2 H;  3T1H H;  4B3S H;  5BR8 H;  4DV7 H;  1XMO H;  5LMN H;  4DV2 H;  5LL6 b;  1HNX H;  3GAB A;  4JI0 H;  4LF8 H;  4LF9 H;  4OX9 H;  4DR2 H;  4JI3 H;  4YHH H;  1SEI A;  1HR0 H;  3J81 W;  1J5E H;  3NCV A;  1N36 H;  4LF6 H;  2VQE H;  2UUA H;  4LFC H;  5A2Q W;  4DV3 H;  4JI4 H;  4K0K H;  2F4V H;  1AN7 A;  4JI6 H;  1I6U A;  4LF5 H;  1S03 G;  3KDK A;  4JYA H;  1HNW H;  3RF2 A;  4PDB A;  4B8C D;  4X65 H;  1XNR H;  2ZM6 H;  2VQF H;  2E5L H;  4GKJ H;  4OD6 A;  4JI5 H;  4NZT M;  3OET A;  4DV1 H;  4AQY H;  2UXB H;  5IT9 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...