2Y3MA

Structure of the extra-membranous domain of the secretin hofq from actinobacillus actinomycetemcomitans
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
165
structure length
135
Chain Sequence
b'QNPVFSIRLKQAPLVPTLQQLALAHNTNLIIDTVSLQLENVDLDQLFRSVAKIKQLDLWQENGIYYFTKAQLNTATIKLHFAKASEVMKSLTGGSGSLLSPNGSITFDDRSNLLLIQDEPRSVRNIKKLIKELDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN TRANSPORT PROTEIN HOFQ
molecule tags Transport protein
source organism Aggregatibacter actinomycetemcomitans
publication title The Extra-Membranous Domains of the Competence Protein Hofq Show DNA Binding, Flexibility and a Shared Fold with Type I Kh Domains.
pubmed doi rcsb
total genus 26
structure length 135
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2y3mA01
3.30.1370.130 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2y3mA02
3OSSD 2Y3MA 3GR5A 4E9JA 4EC5A 3EZJA 4G08A
chains in the Genus database with same CATH superfamily
4DV6H 3OTOH 3T1HH 1X4NA 4LF9H 4DR2H 1WE8A 5LL6b 4JVHA 3J80W 1X4MA 1I6UA 1DTJA 4X62H 4GKJH 3VKEA 2P2RA 1N32H 2HH3A 1J5KA 4BA2I 4LFBH 4H8AA 4DV5H 1F0XA 3KDKA 4KHPH 1ZZKA 4AQYH 5K36G 1V8CA 3L7ZC 2UXDH 2JE6I 4X66H 4DV4H 4B3RH 2CPQA 1J4WA 4JI4H 4OX9H 5IT9W 1IBMH 2PQUA 2UU9H 1WHRA 2AXYA 1XMQH 4JI5H 4NXNH 2ANNA 2M6QA 4IFDG 2UUAH 1TUAA 2DGRA 3J81W 3KDGA 3OETA 1DT4A 3EZJA 2CTFA 1WVNA 4OCHA 4DV1H 4LF5H 1HNWH 2PY9A 3GABA 4NZRM 2OPVA 4OO1G 4DR1H 2FFMA 3RF2A 3T1YH 4JI8H 5A2QW 4JV5H 4LFAH 1IBLH 2NN6G 4G08A 2F4VH 4DUYH 1ZTGA 3FAUA 3AEVB 1J5EH 4PDBA 2OPUA 4DR7H 1ZZJA 4YHHH 4B3TH 1MSZA 2JA9A 4GKKH 2HHHH 4DV2H 4DV7H 2E5LH 4JYAH 2JEAI 2CTMA 2Y3MA 3SB1A 4JI6H 4DV3H 1K1GA 4JI2H 4LIJA 1VIGA 2UUCH 4LFCH 4WANA 2ZM6H 4JI1H 2G8YA 2FPHX 2VKCA 2BA0A 4OD6A 3V69A 2UXBH 4LF7H 2CTKA 2PT7G 4AM3A 4BA1I 2JEBI 4X65H 4FJSA 2FMRA 3NCVA 5DT9A 1HNXH 1ZZIA 3J7AK 4YY3H 1AN7A 1FJGH 1XNRH 4DR3H 2CWHA 1V9NA 4LF6H 4AIMA 4JI3H 3UOEA 1S03G 5C0XG 1X0AA 2JVZA 3OSSD 4B8CD 1XMOH 2LF0A 4JI7H 5IWAH 2VQFH 1VIHA 2O4CA 4NZTM 1XRHA 2JZXA 1PQXA 2CTEA 1IBKH 4DR6H 3GKUA 5FLXW 2CWFA 2LRRA 1UG8A 3U1KA 3JAMW 1NXUA 1WTJA 4DR5H 5BR8H 4QMFB 4FJUA 4B3SH 1KHMA 4DR4H 2ANRA 1S20A 3I0PA 2K1HA 4LF8H 4B3MH 5JEAG 2A1SA 1FKAH 4JVYA 4NBQA 3GR5A 1N36H 4K0KH 2QNDA 2BL5A 4E9JA 4B8TA 4DV0H 2LTMA 4JI0H 1VBIA 2CTJA 2M8WA 2D9IA 1HR0H 2ZQEA 2UUBH 1ODHA 4WALA 1X9ZA 2E3UA 2YQRA 5LMNH 2HH2A 4X64H 2Z0SA 3QD7X 1Z2IA 1N33H 1HNZH 2UXCH 2MJHA 5LMUH 1XNQH 4EC5A 2X06A 1N34H 2CPMA 4LF4H 1I94H 4NXMH 2VQEH 2CTLA 1EC6A 1SEIA 2LTLA 4DUZH
chains in the Genus database with same CATH topology
4DV6H 3OTOH 3T1HH 4LF9H 4DR2H 5LL6b 3J80W 1I6UA 4X62H 4GKJH 1N32H 4LFBH 4DV5H 3KDKA 1F0XA 4KHPH 4AQYH 2UXDH 4X66H 4DV4H 4B3RH 4JI4H 4OX9H 5IT9W 1IBMH 2UU9H 1XMQH 4JI5H 4NXNH 2UUAH 3J81W 3OETA 4OCHA 4DV1H 3KDGA 3EZJA 4LF5H 1HNWH 3GABA 4NZRM 4DR1H 4JI8H 3RF2A 3T1YH 5A2QW 4JV5H 4LFAH 1IBLH 4G08A 2F4VH 4DUYH 3FAUA 1J5EH 4PDBA 4DR7H 4YHHH 4B3TH 4GKKH 2HHHH 4DV2H 4DV7H 2E5LH 4JYAH 2Y3MA 3SB1A 4JI6H 4DV3H 4JI2H 2UUCH 4LFCH 2ZM6H 4JI1H 4OD6A 2FPHX 2VKCA 2UXBH 4LF7H 2PT7G 4X65H 3NCVA 5DT9A 1HNXH 3J7AK 4YY3H 1AN7A 1FJGH 1XNRH 4DR3H 4LF6H 4JI3H 1S03G 3OSSD 4B8CD 1XMOH 2LF0A 4JI7H 5IWAH 2VQFH 4NZTM 2O4CA 1IBKH 4DR6H 5FLXW 3JAMW 4DR5H 5BR8H 4B3SH 4DR4H 4LF8H 4B3MH 1FKAH 3GR5A 1N36H 4K0KH 4E9JA 4DV0H 4JI0H 2D9IA 1HR0H 2ZQEA 2UUBH 1ODHA 1X9ZA 5LMNH 4X64H 3QD7X 1N33H 1HNZH 2UXCH 5LMUH 1XNQH 4EC5A 1N34H 4LF4H 1I94H 4NXMH 2VQEH 1SEIA 4DUZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSS D;  2Y3M A;  3GR5 A;  4E9J A;  4EC5 A;  3EZJ A;  4G08 A; 
#chains in the Genus database with same CATH topology
 4DV6 H;  3OTO H;  3T1H H;  1X4N A;  4LF9 H;  4DR2 H;  1WE8 A;  5LL6 b;  4JVH A;  3J80 W;  1X4M A;  1I6U A;  1DTJ A;  4X62 H;  4GKJ H;  3VKE A;  2P2R A;  1N32 H;  2HH3 A;  1J5K A;  4BA2 I;  4LFB H;  4H8A A;  4DV5 H;  1F0X A;  3KDK A;  4KHP H;  1ZZK A;  4AQY H;  5K36 G;  1V8C A;  3L7Z C;  2UXD H;  2JE6 I;  4X66 H;  4DV4 H;  4B3R H;  2CPQ A;  1J4W A;  4JI4 H;  4OX9 H;  5IT9 W;  1IBM H;  2PQU A;  2UU9 H;  1WHR A;  2AXY A;  1XMQ H;  4JI5 H;  4NXN H;  2ANN A;  2M6Q A;  4IFD G;  2UUA H;  1TUA A;  2DGR A;  3J81 W;  3KDG A;  3OET A;  1DT4 A;  3EZJ A;  2CTF A;  1WVN A;  4OCH A;  4DV1 H;  4LF5 H;  1HNW H;  2PY9 A;  3GAB A;  4NZR M;  2OPV A;  4OO1 G;  4DR1 H;  2FFM A;  3RF2 A;  3T1Y H;  4JI8 H;  5A2Q W;  4JV5 H;  4LFA H;  1IBL H;  2NN6 G;  4G08 A;  2F4V H;  4DUY H;  1ZTG A;  3FAU A;  3AEV B;  1J5E H;  4PDB A;  2OPU A;  4DR7 H;  1ZZJ A;  4YHH H;  4B3T H;  1MSZ A;  2JA9 A;  4GKK H;  2HHH H;  4DV2 H;  4DV7 H;  2E5L H;  4JYA H;  2JEA I;  2CTM A;  2Y3M A;  3SB1 A;  4JI6 H;  4DV3 H;  1K1G A;  4JI2 H;  4LIJ A;  1VIG A;  2UUC H;  4LFC H;  4WAN A;  2ZM6 H;  4JI1 H;  2G8Y A;  2FPH X;  2VKC A;  2BA0 A;  4OD6 A;  3V69 A;  2UXB H;  4LF7 H;  2CTK A;  2PT7 G;  4AM3 A;  4BA1 I;  2JEB I;  4X65 H;  4FJS A;  2FMR A;  3NCV A;  5DT9 A;  1HNX H;  1ZZI A;  3J7A K;  4YY3 H;  1AN7 A;  1FJG H;  1XNR H;  4DR3 H;  2CWH A;  1V9N A;  4LF6 H;  4AIM A;  4JI3 H;  3UOE A;  1S03 G;  5C0X G;  1X0A A;  2JVZ A;  3OSS D;  4B8C D;  1XMO H;  2LF0 A;  4JI7 H;  5IWA H;  2VQF H;  1VIH A;  2O4C A;  4NZT M;  1XRH A;  2JZX A;  1PQX A;  2CTE A;  1IBK H;  4DR6 H;  3GKU A;  5FLX W;  2CWF A;  2LRR A;  1UG8 A;  3U1K A;  3JAM W;  1NXU A;  1WTJ A;  4DR5 H;  5BR8 H;  4QMF B;  4FJU A;  4B3S H;  1KHM A;  4DR4 H;  2ANR A;  1S20 A;  3I0P A;  2K1H A;  4LF8 H;  4B3M H;  5JEA G;  2A1S A;  1FKA H;  4JVY A;  4NBQ A;  3GR5 A;  1N36 H;  4K0K H;  2QND A;  2BL5 A;  4E9J A;  4B8T A;  4DV0 H;  2LTM A;  4JI0 H;  1VBI A;  2CTJ A;  2M8W A;  2D9I A;  1HR0 H;  2ZQE A;  2UUB H;  1ODH A;  4WAL A;  1X9Z A;  2E3U A;  2YQR A;  5LMN H;  2HH2 A;  4X64 H;  2Z0S A;  3QD7 X;  1Z2I A;  1N33 H;  1HNZ H;  2UXC H;  2MJH A;  5LMU H;  1XNQ H;  4EC5 A;  2X06 A;  1N34 H;  2CPM A;  4LF4 H;  1I94 H;  4NXM H;  2VQE H;  2CTL A;  1EC6 A;  1SEI A;  2LTL A;  4DUZ H; 
#chains in the Genus database with same CATH homology
 4DV6 H;  3OTO H;  3T1H H;  4LF9 H;  4DR2 H;  5LL6 b;  3J80 W;  1I6U A;  4X62 H;  4GKJ H;  1N32 H;  4LFB H;  4DV5 H;  3KDK A;  1F0X A;  4KHP H;  4AQY H;  2UXD H;  4X66 H;  4DV4 H;  4B3R H;  4JI4 H;  4OX9 H;  5IT9 W;  1IBM H;  2UU9 H;  1XMQ H;  4JI5 H;  4NXN H;  2UUA H;  3J81 W;  3OET A;  4OCH A;  4DV1 H;  3KDG A;  3EZJ A;  4LF5 H;  1HNW H;  3GAB A;  4NZR M;  4DR1 H;  4JI8 H;  3RF2 A;  3T1Y H;  5A2Q W;  4JV5 H;  4LFA H;  1IBL H;  4G08 A;  2F4V H;  4DUY H;  3FAU A;  1J5E H;  4PDB A;  4DR7 H;  4YHH H;  4B3T H;  4GKK H;  2HHH H;  4DV2 H;  4DV7 H;  2E5L H;  4JYA H;  2Y3M A;  3SB1 A;  4JI6 H;  4DV3 H;  4JI2 H;  2UUC H;  4LFC H;  2ZM6 H;  4JI1 H;  4OD6 A;  2FPH X;  2VKC A;  2UXB H;  4LF7 H;  2PT7 G;  4X65 H;  3NCV A;  5DT9 A;  1HNX H;  3J7A K;  4YY3 H;  1AN7 A;  1FJG H;  1XNR H;  4DR3 H;  4LF6 H;  4JI3 H;  1S03 G;  3OSS D;  4B8C D;  1XMO H;  2LF0 A;  4JI7 H;  5IWA H;  2VQF H;  4NZT M;  2O4C A;  1IBK H;  4DR6 H;  5FLX W;  3JAM W;  4DR5 H;  5BR8 H;  4B3S H;  4DR4 H;  4LF8 H;  4B3M H;  1FKA H;  3GR5 A;  1N36 H;  4K0K H;  4E9J A;  4DV0 H;  4JI0 H;  2D9I A;  1HR0 H;  2ZQE A;  2UUB H;  1ODH A;  1X9Z A;  5LMN H;  4X64 H;  3QD7 X;  1N33 H;  1HNZ H;  2UXC H;  5LMU H;  1XNQ H;  4EC5 A;  1N34 H;  4LF4 H;  1I94 H;  4NXM H;  2VQE H;  1SEI A;  4DUZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...