2Y3MA

Structure of the extra-membranous domain of the secretin hofq from actinobacillus actinomycetemcomitans
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
165
structure length
135
Chain Sequence
b'QNPVFSIRLKQAPLVPTLQQLALAHNTNLIIDTVSLQLENVDLDQLFRSVAKIKQLDLWQENGIYYFTKAQLNTATIKLHFAKASEVMKSLTGGSGSLLSPNGSITFDDRSNLLLIQDEPRSVRNIKKLIKELDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN TRANSPORT PROTEIN HOFQ
publication title The Extra-Membranous Domains of the Competence Protein Hofq Show DNA Binding, Flexibility and a Shared Fold with Type I Kh Domains.
pubmed doi rcsb
source organism Aggregatibacter actinomycetemcomitans
molecule tags Transport protein
total genus 26
structure length 135
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2y3mA01
3.30.1370.130 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2y3mA02
4G08A 4E9JA 4EC5A 3GR5A 2Y3MA 3EZJA 3OSSD
chains in the Genus database with same CATH superfamily
4NZRM 4OCHA 5LMNH 4YHHH 2M6QA 1HR0H 5FLXW 1XNRH 2CWHA 4NXNH 4B8CD 2X06A 4DR1H 2ANRA 2HH3A 2FFMA 5LL6b 2UUAH 2VKCA 4OD6A 4DR4H 4LF9H 1ZZJA 2CPQA 2LTMA 3GR5A 4DV3H 4B3TH 4LF8H 2PT7G 4DV7H 4DR5H 1X4MA 4JI5H 2OPUA 3JAMW 4JVHA 1HNZH 1NXUA 3SB1A 3J80W 2M8WA 4DV4H 1VBIA 1ZTGA 3V69A 4X66H 2E5LH 4JI1H 2JA9A 4B3RH 4KHPH 4NXMH 1KHMA 4AM3A 2LTLA 4DV2H 1PQXA 4AQYH 2UUBH 5DT9A 4WALA 2P2RA 1J5KA 3QD7X 4DV5H 2DGRA 5LMUH 1WE8A 2BL5A 3EZJA 4DV6H 4B3MH 1MSZA 4X65H 4LF6H 3OTOH 4E9JA 4DR6H 4BA1I 1ZZKA 2CTFA 3J81W 3GABA 2LF0A 4DR3H 4AIMA 1FKAH 4NBQA 2Z0SA 2JEAI 4JI4H 4LF4H 1DT4A 1F0XA 1Z2IA 2QNDA 5A2QW 4YY3H 1IBMH 4DV1H 2MJHA 1IBKH 1XRHA 5IWAH 2CPMA 4NZTM 4EC5A 3T1YH 2VQFH 1K1GA 4JI0H 4JI7H 1S03G 4OX9H 2FMRA 4DUZH 1WVNA 2A1SA 4K0KH 2D9IA 3KDGA 1XNQH 3VKEA 4DV0H 4B8TA 2ANNA 1V9NA 2CWFA 3I0PA 4LFCH 4JYAH 3FAUA 4JI8H 4LF7H 2JVZA 3J7AK 1DTJA 2E3UA 5BR8H 5K36G 4B3SH 1ZZIA 1HNWH 4JV5H 2UXCH 4DR7H 2HH2A 2AXYA 4LFBH 1FJGH 3OETA 2JEBI 3KDKA 2UU9H 4H8AA 1VIGA 4JI3H 2O4CA 4GKJH 2CTJA 5IT9W 1TUAA 1WHRA 1IBLH 4JVYA 1I6UA 1EC6A 2JE6I 3T1HH 1WTJA 4G08A 4DUYH 4OO1G 1SEIA 3RF2A 1XMQH 2PQUA 1S20A 2OPVA 1I94H 4JI2H 2CTEA 3L7ZC 3NCVA 1X9ZA 1N33H 1XMOH 2HHHH 4QMFB 3U1KA 4IFDG 2JZXA 3AEVB 2UXDH 1J4WA 4BA2I 2ZQEA 4X64H 2FPHX 1AN7A 3OSSD 2LRRA 4X62H 1HNXH 4FJUA 2NN6G 2ZM6H 3UOEA 5C0XG 2BA0A 3GKUA 4GKKH 2UXBH 5JEAG 4WANA 2YQRA 2CTLA 2PY9A 1N32H 1X0AA 4FJSA 1N34H 4LFAH 4JI6H 1X4NA 2CTKA 4LF5H 4DR2H 1VIHA 1J5EH 4LIJA 1UG8A 2K1HA 1V8CA 1ODHA 2CTMA 2VQEH 2G8YA 1N36H 2Y3MA 2UUCH 4PDBA 2F4VH
chains in the Genus database with same CATH topology
4NZRM 4OCHA 5LMNH 4YHHH 1HR0H 5FLXW 1XNRH 4NXNH 4B8CD 4DR1H 5LL6b 2UUAH 2VKCA 4OD6A 4DR4H 4LF9H 4B3TH 3GR5A 4DV3H 4LF8H 2PT7G 4DV7H 4DR5H 4JI5H 3JAMW 1HNZH 3SB1A 3J80W 4DV4H 2E5LH 4JI1H 4B3RH 4KHPH 4X66H 4NXMH 4DV2H 4AQYH 2UUBH 5DT9A 3QD7X 4DV5H 5LMUH 4DV6H 3EZJA 4B3MH 4X65H 4LF6H 3OTOH 4E9JA 4DR6H 3J81W 3GABA 2LF0A 4DR3H 1FKAH 4JI4H 4LF4H 1F0XA 1IBMH 5A2QW 4YY3H 4DV1H 1IBKH 5IWAH 4NZTM 4EC5A 3T1YH 2VQFH 4JI0H 4JI7H 1S03G 4OX9H 4DUZH 4K0KH 2D9IA 3KDGA 1XNQH 4DV0H 4JYAH 4LFCH 3FAUA 4JI8H 4LF7H 3J7AK 5BR8H 4B3SH 1HNWH 4JV5H 2UXCH 4DR7H 4LFBH 1FJGH 3OETA 3KDKA 2UU9H 4JI3H 4GKJH 5IT9W 2O4CA 1IBLH 1I6UA 3T1HH 4G08A 4DUYH 1SEIA 3RF2A 1XMQH 1I94H 4JI2H 3NCVA 1X9ZA 1N33H 1XMOH 2HHHH 2UXDH 2ZQEA 4X64H 2FPHX 1AN7A 3OSSD 4X62H 1HNXH 2ZM6H 4GKKH 2UXBH 1N32H 1N34H 4LFAH 4JI6H 4LF5H 4DR2H 1J5EH 1ODHA 2VQEH 1N36H 2Y3MA 2UUCH 4PDBA 2F4VH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G08 A;  4E9J A;  4EC5 A;  3GR5 A;  2Y3M A;  3EZJ A;  3OSS D; 
#chains in the Genus database with same CATH topology
 4NZR M;  4OCH A;  5LMN H;  4YHH H;  2M6Q A;  1HR0 H;  5FLX W;  1XNR H;  2CWH A;  4NXN H;  4B8C D;  2X06 A;  4DR1 H;  2ANR A;  2HH3 A;  2FFM A;  5LL6 b;  2UUA H;  2VKC A;  4OD6 A;  4DR4 H;  4LF9 H;  1ZZJ A;  2CPQ A;  2LTM A;  3GR5 A;  4DV3 H;  4B3T H;  4LF8 H;  2PT7 G;  4DV7 H;  4DR5 H;  1X4M A;  4JI5 H;  2OPU A;  3JAM W;  4JVH A;  1HNZ H;  1NXU A;  3SB1 A;  3J80 W;  2M8W A;  4DV4 H;  1VBI A;  1ZTG A;  3V69 A;  4X66 H;  2E5L H;  4JI1 H;  2JA9 A;  4B3R H;  4KHP H;  4NXM H;  1KHM A;  4AM3 A;  2LTL A;  4DV2 H;  1PQX A;  4AQY H;  2UUB H;  5DT9 A;  4WAL A;  2P2R A;  1J5K A;  3QD7 X;  4DV5 H;  2DGR A;  5LMU H;  1WE8 A;  2BL5 A;  3EZJ A;  4DV6 H;  4B3M H;  1MSZ A;  4X65 H;  4LF6 H;  3OTO H;  4E9J A;  4DR6 H;  4BA1 I;  1ZZK A;  2CTF A;  3J81 W;  3GAB A;  2LF0 A;  4DR3 H;  4AIM A;  1FKA H;  4NBQ A;  2Z0S A;  2JEA I;  4JI4 H;  4LF4 H;  1DT4 A;  1F0X A;  1Z2I A;  2QND A;  5A2Q W;  4YY3 H;  1IBM H;  4DV1 H;  2MJH A;  1IBK H;  1XRH A;  5IWA H;  2CPM A;  4NZT M;  4EC5 A;  3T1Y H;  2VQF H;  1K1G A;  4JI0 H;  4JI7 H;  1S03 G;  4OX9 H;  2FMR A;  4DUZ H;  1WVN A;  2A1S A;  4K0K H;  2D9I A;  3KDG A;  1XNQ H;  3VKE A;  4DV0 H;  4B8T A;  2ANN A;  1V9N A;  2CWF A;  3I0P A;  4LFC H;  4JYA H;  3FAU A;  4JI8 H;  4LF7 H;  2JVZ A;  3J7A K;  1DTJ A;  2E3U A;  5BR8 H;  5K36 G;  4B3S H;  1ZZI A;  1HNW H;  4JV5 H;  2UXC H;  4DR7 H;  2HH2 A;  2AXY A;  4LFB H;  1FJG H;  3OET A;  2JEB I;  3KDK A;  2UU9 H;  4H8A A;  1VIG A;  4JI3 H;  2O4C A;  4GKJ H;  2CTJ A;  5IT9 W;  1TUA A;  1WHR A;  1IBL H;  4JVY A;  1I6U A;  1EC6 A;  2JE6 I;  3T1H H;  1WTJ A;  4G08 A;  4DUY H;  4OO1 G;  1SEI A;  3RF2 A;  1XMQ H;  2PQU A;  1S20 A;  2OPV A;  1I94 H;  4JI2 H;  2CTE A;  3L7Z C;  3NCV A;  1X9Z A;  1N33 H;  1XMO H;  2HHH H;  4QMF B;  3U1K A;  4IFD G;  2JZX A;  3AEV B;  2UXD H;  1J4W A;  4BA2 I;  2ZQE A;  4X64 H;  2FPH X;  1AN7 A;  3OSS D;  2LRR A;  4X62 H;  1HNX H;  4FJU A;  2NN6 G;  2ZM6 H;  3UOE A;  5C0X G;  2BA0 A;  3GKU A;  4GKK H;  2UXB H;  5JEA G;  4WAN A;  2YQR A;  2CTL A;  2PY9 A;  1N32 H;  1X0A A;  4FJS A;  1N34 H;  4LFA H;  4JI6 H;  1X4N A;  2CTK A;  4LF5 H;  4DR2 H;  1VIH A;  1J5E H;  4LIJ A;  1UG8 A;  2K1H A;  1V8C A;  1ODH A;  2CTM A;  2VQE H;  2G8Y A;  1N36 H;  2Y3M A;  2UUC H;  4PDB A;  2F4V H; 
#chains in the Genus database with same CATH homology
 4NZR M;  4OCH A;  5LMN H;  4YHH H;  1HR0 H;  5FLX W;  1XNR H;  4NXN H;  4B8C D;  4DR1 H;  5LL6 b;  2UUA H;  2VKC A;  4OD6 A;  4DR4 H;  4LF9 H;  4B3T H;  3GR5 A;  4DV3 H;  4LF8 H;  2PT7 G;  4DV7 H;  4DR5 H;  4JI5 H;  3JAM W;  1HNZ H;  3SB1 A;  3J80 W;  4DV4 H;  2E5L H;  4JI1 H;  4B3R H;  4KHP H;  4X66 H;  4NXM H;  4DV2 H;  4AQY H;  2UUB H;  5DT9 A;  3QD7 X;  4DV5 H;  5LMU H;  4DV6 H;  3EZJ A;  4B3M H;  4X65 H;  4LF6 H;  3OTO H;  4E9J A;  4DR6 H;  3J81 W;  3GAB A;  2LF0 A;  4DR3 H;  1FKA H;  4JI4 H;  4LF4 H;  1F0X A;  1IBM H;  5A2Q W;  4YY3 H;  4DV1 H;  1IBK H;  5IWA H;  4NZT M;  4EC5 A;  3T1Y H;  2VQF H;  4JI0 H;  4JI7 H;  1S03 G;  4OX9 H;  4DUZ H;  4K0K H;  2D9I A;  3KDG A;  1XNQ H;  4DV0 H;  4JYA H;  4LFC H;  3FAU A;  4JI8 H;  4LF7 H;  3J7A K;  5BR8 H;  4B3S H;  1HNW H;  4JV5 H;  2UXC H;  4DR7 H;  4LFB H;  1FJG H;  3OET A;  3KDK A;  2UU9 H;  4JI3 H;  4GKJ H;  5IT9 W;  2O4C A;  1IBL H;  1I6U A;  3T1H H;  4G08 A;  4DUY H;  1SEI A;  3RF2 A;  1XMQ H;  1I94 H;  4JI2 H;  3NCV A;  1X9Z A;  1N33 H;  1XMO H;  2HHH H;  2UXD H;  2ZQE A;  4X64 H;  2FPH X;  1AN7 A;  3OSS D;  4X62 H;  1HNX H;  2ZM6 H;  4GKK H;  2UXB H;  1N32 H;  1N34 H;  4LFA H;  4JI6 H;  4LF5 H;  4DR2 H;  1J5E H;  1ODH A;  2VQE H;  1N36 H;  2Y3M A;  2UUC H;  4PDB A;  2F4V H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...