2Y3MA

Structure of the extra-membranous domain of the secretin hofq from actinobacillus actinomycetemcomitans
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
165
structure length
135
Chain Sequence
QNPVFSIRLKQAPLVPTLQQLALAHNTNLIIDTVSLQLENVDLDQLFRSVAKIKQLDLWQENGIYYFTKAQLNTATIKLHFAKASEVMKSLTGGSGSLLSPNGSITFDDRSNLLLIQDEPRSVRNIKKLIKELDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Extra-Membranous Domains of the Competence Protein Hofq Show DNA Binding, Flexibility and a Shared Fold with Type I Kh Domains.
pubmed doi rcsb
source organism Aggregatibacter actinomycetemcomitans
molecule tags Transport protein
molecule keywords PROTEIN TRANSPORT PROTEIN HOFQ
total genus 26
structure length 135
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2y3mA01
3.30.1370.130 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2y3mA02
2Y3MA 3OSSD 3EZJA 4EC5A 4G08A 3GR5A 4E9JA
chains in the Genus database with same CATH superfamily
3UOEA 2E3UA 1PQXA 1ZZKA 1ODHA 4OD6A 3OTOH 4DR4H 4AQYH 1DT4A 1NXUA 4E9JA 4JI7H 4OO1G 1I94H 4AM3A 3KDKA 4LFCH 4PDBA 2O4CA 2K1HA 2G8YA 2OPVA 3GABA 2UUBH 1FKAH 2CTKA 4NXMH 4DR5H 1J4WA 2CTFA 2BL5A 2D9IA 2M6QA 2NN6G 1J5EH 4DV3H 4JI0H 2PY9A 4BA1I 4LFBH 2CPQA 3I0PA 3SB1A 4X66H 4BA2I 2F4VH 3NCVA 1S03G 4KHPH 4X64H 3OETA 1FJGH 3JAMW 3L7ZC 1V9NA 2VQEH 2UU9H 1TUAA 1XNRH 1ZZJA 4YY3H 2UUAH 1N32H 4NXNH 1Z2IA 2UUCH 1EC6A 2LF0A 1IBMH 1WTJA 2BA0A 4GKKH 3RF2A 2OPUA 2QNDA 1V8CA 2Y3MA 1N34H 5K36G 4JI1H 1VIGA 1WHRA 2AXYA 4JI6H 4G08A 2CPMA 1N33H 2CWFA 2LRRA 1IBLH 2VKCA 4DV5H 4JI8H 2ANRA 4GKJH 4IFDG 3QD7X 2CTEA 2CTLA 1XMQH 4LF9H 2ANNA 3J7AK 2UXCH 2Z0SA 2MJHA 3U1KA 3V69A 4B8CD 2HHHH 2X06A 2JZXA 5JEAG 4FJSA 1HNXH 1UG8A 5IT9W 1I6UA 2VQFH 4JVYA 4NZRM 1HR0H 4OX9H 5BR8H 5FLXW 1J5KA 1IBKH 2CWHA 2A1SA 5LMNH 4B8TA 4JI5H 3AEVB 2E5LH 2ZQEA 3VKEA 1XNQH 2JEAI 4EC5A 2JVZA 2UXDH 1K1GA 4K0KH 3FAUA 1WVNA 4WALA 4LF7H 2LTLA 1MSZA 2JA9A 3GR5A 4DUYH 1X9ZA 2FFMA 1X4NA 4JVHA 5A2QW 2HH2A 4X65H 4B3TH 4LF4H 4JYAH 5LMUH 4LIJA 4WANA 4OCHA 2JEBI 1XMOH 1X0AA 4DR7H 2CTMA 1AN7A 5C0XG 4LF8H 2LTMA 4B3SH 1X4MA 1S20A 3EZJA 1VBIA 1DTJA 1HNZH 1ZTGA 3J80W 4AIMA 4DUZH 3J81W 4DV6H 4DR2H 4JI3H 2PQUA 4DV1H 4LFAH 1F0XA 2CTJA 2PT7G 2YQRA 1HNWH 4DV4H 2M8WA 4B3RH 3OSSD 4H8AA 3T1HH 2JE6I 4NBQA 5DT9A 4B3MH 2DGRA 2P2RA 2ZM6H 4DV7H 4DR3H 3GKUA 1XRHA 4X62H 4JI2H 2UXBH 4LF6H 3KDGA 1ZZIA 4LF5H 4QMFB 3T1YH 1SEIA 4DR6H 1VIHA 4DV0H 4DR1H 4NZTM 1N36H 4YHHH 4JI4H 4FJUA 2HH3A 2FMRA 4DV2H 5IWAH 2FPHX 1KHMA 5LL6b 1WE8A 4JV5H
chains in the Genus database with same CATH topology
1ODHA 4OD6A 3OTOH 4DR4H 4AQYH 4E9JA 4JI7H 1I94H 3KDKA 4LFCH 4PDBA 2O4CA 3GABA 2UUBH 1FKAH 4NXMH 4DR5H 2D9IA 1J5EH 4DV3H 4JI0H 4LFBH 3SB1A 4X66H 2F4VH 3NCVA 1S03G 4KHPH 4X64H 3OETA 1FJGH 3JAMW 2VQEH 2UU9H 1XNRH 1N32H 4YY3H 2UUAH 4NXNH 2UUCH 2LF0A 1IBMH 4GKKH 3RF2A 2Y3MA 1N34H 4JI1H 4JI6H 4G08A 1N33H 1IBLH 4GKJH 2VKCA 4DV5H 4JI8H 3QD7X 1XMQH 4LF9H 3J7AK 2UXCH 4B8CD 2HHHH 1HNXH 5IT9W 1I6UA 2VQFH 4NZRM 1HR0H 4OX9H 5BR8H 5FLXW 1IBKH 5LMNH 4JI5H 2E5LH 2ZQEA 1XNQH 4EC5A 2UXDH 4K0KH 3FAUA 4LF7H 3GR5A 4DUYH 1X9ZA 5A2QW 4B3TH 4X65H 4LF4H 4JYAH 5LMUH 4OCHA 1XMOH 4DR7H 1AN7A 4LF8H 4B3SH 3EZJA 1HNZH 3J80W 4DUZH 3J81W 4DV6H 4DR2H 4JI3H 4DV1H 4LFAH 1F0XA 2PT7G 1HNWH 4DV4H 4B3RH 3OSSD 3T1HH 5DT9A 4B3MH 2ZM6H 4DV7H 4DR3H 4X62H 4JI2H 2UXBH 4LF6H 3KDGA 4LF5H 3T1YH 4DR6H 1SEIA 4DV0H 4DR1H 4NZTM 1N36H 4YHHH 4JI4H 4DV2H 5IWAH 2FPHX 5LL6b 4JV5H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y3M A;  3OSS D;  3EZJ A;  4EC5 A;  4G08 A;  3GR5 A;  4E9J A; 
#chains in the Genus database with same CATH topology
 3UOE A;  2E3U A;  1PQX A;  1ZZK A;  1ODH A;  4OD6 A;  3OTO H;  4DR4 H;  4AQY H;  1DT4 A;  1NXU A;  4E9J A;  4JI7 H;  4OO1 G;  1I94 H;  4AM3 A;  3KDK A;  4LFC H;  4PDB A;  2O4C A;  2K1H A;  2G8Y A;  2OPV A;  3GAB A;  2UUB H;  1FKA H;  2CTK A;  4NXM H;  4DR5 H;  1J4W A;  2CTF A;  2BL5 A;  2D9I A;  2M6Q A;  2NN6 G;  1J5E H;  4DV3 H;  4JI0 H;  2PY9 A;  4BA1 I;  4LFB H;  2CPQ A;  3I0P A;  3SB1 A;  4X66 H;  4BA2 I;  2F4V H;  3NCV A;  1S03 G;  4KHP H;  4X64 H;  3OET A;  1FJG H;  3JAM W;  3L7Z C;  1V9N A;  2VQE H;  2UU9 H;  1TUA A;  1XNR H;  1ZZJ A;  4YY3 H;  2UUA H;  1N32 H;  4NXN H;  1Z2I A;  2UUC H;  1EC6 A;  2LF0 A;  1IBM H;  1WTJ A;  2BA0 A;  4GKK H;  3RF2 A;  2OPU A;  2QND A;  1V8C A;  2Y3M A;  1N34 H;  5K36 G;  4JI1 H;  1VIG A;  1WHR A;  2AXY A;  4JI6 H;  4G08 A;  2CPM A;  1N33 H;  2CWF A;  2LRR A;  1IBL H;  2VKC A;  4DV5 H;  4JI8 H;  2ANR A;  4GKJ H;  4IFD G;  3QD7 X;  2CTE A;  2CTL A;  1XMQ H;  4LF9 H;  2ANN A;  3J7A K;  2UXC H;  2Z0S A;  2MJH A;  3U1K A;  3V69 A;  4B8C D;  2HHH H;  2X06 A;  2JZX A;  5JEA G;  4FJS A;  1HNX H;  1UG8 A;  5IT9 W;  1I6U A;  2VQF H;  4JVY A;  4NZR M;  1HR0 H;  4OX9 H;  5BR8 H;  5FLX W;  1J5K A;  1IBK H;  2CWH A;  2A1S A;  5LMN H;  4B8T A;  4JI5 H;  3AEV B;  2E5L H;  2ZQE A;  3VKE A;  1XNQ H;  2JEA I;  4EC5 A;  2JVZ A;  2UXD H;  1K1G A;  4K0K H;  3FAU A;  1WVN A;  4WAL A;  4LF7 H;  2LTL A;  1MSZ A;  2JA9 A;  3GR5 A;  4DUY H;  1X9Z A;  2FFM A;  1X4N A;  4JVH A;  5A2Q W;  2HH2 A;  4X65 H;  4B3T H;  4LF4 H;  4JYA H;  5LMU H;  4LIJ A;  4WAN A;  4OCH A;  2JEB I;  1XMO H;  1X0A A;  4DR7 H;  2CTM A;  1AN7 A;  5C0X G;  4LF8 H;  2LTM A;  4B3S H;  1X4M A;  1S20 A;  3EZJ A;  1VBI A;  1DTJ A;  1HNZ H;  1ZTG A;  3J80 W;  4AIM A;  4DUZ H;  3J81 W;  4DV6 H;  4DR2 H;  4JI3 H;  2PQU A;  4DV1 H;  4LFA H;  1F0X A;  2CTJ A;  2PT7 G;  2YQR A;  1HNW H;  4DV4 H;  2M8W A;  4B3R H;  3OSS D;  4H8A A;  3T1H H;  2JE6 I;  4NBQ A;  5DT9 A;  4B3M H;  2DGR A;  2P2R A;  2ZM6 H;  4DV7 H;  4DR3 H;  3GKU A;  1XRH A;  4X62 H;  4JI2 H;  2UXB H;  4LF6 H;  3KDG A;  1ZZI A;  4LF5 H;  4QMF B;  3T1Y H;  1SEI A;  4DR6 H;  1VIH A;  4DV0 H;  4DR1 H;  4NZT M;  1N36 H;  4YHH H;  4JI4 H;  4FJU A;  2HH3 A;  2FMR A;  4DV2 H;  5IWA H;  2FPH X;  1KHM A;  5LL6 b;  1WE8 A;  4JV5 H; 
#chains in the Genus database with same CATH homology
 1ODH A;  4OD6 A;  3OTO H;  4DR4 H;  4AQY H;  4E9J A;  4JI7 H;  1I94 H;  3KDK A;  4LFC H;  4PDB A;  2O4C A;  3GAB A;  2UUB H;  1FKA H;  4NXM H;  4DR5 H;  2D9I A;  1J5E H;  4DV3 H;  4JI0 H;  4LFB H;  3SB1 A;  4X66 H;  2F4V H;  3NCV A;  1S03 G;  4KHP H;  4X64 H;  3OET A;  1FJG H;  3JAM W;  2VQE H;  2UU9 H;  1XNR H;  1N32 H;  4YY3 H;  2UUA H;  4NXN H;  2UUC H;  2LF0 A;  1IBM H;  4GKK H;  3RF2 A;  2Y3M A;  1N34 H;  4JI1 H;  4JI6 H;  4G08 A;  1N33 H;  1IBL H;  4GKJ H;  2VKC A;  4DV5 H;  4JI8 H;  3QD7 X;  1XMQ H;  4LF9 H;  3J7A K;  2UXC H;  4B8C D;  2HHH H;  1HNX H;  5IT9 W;  1I6U A;  2VQF H;  4NZR M;  1HR0 H;  4OX9 H;  5BR8 H;  5FLX W;  1IBK H;  5LMN H;  4JI5 H;  2E5L H;  2ZQE A;  1XNQ H;  4EC5 A;  2UXD H;  4K0K H;  3FAU A;  4LF7 H;  3GR5 A;  4DUY H;  1X9Z A;  5A2Q W;  4B3T H;  4X65 H;  4LF4 H;  4JYA H;  5LMU H;  4OCH A;  1XMO H;  4DR7 H;  1AN7 A;  4LF8 H;  4B3S H;  3EZJ A;  1HNZ H;  3J80 W;  4DUZ H;  3J81 W;  4DV6 H;  4DR2 H;  4JI3 H;  4DV1 H;  4LFA H;  1F0X A;  2PT7 G;  1HNW H;  4DV4 H;  4B3R H;  3OSS D;  3T1H H;  5DT9 A;  4B3M H;  2ZM6 H;  4DV7 H;  4DR3 H;  4X62 H;  4JI2 H;  2UXB H;  4LF6 H;  3KDG A;  4LF5 H;  3T1Y H;  4DR6 H;  1SEI A;  4DV0 H;  4DR1 H;  4NZT M;  1N36 H;  4YHH H;  4JI4 H;  4DV2 H;  5IWA H;  2FPH X;  5LL6 b;  4JV5 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...