2JE6I

Structure of a 9-subunit archaeal exosome
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
215
structure length
207
Chain Sequence
QEIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKSIFVANNGRIWAFSEEILIEAIRKIENESHIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
publication title RNA Channelling by the Archaeal Exosome.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 39
structure length 207
sequence length 215
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2je6I01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2je6I02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2je6I03
1YBYA 4LUZA 1E22A 1JJGA 2PNHA 4IJLA 3M4QA 2PCFB 4A3KH 3VKEA 1G291 2QGQA 5GROA 4YCVA 5IWAL 1Y14B 2V4DA 1N32L 2OPVA 1NE3A 3UDGA 4YHHL 3I4MG 1B7YB 2BE5C 1K0RA 4EQ5A 1NMGA 1UE1A 5IWAQ 1VQAA 2PI2A 1TWHH 2NN6I 1N32Q 3HOVH 4C2MH 4IOCA 1KC8C 5EAYA 1HJPA 4YHHQ 1K8MA 1VQFA 1H95A 3L7ZC 4R4QA 1Q12A 4X6AH 3A5UA 5JEAH 1PH3A 1V9PA 4JYAL 4DR7L 2A6EC 2R6GA 4KKTA 3OW7A 3EIVA 4KKSA 4HJ8A 1PFSA 2EDGA 1NBWA 4HIOA 4B3SQ 2R92H 2VY3A 4JYAQ 4DR7Q 4IJHA 4DR1L 4LUVA 2AWOA 3KF6A 3HOUG 3FHWA 3P20A 3JC66 3MXUA 1K1GA 2Q2TA 4OO1H 3CC2A 3V69A 4A75A 2UXCL 1K3RA 4DR1Q 1ZZKA 1E7ZA 1ASYA 3GO5A 4R1JA 2ZTDA 1FGUA 3STBD 3F2CA 4IQZA 2CCZA 5C4XG 4YWKA 2HHHQ 4KN4C 1S3OA 2JJQA 1IYUA 1EIFA 2UXCQ 4IFDJ 4DV5L 1T5EA 1CKNA 4LUOA 1TWGH 1E1TA 1L1OC 4GNXA 4A3LG 1SRUA 2ZJPA 2WAQG 1VQ9A 4DV5Q 3PUVA 1EYGA 1X3EA 2JA5H 3H0GH 4A3IG 4OONA 1KXLA 1I50H 2WFWA 4BA1I 5JJIA 3KLWA 1EOVA 4LF4L 1B70B 4KHPL 2K7VA 1IW7C 2KCMA 1PH4A 3GTJH 1K8OA 3FMCA 2HH3A 4DV1L 3K0XA 3W1BA 2YV5A 2JXMB 1HZCA 2ZM6L 1VQ6A 4HR7B 2V1CC 1XMOL 1K8AC 4X66L 5FLXc 2R7ZH 1EUJA 4WALA 3GD7A 2PNRC 4DV1Q 3GTLH 4A3KG 1VQ4A 1BBWA 2ZM6Q 1CKMA 4OO1I 3UE0A 4PZ8A 1XMOQ 2KBNA 4X66Q 3B6YA 2ES2A 2NZOA 3L2PA 2E74C 1JB7A 1VCIA 5IYCH 3A0JA 2HH2A 3RLFA 1HZBA 1HTPA 3ULPA 4JOIC 3ERSX 4DV2L 4NXML 1C9OA 1KAWA 5C44G 3KYHC 5FLMG 2K5NA 1ZYRC 1K83H 4DV2Q 4A3FG 4NXMQ 4DAMA 4X64L 4G7OC 3A7AB 1I6VC 5IP9G 1RIPA 2R92G 2ALYB 2Z0SA 4NXNL 3WDNA 3MFYA 4K0KL 4P72A 1YVCA 5C4JH 4HIDA 4A93H 3M4OH 2K75A 3OTOL 3HOYH 2K5HA 3RR5A 4DK3C 4X64Q 1UE5A 4A76A 1N33L 2MNAA 3RN2A 3EBEA 3LWUA 1I3QH 2CTEA 2ZJQA 4NXNQ 4GN4B 3PUYA 1DD2A 4EX5A 1NMFA 3OTOQ 3JAMi 3I73A 1IBLL 2MJHA 3AFQA 1YNJC 1N33Q 4WJ4A 4A3DH 4JOIA 2KCTA 5BN5A 2CTJA 1VQJA 1PH8A 1I94L 4DUYQ 2GN5A 4JVYA 3U58A 1ASZA 3TS0A 1VQEA 1HNWQ 1IYJB 1UEBA 1VQHA 3KF6B 4DKAC 1IBLQ 1P8LA 1CKOA 3S15H 1L0WA 3FKIH 3UDXA 2Y0SE 1I94Q 1X54A 4QQBX 3T53B 1J6QA 4KKUA 1X65A 3QJYA 2GVAA 1KL9A 1H9SA 1WI5A 1GUSA 2A68D 2K14A 4LW1A 4JBWA 1VS0A 2RHSB 3AFPA 4A3JG 4GLVB 3I4MH 3CAMA 3NEMA 1G6PA 1CKNB 1Q90A 1EQQA 5BR8L 3CC4A 2B29A 2D0OA 3H15A 1TKWB 4Y52H 3D0FA 3BDOA 4GNXB 1JJ2A 2JA6G 3H94A 2JZXA 4QL5A 2OWOA 1QJOA 3S1QH 4LNQA 1MIUA 5FJ8G 1YZ6A 1PVOA 4AQYL 5BR8Q 4A3GG 1ONLA 2DGYA 4XIGS 2JK8A 4L5TA 3J80i 1IBKL 3CCMA 4DR4L 2E2HH 3CXCA 2IT1A 4IFDG 3PUZA 4DR2L 2MO0A 1QUQA 1Z6HA 2AHOB 2FMRA 1AH9A 4AQYQ 3I2ZA 1QZGA 3GDEA 3U50C 4QJFA 1IBKQ 1E2ZA 4DR4Q 1WYDA 4DR2Q 3HOUH 4JI4L 4G7ZC 2A19A 4ALPA 2AUKA 2N78A 2HIXA 5M5XH 1PH7A 2JVZA 2B63H 5C4XH 4LWCA 2LXJA 4JI4Q 4DR6L 5M5YH 4GN3B 4LF6L 2UUAL 3G4SA 1KHMA 4R4OA 1R9TH 4A3EH 1FJGL 1I6HH 4DR6Q 1UE7A 3MEFA 2OQ0A 4LF6Q 2UUAQ 3HOYG 1D8LA 1QVCA 4UP7A 1GHJA 4POGA 3CCRA 1TWAH 1ZTGA 1PH1A 1FJGQ 1IYVA 1QVFA 4A3IH 1X56A 4PG3A 3ND8A 4B3RL 1SR3A 1Z7TA 3KDFB 1X3GA 4DNIA 3DXJC 4GOPB 3GTKH 2AUJD 1TU2B 1TWFH 2IX1A 4B3RQ 3IKJA 4OGQC 4JI0L 3OOCA 3BU2A 3BZKA 4BA2I 2NVYH 1OXVA 4HJ5A 4UP8A 2OTLA 2HQLA 1M1KC 2DN8A 4A3CG 4X65Q 3K7AH 2I5MX 1OXXK 1GUTA 1IXRA 1L2FA 2B3GA 3AQQA 3LGJA 3PV0A 4JI0Q 4BXXG 3J7A5 2CWPA 3ULLA 1H9MA 4DK6C 2O5JC 4YCUA 4P73A 5C0XJ 2OTJA 1H9JA 2NZHA 1FR3A 3CCJA 3HGBA 1A62A 1Z47A 4JBKA 1PH5A 2JEBI 3CCVA 1YHBA 5C44H 1H9SB 1UE6A 4GNXC 3GQBA 4HJAA 2YTYA 1V8QA 4B3SL 2A69D 5FLMH 4UY8C 1ZZIA 1K8GA 4DV3Q 4A3FH 4DV7L 1C0AA 1GKHA 3W3AA 1RL2A 1EWIA 3CCLA 3E9IA 2ZT9C 3KJOA 4HIKA 1YHQA 5IP9H 5IY0A 2JA7H 1E24A 2ANNA 1N9WA 1N34L 2UUCL 2ASBA 4DV7Q 1AE3A 2K5VA 3EN2A 4R4TA 2YQRA 2HHHL 4DAYB 1SMYC 4KLKA 3HOZG 1A8VA 4LJZC 4P75A 4GKJL 1N34Q 2UUCQ 3K7UC 3E0EA 1VQ8A 4B8TA 1QUQB 3NBHB 2B63G 2JEAI 4POFA 2K32A 4JI5L 1Y1WG 1VQGA 2CTMA 4C3JH 1VQKA 4GKJQ 2CTFA 4A3EG 4MTNA 2JA8G 4JI5Q 1LM0A 1EIYB 2JA9A 4R4IA 3FPPA 5M3FH 1VQCA 1VQNA 3PF5A 5IP7G 3U9SA 4TQUS 2JE6I 5GAEC 3ICEA 4A3JH 2VQFL 1LYLA 3GTQH 1OXSC 4OWXB 4OWTB 3A74A 3PUXA 3TZUA 1X6OA 3PO3G 1VF5C 4YWMA 2FXQA 2VQFQ 2JA6H 2PMZE 3A8KE 2A68C 3LNNA 1TXYA 1SE8A 4GOPC 2BH8A 3HOXG 2QA4A 5FJ8H 2NVXH 4A3GH 3QG1A 2RF4A 4X62L 5A35A 2Q2HA 3DLLA 1KRTA 4IFDH 4JI3L 1WJJA 4HJ7A 2DNEA 3CD6A 1H9RA 1KQSA 5AJ3L 4X62Q 4XTCS 4JI3Q 1X55A 2IHFA 3W5OA 3RZOH 4DPGA 1OTCA 4BY1H 4HIMA 1XNRL 1X9NA 2EXDA 5AJ3Q 3H3VH 2D0PA 1NJIC 3TEHB 1YI2A 1PH2A 1VQOA 4FDBA 4L8JA 5DLQE 5E7NA 2BA1A 3RNUA 4BY7G 1XNRQ 4LF7L 3CMAA 1XJVA 4JV5L 3KDFA 3HOWG 5ELNA 2Y0SG 4GOPA 1NY4A 2JA7G 4MNOA 2IY5B 2KHIA 4OWWB 4DV6L 4PMWA 4LF7Q 4QGUA 4JV5Q 1BBUA 3M7NA 5K36G 2AKWB 1WCMG 2ZTCA 1XPRA 1Q1BA 2YYZA 2WB1E 4DUYL 1IZ6A 4DNRB 4DV6Q 1HNWL 5C0XG 5ELOA 1YNXA 1CFMA 3HFZB 4H02A 5HGQA 2CQOA 2K4KA 1Q81C 1YJNA 1GUGA 4R4CA 4BBSH 2DNCA 2VNUD 3F2BA 2OPUA 1VF7A 3J81c 4I7ZC 1PYBA 4RMFA 3VDYA 5M3FG 1X4MA 2F1MA 4A3CH 3A7LA 1K73C 1Y8NB 2LSSA 1JMCA 4BXXH 2P2RA 3S1RH 3Q8DA 3M4YA 5IYBG 4JBJA 4DK0A 1PA6A 3PSIA 1KRSA 1OXTA 3OPOA 4H13C 2I0QA 2RHQB 2QF7A 1LABA 1SN8A 2BDOA 1LACA 1I5FA 3RLNA 3AEVA 5IT9c 1N36L 3GTMH 2VS1A 4H0LC 3U4VA 3VR5A 1S72A 2R93G 2CFMA 3G71A 2OQKA 1YIJA 1VDZA 4WANA 3T51B 3UDIA 4B3TL 1A0IA 3I72A 1N36Q 4AYBG 4C3IH 2N8NA 1HH2P 2KCCA 2A69C 1M90C 4UP9A 4O2DA 1V43A 4BY1G 3VR2A 1O78A 2A8VA 4B3TQ 3HOZH 4DNTB 1ZKOA 4DR3Q 2EVBA 3NE5B 1GD7A 4JI8L 5IYDH 3N6RA 2PI2E 4WJ3M 2A6HD 4IPCA 1E2VA 4JI1L 5M5WH 1HCZA 1Y1WH 3U4ZA 1QVGA 3A8JE 4RCNA 3M85A 3EQLC 2C35B 1BKBA 4JI8Q 4GLXA 1SMXA 1N8RC 2I5LX 2JA8H 2PY9A 2DUDA 4JI1Q 1J4WA 3STBC 5LMNW 1PV4A 2NN6H 1B9NA 4IPDA 1Y8PB 5IP7H 3PF4A 3I4NG 2EJFC 1VQBA 3PO2G 2D62A 1H9KA 2CKZB 1U5KA 3HKZE 2PQUA 4QIWE 1YJ9A 4P71A 1G51A 1HR0W 1HNXL 2Q2IA 4NBQA 1BDOA 4GKKL 1E1OA 2E8GA 3PO3H 4BBSG 1MKHA 2O5IC 4X65L 4O0AA 4GZYC 5HY6A 2EJMA 4KI0A 2MFIA 2E2JH 1NTGA 3HOXH 1HNXQ 1P16A 2VQEQ 3T1HL 2UU9L 2HT1A 1PHJA 4GKKQ 3S1MH 5JEAJ 3I7FA 3PGZA 3UE1A 1CTMA 3IRBA 4LFAL 5JJLA 3I56A 4LK1C 1E3PA 2Q8IB 3T1HQ 2UU9Q 4AH6A 4A3BG 2GVBA 2ANRA 2LXKA 4APVA 1JT8A 1YNNC 3QIAA 4LIJA 4LFAQ 2PPBC 4TKOB 3AB9A 3I4OA 3AYHB 3KF8B 4DV3L 2F3IA 1A63A 1DTJA 3BZCA 4AM3A 2NVQH 3KJPA 3K8AA 2VL6A 1X3FA 4TVAB 3ER0A 5M3MG 4ME3A 1EWHA 3OW2A 4BY7H 1S40A 3CPFA 1IBML 4HJ9A 5JJKA 4KN7C 5KNCA 1U0LA 3E9HA 3HOWH 1AE2A 1YJWA 5GQOA 1XMQL 3WWVA 1QZHA 5IE8A 1YITA 1VQPA 1YEZA 3CCQA 3CQZH 2CWAA 1T9HA 3T56B 1IBMQ 5K36H 3AEVB 1FVIA 2AXYA 1J5KA 1WCMH 3CC7A 1KD1C 1DXMA 2MQHA 2D2CC 2K50A 1XMQQ 2K52A 3J7ZC 4C3HH 3U1KA 3NELA 2VW9A 2VUMG 3G48A 2E76C 5GADC 1PH6A 2JQOA 1CSQA 5C0XH 1GJXA 2YTXA 5IYDG 4DK1A 5GAHC 2L5TA 1Y1VG 3RLOA 2I5HA 4UPAA 5H1SE 3SGIA 1KIXA 1MJCA 1WVNA 2KENA 2EJGC 3PIPA 4GS3A 3G6EA 2R7DA 1LTLA 2YTVA 1BVSA 2CPQA 1GHKA 4NB3A 1YHAA 3GTGH 3CRLC 3NENA 2NN6G 2L15A 1Q86C 4JI2L 3TQYA 4Y7NH 1Y69U 3TRZA 2EIFA 3GTOH 1Y8OB 2WP8J 4JBMA 5IYBH 4P74A 1SFOH 4JI2Q 3CMEA 3UDFA 2AMCB 1DGSA 4YY3L 3ZJYC 1CUKA 3CW2C 2UXDL 2K33A 4GLAC 3CF5A 2Z6KC 4A3MG 3M3YH 2EQSA 1GM5A 1EC6A 1PH9A 4YY3Q 1V1QA 3T1YL 2DGRA 2XTIA 2R93H 1Q1EA 1EQRA 2UXDQ 3CPWA 3PCOB 3KFUA 1Q7YC 4LF4Q 3S17H 4KHPQ 3S16H 2BE5D 3F8TA 1E2WA 2PQAA 5KNBA 2ID0A 4LFCL 4QY7A 5C0XI 2NVTH 3IFTA 1A6XA 2B8GA 3T1YQ 3TREA 4JG2A 2A1AA 3M4PA 2WAQE 2WB1G 4B3ML 3GTPH 3S2HH 1IL2A 1L1OA 4DV4L 4IO9A 4LFCQ 4BBRH 2UXBL 2LMCB 4J15A 4LFBL 5BN3A 3CCEA 4GN5A 1D7QA 1HQMC 3SDZA 2A6ED 3KLRA 1HNZL 3HOVG 3HKSA 4B3MQ 3M9BA 4OX9L 4H44C 1X4NA 4OXPA 4DV4Q 3VR3A 2UXBQ 1Q82C 1SROA 2QNDA 1SLJA 5LMNL 4LFBQ 4PV1C 2IX0A 2CTLA 5BN4A 2Z6KA 1J5EL 1HNZQ 1HPCA 2MO1A 5JEAG 4IOAA 2QEXA 4OX9Q 4DUZL 1VQLA 4LF9L 4KHZA 4DV0L 3TS2A 1DT4A 5LMNQ 2OCEA 2XGTA 2A6HC 3I4NH 3J81i 1J5EQ 1HR0L 3PO2H 4QMFB 3ND9A 1PMRA 1XTDA 4DUZQ 1VQ5A 1HZ9A 5GAGC 1TUAA 4NPSA 4LF9Q 4IPHA 2E75C 3CCUA 4DV0Q 1O7LA 1DCZA 3PIOA 4JVHA 3PUWA 4OO1G 3RN5A 1HR0Q 4IFDI 2E3UA 2HIVA 1B8AA 4K0KQ 4JC0A 1XNQL 1GUOA 1KHIA 3VR6A 2VZAA 1WOCA 3S24A 1TWCH 1FYCA 2ZJRA 3K81C 1XNQQ 5J3BA 5C3EH 3BJUA 3A8IE 2Q2UA 1IW7D 3FP9A 3F2DA 3VR4A 4A3BH 4PZ7A 3H3VI 3D4RA 1W3SA 3DM3A 1Z9FA 3F1ZA 4G7HC 3J81j 2E2IH 4JI6L 3I55A 4RG1A 3I4LA 5LMUL 3JAMc 2JA5G 3ULJA 3H0GG 1FL0A 1B9MA 2R7FA 4JCVE 1GUNA 4JI7L 1PYSB 3MXNB 2B8FA 4JI6Q 3RZDH 2ATWA 3S2DH 3W1GA 5LMUQ 3CCSA 4YCWA 1O7IA 3S1NH 5M3MH 1OXUA 2H5XA 1C7YA 4AIMA 4A4IA 4JI7Q 1WFQA 2ZTEA 1GO3E 2R7ZG 2BA0A 1JJCB 3BG3A 2BH2A 4IPGA 3K80C 1EFWA 2E5LL 2UUBL 3VA7A 5KNDA 2F52A 1K9MC 4DR3L 3D31A 4LF8L 2KA7A 3HKZG 4YWLA 2CTKA 4PZ6A 2E5LQ 2UUBQ 4BBRG 5IYCG 2VUMH 4LF8Q 2IHEA 1Y1VH 4KMUC 2PQAB 3A5ZB 1CSPA 4DR5L 4MZ9A 3J80c 4L5SA 2F4VL 1UWVA 2RCNA 1VQDA 2AWNA 4LF5L 1CI3M 1L1OB 4DR5Q 2BL5A 1ZZJA 1XPUA 2F4VQ 2N3SA 3L0OA 1JE5A 2D5DA 4LF5Q 4JK1C 1Q46A 4A93G 3CP0A 4A3LH 1VQIA 1LUZA 2CW0C 1WE8A 4AYBE 3CRKC 3S14H 2VQEL 1VIGA 1XPOA 1GVPA 1Q8KA 2N49A 2KHJA 4A3MH 2YU9H 3OYYA 4L5QA 4A3DG 1VQ7A 4L5RC 1W2BA 3SE0A 1HZAA 3KOJA 5C3EG 1VIHA 1VQMA 1MJEA 3FKIG
chains in the Genus database with same CATH superfamily
2EY2A 2JN4A 1YBYA 4LUZA 1E22A 5CV9A 2F0SA 1CQVA 2PNHA 1Y1VB 3ERQA 1JJGA 4XQQA 4IJLA 1BOSA 2Z1CA 2EYJA 3M4QA 3D6WA 2K01A 2PMZB 3V2TA 2PCFB 2PW5A 2RCFA 4A3KH 4ZRZA 3VKEA 2F0FA 2F4IA 1G291 3NBIA 2QGQA 5E4WC 5GROA 4B3RH 4YCVA 5IWAL 1Y14B 3J81W 3HRZC 2V4DA 1HNXH 1O80A 1N32L 2OPVA 1NE3A 4GKKH 3UDGA 3K57A 4CJ1B 4YHHL 3I4MG 5E4XA 1BO0A 1B7YB 2JSOA 1HRJA 2BE5C 1K0RA 4X65H 1EFID 3KLSA 4EQ5A 5LL6b 2R3ZA 3KLSX 4IUQA 1IL8A 4ME5A 1NMGA 1UE1A 5IWAQ 5FOBB 1O7YA 3OMGA 1VQAA 2PI2A 4ZK9B 1TWHH 3T1HH 2NN6I 1N32Q 2UU9H 3HOVH 4C2MH 4IOCA 3VYRA 1KC8C 1EYAA 1HUMA 5EAYA 1HJPA 4YHHQ 1K8MA 1VQFA 1H95A 2RSOA 1KABA 2NUCA 2C9OA 3L7ZC 1DZ1A 4LFAH 2K04A 4R4QA 1Q12A 3BZDB 3S14B 4X6AH 3A5UA 5I6WA 1SAPA 5JEAH 1PH3A 1G2SA 1V9PA 5J22A 2XVSA 4JYAL 4DR7L 2A6EC 1EY6A 2R6GA 4KKTA 1WTPA 1S5CD 3AMUA 3NWTA 5C5MA 5EPLA 3OW7A 1XTCD 1AEXA 1SBBB 3EIVA 3OHXC 2FJ2A 4KKSA 4ZCKA 4HJ8A 4ZAIA 2K05A 1PFSA 1NBWA 2EDGA 2NTTA 4A3MB 4HIOA 4FYDA 4DGZA 2YU9B 4B3SQ 2R92H 2TSSA 5I4DA 2VY3A 4JYAQ 5E1FA 3TZDA 2RDGA 4DR7Q 1II3A 4IJHA 4DR1L 3NXWA 4DV3H 4LUVA 3TDQA 2WACA 2CTJA 1DOMA 2AWOA 1A15A 3KF6A 3HOUG 2XWBB 1PFNA 3FHWA 3P20A 3JC66 1RCVD 3MXUA 1K1GA 1JOQA 2PW7A 1XYIA 2Q2TA 4RGOS 4OO1H 2OXPA 3CC2A 4S3SA 5EPKA 3M7GA 3V69A 4A75A 2UXCL 1K3RA 3I91A 4DR1Q 1ZZKA 1E7ZA 1ASYA 3GO5A 4R1JA 2ZTDA 1FGUA 3STBD 4C1NK 4CKBA 3F2CA 4IQZA 5KGUA 4A3KB 1IBMH 2CCZA 5C4XG 4YWKA 1HHVA 2F0QA 2HHHQ 2F0IA 1D5MC 1S3OA 4KN4C 2WB1B 2JJQA 1IYUA 1EIFA 4RAUC 1XMQH 2CWFA 1XX8A 4ILWA 4J6HA 2MJ8A 2KECA 3SK4A 2PQEA 3HEJA 3TP8A 3J81E 2UXCQ 4IFDJ 1KLUD 4DV5L 1T5EA 1CKNA 1KTKA 4LUOA 1TWGH 1E1TA 1L1OC 4FXGC 4GNXA 2G9DA 5KYIA 4A3LG 4IALA 1TWHB 1SRUA 2ZJPA 3HOVB 2B2WC 4C2MB 1TY2A 1QILA 2WAQG 1VQ9A 4ID6A 4RKLA 2LTMA 4DV5Q 4F8MA 1SNPA 3PUVA 1EYGA 1X3EA 2JYOA 3NPPA 1A3UA 3SK6A 3DM1A 2JA5H 1SNQA 3H0GH 3BVGA 4A3IG 4OONA 1K28A 3HS0C 1KXLA 3ITPA 1I50H 2WFWA 4BA1I 5JJIA 3KLWA 1EOVA 4LF4L 4ZUJA 1B70B 4KHPL 2K7VA 1IW7C 2KCMA 1PH4A 3SVMA 3GTJH 4DN4M 1K8OA 1DM0B 1J8IA 3FMCA 2HH3A 4DV1L 3MHBA 3K0XA 3W1BA 2J7ZA 2F0KA 2YV5A 3TBIB 1HZCA 2JXMB 2R92B 1HQRD 2MPMA 2ZM6L 1VQ6A 4TSSA 3TMEA 4RHSA 4HR7B 2V1CC 1XMOL 3TP7A 1K8AC 1I4GA 4X66L 4JI2H 1Z2IA 5FLXc 2R7ZH 1EUJA 1U4LA 4WALA 3GD7A 2PNRC 1EY0A 4DV1Q 1STEA 4EVOA 3GTLH 2HDMA 4A3KG 1VQ4A 1BBWA 2ZM6Q 1CKMA 2LY7A 3C3LA 4OO1I 1F77A 3UE0A 4V0BA 4PZ8A 1XMOQ 2KBNA 4X66Q 4EC5A 3B6YA 1CM9A 2ES2A 1F2LA 2NZOA 3L2PA 4YY3H 1ET6A 2E74C 1JB7A 3Q6SA 1VCIA 1W6KA 4C56C 2B2WA 5IYCH 3A0JA 1XXGA 3G7LA 2UXDH 2HH2A 3H09A 3RLFA 1HZBA 1HTPA 1SJHD 2QDBA 5FO9B 2B2VC 2WIIB 4JOIC 3ULPA 1TWGB 4N9TA 2B39A 3ERSX 5DEHA 1X32A 4DV2L 2LFNA 4NXML 1C9OA 1KAWA 2NYZD 3T1YH 1F9QA 3C46A 2RSNA 2EYPA 5C44G 4G08A 4DXFA 1PZKD 3HP3A 3KYHC 5FLMG 2K5NA 1Q3LA 1K83H 1ZYRC 1UG8A 5AFWA 2JA5B 1AN7A 1AP0A 4DV2Q 2M00A 3GV6A 1SMYD 4LFCH 4A3FG 3H0GB 4NXMQ 3R3OA 4DAMA 1I50B 5JJZA 4N9PA 4X64L 4G7OC 3KBXA 3A7AB 3LWEA 2F0OA 3K6OA 4DFAA 1I6VC 4KJOA 5ELDA 5IP9G 1F9SA 1RIPA 3M3YB 2VB2X 2R92G 4B3MH 2ALYB 1LLRD 2Z0SA 2X6GA 4NXNL 3WDNA 3MFYA 3GTJB 4K0KL 4P72A 1F2YA 1YVCA 2EPBA 5C4JH 4HIDA 4A93H 1EY8A 3M4OH 1K3BC 4DV4H 3IAYA 2K75A 3OTOL 3HOYH 5C5LA 2SNSA 2UXBH 5T1IA 2K5HA 3RR5A 4DK3C 2PZWA 1UE5A 4X64Q 4LFBH 2LF0A 3HZXA 2B2UC 4A76A 3U9OA 1N33L 2MNAA 3RN2A 3EBEA 3LWUA 1HFNA 1HNZH 1I3QH 1SE4A 2CTEA 2R7ZB 4KV6A 1AZPA 3SHLA 4ZKCB 2ZJQA 4NXNQ 4GN4B 3PUYA 4EGVA 4OX9H 1EU4A 1QB5D 1DD2A 4EX5A 1NMFA 1R4PB 3OTOQ 3T16A 3GTLB 3JAMi 3I73A 1IBLL 2MJHA 3AFQA 5LMNH 5CV8A 1NR4A 1YNJC 1N33Q 4UDUC 4WJ4A 1J5EH 2B2VA 4A3DH 4JOIA 4OEMB 1AN8A 2KCTA 4NKLA 1VQJA 5BN5A 1PH8A 1FD7D 4DUYQ 3HKZB 4C3JG 1I94L 3S2HB 2GN5A 4JVYA 4QIWB 3U58A 1ASZA 4DUZH 1LT4D 3TS0A 4NP5A 1VQEA 1NSNS 1HNWQ 4LF9H 1IYJB 1UEBA 1VQHA 1PDQA 1PQXA 3KF6B 4DV0H 4DKAC 1IBLQ 1P8LA 1L0XB 1CKOA 3BVZA 3S15H 3Q23A 1L0WA 2BDNA 1ENCA 3FKIH 3UDXA 3J81L 2O4CA 1SYCA 1HR0H 2Y0SE 3NSWA 3UI2A 2AQ2B 1I94Q 1X54A 4MHEA 4QQBX 3EFXD 4ULLA 3T53B 1J6QA 1LTTD 4KKUA 1X65A 3QJYA 2GVAA 1RKNA 1KL9A 1H9SA 5C3XA 1WI5A 4XYOA 5D3DA 2JP1A 1GUSA 4XYQA 2A68D 2K14A 4LW1A 4JBWA 1VS0A 2RHSB 3AFPA 4A3JG 4GLVB 1K83B 3I4MH 3DWAA 3CAMA 3NEMA 1G6PA 4QUCA 5EBDA 1XNQH 1CKNB 1Q90A 1BUVT 1EQQA 4B9WA 5BR8L 3CC4A 2B29A 2D0OA 3H15A 1TKWB 3C2PA 4Y52H 2K1BA 3D0FA 3BDOA 2B2UA 4GNXB 1JJ2A 1EIGA 2JA6G 3H94A 2JZXA 4QL5A 4M8AA 5C4JB 4A93B 2OWOA 1QJOA 3M4OB 3S1QH 4PDBA 4LNQA 2SDFA 3HOYB 2VB3X 4CJ2C 1MIUA 2F3VA 5FJ8G 1YZ6A 1PVOA 2KHSA 4AQYL 1LTID 1U9RA 5BR8Q 4DAYA 2KVMA 4A3GG 1ONLA 2DGYA 4XIGS 2JK8A 4L5TA 3J80i 1IBKL 1RD9D 2Z4IA 3CCMA 1I3QB 1WTJA 4DR4L 2E2HH 2IT1A 3CXCA 3AU7A 4IFDG 3GR5A 3PUZA 4DR2L 3H91A 2NB0A 1EQTA 2MO0A 1QUQA 1Z6HA 3OIQA 3NBHA 4JI6H 5EPJA 2AHOB 2P5ZX 2FMRA 1LT5D 4AQYQ 1AH9A 2L9HA 3I2ZA 1QZGA 1KDAA 1JWSD 1F2MA 3GDEA 3U50C 1X3PA 4CJ0B 4QJFA 1IBKQ 5JAVA 4A3DB 1E2ZA 1QCBD 4DR4Q 3V05A 5IIFA 3DHQA 1WYDA 4MTKA 5CC4A 4DR2Q 4JI7H 3HOUH 2M2LA 4QB4A 5C3EB 4JI4L 2F0EA 4G7ZC 2A19A 1KDBA 4ALPA 1WTXA 3S15B 2AUKA 2HUGA 3FKIB 2N78A 2NZ1D 4FJSA 1F0XA 2HIXA 5M5XH 4IUPA 3MVVA 1PH7A 3E5SA 2L11A 2F0JA 2JVZA 3KDGA 2B63H 5C4XH 4LWCA 2LXJA 4JI4Q 4DR6L 1QG7A 5M5YH 4GN3B 4KD3A 4OL7A 4EQOA 2UUAL 4LF6L 4H7BA 1M8AA 2E5LH 2UUBH 3OWFA 3G4SA 1KHMA 4R4OA 1B53A 3I4MB 1CHPD 1MBYA 2F0MA 3EJIA 1CA5A 1R9TH 4DR3H 4A3EH 4LF8H 1BCPF 1S5FD 3FAUA 1FJGL 1QNUA 3PMFA 4KY6A 1EYDA 2F0NA 3R2IA 4DR6Q 1I6HH 1UE7A 3MEFA 2L0CA 3C1FA 2OQ0A 1KAAA 1SEIA 4LF6Q 2RBMA 2UUAQ 2RDFA 5ELFA 3HOYG 1D8LA 1QVCA 3EZJA 5COYA 1RODA 4L63B 1GHJA 4UP7A 1RTNA 5EJWA 4POGA 1I4PA 3CCRA 5ELCA 1TWAH 3S1QB 1ZTGA 1KDCA 1PH1A 1FJGQ 3K5MA 3TP6A 3RD4A 1TVXA 3DEOA 1IYVA 1JE4A 2K6AA 5CV4A 4A3IH 1QVFA 4DR5H 1X56A 4PG3A 3ND8A 5G3LF 4B3RL 1SR3A 2E2HB 1Z7TA 3KDFB 1PRTD 2M8WA 3TN2A 2F4VH 1X3GA 4DNIA 3DXJC 4GOPB 3GTKH 2AUJD 2PZUA 3NP8A 2EXZA 1TU2B 1TWFH 2IX1A 4LF5H 5CMDA 3P1HA 4B3RQ 1SNDA 3IKJA 2H1EA 2HD3A 3A55A 4OGQC 3NTKA 4JI0L 3OOCA 3HOUB 4X3UA 1STNA 1V8CA 3BU2A 3BZKA 5CGKA 4BA2I 3X3NA 2NVYH 3ZYYX 1OXVA 4HJ5A 4UP8A 2OTLA 2HQLA 1M1KC 2DN8A 4A3CG 4X65Q 3K7AH 2BCOA 4X3KA 2I5MX 1OXXK 2ICEC 1IXRA 1GUTA 1L2FA 2B3GA 3AQQA 3LGJA 1CZGA 5M5XB 3GP7A 3PV0A 1I4QA 4JI0Q 4FF4A 2VQEH 4BXXG 3J7A5 2CVRA 2CWPA 2B63B 4Z9CB 3ULLA 5C4XB 2PZTA 5M5YB 1H9MA 1D5ZC 2EE1A 2PO4A 4K2KA 4DK6C 1B2TA 3LX0A 1ICFB 2SEBD 2K5QA 4G4KA 5IGBA 2O5JC 4WJWA 4YCUA 2DY7A 4P73A 5C0XJ 3MAQA 2OTJA 1H9JA 1EL0A 2R61A 2NZHA 1FR3A 3CCJA 1DONA 1R9TB 3HGBA 1XRHA 3F2UA 3K0YA 1A62A 1TS2A 1Z47A 4JBKA 1PH5A 2QCPX 1I6HB 2JEBI 3CCVA 1ZEQX 4HSVA 5NUCA 2A73B 1WVLA 1YHBA 5C44H 4P2CB 2Q8TA 1H9SB 2DJFC 2WAQB 1UE6A 4GNXC 3GQBA 4HJAA 1QE6A 1TWAB 1J9OA 1V8QA 2YTYA 5LL6X 2A69D 5FLMH 4B3SL 1BCPD 4UY8C 2F0LA 1ZZIA 2ZXPA 3T13A 5L37A 1PFBA 1D2BA 1DOKA 5D65A 1K8GA 4DV3Q 4K5VA 4A3FH 1OO9B 4A3IB 4DV7L 1C0AA 1GKHA 2J4XA 3W3AA 3J7YW 5IT9W 1RL2A 1K0SA 1EWIA 3CCLA 3E9IA 2OEOA 2ZT9C 1PTOD 1AW7A 2EYHA 3KJOA 4HIKA 1YHQA 5IP9H 2DY8A 5IWAH 5IY0A 2JA7H 1WTHA 2C5CA 3GTKB 1N32H 4C3IG 1E24A 2ANNA 1N9WA 1TWFB 1N34L 2UUCL 4YHHH 2ASBA 2G5DA 4DV7Q 1AE3A 2K5VA 3EN2A 4R4TA 2YQRA 2HHHL 3Q22A 4DAYB 5IGEA 1SYDA 1CHQD 1SMYC 4KLKA 3HOZG 1A8VA 4LJZC 1JR0D 5DM63 1S4ZA 4P75A 1JB3A 2FFMA 4K2LA 2ICIA 2NVYB 1N34Q 3BS1A 4GKJL 2UUCQ 2PT7G 3K7UC 3E0EA 2CH4A 1VQ8A 2AQ3B 4RGMA 4B8TA 1QUQB 3NBHB 2B63G 4FF2A 2JEAI 3MC0B 5CBAE 3NQIA 4POFA 3PQIA 2K32A 4JI5L 1Y1WG 1VQGA 2CTMA 4C3JH 4PNYA 1CQFA 1VQKA 4JYAH 4GKJQ 4DR7H 3J7AF 1PTOH 2CTFA 4A3EG 1F2ZA 1WHRA 4MTNA 1JORA 4DF7A 2JA8G 3H6MA 4JI5Q 3J80W 4MN3A 1LM0A 1EIYB 2JA9A 4R4IA 2HCIA 2VXWA 1QWYA 1EWCA 3FPPA 4DU9A 5M3FH 1VQCA 1VQNA 3PF5A 4FF1A 5IP7G 2O2LD 4DR1H 3U9SA 3QOJA 1ZXTA 4TQUS 5C44B 5ELEA 1BR9A 2JE6I 5GAEC 2Z8LA 3ICEA 3JAME 4A3JH 1PZID 2VQFL 1LYLA 3GTQH 1OXSC 4OWXB 2KEEA 3BDCA 4EQNA 3MA2B 4OWTB 2UXCH 4A3FB 3UOEA 3A74A 3PUXA 1EIHA 4XQJA 3FPUB 3TZUA 1F9PA 1DJRD 1X6OA 5IGDA 3PO3G 4XT1B 5JPNC 1VF5C 4YWMA 2FXQA 5IT9E 2VQFQ 2JA6H 1S5ED 2PMZE 3A8KE 2A68C 3LNNA 1TXYA 2AQ1B 1SE8A 4GOPC 5DNFA 2BH8A 3HOXG 3I3CA 4FP5D 1LTBD 4DV5H 1TY0A 2QA4A 5FJ8H 1YNND 2QDLA 4WRDA 2NVXH 4A3GH 2HQEA 2RKSA 1RF2D 3QG1A 3MTSA 4I65A 2RF4A 4J1MA 4X62L 5A35A 2Q2HA 5CYUA 2L1BA 3DLLA 1D1IA 5EGTA 5T1GA 1KRTA 1D5XC 4JI3L 4IFDH 2E2DC 1A2TA 2FINB 1B1ZA 2SOBA 2FMCA 4F7XA 1WJJA 4CGYB 2NBFA 1LTRD 4HJ7A 2DNEA 2Z4HA 3CD6A 1QOHA 4O1NA 1H9RA 4V190 1HA6A 1JQYD 1KQSA 4FXDA 5AJ3L 4X62Q 2F0WA 4XTCS 4RGNA 4C3JB 4JI3Q 4C1NI 1MSGA 1X55A 2IHFA 3W5OA 3RZOH 4LF4H 4KHPH 1LT3D 4KHVA 1PTOB 4DPGA 1OTCA 4BY1H 2FMMA 3OMCA 1SJED 2SNMA 4HIMA 4HN7A 1XNRL 3K5OA 1X9NA 2EXDA 5AJ3Q 4RKBA 4DV1H 5IODA 5JOBA 2G8YA 5CV7A 5CR3A 1Q8IA 3H3VH 2ZM6H 2D0PA 2GA4B 4QMGA 3TSSA 3K58A 5M3FB 1NJIC 2HDLA 3D4WA 1ILPA 3J80E 3D8GA 3TEHB 1YI2A 1XMOH 1PH2A 1VQOA 4X66H 4FDBA 4OELB 4L8JA 5DLQE 1V1OA 1JICA 5E7NA 2LTLA 2BA1A 3SK8A 3RNUA 1XNRQ 4BY7G 4LF7L 3CMAA 1XJVA 4JV5L 4KY7A 5I9PA 1SE2A 4A3JB 1JWUD 3KDFA 1SXTA 1X3QA 3GTQB 1KLGD 1UUPA 4ODGA 1D6EC 3D3RA 3HOWG 5ELNA 2Y0SG 4GOPA 4WFN3 1NY4A 2KCNA 1T5XD 4MNOA 2JA7G 5CV6A 2IY5B 2KHIA 4OWWB 3DUZA 4DV6L 4PMWA 1HFGA 4LF7Q 4QGUA 4JV5Q 1BBUA 4UAIA 5D3IB 3M7NA 5K36G 2AKWB 2JA6B 3WOFA 1WCMG 2L4NA 2ZTCA 1XPRA 1Q1BA 3K5NA 1WD1A 4K14A 2YYZA 3VYTA 4C3HG 2WB1E 4DUYL 2NVXB 1IZ6A 4A3GB 1IHZA 1SYFA 4DNRB 4DV6Q 1HNWL 4DV2H 2RVLA 4NXMH 5ELOA 5C0XG 5I2YA 1YNXA 2X69A 1CFMA 3HFZB 4NMZA 4H02A 5HGQA 3A56A 2CQOA 2K4KA 1Q81C 1UAPA 1GUGA 1YJNA 4ZQ3A 3NWSA 5KRUA 1EU3A 2BOSA 5LL6S 4R4CA 4BBSH 5DAUA 2DNCA 1C4QA 2VNUD 4AYBB 4DA2A 3GV3A 1LTGD 1B50A 3F2BA 2OPUA 4X64H 2XRSD 3KF8A 1EEFD 3RZOB 1VF7A 4IUNA 1FNVA 4BWGB 4IURA 4K6DA 3J81c 2K5DA 1JWMD 4BY1B 3OETA 1TT2A 4F88A 1PRTC 1ILQA 1PYBA 4I7ZC 4RMFA 5M3FG 3VDYA 4B8CD 4NXNH 1X4MA 4K0KH 1NR2A 2F1MA 4A3CH 2EYLA 3A7LA 3OTOH 1K73C 1Y8NB 2LSSA 3I70A 4N8X1 1JMCA 1N33H 4BXXH 2P2RA 2F03A 3S1RH 3MEHA 1ML0D 1G8ZD 2MP1A 2TMPA 3M4YA 3Q8DA 5IYBG 4JBJA 4DK0A 1WTVA 3OIPA 2N88A 1PA6A 1IKLA 5JVG3 3PSIA 3NTHA 3NQTA 1IBLH 2CHBD 1KRSA 1OXTA 3OPOA 5KIXA 4H13C 3MXPA 1ENFA 2I0QA 2RHQB 1EY9A 2QF7A 1LABA 1SN8A 1LTSD 1I94H 2BDOA 1LACA 1I5FA 1SSOA 3BYTB 3RLNA 3R8BA 3AEVA 4RGTA 1TS4A 4IUTA 1ESRA 4RH6A 5IT9L 3RMHA 5IT9c 1N36L 3GTMH 2VS1A 4H0LC 1MD2D 1STHA 2F0VA 3U4VA 3VR5A 1S72A 2R93G 2CFMA 5IGGA 3G71A 2OQKA 5EKLA 1YIJA 3E3XA 1VDZA 1BF4A 1MHWC 4WANA 3T51B 3UDIA 1LV9A 2XNAC 1NAPA 4B08A 4B3TL 1A0IA 1NXUA 5LMUH 3I72A 1N36Q 3BVMA 4AYBG 4C3IH 2K5WA 4K5XA 4XXEA 2XWJB 2N8NA 1HH2P 1TQOA 5FLXW 1EY4A 3VYSA 5C4ZA 2KCCA 2A69C 1M90C 4UP9A 1BCPC 4O2DA 1V43A 4BY1G 3VR2A 1O78A 2A8VA 4B3TQ 5BR8H 4KY5A 3HOZH 2EY5A 5ISRA 4ABNA 4DNTB 4E6IA 1ZKOA 1PTOC 4RFBA 4DR3Q 3A54A 2EVBA 1GD7A 3FDTA 3NE5B 4JI8L 1CK1A 5IYDH 3N6RA 2PI2E 4WJ3M 4AQYH 3WOEA 4MIUA 1SNOA 2A6HD 4IPCA 1E2VA 4JI1L 5M5WH 1HCZA 1Y1WH 2X6LA 3U4ZA 3J80L 3A8JE 1QVGA 1IBKH 3NUCA 3S1RB 4RCNA 3M85A 3EQLC 2CWHA 4DR4H 2C35B 1BKBA 2FPHX 4DR2H 4JI8Q 4GLXA 1SMXA 1N8RC 2I5LX 2JA8H 2PY9A 2DUDA 1SYBA 4JI1Q 1J4WA 3STBC 5LMNW 1PV4A 2NN6H 2KOLA 1B9NA 4IPDA 4H8AA 1Y8PB 4HTHA 1FNUA 4HCEA 5IP7H 3PF4A 1A3VA 2RQXA 3I4NG 2EJFC 3I8ZA 4DAVA 1VQBA 3PO2G 1STGA 1QNKA 3D6CA 1SEBD 2D62A 1H9KA 3KUPA 2CKZB 1U5KA 4PMCA 4JI4H 3HKZE 2PQUA 1HA5A 3GTMB 4QIWE 1YJ9A 5KEEA 4P71A 1G91A 2IJ0A 5A2QW 4K5WA 1G51A 5FO7B 1M4VA 1HR0W 1HNXL 1RHPA 2Q2IA 4NBQA 1JCKB 4YIJA 4CDEC 1BDOA 3DEPA 4GKKL 1E1OA 5I2XA 3E0JA 2E8GA 4DR6H 1EZ8A 3PO3H 4BBSG 1MKHA 2O5IC 1I4RA 4LF6H 4X65L 2UUAH 4O0AA 4GZYC 4C3IB 5HY6A 3OSOA 2EJMA 3Q24A 4KI0A 2MFIA 4HAEA 3SXHA 2E2JH 1NTGA 3BYYB 3HOXH 1HNXQ 1P16A 2VQEQ 3T1HL 2UU9L 1A2UA 2HT1A 1PHJA 4GKKQ 5JPMC 1I6UA 3S1MH 1FJGH 5JEAJ 5FLXE 3NK9A 3I7FA 2IL8A 2K28A 3TP5A 3PGZA 3HOZB 5E3FA 4NZRM 3UE1A 5IGCA 1CTMA 3IRBA 4LFAL 5JJLA 1BQQT 2FHTA 3I56A 4LK1C 1E3PA 2Q8IB 1GUWA 3T1HQ 4DXGA 2UU9Q 4AH6A 4A3BG 4FJUA 2GVBA 2WKCA 3T4AC 2ANRA 3D4DA 3SK5A 2LXKA 2F0HA 1STYA 4APVA 1JT8A 3CU7A 4OIJA 2OT2A 1FKAH 3K5LA 4IUUA 5M5WB 1Y1WB 4IZ8A 1YNNC 3QIAA 3H3VC 4LFAQ 4LIJA 2F3WA 2PPBC 4TKOB 2ENBA 3AB9A 1V9NA 3FEWX 3I4OA 3AYHB 3VA5A 3KF8B 4A3EB 1VMCA 2MHVA 1V1PA 5I9OA 5EQ0A 4DV3L 2F3IA 5DM73 2JA8B 1A63A 1DTJA 3BZCA 4AM3A 2NVQH 3KJPA 3K8AA 3JAMW 2MUYA 2VL6A 1EY5A 1X3FA 4CDFC 1TS5A 3ER0A 4TVAB 5C4HA 1LO5D 4JI0H 3EROA 5M3MG 4ME3A 2I46A 1EWHA 3OW2A 4BY7H 1S40A 3CPFA 3EA6A 4HMIA 1IBML 2EY1A 4HJ9A 5JJKA 2Z9HA 4JVZA 4KN7C 5KNCA 4RWSC 1XWEA 1U0LA 3E9HA 4RA8A 3HOWH 2IWHA 1AE2A 1YJWA 5GQOA 1XMQL 4K8JA 4G57A 3WWVA 2FFKB 1QZHA 5IE8A 5A2QE 1YITA 1VQPA 1YEZA 3CCQA 3CQZH 2CWAA 1T9HA 3T56B 3PO3B 2EYFA 1IBMQ 4R8NA 5K36H 3AEVB 1FVIA 5G3LD 2AXYA 4KTAA 1J5KA 1WCMH 3CC7A 1KD1C 2E2JB 1DXMA 2MQHA 4IUVA 2D2CC 2K50A 4OIKA 3HOXB 1XMQQ 2K52A 4KJNA 3J7ZC 1A3TA 2M9VA 4C3HH 3U1KA 3S1MB 3NELA 1WTWA 2VW9A 2VUMG 3G48A 2E76C 5GADC 1PH6A 2JQOA 3QOLA 5I6YA 1CSQA 2K03A 5C0XH 1GJXA 2A5HA 1JOKA 3K7AB 2LS01 2YTXA 5IYDG 3Q0AA 4DK1A 5GAHC 2L5TA 5EKIA 1Y1VG 3RLOA 2I5HA 4JPBW 5M9OA 4UPAA 5H1SE 3SGIA 1BXTA 1KIXA 1MJCA 1LT6D 4R8IA 4B3SH 2EOTA 2EZVA 1WVNA 2KENA 2EJGC 3C1EA 4FVMA 1PRTB 3PIPA 2WINB 4GS3A 3G6EA 4LAAA 2R7DA 1EYCA 4RCOA 1LTLA 2YTVA 4DV7H 1BVSA 3V96A 5FK9C 2CW0D 2F0DA 2CPQA 1RTOA 1GHKA 5EKKA 4F87A 4NB3A 4IN3A 1YHAA 3GTGH 3CRLC 3X3MA 5FKAC 3NENA 2NN6G 2L15A 1Q86C 4OCHA 3MXNA 4JI2L 1N34H 5KYLA 2UUCH 2KJXA 2NVQB 3TQYA 4PQXA 1SYGA 4Y7NH 1Y69U 1UNSA 4ZYSA 2QILA 2XIWA 3TRZA 3QD7X 1LTAD 2EIFA 3GTOH 2HHHH 1Y8OB 2WP8J 1WTOA 2MGSA 2Q8RE 4JBMA 2IX3A 4QCLA 4KK7A 5IYBH 1S5BD 4U673 4P74A 1SFOH 4BY7B 4JI2Q 4GKJH 3CMEA 4XT3B 2IPKD 4QUFA 5K5PA 3UDFA 4PMBA 2AMCB 1HXYD 1DGSA 4YY3L 3HOWB 3MWYW 2Y0SB 2JA7B 4JI5H 3ZJYC 1CUKA 1B3AA 1EZ6A 3CW2C 2UXDL 4NW2A 2K33A 2WKDA 4GLAC 3SEBA 3CQZB 3CF5A 2F0UA 2Z6KC 1JC7A 4A3MG 4JW0A 4CKCA 4CDCC 3M3YH 2EQSA 1GM5A 1EC6A 1WCMB 1PH9A 4YY3Q 5EBCA 5IGFA 1L0YB 4EQPA 3E6ZX 4CKEA 1PLFA 1V1QA 1DOLA 3T1YL 2DGRA 2XTIA 4C3HB 2R93H 1EQRA 1Q1EA 2UXDQ 3OSSD 3CPWA 3PCOB 3KFUA 1STAA 1Q7YC 5C6AA 4LF4Q 3S17H 4X3TA 4KHPQ 5FLXL 1SDFA 1AFPA 1PFMA 3RF2A 1AZQA 3S16H 2BE5D 3F8TA 1E2WA 2PQAA 3R93A 1G6ZA 1BCPB 2ID0A 4Q0FA 5FO8B 5KNBA 4LFCL 2B2TC 4QY7A 5C0XI 2NVTH 3IFTA 4FF3A 1A6XA 2B8GA 3T1YQ 3TREA 1CT1D 4LMQD 4TRDA 2VQFH 4JG2A 2A1AA 1NCVA 3K59A 1PXUA 5J39A 2A1SA 2RA4A 3J7AV 3M4PA 2WAQE 2WB1G 1ENAA 4B3ML 3GTPH 3S2HH 5IOCA 1IL2A 3DWQA 1L1OA 1KNAA 4DV4L 4IO9A 4LFCQ 4BBRH 3URYA 4XQNA 2UXBL 3GTGB 2LMCB 4J15A 4FNFA 4LFBL 5BN3A 3CCEA 4GN5A 1D7QA 1HQMC 3SDZA 2A6ED 3KLRA 1HNZL 4Y7NB 3HOVG 3HKSA 5CBEE 4B3MQ 3M9BA 4OX9L 4H44C 5F2DA 1X4NA 4OXPA 4DV4Q 3GTOB 1STBA 4KD4A 3VR3A 2UXBQ 1Q82C 4X62H 1SROA 3R2TA 2QNDA 4HEDA 4HCSA 1SLJA 3VYUA 5LMNL 1KNEA 1WTQA 4LFBQ 3ONAB 1B44D 4PV1C 2IX0A 3CHBD 4XDXA 4JI3H 1RDPD 1SFOB 2CTLA 5BN4A 2Z6KA 3IL8A 2A74C 1J5EL 1HNZQ 1HPCA 4NZTM 2MO1A 5JEAG 4IOAA 1ODHA 2PYKA 2QEXA 4OX9Q 4DUZL 1V1PB 3P75A 1VQLA 4LF9L 2IW3A 4CHTB 2I07B 2ZQEA 1X9ZA 4KHZA 2Z6BA 4DV0L 3TS2A 2Y3MA 1DT4A 2CPMA 4HSPA 5LMNQ 4O42A 5A2QL 4E9JA 2OCEA 2XGTA 2X06A 2A6HC 2XN9C 3I4NH 3J81i 1WTRA 4CDDC 1J5EQ 1HR0L 3PO2H 4QMFB 3ND9A 1PMRA 1XTDA 1X0AA 3J7AK 4DUZQ 1VQ5A 1S03G 1HZ9A 5GAGC 1TUAA 4NPSA 1TIID 4LF9Q 1FNWA 2E75C 2B2TA 4IPHA 4OHJA 4U68A 1XNRH 2ZXRA 1ET9A 3CCUA 4DV0Q 1TR5A 1O7LA 2R93B 1DCZA 3CKIB 3PIOA 3QO2A 1EOTA 3S17B 3FVQA 3OWEB 4JVHA 3PUWA 3RN5A 1HR0Q 4OO1G 3S16B 1B4OA 4IFDI 1BNZA 2RDHA 2E3UA 2HIVA 5J1ZA 3NCVA 4K6LA 1B8AA 4K0KQ 1NNXA 4JC0A 1XNQL 1G2TA 2NVTB 2B2YC 1GUOA 2NTSA 4LF7H 1KHIA 3GABA 1B3QA 4JV5H 3VR6A 2VZAA 1CZWA 4N8FA 1EEID 1WOCA 3EVQA 3S24A 4FXKC 1BBXC 1C8CA 2VKCA 3GTPB 1ESFA 1TWCH 2L12A 1SNCA 3GKUA 3DMUA 1FYCA 2F0PA 2G9HD 4DV6H 2ZJRA 3K81C 1XNQQ 5J3BA 4BBRB 1EY7A 5DT9A 5C3EH 4ZUIA 2KEDA 3BJUA 3A8IE 1DYQA 3QWNA 4ZKBB 2Q2UA 1IW7D 3FP9A 3MXGA 3F2DA 3VR4A 4A3BH 3BDLA 4PZ7A 3H3VI 3QR8A 4DUYH 2H4OA 1U4PA 3D4RA 1W3SA 3DM3A 1TS3A 1Z9FA 3F1ZA 2QEJC 1HNWH 3PIP3 3J81j 4G7HC 2E2IH 4JI6L 3I55A 4RG1A 3JAML 1GOZA 3I4LA 5LMUL 3JAMc 2JA5G 3ULJA 1FGBD 4I7AA 3H0GG 5C3WA 1FL0A 1B9MA 2R7FA 1VMPA 4JCVE 1W6JA 1GUNA 1I4XA 1O7ZA 4JI7L 1PYSB 1ICWA 3MXNB 2B8FA 4JI6Q 3RZDH 3O13A 2KUMA 2ATWA 3S2DH 3W1GA 5LMUQ 1VBIA 3MFGA 3CCSA 3I4NB 3I90A 4YCWA 3L9AX 1O7IA 3S1NH 3PO2B 5M3MH 1PRTF 1OXUA 2H5XA 5TSSA 5CORA 1C7YA 3QB3A 4AIMA 2ZXOA 3MZ5A 4A4IA 2XRQD 1WFQA 4JI7Q 1U4RA 2ZTEA 2B2YA 1SYEA 1GO3E 2R7ZG 2BA0A 1WD0A 1JJCB 3BG3A 2BH2A 4IPGA 2F0GA 1IKMA 3K80C 2CH4W 1EFWA 2E5LL 5JVH3 2UUBL 2EYOA 2OF1A 1SE3A 3VA7A 5KNDA 2F52A 1EQVA 1MI2A 1K9MC 4DR3L 3D31A 4LF8L 4BBSB 1HTLD 4CBVA 1RJTA 2KA7A 4RHRA 3L3OC 4NDXA 1S5DD 3HKZG 4YWLA 2QW7A 2XSCA 2CTKA 2HCCA 4PZ6A 1UEAB 4Q5VA 2E5LQ 2UUBQ 4BBRG 3NTIA 3HG9A 5IYCG 1ZYRD 1TWCB 2VUMH 3RUZA 2KQ3A 4J8QA 4LF8Q 2IHEA 1I4HA 1Y1VH 4KMUC 2PQAB 3A5ZB 2K1HA 1CSPA 1S20A 4OD6A 1R4QB 4DR5L 4MZ9A 1N36H 1E0BA 4UHVA 2LRRA 1SNMA 4A3BB 3N52A 1CA6A 4FO2A 3J80c 4L5SA 2F4VL 3FRPB 1UWVA 2RCNA 1VQDA 5ELBA 4DAPA 2E2IB 3NHHA 2M6QA 2AWNA 2O4XA 4LF5L 4ZLTF 1CI3M 4B3TH 1L1OB 4DR5Q 2BL5A 1ZZJA 1XPUA 4L6TB 2D9UA 2EY6A 1MGSA 2F4VQ 4WORA 3S9WA 1HUNA 2D9IA 4B9XA 1F9RA 2N3SA 5CV5A 3RZDB 3L0OA 1JE5A 2D5DA 1MSZA 3S2DB 4LF5Q 4JK1C 1PYWD 1Q46A 1YNJD 4A93G 3CP0A 2J0TD 4A3LH 1VQIA 3S1NB 1U4MA 1LUZA 2F0TA 5M3MB 2CQAA 2CW0C 1WE8A 4AYBE 1PTOF 3CRKC 3KK7A 3S14H 2VQEL 1GXDC 4X3SA 1C48A 3KDKA 3SR1A 1VIGA 4JI8H 3IFDA 1XPOA 5HGTA 1GVPA 1NUCA 3KBGA 2EYMA 2NWGA 4JI1H 1Q8KA 3W2DA 2N49A 5LHY1 2L55A 1MSHA 1PZJD 2KHJA 4BS9A 2LKVA 4A3MH 2N55A 4HMJA 2YU9H 2DJGC 1JOOA 3OYYA 4K8IA 4L5QA 4A3DG 3DWPA 1VQ7A 3SB1A 2WV6D 3P7JA 4R9WA 5HURA 4L5RC 1W2BA 4M1UB 3SE0A 3I0PA 1D1KA 1HZAA 3KOJA 5C3EG 2VUMB 5D14A 1VIHA 1VQMA 3PIO3 1MJEA 3G6JB 2QKIC 3FKIG 4QF4A
chains in the Genus database with same CATH topology
2EY2A 1YBYA 4LUZA 1E22A 5CV9A 2F0SA 1CQVA 2PNHA 1Y1VB 3ERQA 1JJGA 4XQQA 4IJLA 1BOSA 2Z1CA 2EYJA 3M4QA 3D6WA 2K01A 2PMZB 3V2TA 2PCFB 2PW5A 4A3KH 4ZRZA 3VKEA 2F0FA 2F4IA 1G291 3NBIA 5E4WC 2QGQA 5GROA 4YCVA 5IWAL 1Y14B 3HRZC 2V4DA 1O80A 1N32L 2OPVA 1NE3A 3UDGA 3K57A 4CJ1B 4YHHL 3I4MG 5E4XA 1BO0A 2JSOA 1HRJA 1B7YB 2BE5C 1K0RA 1EFID 3KLSA 4EQ5A 2R3ZA 3KLSX 4IUQA 1IL8A 4ME5A 1NMGA 1UE1A 5IWAQ 5FOBB 1O7YA 3OMGA 1VQAA 2PI2A 4ZK9B 1TWHH 2NN6I 1N32Q 3HOVH 4C2MH 4IOCA 3VYRA 1KC8C 1EYAA 1HUMA 5EAYA 1HJPA 4YHHQ 1K8MA 1VQFA 1H95A 2RSOA 1KABA 2NUCA 2C9OA 3L7ZC 1DZ1A 2K04A 4R4QA 1Q12A 3BZDB 3S14B 4X6AH 3A5UA 5I6WA 1SAPA 5JEAH 1PH3A 1G2SA 1V9PA 5J22A 2XVSA 4JYAL 4DR7L 2A6EC 1EY6A 2R6GA 4KKTA 1WTPA 1S5CD 3AMUA 3NWTA 5C5MA 5EPLA 3OW7A 1XTCD 1AEXA 1SBBB 3OHXC 3EIVA 2FJ2A 4KKSA 4HJ8A 4ZAIA 2K05A 2NTTA 2EDGA 1NBWA 1PFSA 4A3MB 4HIOA 4FYDA 4DGZA 2YU9B 4B3SQ 2R92H 2TSSA 5I4DA 2VY3A 4JYAQ 5E1FA 3TZDA 2RDGA 4DR7Q 1II3A 4IJHA 4DR1L 3NXWA 4LUVA 3TDQA 2WACA 2CTJA 1DOMA 2AWOA 1A15A 3KF6A 3HOUG 2XWBB 1PFNA 3FHWA 3P20A 3JC66 1RCVD 3MXUA 1K1GA 1JOQA 2PW7A 1XYIA 2Q2TA 4RGOS 4OO1H 2OXPA 3CC2A 4S3SA 5EPKA 3M7GA 3V69A 4A75A 2UXCL 3I91A 1K3RA 4DR1Q 1ZZKA 1E7ZA 1ASYA 3GO5A 4R1JA 4C1NK 4CKBA 4A3KB 1FGUA 2ZTDA 3STBD 4IQZA 5KGUA 3F2CA 2CCZA 5C4XG 4YWKA 1HHVA 2F0QA 2HHHQ 2F0IA 1D5MC 4KN4C 1S3OA 2WB1B 2JJQA 1IYUA 4RAUC 1EIFA 1XX8A 4ILWA 4J6HA 2MJ8A 2KECA 3SK4A 2PQEA 3HEJA 3TP8A 3J81E 2UXCQ 4IFDJ 1KLUD 4DV5L 1T5EA 1CKNA 1KTKA 4LUOA 1TWGH 1E1TA 1L1OC 4FXGC 4GNXA 2G9DA 5KYIA 4A3LG 4IALA 1TWHB 1SRUA 2ZJPA 3HOVB 4C2MB 2B2WC 1TY2A 1QILA 2WAQG 1VQ9A 4ID6A 4RKLA 4DV5Q 4F8MA 1SNPA 3PUVA 1EYGA 1X3EA 2JYOA 3NPPA 1A3UA 3SK6A 3DM1A 2JA5H 1SNQA 3H0GH 3BVGA 4A3IG 4OONA 3HS0C 1KXLA 3ITPA 1I50H 2WFWA 4BA1I 5JJIA 3KLWA 1EOVA 4LF4L 4ZUJA 1B70B 4KHPL 2K7VA 1IW7C 2KCMA 1PH4A 3SVMA 3GTJH 4DN4M 1K8OA 1DM0B 1J8IA 3FMCA 2HH3A 4DV1L 3MHBA 3K0XA 3W1BA 2J7ZA 2F0KA 2YV5A 3TBIB 2JXMB 1HZCA 2R92B 1HQRD 2MPMA 2ZM6L 1VQ6A 4TSSA 3TMEA 4RHSA 4HR7B 2V1CC 1XMOL 3TP7A 1K8AC 1I4GA 4X66L 5FLXc 2R7ZH 1EUJA 1U4LA 4WALA 3GD7A 2PNRC 1EY0A 4DV1Q 1STEA 4EVOA 3GTLH 2HDMA 4A3KG 1VQ4A 1BBWA 2ZM6Q 3C3LA 2LY7A 1CKMA 4OO1I 1F77A 3UE0A 4V0BA 4PZ8A 1XMOQ 2KBNA 4X66Q 3B6YA 1CM9A 2ES2A 1F2LA 2NZOA 3L2PA 1ET6A 2E74C 1JB7A 3Q6SA 1VCIA 1W6KA 4C56C 2B2WA 5IYCH 3A0JA 1XXGA 3G7LA 2HH2A 3H09A 3RLFA 1HZBA 1HTPA 1SJHD 5FO9B 2QDBA 2B2VC 2WIIB 4JOIC 3ULPA 1TWGB 4N9TA 2B39A 3ERSX 5DEHA 1X32A 4DV2L 2LFNA 4NXML 1C9OA 1KAWA 2NYZD 1F9QA 3C46A 2RSNA 2EYPA 5C44G 4DXFA 1PZKD 3HP3A 3KYHC 5FLMG 2K5NA 1Q3LA 1ZYRC 1K83H 5AFWA 2JA5B 1AP0A 4DV2Q 2M00A 3GV6A 1SMYD 4A3FG 3H0GB 4NXMQ 3R3OA 4DAMA 1I50B 5JJZA 4N9PA 4X64L 4G7OC 3KBXA 3A7AB 2F0OA 3LWEA 3K6OA 4DFAA 1I6VC 4KJOA 5ELDA 5IP9G 1F9SA 1RIPA 3M3YB 2VB2X 2R92G 2ALYB 1LLRD 3GTJB 2X6GA 2Z0SA 3WDNA 3MFYA 4NXNL 4K0KL 4P72A 1F2YA 2EPBA 1YVCA 5C4JH 4HIDA 4A93H 1EY8A 3M4OH 3IAYA 2K75A 3OTOL 3HOYH 5C5LA 2SNSA 5T1IA 2K5HA 3RR5A 4DK3C 2PZWA 1UE5A 4X64Q 3HZXA 2B2UC 4A76A 3U9OA 1N33L 2MNAA 3RN2A 1HFNA 3LWUA 3EBEA 1SE4A 1I3QH 2CTEA 2R7ZB 4KV6A 1AZPA 3SHLA 4ZKCB 2ZJQA 4NXNQ 4GN4B 3PUYA 4EGVA 1EU4A 1QB5D 1DD2A 4EX5A 1NMFA 1R4PB 3OTOQ 3T16A 3GTLB 3JAMi 3I73A 1IBLL 2MJHA 3AFQA 5CV8A 1NR4A 1YNJC 1N33Q 4UDUC 4WJ4A 2B2VA 4A3DH 4JOIA 1AN8A 4NKLA 5BN5A 1VQJA 2KCTA 1PH8A 1FD7D 4DUYQ 3HKZB 4C3JG 3S2HB 1I94L 2GN5A 4JVYA 4QIWB 3U58A 1ASZA 1LT4D 3TS0A 4NP5A 1VQEA 1NSNS 1HNWQ 1IYJB 1UEBA 1VQHA 1PDQA 3KF6B 4DKAC 1IBLQ 1P8LA 1L0XB 1CKOA 3BVZA 3S15H 3Q23A 1L0WA 2BDNA 1ENCA 3J81L 3FKIH 3UDXA 1SYCA 3UI2A 3NSWA 2Y0SE 2AQ2B 1I94Q 4MHEA 1X54A 4QQBX 3EFXD 4ULLA 3T53B 1J6QA 1LTTD 4KKUA 1X65A 3QJYA 2GVAA 1RKNA 1KL9A 1H9SA 5C3XA 4XYOA 1WI5A 5D3DA 2JP1A 1GUSA 4XYQA 2A68D 2K14A 4LW1A 4JBWA 1VS0A 2RHSB 3AFPA 4A3JG 4GLVB 1K83B 3I4MH 3DWAA 3CAMA 3NEMA 1G6PA 4QUCA 5EBDA 1CKNB 1Q90A 1BUVT 1EQQA 4B9WA 5BR8L 3CC4A 2B29A 2D0OA 3H15A 1TKWB 3C2PA 4Y52H 2K1BA 3D0FA 3BDOA 2B2UA 4GNXB 1JJ2A 1EIGA 2JA6G 3H94A 2JZXA 4QL5A 4M8AA 5C4JB 4A93B 2OWOA 1QJOA 3M4OB 3S1QH 4LNQA 2SDFA 3HOYB 2VB3X 4CJ2C 2F3VA 1MIUA 5FJ8G 1YZ6A 1PVOA 2KHSA 4AQYL 1LTID 1U9RA 4DAYA 5BR8Q 2KVMA 4A3GG 1ONLA 2DGYA 4XIGS 2JK8A 4L5TA 3J80i 1IBKL 1RD9D 2Z4IA 3CCMA 1I3QB 4DR4L 2E2HH 2IT1A 3CXCA 3AU7A 4IFDG 3PUZA 4DR2L 3H91A 2NB0A 1EQTA 2MO0A 3OIQA 1Z6HA 1QUQA 3NBHA 5EPJA 2AHOB 2FMRA 1LT5D 4AQYQ 1AH9A 2L9HA 3I2ZA 1QZGA 1KDAA 1JWSD 1F2MA 3GDEA 3U50C 1X3PA 4CJ0B 4QJFA 1IBKQ 5JAVA 4A3DB 1E2ZA 1QCBD 4DR4Q 3V05A 5IIFA 3DHQA 1WYDA 5CC4A 4DR2Q 3HOUH 2M2LA 4QB4A 5C3EB 4JI4L 2F0EA 4G7ZC 2A19A 1KDBA 4ALPA 1WTXA 3S15B 2AUKA 2HUGA 3FKIB 2NZ1D 2N78A 2HIXA 5M5XH 4IUPA 3MVVA 1PH7A 3E5SA 2L11A 2F0JA 2JVZA 2B63H 5C4XH 4LWCA 2LXJA 4JI4Q 4DR6L 1QG7A 5M5YH 4GN3B 4KD3A 4OL7A 4EQOA 2UUAL 4LF6L 4H7BA 1M8AA 3OWFA 3G4SA 1KHMA 4R4OA 1B53A 3I4MB 1CHPD 1MBYA 2F0MA 3EJIA 1CA5A 1R9TH 4A3EH 1BCPF 1S5FD 1FJGL 1QNUA 3PMFA 4KY6A 1EYDA 2F0NA 3R2IA 4DR6Q 1I6HH 1UE7A 3MEFA 2L0CA 3C1FA 2OQ0A 1KAAA 4LF6Q 2RBMA 2UUAQ 2RDFA 5ELFA 3HOYG 1D8LA 1QVCA 5COYA 1RODA 4L63B 1GHJA 4UP7A 1RTNA 5EJWA 4POGA 1I4PA 3CCRA 5ELCA 1TWAH 3S1QB 1ZTGA 1KDCA 1PH1A 1FJGQ 3K5MA 3TP6A 3RD4A 1TVXA 3DEOA 1IYVA 1JE4A 2K6AA 5CV4A 4A3IH 1QVFA 1X56A 4PG3A 3ND8A 5G3LF 4B3RL 1SR3A 2E2HB 1Z7TA 3KDFB 1PRTD 3TN2A 1X3GA 4DNIA 3DXJC 4GOPB 3GTKH 2AUJD 2PZUA 3NP8A 2EXZA 1TU2B 1TWFH 2IX1A 5CMDA 3P1HA 4B3RQ 1SNDA 3IKJA 2H1EA 3A55A 4OGQC 3NTKA 4JI0L 3OOCA 3HOUB 4X3UA 1STNA 3BU2A 5CGKA 3BZKA 4BA2I 3X3NA 2NVYH 3ZYYX 1OXVA 4HJ5A 4UP8A 2OTLA 2HQLA 1M1KC 2DN8A 4A3CG 4X65Q 3K7AH 2BCOA 4X3KA 2I5MX 1OXXK 2ICEC 1GUTA 1IXRA 1L2FA 2B3GA 3AQQA 3LGJA 1CZGA 5M5XB 3GP7A 3PV0A 1I4QA 4JI0Q 4FF4A 4BXXG 3J7A5 2CVRA 2CWPA 2B63B 4Z9CB 5C4XB 3ULLA 2PZTA 5M5YB 1H9MA 1D5ZC 2EE1A 2PO4A 4K2KA 4DK6C 1B2TA 3LX0A 2SEBD 2K5QA 4G4KA 5IGBA 2O5JC 4WJWA 4YCUA 2DY7A 5C0XJ 4P73A 3MAQA 2OTJA 1H9JA 1EL0A 2R61A 2NZHA 1FR3A 3CCJA 1DONA 1R9TB 3HGBA 3F2UA 3K0YA 1A62A 1TS2A 1Z47A 4JBKA 1PH5A 2QCPX 1I6HB 2JEBI 3CCVA 1ZEQX 4HSVA 5NUCA 2A73B 1WVLA 1YHBA 5C44H 4P2CB 2Q8TA 1H9SB 2WAQB 1UE6A 4GNXC 3GQBA 4HJAA 1QE6A 1TWAB 1J9OA 1V8QA 2YTYA 5LL6X 2A69D 5FLMH 4B3SL 1BCPD 4UY8C 2F0LA 1ZZIA 2ZXPA 3T13A 1PFBA 1D2BA 1DOKA 5D65A 1K8GA 4DV3Q 4K5VA 4A3FH 1OO9B 4A3IB 4DV7L 1C0AA 1GKHA 2J4XA 3W3AA 3J7YW 1RL2A 1EWIA 3CCLA 3E9IA 2OEOA 2ZT9C 1PTOD 1AW7A 2EYHA 3KJOA 4HIKA 1YHQA 5IP9H 2DY8A 5IY0A 2JA7H 2C5CA 3GTKB 4C3IG 1E24A 2ANNA 1N9WA 1TWFB 1N34L 2UUCL 2ASBA 4DV7Q 1AE3A 2K5VA 3EN2A 4R4TA 2YQRA 2HHHL 3Q22A 5IGEA 4DAYB 1SYDA 1CHQD 1SMYC 4KLKA 3HOZG 1A8VA 4LJZC 1JR0D 5DM63 1S4ZA 4P75A 1JB3A 4K2LA 2ICIA 2NVYB 1N34Q 3BS1A 4GKJL 2UUCQ 3K7UC 3E0EA 1VQ8A 2AQ3B 4RGMA 4B8TA 1QUQB 3NBHB 2B63G 4FF2A 2JEAI 3MC0B 5CBAE 3NQIA 4POFA 2K32A 4JI5L 1Y1WG 1VQGA 2CTMA 4C3JH 4PNYA 1CQFA 1VQKA 4GKJQ 3J7AF 1PTOH 2CTFA 4A3EG 1F2ZA 4MTNA 1JORA 4DF7A 2JA8G 3H6MA 4JI5Q 4MN3A 1LM0A 1EIYB 2JA9A 4R4IA 2HCIA 2VXWA 1QWYA 1EWCA 3FPPA 4DU9A 5M3FH 1VQCA 1VQNA 3PF5A 4FF1A 5IP7G 2O2LD 3U9SA 3QOJA 1ZXTA 4TQUS 5C44B 5ELEA 1BR9A 2JE6I 5GAEC 2Z8LA 3ICEA 3JAME 4A3JH 1PZID 2VQFL 1LYLA 3GTQH 1OXSC 4OWXB 2KEEA 3BDCA 4EQNA 3MA2B 4OWTB 4A3FB 3A74A 3PUXA 1EIHA 4XQJA 3FPUB 3TZUA 1F9PA 1DJRD 5IGDA 1X6OA 3PO3G 4XT1B 5JPNC 1VF5C 4YWMA 2FXQA 5IT9E 2VQFQ 2JA6H 1S5ED 2PMZE 3A8KE 2A68C 3LNNA 1TXYA 2AQ1B 1SE8A 4GOPC 5DNFA 2BH8A 3HOXG 3I3CA 4FP5D 1LTBD 1TY0A 2QA4A 5FJ8H 1YNND 4WRDA 2NVXH 4A3GH 2HQEA 2RKSA 1RF2D 3QG1A 3MTSA 4I65A 4J1MA 2RF4A 4X62L 5A35A 5CYUA 2Q2HA 2L1BA 3DLLA 1D1IA 5EGTA 5T1GA 1KRTA 1D5XC 4IFDH 4JI3L 2E2DC 1A2TA 2FINB 1B1ZA 2SOBA 2FMCA 4F7XA 1WJJA 4CGYB 2NBFA 1LTRD 4HJ7A 2DNEA 2Z4HA 3CD6A 1QOHA 4O1NA 1H9RA 4V190 1HA6A 1JQYD 1KQSA 4FXDA 5AJ3L 4X62Q 2F0WA 4XTCS 4RGNA 4C3JB 4JI3Q 4C1NI 1MSGA 1X55A 2IHFA 3W5OA 3RZOH 1LT3D 4KHVA 1PTOB 4DPGA 1OTCA 4BY1H 2FMMA 3OMCA 1SJED 2SNMA 4HIMA 4HN7A 1XNRL 3K5OA 1X9NA 2EXDA 5AJ3Q 4RKBA 5IODA 5JOBA 5CV7A 5CR3A 1Q8IA 3H3VH 3TSSA 2GA4B 4QMGA 5M3FB 3K58A 1ILPA 2D0PA 2HDLA 3D4WA 1NJIC 3J80E 3D8GA 3TEHB 1YI2A 1PH2A 1VQOA 4FDBA 4L8JA 5DLQE 1V1OA 1JICA 5E7NA 2BA1A 3SK8A 3RNUA 1XNRQ 4BY7G 4LF7L 3CMAA 1XJVA 4JV5L 4KY7A 5I9PA 1SE2A 4A3JB 1JWUD 3KDFA 1SXTA 1X3QA 3GTQB 1KLGD 1UUPA 4ODGA 1D6EC 3D3RA 3HOWG 5ELNA 2Y0SG 4GOPA 4WFN3 1NY4A 2KCNA 1T5XD 4MNOA 2JA7G 5CV6A 2IY5B 2KHIA 4OWWB 3DUZA 4DV6L 4PMWA 1HFGA 4LF7Q 4QGUA 4JV5Q 4UAIA 5D3IB 1BBUA 3M7NA 5K36G 2AKWB 2JA6B 3WOFA 1WCMG 2L4NA 2ZTCA 1XPRA 1Q1BA 3K5NA 1WD1A 4K14A 2YYZA 3VYTA 4C3HG 2WB1E 4DUYL 2NVXB 1IZ6A 4A3GB 1IHZA 1SYFA 4DNRB 4DV6Q 1HNWL 2RVLA 5C0XG 5ELOA 5I2YA 2X69A 1YNXA 1CFMA 3HFZB 4NMZA 4H02A 5HGQA 3A56A 2CQOA 2K4KA 1Q81C 1UAPA 1GUGA 1YJNA 4ZQ3A 3NWSA 5KRUA 1EU3A 2BOSA 5LL6S 4R4CA 4BBSH 5DAUA 2DNCA 1C4QA 2VNUD 4AYBB 4DA2A 3GV3A 1LTGD 1B50A 3F2BA 2OPUA 2XRSD 3KF8A 1EEFD 3RZOB 1VF7A 4IUNA 1FNVA 4BWGB 4IURA 4K6DA 3J81c 2K5DA 1JWMD 4BY1B 1TT2A 4F88A 1PRTC 1ILQA 4I7ZC 1PYBA 4RMFA 5M3FG 3VDYA 1X4MA 1NR2A 2F1MA 4A3CH 2EYLA 3A7LA 1K73C 1Y8NB 2LSSA 3I70A 1JMCA 4BXXH 2P2RA 2F03A 3S1RH 3MEHA 1ML0D 1G8ZD 2MP1A 2TMPA 3M4YA 3Q8DA 5IYBG 4JBJA 4DK0A 1WTVA 3OIPA 2N88A 1PA6A 1IKLA 5JVG3 3PSIA 3NTHA 3NQTA 2CHBD 1KRSA 1OXTA 3OPOA 5KIXA 4H13C 3MXPA 1ENFA 2I0QA 2RHQB 1EY9A 2QF7A 1LABA 1SN8A 1LTSD 2BDOA 1LACA 1I5FA 1SSOA 3BYTB 3RLNA 3R8BA 3AEVA 4RGTA 1TS4A 4IUTA 1ESRA 4RH6A 5IT9L 3RMHA 5IT9c 1N36L 3GTMH 2VS1A 4H0LC 1MD2D 1STHA 2F0VA 3U4VA 3VR5A 1S72A 2R93G 2CFMA 5IGGA 3G71A 2OQKA 5EKLA 1YIJA 1VDZA 1BF4A 4WANA 3T51B 3UDIA 1LV9A 2XNAC 1NAPA 4B08A 4B3TL 1A0IA 3I72A 1N36Q 3BVMA 4AYBG 4C3IH 2K5WA 4K5XA 4XXEA 2XWJB 2N8NA 1HH2P 1TQOA 1EY4A 3VYSA 5C4ZA 2KCCA 2A69C 1M90C 4UP9A 1BCPC 4O2DA 1V43A 4BY1G 3VR2A 1O78A 2A8VA 4B3TQ 4KY5A 3HOZH 2EY5A 5ISRA 4ABNA 4DNTB 4E6IA 1ZKOA 1PTOC 4RFBA 4DR3Q 3A54A 2EVBA 3FDTA 3NE5B 1GD7A 4JI8L 1CK1A 5IYDH 3N6RA 2PI2E 4WJ3M 3WOEA 4MIUA 1SNOA 2A6HD 4IPCA 1E2VA 4JI1L 5M5WH 1HCZA 1Y1WH 2X6LA 3U4ZA 3J80L 3A8JE 1QVGA 3NUCA 3S1RB 4RCNA 3M85A 3EQLC 2C35B 1BKBA 4JI8Q 4GLXA 1SMXA 1N8RC 2I5LX 2JA8H 2PY9A 2DUDA 1SYBA 4JI1Q 1J4WA 3STBC 5LMNW 1PV4A 2NN6H 2KOLA 1B9NA 4IPDA 1Y8PB 4HTHA 1FNUA 4HCEA 5IP7H 3PF4A 1A3VA 2RQXA 3I4NG 2EJFC 3I8ZA 4DAVA 1VQBA 3PO2G 1STGA 1QNKA 3D6CA 1SEBD 2D62A 1H9KA 3KUPA 2CKZB 4PMCA 1U5KA 3HKZE 2PQUA 1HA5A 3GTMB 4QIWE 1YJ9A 5KEEA 1G91A 4P71A 2IJ0A 4K5WA 1G51A 5FO7B 1M4VA 1HR0W 1HNXL 1RHPA 2Q2IA 4NBQA 1JCKB 4YIJA 1BDOA 3DEPA 4GKKL 5I2XA 1E1OA 3E0JA 2E8GA 1EZ8A 3PO3H 4BBSG 1MKHA 2O5IC 1I4RA 4X65L 4O0AA 4GZYC 4C3IB 5HY6A 3OSOA 2EJMA 3Q24A 4KI0A 2MFIA 4HAEA 3SXHA 2E2JH 1NTGA 3BYYB 3HOXH 1HNXQ 1P16A 2VQEQ 3T1HL 2UU9L 1A2UA 2HT1A 1PHJA 4GKKQ 5JPMC 3S1MH 5JEAJ 5FLXE 3NK9A 3I7FA 2IL8A 2K28A 3TP5A 3PGZA 3HOZB 5E3FA 3UE1A 5IGCA 1CTMA 3IRBA 4LFAL 5JJLA 1BQQT 2FHTA 3I56A 4LK1C 1E3PA 2Q8IB 1GUWA 3T1HQ 4DXGA 2UU9Q 4AH6A 4A3BG 2GVBA 2WKCA 3T4AC 2ANRA 3D4DA 3SK5A 2LXKA 2F0HA 1STYA 4APVA 1JT8A 3CU7A 4OIJA 2OT2A 3K5LA 4IUUA 5M5WB 1Y1WB 4IZ8A 1YNNC 3QIAA 3H3VC 4LFAQ 4LIJA 2F3WA 2PPBC 4TKOB 2ENBA 3AB9A 3FEWX 3I4OA 3AYHB 3VA5A 4A3EB 3KF8B 1VMCA 2MHVA 1V1PA 5I9OA 5EQ0A 4DV3L 5DM73 2JA8B 2F3IA 1A63A 1DTJA 3BZCA 4AM3A 2NVQH 3KJPA 3K8AA 2MUYA 2VL6A 1EY5A 1X3FA 1TS5A 3ER0A 4TVAB 5C4HA 1LO5D 3EROA 5M3MG 4ME3A 2I46A 1EWHA 3OW2A 4BY7H 1S40A 3EA6A 3CPFA 4HMIA 1IBML 2EY1A 4HJ9A 5JJKA 4KN7C 5KNCA 4RWSC 1XWEA 1U0LA 3E9HA 4RA8A 3HOWH 2IWHA 1AE2A 1YJWA 5GQOA 1XMQL 4K8JA 4G57A 3WWVA 2FFKB 1QZHA 5A2QE 5IE8A 1YITA 1VQPA 1YEZA 3CCQA 3CQZH 2CWAA 1T9HA 3T56B 3PO3B 2EYFA 1IBMQ 4R8NA 5K36H 3AEVB 1FVIA 5G3LD 2AXYA 4KTAA 1J5KA 1WCMH 2E2JB 3CC7A 1KD1C 1DXMA 2MQHA 4IUVA 2D2CC 2K50A 4OIKA 3HOXB 1XMQQ 2K52A 4KJNA 3J7ZC 1A3TA 2M9VA 4C3HH 3U1KA 3S1MB 3NELA 1WTWA 2VW9A 2VUMG 3G48A 2E76C 5GADC 1PH6A 2JQOA 3QOLA 5I6YA 2K03A 1CSQA 5C0XH 1GJXA 2A5HA 1JOKA 3K7AB 2LS01 2YTXA 5IYDG 3Q0AA 4DK1A 5GAHC 2L5TA 5EKIA 1Y1VG 3RLOA 2I5HA 5M9OA 4UPAA 5H1SE 3SGIA 1BXTA 1KIXA 1MJCA 1LT6D 4R8IA 2EOTA 2EZVA 1WVNA 2KENA 2EJGC 3C1EA 4FVMA 1PRTB 3PIPA 2WINB 4GS3A 3G6EA 4LAAA 2R7DA 1EYCA 4RCOA 1LTLA 2YTVA 1BVSA 3V96A 5FK9C 2CW0D 2F0DA 2CPQA 1RTOA 1GHKA 5EKKA 4F87A 4NB3A 4IN3A 1YHAA 3GTGH 3CRLC 3X3MA 5FKAC 3NENA 2NN6G 2L15A 1Q86C 3MXNA 4JI2L 5KYLA 2KJXA 2NVQB 3TQYA 4PQXA 1SYGA 4Y7NH 1Y69U 1UNSA 4ZYSA 2QILA 2XIWA 3TRZA 1LTAD 2EIFA 3GTOH 1Y8OB 2WP8J 1WTOA 2MGSA 2Q8RE 4JBMA 2IX3A 4QCLA 4KK7A 5IYBH 1S5BD 4U673 4P74A 1SFOH 4BY7B 4JI2Q 3CMEA 4XT3B 2IPKD 4QUFA 5K5PA 3UDFA 4PMBA 2AMCB 1HXYD 1DGSA 4YY3L 3HOWB 3MWYW 2Y0SB 2JA7B 3ZJYC 1CUKA 1B3AA 1EZ6A 3CW2C 2UXDL 4NW2A 2K33A 2WKDA 4GLAC 3SEBA 3CQZB 3CF5A 2F0UA 2Z6KC 1JC7A 4A3MG 4CKCA 3M3YH 2EQSA 1GM5A 1EC6A 1WCMB 1PH9A 4YY3Q 5EBCA 5IGFA 1L0YB 4EQPA 3E6ZX 4CKEA 1PLFA 1V1QA 1DOLA 3T1YL 2DGRA 2XTIA 4C3HB 2R93H 1Q1EA 1EQRA 2UXDQ 3CPWA 3PCOB 3KFUA 1STAA 1Q7YC 5C6AA 4LF4Q 3S17H 4X3TA 4KHPQ 5FLXL 1SDFA 1AFPA 1PFMA 1AZQA 3S16H 2BE5D 3F8TA 1E2WA 2PQAA 3R93A 1G6ZA 1BCPB 2ID0A 4Q0FA 5FO8B 5KNBA 4LFCL 2B2TC 4QY7A 5C0XI 2NVTH 3IFTA 4FF3A 1A6XA 2B8GA 3T1YQ 3TREA 1CT1D 4LMQD 4TRDA 4JG2A 3K59A 1NCVA 2A1AA 1PXUA 5J39A 2RA4A 3J7AV 3M4PA 2WAQE 2WB1G 1ENAA 4B3ML 3GTPH 3S2HH 5IOCA 1IL2A 3DWQA 1L1OA 1KNAA 4DV4L 4IO9A 4LFCQ 4BBRH 3URYA 4XQNA 2UXBL 3GTGB 2LMCB 4J15A 4FNFA 4LFBL 5BN3A 3CCEA 4GN5A 1D7QA 1HQMC 3SDZA 2A6ED 3KLRA 1HNZL 4Y7NB 3HOVG 3HKSA 5CBEE 4B3MQ 3M9BA 4OX9L 4H44C 5F2DA 1X4NA 4OXPA 4DV4Q 3GTOB 1STBA 4KD4A 3VR3A 2UXBQ 1Q82C 3R2TA 1SROA 2QNDA 4HEDA 4HCSA 1WTQA 3VYUA 1SLJA 1KNEA 5LMNL 4LFBQ 3ONAB 1B44D 4PV1C 2IX0A 3CHBD 4XDXA 1RDPD 1SFOB 2CTLA 5BN4A 2Z6KA 3IL8A 2A74C 1J5EL 1HNZQ 1HPCA 2MO1A 5JEAG 4IOAA 2PYKA 2QEXA 4OX9Q 4DUZL 1V1PB 3P75A 1VQLA 4LF9L 2IW3A 4CHTB 2I07B 4KHZA 4DV0L 3TS2A 1DT4A 4HSPA 5LMNQ 4O42A 5A2QL 2OCEA 2XGTA 2A6HC 2XN9C 3I4NH 3J81i 1WTRA 1J5EQ 1HR0L 3PO2H 4QMFB 3ND9A 1PMRA 1XTDA 4DUZQ 1VQ5A 1HZ9A 5GAGC 1TUAA 4NPSA 1TIID 4LF9Q 1FNWA 2E75C 2B2TA 4U68A 4OHJA 4IPHA 2ZXRA 1ET9A 3CCUA 4DV0Q 1TR5A 1O7LA 2R93B 1DCZA 3CKIB 3PIOA 3QO2A 1EOTA 3S17B 3FVQA 3OWEB 4JVHA 3PUWA 4OO1G 3RN5A 1HR0Q 3S16B 1B4OA 4IFDI 1BNZA 2RDHA 2E3UA 2HIVA 5J1ZA 4K6LA 1B8AA 4K0KQ 4JC0A 1XNQL 1G2TA 2NVTB 2B2YC 1GUOA 2NTSA 1KHIA 3VR6A 2VZAA 1CZWA 1EEID 3EVQA 1WOCA 3S24A 4FXKC 1BBXC 1C8CA 3GTPB 1ESFA 1TWCH 2L12A 1SNCA 3DMUA 1FYCA 2F0PA 2G9HD 2ZJRA 3K81C 1XNQQ 5J3BA 4BBRB 1EY7A 5C3EH 4ZUIA 2KEDA 3BJUA 3A8IE 1DYQA 3QWNA 4ZKBB 2Q2UA 1IW7D 3FP9A 3MXGA 3F2DA 3VR4A 4A3BH