2JE6I

Structure of a 9-subunit archaeal exosome
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
215
structure length
207
Chain Sequence
b'QEIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKSIFVANNGRIWAFSEEILIEAIRKIENESHIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
publication title RNA Channelling by the Archaeal Exosome.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 39
structure length 207
sequence length 215
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2je6I01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2je6I02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2je6I03
4LF6Q 1OXUA 4YCUA 2NVQH 1W2BA 1VF7A 4JBKA 2VZAA 3UDGA 3L2PA 2MO0A 1H9KA 4A3GH 4JI0L 1JE5A 1YVCA 3PO2H 3V69A 4JV5Q 5A35A 1PVOA 3I55A 2IHEA 4PV1C 1YBYA 2OPVA 3H0GH 1HNZL 4X66Q 4LFBQ 1EUJA 4B3RQ 1DXMA 2O5IC 1SLJA 1TUAA 2CTJA 2EJFC 5IP9G 1HCZA 1SMXA 2DNCA 2R92H 4YWMA 2E75C 3NEMA 1AH9A 1DD2A 2P2RA 4RG1A 3HOWH 2MNAA 2JA6H 2HIVA 2WP8J 4NBQA 1K8GA 4KHPL 3TQYA 1VQPA 3ERSX 5C3EH 2R7ZG 4IJHA 4GKKL 3FPPA 5IP7G 3FMCA 3CD6A 1DTJA 1VQJA 1E2WA 4DV6L 2KCCA 2GVBA 4TQUS 2ALYB 2V4DA 4A93G 4MNOA 3T1HQ 2E3UA 4YCWA 1KRTA 1QZHA 3J80c 4LF8L 1FL0A 1PHJA 1Z6HA 3IRBA 4LF5Q 3RNUA 1MJEA 1GD7A 2JA9A 2PPBC 2O5JC 4JI5L 3M7NA 3K8AA 1Y1WH 4XIGS 3STBC 1VQLA 1I6VC 3E9IA 2BA1A 3A8IE 2ANRA 3H94A 2N78A 2PQUA 1I3QH 4IPCA 4A3LH 1K0RA 4QGUA 2DN8A 1VQFA 3CPWA 4JI0Q 3KLWA 2AXYA 4NB3A 1VQHA 4GOPC 3TS2A 1VQCA 4HIOA 2I5MX 2RHQB 1EQRA 3AEVA 3I73A 2IY5B 1IW7C 1VQMA 1HNZQ 2NZHA 2R7FA 4GLXA 1A6XA 4A3DG 2UXBL 1IYUA 2K5NA 3M4PA 2NN6I 1ZZIA 2KA7A 5JJKA 1EIYB 2A68C 2ASBA 4IO9A 3K0XA 3VR6A 3KYHC 4GZYC 3W5OA 3H3VI 4KHPQ 4A3FH 4DR3L 3KJOA 3PCOB 4GKKQ 3I2ZA 3G6EA 5IT9c 1NY4A 4H02A 4X65L 1VQ5A 4LW1A 4DV6Q 1X55A 3U9SA 3J81c 2VL6A 5IYBG 2UXCL 2KBNA 1JMCA 1S40A 1VQ4A 1L1OC 3U1KA 5E7NA 3M85A 1CSPA 1VQAA 1PH1A 4LF8Q 3GTMH 4JOIC 3AEVB 1PYSB 5C0XI 2BE5C 2CTFA 1M1KC 2JA7H 4P71A 3AYHB 4B8TA 4B3ML 1EWHA 1PH2A 3RLOA 3CC2A 4HJ9A 1L2FA 2ZM6L 4JI5Q 1H9RA 3DLLA 1ZZKA 2R6GA 4BXXH 1GO3E 2VY3A 2DNEA 1YNNC 1OXSC 4BBRH 3GTPH 3UDFA 1VQGA 1SR3A 1WCMH 1FJGL 1PV4A 2PI2E 3TEHB 4DV2Q 3CPFA 1TWFH 3LWUA 4A3JG 4A3MH 3TS0A 3PUVA 4KN7C 2UXBQ 3I4MG 3A74A 2K50A 1D7QA 1L1OB 1Y8NB 2AMCB 1JJ2A 3AB9A 2KHJA 3A7AB 4DPGA 1X4NA 2EXDA 1QVGA 1YHQA 1Q12A 3IFTA 2R93G 4WJ3M 4JI1L 1XPOA 1OXXK 2JA8G 4DR3Q 3S16H 1TWCH 5BN3A 4IPHA 3KF6A 2NN6G 3HOYG 4MZ9A 2MJHA 3BZKA 4BY1H 3UDIA 1VQIA 1PA6A 3MEFA 1MJCA 3KLRA 3S1MH 2A6ED 3I7FA 3LGJA 1E1TA 4G7HC 4B3MQ 2PY9A 1XTDA 4OO1H 4JI2L 2JZXA 3HOUH 1UE1A 1BKBA 3CCSA 1G51A 1PH9A 3M3YH 3CCQA 1GUTA 2JK8A 3E9HA 2NZOA 1V43A 1FJGQ 5C0XG 4R4QA 3W1GA 2RCNA 1Y14B 1IBKL 3KF6B 2YYZA 3CC7A 3VDYA 4LIJA 3HKSA 1B7YB 1Y69U 2K14A 4C3IH 2E76C 4QJFA 4L5SA 3VA7A 3ER0A 2A8VA 2LSSA 1L0WA 2VQFL 4JI4L 4DV5L 4A3BG 2E2IH 2JJQA 2JQOA 4LJZC 3GTKH 3JAMi 2AHOB 2QGQA 4A3EG 2NVXH 1XMQL 2L5TA 5FLXc 1PH8A 4QMFB 1WVNA 2E8GA 4TVAB 1HZAA 2CFMA 4JI1Q 1EYGA 3CRKC 2KCMA 3PSIA 2C35B 1TKWB 3ND9A 4HIMA 1E3PA 4AQYL 2ID0A 5GAHC 5FJ8G 3NENA 5M5XH 1HR0L 4BY7H 1HH2P 1QVCA 3SE0A 2QF7A 3HOZG 1XPRA 1IYVA 1TXYA 1Q81C 4GNXA 3VR4A 4NXNL 2I0QA 4BBSH 4GLVB 2YTXA 2JE6I 5IP9H 3RR5A 4JI2Q 3FKIG 1G291 2PNHA 1LABA 4C3HH 2CQOA 4Y52H 3F1ZA 3VR5A 1VQEA 3GTLH 4OGQC 4C2MH 2R7ZH 3EN2A 3IKJA 3CP0A 3KOJA 2ES2A 4HJ5A 1VIHA 4PZ8A 2JEBI 1BBUA 4O0AA 1GVPA 1C7YA 4H44C 1K3RA 1KC8C 1IBKQ 3VKEA 2HT1A 4KN4C 3HKZG 1T5EA 4A3IG 3S1QH 5C44H 1W3SA 2E74C 1K8OA 1A63A 2A6HC 4DV7L 3CCUA 4GNXB 5M3FG 4G7OC 5GADC 4HJAA 3OOCA 4KKSA 4JI4Q 4DV5Q 4OWXB 3AFPA 1XMQQ 5FLMG 2OWOA 1GUSA 5K36H 1FGUA 3WWVA 3T1YL 1X54A 1UE6A 2K32A 4KLKA 2CTLA 4DR5L 3EQLC 4DK1A 4OWWB 1N36L 4AQYQ 4A3CG 4A4IA 2XTIA 2E2HH 1Q46A 3S1RH 4LFCL 5JJLA 4OWTB 4X62L 1VQ9A 3PO3G 4NXNQ 3GDEA 5GQOA 2AUKA 3M4YA 1EOVA 2GN5A 5HGQA 3F2CA 3OW7A 3I56A 2CTKA 4ME3A 5M5YH 2WB1E 2IHFA 5IYCG 4FDBA 5M3MG 3A8KE 2UUCL 1GJXA 3P20A 4IFDH 3CAMA 1BDOA 3GTGH 3LNNA 4LUVA 1EWIA 1G6PA 1B9MA 5IWAL 2Q2TA 5IYBH 4JBJA 1Q86C 3CC4A 1Y8PB 1VDZA 2ZTEA 1HTPA 3BG3A 3CCVA 1V8QA 2JA5G 3PUWA 1EFWA 1GUNA 4R4IA 1TWHH 3STBD 5C0XJ 3M4QA 5JEAJ 1X3EA 1NJIC 3GTQH 5C4XH 1J5KA 1J4WA 3GTJH 5BN4A 1M90C 2UU9L 3T1YQ 5IYDH 1T9HA 1XJVA 4JI8L 2ZT9C 4DR5Q 2CTEA 1NMFA 1N36Q 4A3GG 2NVYH 1KAWA 4PZ7A 1QZGA 2ZTCA 2EVBA 4GOPA 3MXUA 5DLQE 1IW7D 1NBWA 2OQKA 1KHMA 4UP8A 4YY3L 2PCFB 1DT4A 4LFCQ 3H0GG 4C3JH 3WDNA 3D4RA 4X62Q 1VF5C 3ND8A 1AE3A 3Q8DA 3KJPA 2A68D 2F3IA 1J5EL 1Z47A 4DUZL 4DAYB 3RN5A 2WAQG 2VUMH 4DAMA 4ALPA 3PUYA 3F8TA 2K33A 2DUDA 2Y0SG 3HOWG 4YCVA 3A8JE 2R93H 5LMNL 1Q1BA 4XTCS 2UUCQ 1H9SB 5C3EG 1B8AA 1YNXA 2Q2HA 2AUJD 4GN4B 1Q8KA 2DGRA 2D0PA 4JYAL 5IWAQ 2A69C 2NN6H 1L1OA 1X3FA 1YJNA 4IPDA 4KKTA 4GOPB 5GROA 3FHWA 1Q7YC 4G7ZC 3BJUA 4JOIA 4DUYL 1YHBA 3W1BA 2CWPA 2CCZA 2B3GA 3DM3A 3RLNA 3F2DA 4HJ8A 3CCEA 1N8RC 5HY6A 1VQ6A 1P8LA 2HQLA 1Y1WG 2B63G 4L5RC 1XMOL 1WI5A 2UU9Q 4A3LG 2CPQA 4GN3B 4JI8Q 2YQRA 5AJ3L 3CCMA 5JEAH 4JBWA 1MIUA 1N32L 1KIXA 4YY3Q 1I50H 4IJLA 3F2BA 4HIKA 4K0KL 2K7VA 1GM5A 2LMCB 1WJJA 3G4SA 1GHKA 5J3BA 1J5EQ 2AWOA 4QY7A 3I72A 4DUZQ 1TWAH 3N6RA 4BA1I 1CUKA 1Q90A 1XNQL 4A3EH 2EJGC 2Z6KC 2B29A 2UUAL 2F4VL 5LMNQ 4A3FG 4X65Q 2ZJPA 3A0JA 2FXQA 4QIWE 4OO1I 4DV4L 1ZKOA 3CMAA 4R1JA 2UXCQ 3FP9A 3CCLA 4JVHA 3KDFA 4JYAQ 3K81C 2RHSB 3BU2A 2D2CC 1X9NA 1YZ6A 1K83H 3KFUA 3M4OH 4DUYQ 1PMRA 2JA7G 2ZM6Q 4LF9L 1Y1VH 2N3SA 2Q2UA 1HPCA 1TU2B 1YJ9A 1CTMA 4BXXG 4JK1C 1HNWL 1E22A 1SN8A 1HR0W 4BBRG 1LACA 3QG1A 4JBMA 1A0IA 4HIDA 1WCMG 2QA4A 1E7ZA 1IYJB 5AJ3Q 4LFAL 1B9NA 1N9WA 1N32Q 3KDFB 1YHAA 4A3MG 1SRUA 1X4MA 3D31A 3J81j 2D62A 4JC0A 1HNXL 1IBML 4K0KQ 1YNJC 3G48A 2E5LL 4B3SL 4LF7L 2D0OA 3HOVH 1LUZA 1HZ9A 4AM3A 2I5HA 2K5HA 1ZZJA 1A8VA 1K1GA 3ICEA 3H15A 1XNQQ 3T53B 1K9MC 5FLMH 1I6HH 1CFMA 2JXMB 4OXPA 2UUAQ 4KHZA 2F4VQ 1HZCA 2H5XA 1K8AC 1EC6A 1TWGH 2AWNA 4P72A 1LTLA 4DV4Q 3UDXA 4H0LC 2VNUD 3CF5A 1X65A 4A3CH 1UE5A 5ELNA 1Z9FA 1OXVA 3BDOA 4OONA 1WOCA 3J80i 4OX9L 2A1AA 3VR3A 3PUZA 1FYCA 3KF8B 1RIPA 2PMZE 3S24A 4LF9Q 3PF5A 1VIGA 3CCRA 4OO1G 1N34L 4R4CA 4UP9A 4DR4L 3HOUG 1CKOA 2JVZA 1UEBA 1HNWQ 3A5ZB 3EIVA 5IP7H 1U5KA 1PFSA 2B8FA 3MXNB 4Y7NH 4A93H 4H13C 1YJWA 5GAGC 4A75A 4A3KG 4LFAQ 4X64L 5GAEC 2V1CC 2A6HD 4POFA 2BL5A 4TKOB 4A76A 3UE1A 3VR2A 3I4NG 1YITA 4HR7B 2JA5H 5BN5A 1R9TH 5ELOA 1IBLL 1HNXQ 1IBMQ 1E1OA 2PQAA 2VQFQ 3OTOL 2E5LQ 2E2JH 4B3SQ 1N33L 1LYLA 4LF7Q 3HOXG 5LMUL 1FVIA 4DNIA 3AQQA 3K7UC 1SE8A 1SROA 2AKWB 3G71A 4APVA 3CXCA 3TREA 2K75A 4GS3A 5KNCA 4J15A 4YHHL 3PIPA 2YTYA 1CI3M 1D8LA 1HR0Q 4JI6L 2BA0A 3J81i 1IL2A 1VQOA 2ATWA 3S15H 2CTMA 4BY7G 1HQMC 4A3DH 3ULJA 4PG3A 2DGYA 2VQEL 4IFDI 4DK6C 4OX9Q 2RF4A 3D0FA 3PGZA 1K73C 3S1NH 4BBSG 4NXML 3CW2C 1PH6A 2PQAB 3JAMc 1ZTGA 1UE7A 3PIOA 4DK3C 2WAQE 4KKUA 1N34Q 4LWCA 2OTLA 4DR4Q 1YI2A 4YWLA 3K80C 2MO1A 2PNRC 2Y0SE 2CW0C 2BH2A 2HH2A 4X6AH 1IZ6A 3GD7A 1H95A 1CSQA 1KD1C 1NE3A 3HFZB 4X64Q 4YWKA 2PI2A 3U4VA 1WE8A 4HJ7A 3GTOH 4DV7Q 4AYBG 3RN2A 5C44G 4KMUC 3I4LA 1IBLQ 1K8MA 1B70B 4L8JA 2Q8IB 3OTOQ 3U58A 1N33Q 4EX5A 5LMNW 1H9SA 2UUBL 3JC66 3GO5A 5LMUQ 4GN5A 1E2ZA 1IXRA 2B63H 5K36G 1GUGA 4DV0L 1WFQA 3L7ZC 1JB7A 3PO2G 3HGBA 4DK0A 3ULLA 4YHHQ 1VQDA 4JI6Q 4A3JH 2KHIA 2MFIA 4DV2L 3GQBA 5IY0A 3QJYA 1VQ7A 4IQZA 2LXKA 2ZJRA 3I4MH 4JVYA 4RCNA 1YEZA 2VQEQ 1ZYRC 4AIMA 3OYYA 3U4ZA 2R92G 4LF4L 4DV1L 1PH4A 2OPUA 4NXMQ 2K4KA 2ZJQA 2JA6G 2D5DA 4GLAC 4R4TA 1PH3A 2WB1G 2MQHA 1KQSA 2A19A 5C4JH 2JA8H 5EAYA 1J6QA 1P16A 1HJPA 1X6OA 3TRZA 4DR2L 1KHIA 4IFDG 2YTVA 1OTCA 2A69D 4UPAA 3U50C 3HOYH 1RL2A 2BE5D 4NPSA 1Z7TA 4JCVE 1XNRL 5KNDA 4DR1L 4WALA 4DNTB 2F52A 4JG2A 1KRSA 2KENA 4AH6A 3H3VH 1I94L 3S2HH 3L0OA 1CKNA 2OTJA 1E2VA 3OPOA 1C9OA 3AFQA 3RZOH 3UE0A 5C4XG 1BVSA 2UUBQ 1Y8OB 3ZJYC 4R4OA 4DV3L 2HIXA 1XPUA 1GUOA 4DV0Q 5IYDG 2YU9H 2UXDL 3NELA 1H9JA 5C0XH 4BA2I 1X3GA 2QEXA 4L5TA 1JT8A 5KNBA 2B8GA 1KL9A 3W3AA 2BDOA 4IOAA 1PH7A 3J7ZC 3QIAA 4QL5A 4LF4Q 1KXLA 4I7ZC 4KI0A 4DV1Q 4A3BH 4WJ4A 3RZDH 1ASZA 1VQBA 2ANNA 2VUMG 1CKNB 3NBHB 4O2DA 2VW9A 1VQNA 1LM0A 4DR6L 2Z6KA 2L15A 1FR3A 3A7LA 1S72A 4L5QA 1EQQA 1S3OA 5H1SE 5FJ8H 1PH5A 1Q82C 1DGSA 1VQ8A 4DR2Q 4P74A 3J7A5 4JI3L 2Z0SA 3PV0A 1V9PA 3HOZH 3M9BA 1XNRQ 4DR1Q 2WFWA 1V1QA 2XGTA 4IPGA 4GKJL 2JEAI 1I94Q 4DR7L 1C0AA 3A5UA 2A6EC 3FKIH 4B3TL 1AE2A 1VCIA 1NMGA 1SFOH 2EIFA 1XMOQ 4QQBX 1QVFA 2Q2IA 5BR8L 4DV3Q 3S2DH 3MFYA 2CKZB 1X56A 2N8NA 1CKMA 4LUZA 1U0LA 1ASYA 2UXDQ 2LXJA 3T51B 2F1MA 2BH8A 2I5LX 5IE8A 4WANA 1GKHA 4A3KH 5JEAG 5JJIA 1HZBA 4A3IH 3CQZH 2IX0A 3HKZE 2OQ0A 1JJCB 1QJOA 4P75A 5M3FH 3I4NH 1NTGA 1EIFA 2CWAA 2HHHL 1I5FA 2EJMA 4JI7L 4UY8C 3NE5B 3B6YA 4LF6L 3HOXH 2OCEA 1SMYC 2K52A 3E0EA 4DR6Q 3CRLC 1OXTA 2HH3A 2R7DA 2YV5A 4JV5L 1UWVA 1JJGA 2QNDA 1QUQA 5M5WH 3PF4A 1A62A 4IOCA 4JI3Q 1E24A 3EBEA 4BY1G 4X66L 4LFBL 3K7AH 4B3RL 4DKAC 2IX1A 1VS0A 3PO3H 4GNXC 4PMWA 4GKJQ 3OW2A 4DR7Q 3CMEA 4IFDJ 3S17H 4LUOA 1VQKA 1O7LA 2EQSA 1Y1VG 4B3TQ 1WYDA 3I4OA 1BBWA 2N49A 4MTNA 5IYCH 5M3MH 2IT1A 4DNRB 3S14H 2NVTH 3CCJA 2GVAA 5BR8Q 1Q1EA 1PYBA 2ZTDA 2EDGA 4P73A 1MKHA 1DCZA 3T1HL 3DXJC 3TZUA 1ONLA 4UP7A 2FMRA 4LNQA 3PUXA 4EQ5A 1QUQB 3ULPA 3SDZA 3RLFA 1GHJA 1H9MA 2KCTA 4LF5L 4RMFA 2K5VA 4PZ6A 1YIJA 4LK1C 3SGIA 4AYBE 2HHHQ 3BZCA 3T56B 2VS1A 4JI7Q 1O78A 4POGA 1O7IA 3HOVG
chains in the Genus database with same CATH superfamily
4OIKA 4RHSA 4LF6Q 2M8WA 5K5PA 1BUVT 1OXUA 4YCUA 2EY6A 2NVQH 1W2BA 4BS9A 4DA2A 1VF7A 3BDCA 4JBKA 1TWHB 2VZAA 4MHEA 3UDGA 3L2PA 2MO0A 1H9KA 3GTQB 1I4RA 4A3GH 4JI0L 3G7LA 1JE5A 1YVCA 1RHPA 3PO2H 3V69A 4JV5Q 4OD6A 4R8NA 5A35A 4DXFA 1PVOA 3NQTA 2E2DC 2M00A 1SYDA 3I55A 2IHEA 1SE4A 1RJTA 3H6MA 4PV1C 3J7AK 1YBYA 4IN3A 5CV8A 3D6CA 4FF3A 3PIP3 2OPVA 4ZUJA 3H0GH 1HNZL 3I3CA 4X66Q 4LFBQ 1EUJA 4B3RQ 3K6OA 1DXMA 2O5IC 1SLJA 5DM63 2NVYB 5T1GA 1TUAA 1MI2A 1JB3A 2CTJA 2EJFC 3R2TA 5IP9G 1HCZA 1SMXA 2UU9H 2VB2X 2DNCA 4F88A 5CC4A 3J81L 2R92H 2F0MA 4YWMA 2E75C 3NEMA 5JVG3 2CWHA 2K5QA 1AH9A 2QDLA 3H3VC 1DD2A 4JI8H 2P2RA 2EXZA 4RG1A 4C3JB 5EQ0A 3HOWH 2MNAA 2JA6H 1LTTD 4F8MA 1SNDA 2HIVA 3KBGA 4XXEA 2F0KA 2WIIB 5FOBB 2WP8J 2K03A 2CW0D 4NBQA 1K8GA 4KHPL 3TQYA 2FPHX 3DEOA 1MSZA 1SYCA 3PIO3 1VQPA 3ERSX 5C3EH 5J39A 2R7ZG 4IJHA 4GKKL 3FPPA 1EYDA 5IP7G 5CV4A 4LMQD 4YY3H 3FMCA 3CD6A 2VUMB 1ILQA 1DTJA 1VQJA 1E2WA 4DV6L 2KCCA 2F0QA 4HMJA 2GVBA 4TQUS 2ALYB 3RUZA 2V4DA 4A93G 4MNOA 3T1HQ 2E3UA 4YCWA 1KRTA 3K58A 4EQPA 3D6WA 2R93B 1QZHA 1J5EH 3P1HA 4O42A 1STBA 4DUZH 3J80c 2K5DA 4LF8L 1FL0A 4F7XA 3EZJA 3VYSA 1PHJA 1Z6HA 3IRBA 4LF5Q 3RNUA 1MJEA 1GD7A 3V05A 4QMGA 1WD0A 2JA9A 3X3MA 4PMCA 2PPBC 3CKIB 5LMNH 4JI5L 2O5JC 4NKLA 2H4OA 5C5MA 3M7NA 3K8AA 2BOSA 1Y1WH 4XIGS 2M6QA 3STBC 1B53A 2ZXOA 1VQLA 1I6VC 2FFMA 3E9IA 2Q8TA 1S5FD 5I9PA 2BA1A 3A8IE 3MTSA 4UHVA 5F2DA 3H94A 2ANRA 4XT3B 2N78A 2PQUA 1I3QH 4IPCA 4A3LH 1EIGA 4FP5D 4IUQA 1K0RA 1B1ZA 1V8CA 4JYAH 1CZWA 2NTTA 2I07B 4QGUA 1BCPB 2DN8A 1VQFA 5CYUA 4HEDA 3CPWA 2ZXRA 4CDEC 3OSOA 4JI0Q 1II3A 5J22A 3C2PA 3KLWA 4DUYH 1UEAB 2AXYA 4NB3A 1VQHA 1JOOA 4GOPC 3TS2A 1VQCA 4HIOA 2I5MX 1EIHA 2RHQB 1BQQT 1EQRA 2MGSA 3AEVA 2KJXA 3I73A 2IY5B 1IW7C 1VQMA 1HNZQ 2NZHA 2R7FA 2TSSA 4GLXA 1A6XA 1TS5A 4A3DG 2UXBL 1IYUA 2K5NA 3CU7A 3URYA 3SK6A 3M4PA 3Q24A 2NN6I 3N52A 1ZZIA 1XMOH 2KA7A 5JJKA 1EIYB 2PQEA 2A68C 2NYZD 3SHLA 2ASBA 1RTNA 4XT1B 4IO9A 1ILPA 1I50B 1FGBD 3K0XA 5ELBA 2B2YA 3VR6A 5DEHA 3KYHC 4GZYC 3W5OA 2UXDH 3DWQA 3H3VI 2WV6D 4KHPQ 4A3FH 2FHTA 4ZRZA 2X06A 5G3LD 1F2ZA 1X3PA 4DR3L 4K14A 3PCOB 3KJOA 4GKKQ 1N32H 3I2ZA 3G6EA 5IT9c 1SNMA 1TQOA 1TWAB 1NY4A 4H02A 4X65L 2IW3A 4NP5A 4LW1A 4NW2A 4DV6Q 1VQ5A 4FF4A 3NWSA 1X55A 2XWBB 3U9SA 4K0KH 2L11A 3J81c 4A3EB 2VL6A 5IYBG 2UXCL 5FLXW 1WTHA 2KBNA 1JMCA 3RMHA 1S40A 1VQ4A 1L1OC 3U1KA 4QIWB 1RCVD 1D1KA 1EEID 5E7NA 4RGOS 3M85A 1AP0A 1NAPA 2EY2A 4IUNA 1CSPA 1VQAA 1PH1A 5C4ZA 4LF8Q 3GTMH 4JOIC 3AEVB 1PYSB 5C0XI 2EYOA 2NUCA 2BE5C 3NBHA 2EE1A 2CTFA 1M1KC 2JA7H 2MPMA 2F0UA 4P71A 3AYHB 1XNQH 4B8TA 4B3ML 2F0GA 1EWHA 2B2UA 1PH2A 3RLOA 3UI2A 3CC2A 2UUAH 4HJ9A 2F4VH 1L2FA 2QKIC 2ZM6L 3DLLA 1H9RA 4JI5Q 1HRJA 1K83B 1ZZKA 4DV4H 2J0TD 2R6GA 5EKLA 2SNMA 2IWHA 4KY5A 4BXXH 2XRQD 3M4OB 2VY3A 2DNEA 1YNNC 3EJIA 2NB0A 3CHBD 4R9WA 1Y1VB 1OXSC 4BBRH 3GTPH 3UDFA 1VQGA 1SR3A 5C5LA 1WCMH 1WD1A 3ZYYX 1FJGL 4DAVA 1PV4A 2B2TC 2PI2E 3TEHB 2EYMA 1Q3LA 3CPFA 4DV2Q 3OMGA 1TWFH 1MD2D 3LWUA 3NK9A 4N9PA 5ELCA 4A3JG 3AMUA 4A3MH 4LF9H 4C3JG 1JOKA 3QWNA 3IAYA 5FO8B 1IL8A 3TS0A 3P75A 3PUVA 2SNSA 4BWGB 4KN7C 2UXBQ 3I4MG 2F4IA 3A74A 2K50A 1D7QA 1L1OB 1Y8NB 2AMCB 1JJ2A 3HZXA 1HNWH 2QILA 2F0NA 3AB9A 2EZVA 1WVLA 4CHTB 4KY6A 2KHJA 3A7AB 4DPGA 1X4NA 1PFBA 2EXDA 5CORA 1QVGA 3G6JB 2OF1A 1YHQA 1CT1D 1Q12A 5L37A 3IFTA 1MHWC 2F0PA 2R93G 1S03G 3NTIA 3R3OA 4WJ3M 4JI1L 5FO9B 3F2UA 2HDLA 3HOVB 4IUPA 1XPOA 1OXXK 2JA8G 4DR3Q 1IHZA 3S16H 1L0YB 1TWCH 1PTOH 1I6UA 2LTMA 1E0BA 5BN3A 1SYGA 5I6YA 2K01A 4IPHA 4PNYA 3KF6A 1HNXH 2NN6G 1IBMH 1I6HB 1FKAH 3HOYG 2E5LH 2A74C 4B3SH 4LF7H 4MZ9A 1HFNA 2MJHA 4V0BA 1TWGB 1NNXA 4K8JA 3BZKA 4BY1H 3UDIA 5DNFA 1VQIA 4G08A 3GV6A 1PZID 1PA6A 1I4XA 3MEFA 2F0LA 1MJCA 2G9DA 3KLRA 3S1MH 2A6ED 3I7FA 1G2TA 3LGJA 3RD4A 2VXWA 3ERQA 1E1TA 4G7HC 2EYLA 2Z8LA 4B3MQ 2PY9A 1CM9A 1XTDA 4OO1H 4JI2L 2O2LD 4DN4M 3C1EA 2JZXA 1QILA 3HOUH 2PW7A 3QD7X 1IKLA 1PFMA 3OHXC 3K7AB 2DY8A 3NBIA 2PMZB 1UE1A 2F0TA 1BKBA 3CCSA 3J7AV 1G51A 1PH9A 3MA2B 3M3YH 3CCQA 1GUTA 2JK8A 3E9HA 2EYPA 4RCOA 5A2QW 1AN8A 1SNPA 2NZOA 4H8AA 1V43A 2LRRA 4OX9H 1FJGQ 5C0XG 4I65A 4R4QA 1CZGA 3W1GA 2G8YA 2RCNA 1Y14B 2NWGA 1WTRA 1IBKL 4IALA 4OHJA 3KF6B 4ABNA 2IPKD 2YYZA 3CC7A 3VDYA 3R8BA 4OELB 4Y7NB 4LIJA 3HKSA 1B7YB 1RD9D 4A93B 1Y69U 2EYFA 2K14A 1N34H 4C3IH 5E4WC 4DR4H 4IUTA 3GR5A 3NWTA 2E76C 2F0EA 4QJFA 3QOLA 4L5SA 4KY7A 4RAUC 3VA7A 2K5WA 3ER0A 1PRTC 2A8VA 2Z1CA 1G2SA 2LSSA 1DOLA 4OCHA 1L0WA 2VQFL 4Z9CB 3J80E 3NTHA 4JI4L 4DV5L 4A3BG 2E2IH 2JJQA 2JQOA 4LJZC 3GTKH 4B08A 3NHHA 3JAMi 2AHOB 5C3XA 2QGQA 4A3EG 2NVXH 1XMQL 1TT2A 1X9ZA 4WFN3 2JA5B 2D9UA 2L5TA 5FLXc 1PH8A 1R9TB 2HCIA 4QMFB 1WVNA 2E8GA 4TVAB 1HZAA 2CFMA 1EU4A 3C1FA 4JI1Q 3SK5A 1EYGA 5TSSA 4X64H 2KCMA 3CRKC 3PSIA 1QE6A 2C35B 1WTPA 1TKWB 3ND9A 4HIMA 1E3PA 4AQYL 3OMCA 2ID0A 1X3QA 5GAHC 5FJ8G 3NENA 2EYHA 5M5XH 1IBLH 2LS01 3JAML 1WTVA 1HR0L 4BY7H 1HH2P 2Z4IA 3OTOH 2B39A 4B8CD 1QVCA 1N33H 3SE0A 2QF7A 2NBFA 3HOZG 3OIPA 1XPRA 1IYVA 1TXYA 1Q81C 4GNXA 5LMUH 3VR4A 1KNEA 2QEJC 1SNCA 1SYEA 4NXNL 4ZKBB 2I0QA 4BBSH 4GLVB 5D14A 3K59A 1CK1A 2YTXA 3TP7A 2JE6I 5IP9H 3C46A 4DF7A 3RR5A 4JI2Q 3FKIG 1G291 2B2VC 2PNHA 2KEDA 1JWUD 1LABA 1TY0A 2HD3A 4YHHH 1O7YA 4C3HH 4JI6H 2CQOA 4Y52H 3S1NB 1U4LA 2HUGA 3F1ZA 1VQEA 3VR5A 3GTLH 4OGQC 1G6ZA 4C2MH 2R7ZH 1QB5D 1BOSA 1FNUA 3EN2A 3A56A 1ESFA 2WAQB 2H1EA 3IKJA 4QF4A 3CP0A 1STNA 1WTQA 2BDNA 3KOJA 2ES2A 2JN4A 4HJ5A 1VIHA 2VQEH 4PZ8A 2JEBI 1BBUA 4O0AA 1GVPA 1C7YA 4H44C 1K3RA 1KC8C 3H09A 2XSCA 1IBKQ 3VKEA 3L9AX 2HT1A 4NXMH 5IT9E 4KN4C 3HKZG 1T5EA 4A3IG 3Q6SA 3S1QH 4RH6A 5C44H 1W3SA 1QNUA 2E74C 2O4XA 4XYQA 1K8OA 1EY8A 2K1BA 1I4QA 4XQQA 2A6HC 3J81E 1A63A 4DV7L 3CCUA 3Q23A 4GNXB 3D3RA 5M3FG 1B50A 1STAA 4G7OC 2F0WA 5D3DA 5GADC 5LL6S 1PXUA 1K3BC 2L1BA 4HJAA 2A1SA 3OOCA 4HMIA 4KKSA 4JI4Q 4DV5Q 4OWXB 3Q0AA 3AFPA 3HS0C 2RVLA 5CBEE 3GTOB 5EPJA 3W2DA 1SSOA 4CKCA 1XMQQ 5FLMG 2OWOA 1GUSA 2K6AA 5K36H 1FGUA 2O4CA 3WWVA 3HOVG 3T1YL 1S5BD 3IL8A 1X54A 4OEMB 1UE6A 2K32A 2A73B 4KLKA 3MZ5A 2CTLA 1F2MA 3EQLC 1G8ZD 4DK1A 4QUFA 4DR5L 3O13A 4RKBA 4OWWB 1N36L 4JW0A 4DGZA 2IJ0A 4FJUA 4AQYQ 3L3OC 4A3CG 3TZDA 4K2LA 4OL7A 3VYUA 4A4IA 2B63B 5C6AA 1PRTF 2XTIA 1ICWA 3MXPA 2E2HH 4KTAA 1Q46A 3S1RH 5CV5A 4LFCL 5JJLA 3LX0A 5HGTA 4OWTB 2XWJB 4X62L 1VQ9A 1DYQA 5JOBA 3TP5A 2UUBH 1SNOA 4JI5H 2R61A 3PO3G 4NXNQ 3GDEA 1TS2A 5GQOA 4A3JB 2AUKA 1EOVA 3M4YA 2GN5A 5HGQA 3F2CA 3OETA 3S9WA 3OW7A 1SE2A 3I8ZA 1BCPD 4DV0H 3I56A 3D4WA 2CTKA 4ME3A 2F0JA 5M5YH 3HEJA 1WTWA 5CBAE 3I4MB 3KDGA 2WB1E 2IHFA 5IYCG 4FDBA 5M3MG 2QDBA 5IGDA 3T13A 1CHPD 3A8KE 4L6TB 1PLFA 2IX3A 1S5ED 2UUCL 4ZKCB 4DV2H 3TSSA 1GJXA 5CR3A 2NTSA 4S3SA 4U68A 3TMEA 1F9QA 4NZTM 1JC7A 4EQNA 3P20A 3CAMA 4IFDH 1VMCA 1BDOA 2RA4A 3GTGH 2XIWA 1CQVA 3LNNA 4LUVA 1EWIA 1FNWA 1G6PA 1B9MA 5IWAL 2Q2TA 5IYBH 4JBJA 4LF4H 5C4JB 1Q86C 4DV1H 2JA8B 3CC4A 3WOFA 1Y8PB 4ZK9B 1TS3A 3MHBA 3E6ZX 1VDZA 2ZTEA 1HTPA 3K5NA 3T4AC 3BG3A 3EROA 3CCVA 1V8QA 1BBXC 3PUWA 2JA5G 1EFWA 1R4QB 4DAYA 1GUNA 4R4IA 1BNZA 1F9SA 1TWHH 5KRUA 3HOYB 3STBD 4CKEA 5C0XJ 3M4QA 5JEAJ 1X3EA 1NJIC 3GTQH 5C4XH 1ESRA 1J5KA 1J4WA 3GTJH 3FAUA 4DR2H 1NR2A 5BN4A 1M90C 1R4PB 2UU9L 2ENBA 1XXGA 3T1YQ 3S2HB 5IYDH 1T9HA 1QCBD 1XJVA 4UDUC 4JI8L 2ZT9C 4DR5Q 1XNRH 1GUWA 4DR1H 4L63B 5C4HA 3PQIA 1NMFA 3RZOB 3DUZA 2CTEA 1N36Q 4A3GG 2NVYH 1KAWA 4PZ7A 1QZGA 5IGFA 5JVH3 2ZTCA 3SXHA 5D65A 3T16A 2EVBA 1I94H 4GOPA 5EPLA 1KDBA 1PDQA 3MXUA 5DLQE 1IW7D 1NBWA 1CQFA 2OQKA 1KHMA 1ZYRD 1PTOC 4UP8A 4NDXA 4YY3L 2PCFB 1SJHD 1DT4A 3GV3A 2YU9B 4LFCQ 3H0GG 4C3JH 3WDNA 3VYRA 3D4RA 2CHBD 4MTKA 4X62Q 4RA8A 4BBRB 1VF5C 3ND8A 1AE3A 3Q8DA 3KJPA 2A68D 2F0FA 2F3IA 1TVXA 1J5EL 3SEBA 5KYIA 4DV3H 1L0XB 1Z47A 2DY7A 4KJNA 4DAYB 4DUZL 2WAQG 3RN5A 2A5HA 2VUMH 4DAMA 4ALPA 5EBDA 3PUYA 4RGMA 2CWFA 3F8TA 4A3MB 5IGBA 1QG7A 2DUDA 2K33A 2Y0SG 2Z4HA 3HOWG 2MP1A 2WKDA 4YCVA 3A8JE 1O7ZA 2R93H 2Z9HA 1JWSD 5LMNL 1Q1BA 4XTCS 1ENCA 1C4QA 1DM0B 2UUCQ 4A3BB 5E3FA 1H9SB 5C3EG 1B8AA 1YNXA 1C48A 1VBIA 3RZDB 2Q2HA 2AUJD 4FXKC 4GN4B 1JICA 1Q8KA 2DGRA 2D0PA 4J1MA 2L12A 5FLXE 3QOJA 1AN7A 2WKCA 1I4PA 4JYAL 5IWAQ 2A69C 1LT5D 2NN6H 1L1OA 4XQJA 1EWCA 1X3FA 1YJNA 3OIQA 4IPDA 4KKTA 4GOPB 5GROA 3FHWA 1Q7YC 4G7ZC 1MSHA 3BJUA 3A55A 4JOIA 1UNSA 4DUYL 2MUYA 3PMFA 1YHBA 2RDGA 3W1BA 2CWPA 2CCZA 1EZ8A 2B3GA 3DM3A 4DR6H 3RLNA 3F2DA 4HJ8A 3HOZB 3CCEA 1N8RC 5HY6A 1EYCA 1XWEA 2BCOA 1KABA 3BDLA 1VQ6A 1ET6A 1P8LA 2HQLA 1BO0A 1Y1WG 2B63G 5IODA 4L5RC 1XMOL 2Q8RE 1WI5A 2L9HA 3ONAB 2AQ2B 1DONA 4RHRA 4JI3H 2UU9Q 4A3LG 2CPQA 3FKIB 2F0OA 3S1MB 1U4MA 4GN3B 5CMDA 4CKBA 5IGCA 4JI8Q 1S20A 2YQRA 2CH4W 1SFOB 1F2YA 1XYIA 2B2TA 5AJ3L 3CCMA 4EC5A 4GKJH 3E3XA 3ITPA 4DR7H 5JEAH 1MIUA 1A2UA 4JBWA 3BVZA 3S2DB 1N32L 1KIXA 4F87A 1RODA 1EQTA 1EY4A 4YY3Q 1Q8IA 1I50H 4B3TH 2OEOA 4R8IA 4IJLA 3F2BA 4HSPA 4HIKA 4Q5VA 4ZAIA 2L4NA 4K0KL 3KLSA 5EKKA 4RWSC 1TY2A 2K7VA 1GM5A 4MIUA 2LMCB 1WJJA 3G4SA 5BR8H 4A3KB 3VYTA 1SBBB 2X6LA 1GHKA 5J3BA 5JAVA 1J5EQ 2AWOA 4FF1A 4QY7A 3I72A 3HKZB 4DUZQ 2D9IA 4A3IB 3CQZB 2L0CA 1TWAH 1X0AA 3Q22A 3BYTB 2SOBA 3N6RA 2FJ2A 3MVVA 4BA1I 1CUKA 1Q90A 1XNQL 4A3EH 2EJGC 5M3FB 3I4NB 1ET9A 2Z6KC 2B29A 3DMUA 4KV6A 2PO4A 2UUAL 1PTOF 2F4VL 5KGUA 2Y3MA 3MEHA 5LMNQ 4C1NK 4A3FG 4X65Q 2ZJPA 3A0JA 2FXQA 4QIWE 4OO1I 4DV4L 2KOLA 1ZKOA 2F3VA 3CMAA 1EL0A 4R1JA 3HOXB 2UXCQ 3FP9A 1ZEQX 2FFKB 2KHSA 3CCLA 4JVHA 3KDFA 1KDAA 1BR9A 2HHHH 3R2IA 4JYAQ 3K81C 2RHSB 2Z6BA 1HUNA 3BU2A 5EGTA 2D2CC 4JI7H 1X9NA 1YZ6A 4JPBW 1K83H 4EQOA 1I4GA 3NPPA 2ICEC 4LF6H 2QCPX 3KFUA 2NZ1D 1DJRD 3M4OH 4DUYQ 1PMRA 5ELFA 2B2WC 5M5WB 2JA7G 2ZM6Q 4LF9L 1D2BA 1PYWD 1Y1VH 2L55A 4WRDA 2N3SA 2Q2UA 3DHQA 1HPCA 4CJ2C 4JV5H 5LL6X 1TU2B 1YJ9A 3PO3B 1CTMA 1AW7A 5G3LF 4BXXG 4JK1C 1B4OA 1HNWL 1LTSD 3S17B 2X69A 1E22A 1ICFB 3WOEA 1SN8A 3JAMW 5A2QE 1HR0W 4X66H 2KUMA 4LFBH 4B3RH 4KHVA 4BBRG 1LACA 3QG1A 4JBMA 1A0IA 4HIDA 1WCMG 5M3MB 4IURA 4RKLA 1E7ZA 3I90A 5HURA 2QA4A 1RTOA 1IYJB 4ODGA 5AJ3Q 2VB3X 4LFAL 3S14B 4ZLTF 2NVTB 1I4HA 3KK7A 4LAAA 1D5MC 2XNAC 1D5XC 1B9NA 1N9WA 1N32Q 3KDFB 1YHAA 4DU9A 4A3MG 3TN2A 1SRUA 1X4MA 1PRTD 3D31A 3J81j 2D62A 4JC0A 1HNXL 1IBML 1B3QA 4K0KQ 1YNJC 1ENFA 1SMYD 3G48A 3K5OA 3A54A 3SK8A 5IIFA 2E5LL 2K04A 4B3SL 1B2TA 4LF7L 4ILWA 2D0OA 3HOVH 1LUZA 1HZ9A 4EVOA 4AM3A 2ZQEA 1LV9A 2M2LA 4FJSA 2I5HA 2K5HA 4B9WA 1ZZJA 1A8VA 3SK4A 1K1GA 3ICEA 1QWYA 4Q0FA 3H15A 3T1HH 4AYBB 5ISRA 1XNQQ 3T53B 1EZ6A 3MXNA 1K9MC 2F0HA 3E0JA 1HA6A 5FLMH 1I6HH 1CFMA 2JXMB 4OXPA 2UUAQ 1HZCA 1KTKA 2H5XA 3MC0B 3MXGA 4KHZA 1K8AC 1TWGH 2F4VQ 1EC6A 2AWNA 4P72A 1LTLA 2C5CA 4DV4Q 3UDXA 2RQXA 3HP3A 4H0LC 1EQVA 2VNUD 1KNAA 1JR0D 3I70A 4N8X1 3CF5A 2EY1A 2RDFA 1XX8A 4LF5H 4K8IA 1X65A 5I2YA 4A3CH 4K5WA 1UE5A 1F9PA 2NVQB 1JCKB 5ELNA 3OWEB 1EY5A 1Z9FA 1OXVA 3BDOA 2K1HA 4OONA 4A3GB 1WOCA 3J80i 4O1NA 4OX9L 2A1AA 3PO2B 3VR3A 3GABA 1TS4A 3PUZA 1FYCA 3KF8B 3J7YW 1RIPA 2PMZE 1W6KA 3S24A 4LF9Q 3H0GB 3PF5A 1VIGA 1LTAD 1PRTB 3CCRA 4OO1G 2B2VA 5FK9C 1HFGA 5JPMC 1N34L 4R4CA 4UP9A 4DR4L 3HOUG 4JI0H 2WINB 2RBMA 3V2TA 2MHVA 4HN7A 1J8IA 1CKOA 2CPMA 2JVZA 2C9OA 2J7ZA 1UEBA 1HNWQ 3A5ZB 3EIVA 5IP7H 3V96A 1U5KA 1PFSA 3J7AF 1F77A 1LT3D 2R92B 1IKMA 2B8FA 2ICIA 3MXNB 1A3UA 1HNZH 3GKUA 4Y7NH 3EVQA 4X3KA 4A93H 2Y0SB 3HOWB 4H13C 1YJWA 3AU7A 2JA6B 5GAGC 4A75A 4A3KG 5M5YB 1D6EC 4LFAQ 3TP6A 4X64L 5C3EB 1HUMA 5GAEC 3R93A 1HTLD 2PT7G 5C3WA 1UUPA 2V1CC 3IFDA 2RKSA 2OT2A 3KLSX 2A6HD 4POFA 2BL5A 4TKOB 4A76A 4M1UB 3UE1A 3VR2A 3I4NG 1YITA 4HR7B 2JA5H 5BN5A 4C3IG 1LTBD 2MJ8A 5ELOA 1R9TH 1HNXQ 1E1OA 1IBLL 1CA6A 2PQAA 1IBMQ 2VQFQ 4KHPH 3OTOL 1JQYD 2E5LQ 2E2JH 1B3AA 4B3SQ 4UAIA 1N33L 1LYLA 4LF7Q 4GKKH 1A3TA 3TBIB 3HOXG 2KQ3A 5LMUL 1FVIA 4DNIA 3AQQA 4PQXA 3K7UC 1SE8A 1SROA 4DV6H 2AKWB 4NZRM 3G71A 4APVA 3CXCA 3TREA 3BYYB 5IOCA 1S5CD 2HDMA 2K75A 4FXGC 4GS3A 1G91A 2KCNA 2PYKA 5KNCA 1RDPD 4J15A 1Y1WB 5IWAH 2FMMA 4LF8H 4YHHL 3PIPA 2YTYA 2K28A 1CI3M 1FD7D 4HTHA 1D8LA 2QW7A 1HR0Q 1STYA 2PZWA 4JI6L 5C4XB 2BA0A 2PW5A 2GA4B 1I3QB 1DZ1A 1BXTA 3J81i 1IL2A 3GTJB 1VQOA 1JORA 5I2XA 2ATWA 3C3LA 3S15H 4BY7G 2CTMA 1HQMC 1RF2D 4A3DH 3ULJA 4PG3A 4G57A 1SEBD 2DGYA 4FF2A 2XVSA 2VQEL 1X32A 4IFDI 4DK6C 2N88A 4CDFC 4OX9Q 1S4ZA 2RF4A 3D0FA 3PGZA 1K73C 3KUPA 3S1NH 5IGEA 5IT9L 4BBSG 4PDBA 4NXML 3CW2C 1PH6A 3D8GA 4FVMA 2PQAB 3JAMc 1ZTGA 1UE7A 2F0DA 3NCVA 3PIOA 1DOKA 4DK3C 2WAQE 4KKUA 1N34Q 4LWCA 2OTLA 4DR4Q 5CGKA 1YI2A 4YWLA 3K80C 2MO1A 1BCPC 3SB1A 2PNRC 2RSOA 2Y0SE 4CDCC 4C3HG 2CW0C 2BH2A 2F0IA 1HHVA 2HQEA 2HH2A 2J4XA 2KVMA 4X6AH 1IZ6A 2CH4A 1SYBA 2SDFA 3GD7A 1H95A 1VMPA 5KEEA 1JE4A 5EJWA 2UXBH 1CSQA 1KD1C 1NE3A 5EPKA 4A3FB 3HFZB 5AFWA 1U9RA 4X64Q 2P5ZX 4YWKA 2PI2A 3U4VA 1STGA 1WE8A 4HJ7A 3GTOH 1WHRA 1NSNS 4DV7Q 4AYBG 3RN2A 5C44G 1STEA 4KMUC 1WTOA 2DJGC 3I4LA 1IBLQ 1K8MA 1B70B 1LT6D 4L8JA 5COYA 2Q8IB 3OTOQ 3U58A 1N33Q 4DR3H 1PQXA 4EX5A 2LY7A 5LMNW 1H9SA 2UUBL 3JC66 3GTMB 5LHY1 3GO5A 5LMUQ 4GN5A 4X65H 1E2ZA 2EOTA 1IXRA 2B63H 2JA7B 1RKNA 2UXCH 5K36G 1NCVA 1GUGA 1WFQA 4DV0L 3L7ZC 4QB4A 1JB7A 3PO2G 3BVGA 4V190 1LT4D 3HGBA 3OWFA 4CBVA 4DK0A 2G5DA 5CV7A 3ULLA 4FNFA 4YHHQ 1EY0A 5EBCA 1VQDA 1PTOD 4N8FA 4X3TA 4JI6Q 1EOTA 4E6IA 4A3JH 2KHIA 2MFIA 3I0PA 4DV2L 4B3MH 3GQBA 5IY0A 3QJYA 1VQ7A 4IQZA 2LXKA 4CGYB 2ZJRA 3GTPB 4ZUIA 2ZM6H 4HCSA 2LKVA 2WACA 1WCMB 3I4MH 2RSNA 4JVYA 4RCNA 1YEZA 2VQEQ 1ZYRC 4AIMA 4HCEA 3OYYA 5FKAC 3U4ZA 2R92G 4LF4L 4DV1L 1PH4A 2OPUA 1TWFB 3HG9A 3BS1A 3D4DA 5J1ZA 4NXMQ 2VKCA 4E9JA 4WORA 2K4KA 2JSOA 2ZJQA 1WTXA 1EY7A 4QCLA 2B2YC 2JA6G 2D5DA 4ZYSA 4GLAC 3TDQA 1AEXA 4R4TA 1PH3A 2WB1G 4G4KA 1FJGH 1HQRD 2MQHA 2XN9C 3KDKA 1KQSA 2A19A 4TSSA 1ODHA 3E5SA 2JYOA 3VA5A 5C4JH 2JA8H 4C1NI 5EAYA 2LFNA 1J6QA 1KLUD 3LWEA 1P16A 1HJPA 1X6OA 1WTJA 3TRZA 4DR2L 2EYJA 1KHIA 2YTVA 3DWAA 1NR4A 4IFDG 1OTCA 2A69D 4PMBA 2M9VA 4UPAA 3U50C 1EU3A 1A3VA 1BF4A 3HOYH 1RL2A 1SXTA 3SVMA 1AZQA 2BE5D 4K5XA 4NPSA 1Z7TA 4JCVE 1XNRL 2R3ZA 5KNDA 4DR1L 4WALA 3S16B 1TWCB 2F52A 1LO5D 1PTOB 4DNTB 4JG2A 1KRSA 1LTGD 2KENA 4RGNA 4AH6A 3H3VH 4IUUA 1I94L 4FO2A 1GXDC 1C8CA 1BCPF 1HA5A 1V1PA 1EEFD 3S2HH 3L0OA 2B2UC 2FMCA 4FYDA 1CKNA 2OTJA 4JI1H 1E2VA 3OPOA 3DEPA 1YNND 1XRHA 2ZXPA 1FNVA 1C9OA 3AFQA 4BY1B 3RZOH 3UE0A 2XRSD 5NUCA 1SJED 1ENAA 1BVSA 2N55A 2UUBQ 5C4XG 4N9TA 1Z2IA 2EY5A 1Y8OB 3MFGA 3ZJYC 4R4OA 4DV3L 2PZTA 2HIXA 4KK7A 1XPUA 1GUOA 2CVRA 1K28A 4DV0Q 5IYDG 2LTLA 2YU9H 1EY9A 2UXDL 3NELA 3HOUB 1H9JA 5I9OA 5C0XH 4BA2I 4XYOA 1X3GA 1QNKA 1M4VA 1MSGA 2QEXA 4DXGA 2G9HD 4L5TA 1JT8A 4I7AA 4YIJA 5KNBA 2AQ1B 2B8GA 3M3YB 3EA6A 4JI2H 1KL9A 3OSSD 4RGTA 3U9OA 2FINB 3W3AA 5FLXL 3FEWX 1F2LA 4TRDA 2BDOA 1AFPA 1A2TA 3BZDB 4IOAA 1PH7A 2IL8A 1F9RA 2RCFA 1QOHA 3J7ZC 1UAPA 3QIAA 1K0SA 4QL5A 5CV6A 3NQIA 4LF4Q 1KXLA 3HRZC 4I7ZC 4IZ8A 4KI0A 4DV1Q 4A3BH 3NP8A 1KAAA 4EGVA 4WJ4A 1V1PB 3P7JA 1VQBA 3RZDH 1ASZA 2ANNA 1EYAA 1CKNB 2VUMG 3NBHB 4O2DA 2VW9A 1VQNA 4XQNA 4C3IB 1LM0A 5DM73 4HSVA 4DR6L 2Z6KA 4M8AA 4XDXA 2L15A 1IBKH 1FR3A 3A7LA 1KLGD 1S72A 4L5QA 1M8AA 1EQQA 4LFAH 1LLRD 2E2IB 1S3OA 5H1SE 5FJ8H 1PH5A 3GTKB 1Q82C 1DGSA 3RF2A 1SEIA 1VQ8A 4DR2Q 2NVXB 4P74A 1SE3A 3J7A5 1AZPA 4JI3L 4K6LA 2Z0SA 3PV0A 1V9PA 3HOZH 3M9BA 2PZUA 1NXUA 2VQFH 1XNRQ 1D5ZC 3I91A 4JI4H 1V9NA 4DV5H 4DR1Q 2WFWA 1V1QA 2XGTA 3K5LA 1U4RA 4IPGA 4GKJL 1PZKD 2B2WA 5FO7B 2JEAI 1I94Q 4DR7L 1XMQH 4ME5A 4ZCKA 1C0AA 5M5XB 3A5UA 4CDDC 4BY7B 3GP7A 4CJ1B 2A6EC 3FKIH 3NXWA 4B3TL 1AE2A 1JWMD 1VCIA 1NMGA 1SFOH 3DWPA 1PFNA 2EIFA 1XMOQ 1SNQA 4QQBX 4AQYH 1QVFA 3FVQA 3K0YA 4BBSB 2Q2IA 5BR8L 2DJFC 4DV3Q 3S2DH 3MFYA 2CKZB 1X56A 2N8NA 1HR0H 1CKMA 4LUZA 1U0LA 4DAPA 3JAME 3M7GA 1ASYA 2UXDQ 2LXJA 1JOQA 3T51B 4QUCA 1A15A 1MGSA 2F1MA 2BH8A 2I5LX 1KDCA 5IE8A 4WANA 1GKHA 4NXNH 5T1IA 4C3HB 4A3KH 5KIXA 3KF8A 3GTLB 5JEAG 5JJIA 1HZBA 4C2MB 4A3IH 2R7ZB 3CQZH 2F0VA 4KD3A 2IX0A 3HKZE 2OQ0A 5CV9A 1JJCB 1YNJD 1QJOA 4J8QA 3NSWA 2SEBD 2F0SA 4P75A 1ML0D 2JP1A 5M3FH 3I4NH 1NTGA 5DAUA 1EIFA 2X6GA 2CWAA 2HHHL 1I5FA 3H91A 2EJMA 4JI7L 4ULLA 2I46A 4UY8C 3NE5B 3J80W 3B6YA 4LF6L 5E1FA 2F3WA 3HOXH 3FRPB 2OCEA 1SMYC 3S1QB 5C44B 2K52A 5M9OA 1U4PA 2F03A 5I6WA 4HAEA 3FDTA 3BVMA 3E0EA 4DR6Q 2LF0A 3MWYW 3CRLC 2OXPA 1OXTA 4CJ0B 2HH3A 2R7DA 2YV5A 4JV5L 2E2JB 1O80A 4OIJA 1LTRD 1UWVA 4RFBA 5I4DA 1JJGA 2QNDA 1QUQA 5M5WH 3PF4A 1A62A 1STHA 4K6DA 3K5MA 4IOCA 4IUVA 2CQAA 3EFXD 5EKIA 4KJOA 1SDFA 1SYFA 4JI3Q 1XTCD 4ZQ3A 4DV7H 5A2QL 1E24A 5E4XA 3EBEA 4BY1G 4X66L 1V1OA 4LFBL 3K7AH 4B3RL 3TP8A 4DFAA 4DKAC 5JJZA 2IX1A 3KBXA 1VS0A 1SAPA 4K5VA 4GNXC 3PO3H 4PMWA 4MN3A 1UG8A 5IGGA 4GKJQ 1W6JA 1PZJD 2AQ3B 2K05A 3NUCA 1NUCA 2RDHA 4KD4A 3OW2A 3CMEA 2KECA 4DR7Q 3FPUB 1LTID 4IFDJ 2E2HB 3S17H 3T1YH 5JPNC 2KEEA 4LUOA 3S1RB 1VQKA 5D3IB 1O7LA 2EQSA 1Y1VG 4B3TQ 1S5DD 1WYDA 5ELEA 3I4OA 4DR5H 1BBWA 2N49A 3UOEA 4MTNA 1N36H 3J80L 4FXDA 5IYCH 3S15B 5M3MH 4X3UA 2IT1A 4NMZA 1F0XA 4DNRB 4A3DB 3S14H 2NVTH 4WJWA 4ID6A 4P2CB 3CCJA 4U673 2GVAA 5BR8Q 3QB3A 2HCCA 1Q1EA 1EY6A 1PYBA 1TIID 3DM1A 2ZTDA 4J6HA 3MAQA 2EDGA 1CHQD 1GOZA 4P73A 1D1IA 4LFCH 1MKHA 2WB1B 4X62H 1DCZA 5KYLA 3T1HL 4C56C 3DXJC 3TZUA 1OO9B 1ONLA 4UP7A 1EFID 1ZXTA 5ELDA 2FMRA 4LNQA 3PUXA 4K2KA 5LL6b 4EQ5A 1QUQB 4H7BA 4JVZA 4X3SA 2EPBA 3NTKA 3ULPA 4B9XA 5IT9W 3SDZA 1MBYA 2TMPA 3K57A 3RLFA 1DOMA 1GHJA 1H9MA 2KCTA 3QO2A 4LF5L 3GTGB 4RMFA 2K5VA 4PZ6A 3J81W 1YIJA 4LK1C 3SGIA 3SR1A 4AYBE 2HHHQ 1TR5A 3BZCA 3T56B 1CA5A 1B44D 1HXYD 3X3NA 5DT9A 2UUCH 1J9OA 1T5XD 2VS1A 1O78A 3QR8A 4JI7Q 4POGA 1O7IA 1GO3E
chains in the Genus database with same CATH topology
4OIKA 4RHSA 4LF6Q 5K5PA 1BUVT 1OXUA 4YCUA 2EY6A 2NVQH 1W2BA 4BS9A 4DA2A 1VF7A 3BDCA 4JBKA 1TWHB 2VZAA 4MHEA 3UDGA 3L2PA 2MO0A 1H9KA 3GTQB 1I4RA 4A3GH 4JI0L 3G7LA 1JE5A 1YVCA 1RHPA 3PO2H 3V69A 4JV5Q 4R8NA 5A35A 4DXFA 1PVOA 3NQTA 2E2DC 2M00A 1SYDA 3I55A 2IHEA 1SE4A 1RJTA 3H6MA 4PV1C 1YBYA 4IN3A 5CV8A 3D6CA 4FF3A 3PIP3 2OPVA 4ZUJA 3H0GH 1HNZL 3I3CA 4X66Q 4LFBQ 1EUJA 4B3RQ 3K6OA 1DXMA 2O5IC 1SLJA 5DM63 2NVYB 5T1GA 1TUAA 1MI2A 1JB3A 2CTJA 2EJFC 3R2TA 5IP9G 1HCZA 1SMXA 2VB2X 2DNCA 4F88A 5CC4A 3J81L 2R92H 2F0MA 4YWMA 2E75C 5JVG3 3NEMA 2K5QA 1AH9A 3H3VC 1DD2A 2P2RA 2EXZA 4RG1A 4C3JB 5EQ0A 3HOWH 2MNAA 2JA6H 1LTTD 4F8MA 1SNDA 2HIVA 3KBGA 4XXEA 2F0KA 2WIIB 5FOBB 2WP8J 2K03A 2CW0D 4NBQA 1K8GA 4KHPL 3TQYA 3DEOA 1SYCA 3PIO3 1VQPA 3ERSX 5C3EH 5J39A 2R7ZG 4IJHA 4GKKL 3FPPA 1EYDA 5IP7G 5CV4A 4LMQD 3FMCA 3CD6A 2VUMB 1ILQA 1DTJA 1VQJA 1E2WA 4DV6L 2KCCA 2F0QA 4HMJA 2GVBA 4TQUS 2ALYB 3RUZA 2V4DA 4A93G 4MNOA 3T1HQ 2E3UA 4YCWA 1KRTA 3K58A 4EQPA 3D6WA 2R93B 1QZHA 3P1HA 4O42A 1STBA 3J80c 2K5DA 4LF8L 4F7XA 1FL0A 3VYSA 1PHJA 1Z6HA 3IRBA 4LF5Q 3RNUA 1MJEA 1GD7A 3V05A 4QMGA 1WD0A 2JA9A 3X3MA 4PMCA 2PPBC 3CKIB 2O5JC 4JI5L 4NKLA 2H4OA 5C5MA 3M7NA 3K8AA 2BOSA 1Y1WH 4XIGS 3STBC 1B53A 2ZXOA 1VQLA 1I6VC 2Q8TA 3E9IA 1S5FD 5I9PA 2BA1A 3A8IE 3MTSA 5F2DA 2ANRA 3H94A 4XT3B 2N78A 2PQUA 1I3QH 4IPCA 4A3LH 1EIGA 4FP5D 4IUQA 1K0RA 1B1ZA 1CZWA 2NTTA 2I07B 4QGUA 1BCPB 2DN8A 1VQFA 5CYUA 4HEDA 3CPWA 2ZXRA 3OSOA 4JI0Q 1II3A 5J22A 3C2PA 3KLWA 1UEAB 2AXYA 4NB3A 1VQHA 1JOOA 4GOPC 3TS2A 1VQCA 4HIOA 2I5MX 1EIHA 2RHQB 1BQQT 1EQRA 2MGSA 3AEVA 2KJXA 3I73A 2IY5B 1IW7C 1VQMA 1HNZQ 2NZHA 2R7FA 2TSSA 4GLXA 1A6XA 1TS5A 4A3DG 2UXBL 1IYUA 2K5NA 3CU7A 3URYA 3SK6A 3M4PA 3Q24A 2NN6I 3N52A 1ZZIA 2KA7A 5JJKA 1EIYB 2PQEA 2A68C 2NYZD 3SHLA 2ASBA 1RTNA 4XT1B 1ILPA 4IO9A 1I50B 1FGBD 5ELBA 3K0XA 2B2YA 3VR6A 5DEHA 3KYHC 4GZYC 3W5OA 3DWQA 3H3VI 2WV6D 4KHPQ 4A3FH 2FHTA 4ZRZA 5G3LD 1F2ZA 1X3PA 4DR3L 4K14A 3PCOB 3KJOA 4GKKQ 3I2ZA 3G6EA 5IT9c 1SNMA 1TQOA 1TWAB 1NY4A 4H02A 4X65L 2IW3A 4NP5A 4LW1A 4NW2A 4FF4A 4DV6Q 1VQ5A 3NWSA 1X55A 2XWBB 3U9SA 2L11A 4A3EB 3J81c 2VL6A 5IYBG 2UXCL 2KBNA 1JMCA 3RMHA 1S40A 1VQ4A 1L1OC 3U1KA 4QIWB 1RCVD 1D1KA 1EEID 5E7NA 4RGOS 3M85A 1AP0A 1NAPA 2EY2A 4IUNA 1CSPA 1VQAA 1PH1A 5C4ZA 4LF8Q 3GTMH 4JOIC 3AEVB 1PYSB 5C0XI 2EYOA 2NUCA 2BE5C 3NBHA 2EE1A 2CTFA 1M1KC 2JA7H 2MPMA 2F0UA 4P71A 3AYHB 4B8TA 4B3ML 2F0GA 1EWHA 2B2UA 1PH2A 3RLOA 3UI2A 3CC2A 4HJ9A 1L2FA 2QKIC 2ZM6L 3DLLA 1H9RA 4JI5Q 1HRJA 1K83B 1ZZKA 2J0TD 2R6GA 5EKLA 2SNMA 2IWHA 4KY5A 4BXXH 2XRQD 3M4OB 2VY3A 2DNEA 1YNNC 3EJIA 2NB0A 3CHBD 4R9WA 1Y1VB 1OXSC 4BBRH 3GTPH 3UDFA 1VQGA 1SR3A 5C5LA 1WD1A 1WCMH 3ZYYX 1FJGL 4DAVA 1PV4A 2B2TC 2PI2E 3TEHB 2EYMA 1Q3LA 3CPFA 4DV2Q 3OMGA 1TWFH 1MD2D 3LWUA 3NK9A 4N9PA 5ELCA 3AMUA 4A3JG 4A3MH 4C3JG 1JOKA 3QWNA 3IAYA 5FO8B 1IL8A 3TS0A 3P75A 3PUVA 2SNSA 4BWGB 4KN7C 2UXBQ 3I4MG 2F4IA 3A74A 2K50A 1D7QA 1L1OB 1Y8NB 2AMCB 1JJ2A 3HZXA 2QILA 2F0NA 3AB9A 2EZVA 1WVLA 4CHTB 4KY6A 2KHJA 3A7AB 4DPGA 1X4NA 1PFBA 2EXDA 5CORA 1QVGA 3G6JB 2OF1A 1YHQA 1CT1D 1Q12A 3IFTA 2F0PA 2R93G 3NTIA 3R3OA 4WJ3M 4JI1L 5FO9B 3F2UA 2HDLA 3HOVB 4IUPA 1XPOA 1OXXK 2JA8G 4DR3Q 1IHZA 3S16H 1L0YB 1TWCH 1PTOH 1E0BA 5BN3A 1SYGA 5I6YA 2K01A 4PNYA 4IPHA 3KF6A 2NN6G 1I6HB 3HOYG 2A74C 4MZ9A 1HFNA 2MJHA 4V0BA 1TWGB 4K8JA 3BZKA 4BY1H 3UDIA 5DNFA 1VQIA 3GV6A 1PZID 1PA6A 1I4XA 3MEFA 2F0LA 2G9DA 1MJCA 3KLRA 3S1MH 2A6ED 1G2TA 3I7FA 3LGJA 3RD4A 2VXWA 3ERQA 1E1TA 4G7HC 2EYLA 2Z8LA 4B3MQ 2PY9A 1CM9A 1XTDA 4OO1H 4JI2L 2O2LD 4DN4M 3C1EA 2JZXA 1QILA 3HOUH 2PW7A 1IKLA 1PFMA 3OHXC 3K7AB 2DY8A 3NBIA 2PMZB 1UE1A 2F0TA 3J7AV 1BKBA 3CCSA 1G51A 1PH9A 3MA2B 3M3YH 3CCQA 1GUTA 2JK8A 3E9HA 2EYPA 4RCOA 1AN8A 1SNPA 2NZOA 1V43A 1FJGQ 5C0XG 4I65A 4R4QA 1CZGA 3W1GA 2RCNA 2NWGA 1Y14B 1WTRA 1IBKL 4IALA 4OHJA 4ABNA 3KF6B 2IPKD 2YYZA 3CC7A 3VDYA 3R8BA 4Y7NB 4LIJA 3HKSA 1RD9D 1B7YB 4A93B 1Y69U 2EYFA 2K14A 4C3IH 5E4WC 4IUTA 3NWTA 2E76C 2F0EA 4QJFA 3QOLA 4L5SA 4KY7A 4RAUC 3VA7A 2K5WA 3ER0A 1PRTC 2A8VA 2Z1CA 1G2SA 2LSSA 1DOLA 1L0WA 2VQFL 4Z9CB 3J80E 3NTHA 4JI4L 4DV5L 4A3BG 2E2IH 2JJQA 2JQOA 4LJZC 3GTKH 4B08A 3NHHA 3JAMi 5C3XA 2AHOB 2QGQA 4A3EG 2NVXH 1XMQL 1TT2A 4WFN3 2JA5B 2D9UA 2L5TA 5FLXc 1R9TB 1PH8A 2HCIA 4QMFB 1WVNA 2E8GA 4TVAB 1HZAA 2CFMA 1EU4A 3C1FA 4JI1Q 3SK5A 1EYGA 5TSSA 3CRKC 2KCMA 3PSIA 1QE6A 2C35B 1WTPA 1TKWB 3ND9A 4HIMA 1E3PA 4AQYL 3OMCA 2ID0A 1X3QA 5GAHC 5FJ8G 3NENA 2EYHA 5M5XH 2LS01 3JAML 1WTVA 1HR0L 4BY7H 1HH2P 2Z4IA 2B39A 1QVCA 3SE0A 2QF7A 2NBFA 3HOZG 3OIPA 1XPRA 1IYVA 1TXYA 1Q81C 4GNXA 3VR4A 1KNEA 2QEJC 1SNCA 1SYEA 4NXNL 4ZKBB 2I0QA 4BBSH 5D14A 3K59A 4GLVB 1CK1A 2YTXA 3TP7A 2JE6I 5IP9H 3C46A 4DF7A 3RR5A 4JI2Q 3FKIG 1G291 2B2VC 2PNHA 2KEDA 1JWUD 1LABA 1TY0A 1O7YA 4C3HH 2CQOA 4Y52H 3S1NB 1U4LA 2HUGA 3F1ZA 3VR5A 1VQEA 3GTLH 4OGQC 1G6ZA 4C2MH 2R7ZH 1QB5D 1BOSA 1FNUA 3EN2A 3A56A 1ESFA 2WAQB 2H1EA 3IKJA 4QF4A 3CP0A 1STNA 1WTQA 2BDNA 3KOJA 2ES2A 4HJ5A 1VIHA 4PZ8A 2JEBI 1BBUA 4O0AA 1GVPA 1C7YA 4H44C 1K3RA 1KC8C 3H09A 2XSCA 1IBKQ 3VKEA 3L9AX 2HT1A 5IT9E 4KN4C 3HKZG 1T5EA 4A3IG 3Q6SA 3S1QH 4RH6A 5C44H 1W3SA 1QNUA 2E74C 2O4XA 4XYQA 1K8OA 1EY8A 2K1BA 1I4QA 4XQQA 2A6HC 3J81E 1A63A 4DV7L 3CCUA 3Q23A 4GNXB 3D3RA 1B50A 5M3FG 1STAA 4G7OC 2F0WA 5D3DA 5GADC 5LL6S 1PXUA 2L1BA 4HJAA 3OOCA 4HMIA 4KKSA 4JI4Q 4DV5Q 4OWXB 3Q0AA 3HS0C 3AFPA 2RVLA 5CBEE 3GTOB 5EPJA 3W2DA 1SSOA 4CKCA 1XMQQ 5FLMG 2OWOA 1GUSA 2K6AA 5K36H 1FGUA 3WWVA 3HOVG 3T1YL 1S5BD 3IL8A 1X54A 1UE6A 2K32A 2A73B 4KLKA 3MZ5A 2CTLA 1F2MA 3EQLC 1G8ZD 4DK1A 4QUFA 4DR5L 3O13A 4RKBA 4OWWB 1N36L 4DGZA 2IJ0A 4AQYQ 3L3OC 4A3CG 3TZDA 4K2LA 4OL7A 3VYUA 4A4IA 2B63B 5C6AA 1PRTF 2XTIA 1ICWA 3MXPA 2E2HH 4KTAA 1Q46A 3S1RH 5CV5A 4LFCL 5JJLA 3LX0A 5HGTA 4OWTB 2XWJB 4X62L 1VQ9A 1DYQA 3TP5A 5JOBA 1SNOA 2R61A 3PO3G 4NXNQ 3GDEA 1TS2A 5GQOA 4A3JB 2AUKA 3M4YA 1EOVA 2GN5A 5HGQA 3F2CA 3S9WA 3OW7A 1SE2A 3I8ZA 1BCPD 3I56A 3D4WA 2CTKA 4ME3A 2F0JA 5M5YH 3HEJA 1WTWA 5CBAE 3I4MB 2WB1E 2IHFA 5IYCG 4FDBA 5M3MG 2QDBA 5IGDA 3T13A 1CHPD 3A8KE 4L6TB 1PLFA 2IX3A 1S5ED 2UUCL 4ZKCB 3TSSA 1GJXA 5CR3A 2NTSA 4S3SA 4U68A 3TMEA 1F9QA 1JC7A 4EQNA 3P20A 4IFDH 3CAMA 1VMCA 1BDOA 2RA4A 3GTGH 2XIWA 1CQVA 3LNNA 4LUVA 1EWIA 1FNWA 1G6PA 1B9MA 5IWAL 2Q2TA 5IYBH 4JBJA 5C4JB 1Q86C 2JA8B 3CC4A 3WOFA 1Y8PB 4ZK9B 1TS3A 3MHBA 3E6ZX 1VDZA 2ZTEA 1HTPA 3K5NA 3T4AC 3BG3A 3EROA 1BBXC 1V8QA 3CCVA 3PUWA 2JA5G 1EFWA 1R4QB 4DAYA 1GUNA 4R4IA 1BNZA 1F9SA 3HOYB 5KRUA 1TWHH 4CKEA 3STBD 5C0XJ 3M4QA 5JEAJ 1X3EA 1NJIC 3GTQH 5C4XH 1ESRA 1J5KA 1J4WA 3GTJH 1NR2A 5BN4A 1M90C 1R4PB 2UU9L 2ENBA 1XXGA 3T1YQ 3S2HB 5IYDH 1T9HA 1QCBD 1XJVA 4UDUC 4JI8L 2ZT9C 4DR5Q 1GUWA 4L63B 5C4HA 3RZOB 1NMFA 2CTEA 3DUZA 1N36Q 4A3GG 2NVYH 1KAWA 4PZ7A 1QZGA 5IGFA 5JVH3 2ZTCA 3SXHA 5D65A 3T16A 2EVBA 4GOPA 5EPLA 1KDBA 1PDQA 3MXUA 5DLQE 1IW7D 1NBWA 1CQFA 2OQKA 1KHMA 1ZYRD 1PTOC 4UP8A 4NDXA 4YY3L 2PCFB 1SJHD 1DT4A 3GV3A 2YU9B 4LFCQ 3H0GG 4C3JH 3WDNA 3VYRA 3D4RA 2CHBD 4X62Q 4RA8A 4BBRB 1VF5C 3ND8A 1AE3A 3Q8DA 3KJPA 2A68D 2F0FA 2F3IA 1TVXA 1J5EL 3SEBA 5KYIA 1L0XB 1Z47A 2DY7A 4KJNA 4DAYB 4DUZL 2WAQG 3RN5A 2A5HA 2VUMH 4DAMA 4ALPA 5EBDA 3PUYA 4RGMA 3F8TA 4A3MB 5IGBA 1QG7A 2K33A 2Z4HA 2DUDA 2Y0SG 3HOWG 2MP1A 2WKDA 4YCVA 3A8JE 1O7ZA 2R93H 1JWSD 5LMNL 1Q1BA 4XTCS 1ENCA 1C4QA 1DM0B 4A3BB 2UUCQ 5E3FA 1H9SB 5C3EG 1B8AA 1YNXA 1C48A 3RZDB 2Q2HA 2AUJD 4FXKC 4GN4B 1JICA 1Q8KA 2DGRA 2D0PA 4J1MA 2L12A 5FLXE 3QOJA 2WKCA 1I4PA 4JYAL 5IWAQ 2A69C 1LT5D 2NN6H 1L1OA 4XQJA 1EWCA 1X3FA 1YJNA 3OIQA 4IPDA 4KKTA 4GOPB 5GROA 3FHWA 1Q7YC 4G7ZC 1MSHA 3BJUA 3A55A 4JOIA 1UNSA 4DUYL 2MUYA 3PMFA 1YHBA 2RDGA 3W1BA 2CWPA 2CCZA 1EZ8A 2B3GA 3DM3A 3RLNA 3F2DA 3HOZB 4HJ8A 3CCEA 1N8RC 5HY6A 1EYCA 1XWEA 2BCOA 1KABA 3BDLA 1VQ6A 1ET6A 1P8LA 2HQLA 1BO0A 1Y1WG 2B63G 5IODA 4L5RC 1XMOL 2Q8RE 1WI5A 2L9HA 3ONAB 2AQ2B 1DONA 4RHRA 2UU9Q 4A3LG 2CPQA 3FKIB 2F0OA 3S1MB 1U4MA 5CMDA 4GN3B 4CKBA 5IGCA 4JI8Q 2YQRA 1SFOB 1F2YA 1XYIA 2B2TA 5AJ3L 3CCMA 3ITPA 5JEAH 4JBWA 1A2UA 1MIUA 3BVZA 3S2DB 1N32L 1KIXA 4F87A 1RODA 1EQTA 1EY4A 4YY3Q 1Q8IA 1I50H 2OEOA 4R8IA 4IJLA 3F2BA 4HSPA 4HIKA 4Q5VA 4ZAIA 2L4NA 4K0KL 3KLSA 5EKKA 4RWSC 1TY2A 2K7VA 1GM5A 4MIUA 2LMCB 1WJJA 3G4SA 4A3KB 3VYTA 1SBBB 2X6LA 1GHKA 5J3BA 5JAVA 4FF1A 2AWOA 1J5EQ 4QY7A 3I72A 3HKZB 4DUZQ 4A3IB 3CQZB 2L0CA 1TWAH 3Q22A 3BYTB 2SOBA 3N6RA 2FJ2A 3MVVA 4BA1I 1CUKA 1Q90A 1XNQL 4A3EH 2EJGC 5M3FB 3I4NB 1ET9A 2Z6KC 3DMUA 2B29A 4KV6A 2PO4A 2UUAL 1PTOF 2F4VL 5KGUA 3MEHA 5LMNQ 4C1NK 4A3FG 4X65Q 2ZJPA 3A0JA 4OO1I 2FXQA 4QIWE 4DV4L 2KOLA 1ZKOA 2F3VA 3CMAA 1EL0A 4R1JA 3HOXB 2UXCQ 3FP9A 1ZEQX 2FFKB 2KHSA 3CCLA 4JVHA 3KDFA 1KDAA 1BR9A 3R2IA 4JYAQ 3K81C 2RHSB 1HUNA 3BU2A 5EGTA 2D2CC 1X9NA 1YZ6A 4EQOA 1K83H 1I4GA 3NPPA 2ICEC 2QCPX 3KFUA 2NZ1D 1DJRD 3M4OH 4DUYQ 1PMRA 5ELFA 2B2WC 5M5WB 2JA7G 2ZM6Q 4LF9L 1D2BA 1PYWD 1Y1VH 2L55A 4WRDA 2N3SA 2Q2UA 3DHQA 1HPCA 4CJ2C 5LL6X 1TU2B 3PO3B 1YJ9A 1CTMA 1AW7A 5G3LF 4BXXG 4JK1C 1B4OA 1HNWL 1LTSD 3S17B 2X69A 3WOEA 1E22A 1SN8A 5A2QE 1HR0W 2KUMA 4KHVA 4BBRG 1LACA 3QG1A 4JBMA 1A0IA 4HIDA 1WCMG 5M3MB 4IURA 4RKLA 1E7ZA 3I90A 5HURA 2QA4A 1RTOA 1IYJB 4ODGA 3S14B 2VB3X 2NVTB 5AJ3Q 4ZLTF 4LFAL 1I4HA 3KK7A 4LAAA 1D5MC 2XNAC 1D5XC 1B9NA 1N9WA 1N32Q 3KDFB 1YHAA 4DU9A 4A3MG 3TN2A 1SRUA 1X4MA 1PRTD 3D31A 3J81j 2D62A 4JC0A 1HNXL 1IBML 4K0KQ 1YNJC 1ENFA 1SMYD 3K5OA 5IIFA 3A54A 3SK8A 3G48A 2E5LL 2K04A 1B2TA 4B3SL 4LF7L 4ILWA 2D0OA 3HOVH 1LUZA 1HZ9A 4EVOA 4AM3A 1LV9A 2M2LA 2I5HA 4B9WA 2K5HA 1ZZJA 3SK4A 1A8VA 1K1GA 3ICEA 1QWYA 4Q0FA 3H15A 4AYBB 5ISRA 1XNQQ 3T53B 1EZ6A 3MXNA 1K9MC 2F0HA 3E0JA 1HA6A 5FLMH 1I6HH 1CFMA 2JXMB 4OXPA 2UUAQ 4KHZA 1KTKA 3MXGA 3MC0B 1HZCA 2H5XA 1K8AC 1TWGH 2F4VQ 1EC6A 2AWNA 4P72A 1LTLA 2C5CA 4DV4Q 3UDXA 2RQXA 3HP3A 4H0LC 1EQVA 2VNUD 1KNAA 1JR0D 3I70A 3CF5A 2EY1A 2RDFA 1XX8A 4K8IA 5I2YA 1X65A 4A3CH 4K5WA 2NVQB 1F9PA 1UE5A 1JCKB 5ELNA 3OWEB 1EY5A 1Z9FA 1OXVA 3BDOA 4OONA 4A3GB 1WOCA 3J80i 4O1NA 4OX9L 2A1AA 3PO2B 3VR3A 1TS4A 3PUZA 1FYCA 3KF8B 3J7YW 1RIPA 2PMZE 1W6KA 3S24A 4LF9Q 3H0GB 3PF5A 1VIGA 1LTAD 1PRTB 3CCRA 4OO1G 2B2VA 5FK9C 1HFGA 5JPMC 1N34L 4R4CA 4UP9A 4DR4L 3HOUG 2WINB 2RBMA 3V2TA 2MHVA 4HN7A 1J8IA 1CKOA 2JVZA 2C9OA 2J7ZA 1UEBA 1HNWQ 3A5ZB 3EIVA 5IP7H 3V96A 1U5KA 1PFSA 3J7AF 1F77A 1LT3D 2R92B 1IKMA 2B8FA 2ICIA 3MXNB 1A3UA 4Y7NH 3EVQA 4X3KA 4A93H 2Y0SB 3HOWB 4H13C 1YJWA 3AU7A 2JA6B 5GAGC 5M5YB 4A75A 4A3KG 1D6EC 4LFAQ 3TP6A 4X64L 5C3EB 1HUMA 5GAEC 3R93A 1HTLD 5C3WA 1UUPA 2V1CC 3IFDA 2RKSA 2OT2A 3KLSX 2A6HD 4POFA 2BL5A 4TKOB 4A76A 4M1UB 3UE1A 3VR2A 3I4NG 1YITA 4HR7B 2JA5H 5BN5A 4C3IG 1LTBD 2MJ8A 5ELOA 1R9TH 1HNXQ 1E1OA 1IBLL 1CA6A 2PQAA 1IBMQ 2VQFQ 3OTOL 1JQYD 2E5LQ 2E2JH 1B3AA 4B3SQ 4UAIA 1N33L 1LYLA 4LF7Q 1A3TA 3TBIB 3HOXG 2KQ3A 5LMUL 1FVIA 4DNIA 3AQQA 4PQXA 3K7UC 1SE8A 1SROA 2AKWB 3G71A 4APVA 3CXCA 3TREA 3BYYB 5IOCA 1S5CD 2HDMA 4FXGC 2K75A 1G91A 4GS3A 2KCNA 2PYKA 5KNCA 1RDPD 4J15A 1Y1WB 2FMMA 4YHHL 3PIPA 2YTYA 2K28A 1CI3M 1FD7D 4HTHA 1D8LA 1HR0Q 1STYA 2PZWA 5C4XB 4JI6L 2BA0A 2PW5A 2GA4B 1I3QB 1DZ1A 1BXTA 3J81i 1IL2A 3GTJB 1VQOA 1JORA 5I2XA 2ATWA 3C3LA 3S15H 4BY7G 2CTMA 1HQMC 1RF2D 4A3DH 3ULJA 4PG3A 4G57A 1SEBD 2DGYA 4FF2A 2XVSA 2VQEL 1X32A 4IFDI 4DK6C 2N88A 4OX9Q 1S4ZA 2RF4A 3D0FA 3PGZA 1K73C 3KUPA 3S1NH 5IGEA 5IT9L 4BBSG 4NXML 3CW2C 1PH6A 3D8GA 4FVMA 2PQAB 3JAMc 1ZTGA 1UE7A 2F0DA 3PIOA 1DOKA 4DK3C 2WAQE 4KKUA 1N34Q 4LWCA 2OTLA 4DR4Q 5CGKA 1YI2A 4YWLA 3K80C 2MO1A 1BCPC 2PNRC 2RSOA 2Y0SE 4C3HG 2CW0C 2BH2A 2F0IA 1HHVA 2HQEA 2HH2A 2J4XA 2KVMA 4X6AH 1IZ6A 1SYBA 2SDFA 3GD7A 1H95A 1VMPA 5KEEA 1JE4A 5EJWA 1CSQA 1KD1C 1NE3A 5EPKA 4A3FB 3HFZB 5AFWA 1U9RA 4X64Q 4YWKA 2PI2A 3U4VA 1STGA 1WE8A 4HJ7A 3GTOH 1NSNS 4DV7Q 4AYBG 3RN2A 5C44G 1STEA 4KMUC 1WTOA 3I4LA 1IBLQ 1K8MA 1B70B 1LT6D 4L8JA 5COYA 2Q8IB 3OTOQ 3U58A 1N33Q 4EX5A 2LY7A 5LMNW 1H9SA 2UUBL 3GTMB 3JC66 5LHY1 3GO5A 5LMUQ 4GN5A 1E2ZA 2EOTA 1IXRA 2B63H 2JA7B 1RKNA 5K36G 1NCVA 1GUGA 1WFQA 4DV0L 3L7ZC 4QB4A 1JB7A 3PO2G 3BVGA 4V190 1LT4D 3HGBA 3OWFA 4CBVA 4DK0A 5CV7A 3ULLA 4FNFA 4YHHQ 1EY0A 5EBCA 1VQDA 1PTOD 4X3TA 4JI6Q 1EOTA 4E6IA 4A3JH 2KHIA 2MFIA 4DV2L 3GQBA 5IY0A 3QJYA 1VQ7A 4IQZA 4CGYB 2LXKA 2ZJRA 3GTPB 4ZUIA 4HCSA 2LKVA 2WACA 1WCMB 3I4MH 2RSNA 4JVYA 4RCNA 1YEZA 2VQEQ 1ZYRC 4AIMA 4HCEA 3OYYA 5FKAC 3U4ZA 2R92G 4LF4L 4DV1L 1PH4A 2OPUA 1TWFB 3HG9A 3BS1A 3D4DA 5J1ZA 4NXMQ 4WORA 2K4KA 2JSOA 2ZJQA 1WTXA 1EY7A 4QCLA 2B2YC 2JA6G 2D5DA 4ZYSA 4GLAC 3TDQA 1AEXA 4R4TA 1PH3A 2WB1G 4G4KA 1HQRD 2MQHA 2XN9C 1KQSA 2A19A 4TSSA 3E5SA 2JYOA 3VA5A 5C4JH 2JA8H 4C1NI 5EAYA 2LFNA 1J6QA 1KLUD 3LWEA 1P16A 1HJPA 1X6OA 3TRZA 4DR2L 2EYJA 1KHIA 3DWAA 4IFDG 1NR4A 2YTVA 1OTCA 2A69D 4PMBA 2M9VA 4UPAA 3U50C 1EU3A 1A3VA 1BF4A 3HOYH 1RL2A 1SXTA 3SVMA 1AZQA 2BE5D 4K5XA 4NPSA 1Z7TA 4JCVE 1XNRL 2R3ZA 5KNDA 4DR1L 4WALA 3S16B 1TWCB 4DNTB 1LO5D 1PTOB 2F52A 4JG2A 1KRSA 1LTGD 4RGNA 2KENA 4AH6A 3H3VH 4IUUA 1I94L 4FO2A 1GXDC 1C8CA 1BCPF 1HA5A 1V1PA 1EEFD 3S2HH 4FYDA 2B2UC 2FMCA 3L0OA 1CKNA 2OTJA 1E2VA 3OPOA 3DEPA 1YNND 2ZXPA 1FNVA 4BY1B 1C9OA 3AFQA 3RZOH 3UE0A 2XRSD 5NUCA 1SJED 1ENAA 1BVSA 2N55A 2UUBQ 5C4XG 4N9TA 2EY5A 1Y8OB 3MFGA 3ZJYC 4R4OA 4DV3L 2PZTA 2HIXA 4KK7A 1XPUA 1GUOA 2CVRA 4DV0Q 5IYDG 2YU9H 1EY9A 2UXDL 3NELA 3HOUB 1H9JA 5I9OA 5C0XH 4BA2I 4XYOA 1X3GA 1QNKA 1M4VA 1MSGA 2QEXA 4DXGA 2G9HD 4L5TA 1JT8A 4YIJA 5KNBA 2AQ1B 2B8GA 3M3YB 3EA6A 1KL9A 4RGTA 3U9OA 2FINB 3W3AA 5FLXL 3FEWX 1F2LA 4TRDA 2BDOA 1AFPA 1A2TA 3BZDB 4IOAA 1PH7A 2IL8A 1F9RA 1QOHA 3J7ZC 1UAPA 3QIAA 4QL5A 5CV6A 3NQIA 4LF4Q 1KXLA 3HRZC 4I7ZC 4IZ8A 4KI0A 4DV1Q 4A3BH 3NP8A 1KAAA 4EGVA 4WJ4A 1V1PB 3P7JA 1VQBA 3RZDH 1ASZA 2ANNA 1EYAA 1CKNB 2VUMG 3NBHB 4O2DA 2VW9A 1VQNA 4XQNA 4C3IB 5DM73 1LM0A 4HSVA 4DR6L 2Z6KA 4M8AA 4XDXA 2L15A 1FR3A 3A7LA 1KLGD 1S72A 4L5QA 1M8AA 1EQQA 1LLRD 2E2IB 1S3OA 5H1SE 5FJ8H 1PH5A 3GTKB 1Q82C 1DGSA 2NVXB 4DR2Q 1VQ8A 4P74A 1SE3A 3J7A5 1AZPA 4JI3L 4K6LA 2Z0SA 3PV0A 1V9PA 3HOZH 3M9BA 2PZUA 1XNRQ 1D5ZC 3I91A 4DR1Q 2WFWA 1V1QA 2XGTA 3K5LA 1U4RA 4IPGA 4GKJL 1PZKD 2B2WA 5FO7B 2JEAI 1I94Q 4DR7L 4ME5A 1C0AA 5M5XB 3A5UA 4BY7B 3GP7A 4CJ1B 2A6EC 3NXWA 3FKIH 4B3TL 1AE2A 1JWMD 1VCIA 1NMGA 1SFOH 3DWPA 1PFNA 2EIFA 1XMOQ 1SNQA 4QQBX 1QVFA 3FVQA 3K0YA 4BBSB 2Q2IA 5BR8L 4DV3Q 3S2DH 3MFYA 2CKZB 1X56A 2N8NA 1CKMA 4DAPA 1U0LA 4LUZA 3JAME 3M7GA 1ASYA