2JE6I

Structure of a 9-subunit archaeal exosome
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
215
structure length
207
Chain Sequence
QEIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKSIFVANNGRIWAFSEEILIEAIRKIENESHIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
publication title RNA Channelling by the Archaeal Exosome.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 39
structure length 207
sequence length 215
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2je6I01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2je6I02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2je6I03
3NENA 1ZYRC 1VQ9A 3KJPA 1Z7TA 1SMYC 3I4LA 5C0XI 4PZ7A 2R7FA 4DR5Q 4DV4L 4IPDA 2JXMB 2KBNA 4LNQA 1B8AA 4GN5A 4BXXH 5C3EG 4KN7C 2JA5G 5LMNW 4L5SA 2A1AA 3SDZA 1C9OA 4JBWA 1QZGA 3A0JA 1I50H 2K5VA 3W3AA 4DNTB 1LM0A 3U50C 1EIFA 1VQ5A 4A3MG 1PA6A 2C35B 3F8TA 4PZ6A 5C3EH 3A74A 4DUZL 4LUZA 3ULJA 2EXDA 4IOCA 1E2ZA 4LFCQ 1N33Q 4HIDA 1IW7D 1YJNA 2KCTA 4LFBL 1O7IA 4A3MH 4LF4Q 4AYBG 2ANRA 2N49A 1B7YB 2QNDA 2ATWA 2YU9H 5DLQE 1K8GA 3CXCA 1DXMA 2OCEA 1KHIA 2B8GA 1NTGA 4BBRH 2E8GA 2NN6G 3HFZB 4KKUA 2VUMG 4DV7Q 4LF9Q 3BZKA 4TKOB 2CKZB 1G6PA 3I72A 2D5DA 2JA6G 1G291 2OPUA 4DR2Q 4DNRB 3RN2A 3KF8B 2OQKA 5GADC 1VQPA 2HIVA 2QEXA 2NN6H 2VUMH 1U0LA 1VQBA 2E76C 1K1GA 4MZ9A 3S14H 3T53B 4JI7Q 4DK0A 3VR3A 4X65Q 4L5TA 3H0GG 3OTOQ 1UE6A 2MO0A 4DR5L 1VIGA 3M9BA 1U5KA 5JEAG 2I0QA 5HGQA 1WYDA 4HJAA 2LMCB 3PUYA 3L0OA 1Q12A 1WCMH 3M4QA 3TRZA 3S15H 1XJVA 4OX9Q 1PHJA 1GHKA 1MKHA 3M7NA 3RN5A 3CRLC 4IJLA 3H0GH 1YHAA 1UE5A 2BE5D 4GN4B 2JEBI 5JEAH 1VS0A 4MTNA 3GTQH 1MJEA 1IZ6A 3KJOA 3UDIA 3S24A 1EYGA 4LFCL 1N33L 5IT9c 4MNOA 5ELNA 1CI3M 1PH7A 1KXLA 2ZJPA 3RR5A 1N32Q 1CTMA 4NXNQ 3KF6A 4A3BG 3VR6A 1TU2B 1ZZKA 4X66Q 3CMEA 1S3OA 3G71A 3HKSA 1CKNA 1HZBA 4JVHA 4WJ3M 2B63G 3VR2A 1H9KA 4JI6L 1PH5A 4DV7L 4LF9L 4B3RQ 1C0AA 1X9NA 1X3FA 4DK6C 1S72A 1Z9FA 1SE8A 1YHBA 4A3DH 2AWOA 2AWNA 5JJKA 4JI0Q 4DPGA 1CKNB 3PCOB 2NN6I 1L1OB 3QIAA 2ZM6Q 4IQZA 1SROA 2I5LX 4JI7L 2F4VQ 1Q1BA 3OTOL 2BL5A 3BJUA 2UXDQ 1SLJA 3IFTA 4DR4L 4UP7A 1IBKQ 3T1YQ 2VY3A 2B29A 1VQKA 4DR3Q 2PI2E 4L5QA 4O0AA 2L15A 1Y1WG 1JMCA 1HR0Q 1XNQQ 4JI8L 1OXTA 3TEHB 1W2BA 4PMWA 1Q1EA 1EOVA 4GLXA 4GKKL 3F2CA 4LF7Q 1VQ8A 2KA7A 3NE5B 2YQRA 4X64Q 1GM5A 1TWFH 2EQSA 1Q8KA 2B8FA 3KLWA 2ZT9C 1Y1WH 2WFWA 4P71A 2AHOB 2CCZA 2P2RA 2CQOA 2E5LQ 1I94L 1DD2A 4B8TA 4OWWB 2WB1E 5IWAQ 1N32L 4NXNL 4KKSA 3H15A 2DGRA 3ZJYC 4YWLA 1ASZA 4X66L 4RG1A 3CCVA 3I4MG 1OXVA 4DNIA 3HOZG 3ULLA 2IX1A 1A8VA 4B3RL 3GO5A 3PV0A 1O7LA 3I55A 5HY6A 3NEMA 4JI1Q 1Q90A 2JEAI 1VQFA 3I4MH 3K7AH 2HT1A 5GROA 3A5ZB 3CCQA 3HOZH 3ERSX 1IYJB 4JI0L 1PFSA 4L8JA 4WANA 2K33A 3U4VA 2ZM6L 2F4VL 2PI2A 4C2MH 1NY4A 2A69C 3HKZE 2XGTA 2CTJA 1JJCB 4LW1A 4JBMA 4NXMQ 3PGZA 2K5NA 2UXDL 1A62A 3STBD 3OW7A 2NZHA 1Y8OB 4KHZA 3T1YL 4EQ5A 4DR3L 3PUXA 2QGQA 1T9HA 3PUZA 1PMRA 5M3MG 3CF5A 1XNQL 1PYSB 3SGIA 3GDEA 4LJZC 4LFAL 1X3GA 1NMFA 1TWHH 4LUVA 4LF7L 1OXUA 2F52A 2KCMA 4X64L 2IT1A 3V69A 1VF5C 1T5EA 1UEBA 4BBSH 4J15A 4DV0Q 1CSQA 3P20A 4JC0A 1LUZA 1XTDA 5IWAL 3HOVG 1RIPA 4KLKA 2ZTCA 2Z6KA 2BH8A 2A19A 2UU9Q 1VF7A 3MXNB 4OWXB 3QJYA 1Z47A 3TQYA 5BN4A 3L2PA 4I7ZC 1ONLA 1PH4A 3PO3G 1AE2A 3HOVH 2GN5A 3Q8DA 5KNDA 4JI1L 3RZOH 2JJQA 2BH2A 3IKJA 3KOJA 4HJ9A 4G7ZC 2JA8G 4G7HC 3PF4A 5M5XH 1YZ6A 3PO3H 4HJ8A 3A8IE 3CCUA 1HZ9A 1SMXA 1R9TH 2OQ0A 4IPGA 4A3FG 5IYCG 1RL2A 2D62A 4NXML 5BN5A 2RF4A 1YNJC 3K7UC 2JA8H 1B9NA 1JE5A 3N6RA 3S1MH 3PF5A 1SR3A 2UUBQ 3I4OA 3ND9A 1B9MA 4A75A 1ZKOA 4BXXG 4DR7Q 4A3FH 5IYCH 4JI2L 2K52A 1AH9A 2CW0C 1XPOA 1N36L 4Y52H 2EJFC 1LABA 2AKWB 2PY9A 4DV0L 1YEZA 2ZJRA 1X4NA 5M3FG 4FDBA 1PH8A 3CMAA 4JI3Q 2V1CC 1VCIA 4GLVB 1V8QA 1DGSA 3S17H 3W1BA 1IL2A 2UXBL 4DUYL 1HNXQ 3CPFA 1GVPA 1X56A 3CCLA 1FL0A 4IPHA 5M3FH 4LF8L 2Q2UA 2CPQA 1HQMC 2CTLA 4PV1C 1EQRA 4KKTA 4BBRG 3WDNA 4X62L 1O78A 1KIXA 2EJGC 3TS2A 1V9PA 1KAWA 4AM3A 4DR6Q 1GUSA 1LACA 2JA9A 2LXJA 4YCUA 1ZZJA 1Q82C 2E2HH 1E22A 1ZTGA 2YV5A 3NELA 3U58A 3H94A 1VQCA 1TKWB 4JVYA 5IYDG 3RNUA 2ANNA 5M5YH 4O2DA 1XMQQ 4UY8C 1WCMG 2NVXH 2XTIA 3DLLA 4DR7L 1K3RA 1FVIA 2CTKA 5IYDH 2MJHA 3OPOA 4TQUS 2E3UA 2HIXA 3GTJH 5KNCA 1J6QA 3UDGA 2A6HC 3T56B 1VQHA 3G48A 4A3IG 1V43A 4BY1G 2PQUA 1KRSA 4JI3L 3HOYG 2MFIA 1DTJA 5K36G 1K8AC 3I73A 3EIVA 3F2BA 3HOWG 1M1KC 1CSPA 4OGQC 2JZXA 2MQHA 3KYHC 1HNXL 4LF6Q 3RLOA 3T51B 1E1OA 4A3IH 1H9RA 4BY1H 3EQLC 4OONA 1I6VC 3D4RA 1JT8A 3HOYH 4YY3Q 2Q2TA 5K36H 3HOWH 3K8AA 1EFWA 2IY5B 2E75C 3H3VH 1Y69U 1K83H 2Z6KC 5ELOA 2VZAA 4LF4L 1XPRA 4Y7NH 2D0OA 3A7LA 4GNXA 4DR6L 3D31A 4YCVA 4A3DG 3ER0A 2JVZA 4LIJA 3W1GA 1GKHA 1L1OA 4KMUC 3CCSA 3F2DA 4QJFA 4LWCA 1YIJA 1QVGA 1DCZA 1TWCH 1H9SB 2EJMA 3J80c 1LYLA 3PO2H 1XMQL 1YHQA 4DR2L 4GNXB 1VQJA 2A69D 5E7NA 2WAQE 3ULPA 2RHQB 2K5HA 2UUCQ 1X54A 1FJGQ 1E1TA 3SE0A 4X65L 1D8LA 1YNNC 2EVBA 2VS1A 4GKJQ 1S40A 1JJ2A 3S1QH 3VA7A 1ZZIA 2NZOA 3CC4A 3MFYA 4BA2I 4OX9L 3BG3A 4P74A 1GD7A 4B3MQ 4R4CA 4LF6L 3J81i 5AJ3Q 1UE1A 3FMCA 1VQNA 4KI0A 2PQAB 2R6GA 1UWVA 3J7ZC 4YY3L 1KQSA 2VQFQ 1IBMQ 2OWOA 1N8RC 4A3EG 4A3KG 1Q7YC 4H0LC 2DNEA 3H3VI 3DM3A 5FLMG 4RMFA 1Q81C 2CTFA 4A3EH 1N34Q 4A3KH 3GTOH 4XTCS 2GVBA 3HGBA 5FLMH 1VDZA 2A6ED 3LNNA 3OW2A 1WJJA 1Y8NB 4YWMA 3BDOA 5FJ8G 3KLRA 4IFDJ 4POFA 2RHSB 2YTVA 1X3EA 3VR4A 2UUCL 4A3LG 1FJGL 4UP8A 2NVQH 1PH2A 3UDFA 1KC8C 1XMOQ 2OTJA 1K8OA 4DV6Q 1PV4A 2Q2HA 2WAQG 3FP9A 4LUOA 3W5OA 5FJ8H 1VIHA 1TXYA 2BA0A 3KDFB 3I7FA 4A93G 1IBKL 4A3LH 3E9HA 3EN2A 1OXSC 4B3TQ 5J3BA 4BBSG 1E7ZA 1HR0L 3TZUA 4JK1C 4JOIA 4B3ML 3KFUA 1VQIA 3JC66 1EWIA 4DV1Q 4X6AH 4DKAC 4HIMA 1N9WA 4B3SQ 4PG3A 1E2VA 4A93H 3CCMA 1IBLQ 4A3JG 3GQBA 3CCRA 1TUAA 2VQFL 1IBML 4HR7B 3M85A 4HIOA 5H1SE 4LF5Q 3BZCA 2E5LL 3NBHB 4IPCA 2LSSA 1VQDA 2I5MX 4DV5Q 2AUJD 3U9SA 1CUKA 2KENA 1W3SA 4JV5Q 3VDYA 1K73C 5C0XJ 3U4ZA 4AH6A 2CTEA 1NE3A 4YHHQ 4A3JH 3T1HQ 1KL9A 4UP9A 4QIWE 2WB1G 4K0KQ 1JB7A 1N34L 1IYUA 2AUKA 2ZJQA 3RLNA 3CRKC 1L2FA 1FGUA 1HZCA 1EWHA 4DAYB 4A3CG 3GTGH 1HJPA 4XIGS 2K75A 4DAMA 3PUVA 1KRTA 2N3SA 1Y8PB 1I5FA 1GUOA 4GNXC 2KCCA 1YBYA 1CKOA 1J5EQ 4P75A 3VKEA 2HQLA 1MJCA 1L1OC 4A76A 1XMOL 4DV6L 1QVFA 4A3CH 1IXRA 2E2IH 1DT4A 1V1QA 3CC7A 1GHJA 2R92G 5EAYA 1K0RA 1WFQA 1K9MC 1VQMA 3ICEA 3TS0A 3PIPA 3M4OH 3HKZG 5C44H 4ALPA 1IYVA 1GUNA 3JAMi 3AYHB 2A6HD 1K8MA 3FKIG 4L5RC 2R92H 1EQQA 4B3SL 4G7OC 3GD7A 4GOPB 3GTPH 3A7AB 1FR3A 5JJLA 4GLAC 2DGYA 3CD6A 1NJIC 4JBJA 3M4YA 4DV3Q 3CQZH 5IE8A 1GUGA 1HNWQ 3AB9A 4LF5L 3FKIH 4DV5L 1M90C 1D7QA 1YJ9A 1Y14B 1Q86C 2FMRA 2UU9L 4C3JH 4JV5L 2NVYH 1SFOH 4JI4Q 4YHHL 3T1HL 4A3GH 1EUJA 1Z6HA 4K0KL 4AQYQ 3RZDH 5BN3A 3K81C 1X6OA 5BR8Q 1LTLA 2VNUD 5A35A 3GTMH 3I56A 2A68C 2PPBC 5LMNQ 2GVAA 2ZTDA 2EDGA 2JA5H 1CFMA 1HPCA 2H5XA 1WI5A 5LMUQ 1J5EL 3PUWA 2QA4A 4AIMA 1KD1C 1VQ7A 2CWPA 3VR5A 5GQOA 1E3PA 3RLFA 3S2HH 1YNXA 2A8VA 2OTLA 4OXPA 1QVCA 1WOCA 5IP9G 2UUBL 4JBKA 4JI6Q 1YI2A 1VQGA 3ND8A 1E2WA 3CW2C 1XNRQ 2K50A 2O5JC 2IHEA 1QJOA 1MIUA 3TREA 1HH2P 4LK1C 5IP9H 4DV3L 2KHIA 3S1NH 3J7A5 3D0FA 5IY0A 1HNWL 4H44C 5C4JH 4JG2A 3PIOA 3E0EA 3UE0A 1BVSA 1PH3A 2Q8IB 2JA6H 4R4TA 2VQEQ 4JOIC 4JI4L 5JJIA 3E9IA 4DR4Q 4IOAA 1P8LA 4TVAB 3A5UA 2JE6I 3QG1A 4AQYL 4GN3B 1Q46A 3M4PA 5BR8L 4JI8Q 2PMZE 4DV2Q 2YTYA 4GZYC 4IJHA 4OO1G 2MNAA 5LMNL 4GKKQ 4KHPQ 3WWVA 1H9SA 5IYBG 2D0PA 5JEAJ 3CP0A 5LMUL 2K32A 1VQAA 4WJ4A 3PO2G 2VW9A 1J5KA 4H13C 4OO1H 1I94Q 1I3QH 1A0IA 1SRUA 1HNZQ 1QZHA 4JYAQ 3HOUG 5FLXc 5IYBH 2EIFA 1IW7C 3AFQA 2LXKA 2CWAA 4OWTB 3L7ZC 1I6HH 2R7DA 1VQ4A 2DUDA 3J80i 3FHWA 4A3BH 5GAHC 2PNHA 2ES2A 3CCEA 1XNRL 3HOUH 3KF6B 1ASYA 2R93G 1OTCA 2E74C 4IO9A 2ASBA 4APVA 1HR0W 4GOPC 2PQAA 3CCJA 2B63H 2AXYA 4QL5A 4QY7A 2VL6A 4PZ8A 1A63A 2DNCA 3S2DH 3DXJC 3MXUA 2D2CC 2HH3A 2Q2IA 1TWGH 2R93H 2VQEL 1HCZA 2IHFA 4C3IH 2YTXA 4R4OA 1VQOA 1E24A 4UPAA 4RCNA 1VQ6A 4JI5Q 2OPVA 4YWKA 3J81c 2WP8J 2JQOA 4DV2L 2IX0A 2JK8A 4LFAQ 1PH6A 1G51A 2KHJA 3K0XA 4KHPL 2E2JH 4IFDG 2Z0SA 4POGA 4P73A 2BE5C 1CKMA 5GAEC 5GAGC 3MEFA 4OO1I 1HNZL 3J81j 4JYAL 2CFMA 2I5HA 2R7ZG 1OXXK 2K7VA 4IFDH 3G6EA 4DR1Q 1Y1VG 2NVTH 3KDFA 2UUAQ 2F3IA 4R4QA 1YITA 3OOCA 3I2ZA 1VQEA 5M5WH 1TWAH 2B3GA 2R7ZH 1PYBA 1PVOA 3CC2A 1EC6A 2K14A 1Y1VH 4NB3A 4GKJL 4EX5A 1NMGA 2RCNA 1A6XA 1H9JA 4DK3C 1GO3E 2Y0SE 2UXCQ 5IP7G 3I4NG 2JA7G 3S16H 2N8NA 2L5TA 2HH2A 3GTLH 1JJGA 1BKBA 2YYZA 3IRBA 1BDOA 5C0XG 5AJ3L 4NBQA 3A8JE 3HOXG 4JI5L 4C3HH 2PCFB 1GJXA 2HHHQ 1PH9A 5IP7H 3I4NH 2JA7H 4DK1A 3OYYA 1X65A 3FPPA 4HIKA 3CAMA 3AEVA 4WALA 3LGJA 4ME3A 2ID0A 4A4IA 3B6YA 1J4WA 4JI2Q 5C0XH 1QUQA 1C7YA 4KN4C 3HOXH 4QMFB 3S1RH 1N36Q 5M3MH 1B70B 4R4IA 4DV4Q 1L0WA 3A8KE 4R1JA 2A68D 3AEVB 3M3YH 1EIYB 1WE8A 3BU2A 3CPWA 4HJ7A 1X4MA 2FXQA 1BBUA 1P16A 1YJWA 4GS3A 4HJ5A 1QUQB 1XPUA 2UXBQ 5KNBA 2AMCB 4DUYQ 1FYCA 4H02A 4IFDI 2ALYB 4NPSA 4DR1L 1VQLA 3EBEA 2F1MA 3PSIA 2UUAL 2MO1A 4LF8Q 1HTPA 1BBWA 3UE1A 4DUZQ 2BDOA 2N78A 3K80C 4AYBE 2ZTEA 3AQQA 2PNRC 4BY7G 4QQBX 2V4DA 5C44G 1X55A 4X62Q 3GTKH 2BA1A 4LFBQ 4JCVE 4GOPA 1YVCA 1WVNA 3AFPA 4QGUA 2UXCL 2A6EC 2K4KA 5C4XG 4BY7H 4B3TL 1UE7A 1AE3A 1PH1A 3UDXA 2Y0SG 2QF7A 3F1ZA 4P72A 4DV1L 3JAMc 1H95A 1NBWA 1GUTA 2DN8A 4YCWA 2HHHL 1SN8A 5C4XH 1IBLL 1KHMA 3G4SA 3U1KA 2CTMA 1HZAA 4A3GG 2O5IC 1H9MA 4BA1I 3STBC 3LWUA
chains in the Genus database with same CATH superfamily
2F0TA 1G2SA 1QG7A 1ZYRC 3IFDA 3NENA 2NUCA 1VQ9A 3KJPA 5C5LA 1Z7TA 5CV7A 3GR5A 5E3FA 1K28A 3Q6SA 1SMYC 3I4LA 4HCSA 5C0XI 4PMBA 2B2VC 3C1EA 1XXGA 4PZ7A 4B8CD 5IGGA 2R7FA 4DR5Q 5M3FB 5C3EB 3FRPB 3J80L 1GXDC 4IPDA 2JXMB 2KBNA 4DV4L 1B53A 1D5XC 4LNQA 1EIGA 4JI4H 1B8AA 1BCPC 1CHPD 4GN5A 4XYQA 4BXXH 5C3EG 4KN7C 3BZDB 5LMNW 2JA5G 5C3WA 4L5SA 2A1AA 4AQYH 3SDZA 1V1OA 1C9OA 5FO9B 4FP5D 1O7ZA 4JBWA 1QZGA 3A0JA 5BR8H 1O7YA 1GUWA 1I50H 2RDFA 2K5VA 3W3AA 4DNTB 1LM0A 3U50C 4N8X1 1EIFA 1VQ5A 4A3MG 1PA6A 4IUNA 2C35B 3F8TA 5LMNH 4NDXA 4PZ6A 1Q3LA 1PTOC 5C3EH 3A74A 1NXUA 1I4RA 1F2ZA 2EYHA 4DUZL 2F03A 4IUTA 4BBRB 5KEEA 4LUZA 3ULJA 2EXDA 4IOCA 1E2ZA 2E2HB 4DR6H 3OMCA 4LFCQ 1N33Q 1AW7A 3I3CA 4HIDA 1IW7D 1YJNA 4AYBB 3V05A 2KCTA 4U68A 4LFBL 1O7IA 4A3MH 4LF4Q 4AYBG 1QNUA 2ANRA 2N49A 1O80A 1B7YB 4NMZA 3URYA 2QNDA 2ATWA 2YU9H 3HRZC 5DLQE 1K8GA 3CXCA 5IOCA 1DXMA 2NVXB 1JB3A 2OCEA 1KHIA 3OMGA 2B8GA 1NTGA 4BBRH 5JAVA 2E8GA 2NN6G 3HFZB 1TS5A 4KKUA 2VUMG 4DV7Q 4LF9Q 3BZKA 4KY5A 2F0LA 2CKZB 4TKOB 1PZKD 3GTJB 4XDXA 1G6PA 3I72A 2D5DA 4V190 2JA6G 1XNRH 1G291 2OPUA 4R8NA 1WCMB 2MHVA 5FK9C 4DR2Q 5CV6A 4DNRB 3RN2A 1CHQD 3KF8B 2OQKA 5GADC 1VQPA 2HIVA 3EA6A 2QEXA 1D1IA 2NN6H 1RODA 2VUMH 1U0LA 1VQBA 2E76C 4NKLA 2HQEA 1K1GA 4MZ9A 3S14H 3T53B 4JI7Q 2KCNA 4DK0A 3VR3A 1WTRA 4X65Q 4L5TA 3H0GG 3OTOQ 4K14A 2K5WA 1UE6A 2MO0A 2RKSA 4K6DA 4DR5L 3M9BA 1U5KA 4IUQA 5JEAG 4BY1B 2I0QA 2VQEH 4HSPA 5HGQA 1WYDA 3DWPA 2LMCB 4OL7A 3L0OA 3PUYA 4HJAA 1Q12A 3HOYB 1VMCA 2WINB 1S5DD 1WCMH 2LF0A 3M4QA 3TRZA 3S15H 1XJVA 4OX9Q 5D3IB 1XWEA 3HOWB 1F77A 1PHJA 4EQPA 1MKHA 1GHKA 1HRJA 3M7NA 5COYA 3EFXD 3DWAA 4FJSA 3RN5A 3CRLC 4IJLA 3H0GH 1YHAA 4LAAA 4DV2H 1UE5A 2BE5D 4GN4B 2I46A 3TSSA 4C1NK 2L9HA 2K1HA 2JEBI 5JEAH 1VS0A 1UUPA 1U4MA 4MTNA 3GTQH 2L12A 3I70A 1MJEA 4EQNA 4KHPH 1IZ6A 1VBIA 3KJOA 1HTLD 1RTNA 2WKCA 3UDIA 2FFMA 1ICFB 3D4DA 3S24A 3SB1A 1EYGA 4LFCL 4OEMB 1N33L 1EZ8A 1UG8A 2PYKA 5IT9c 3IL8A 4MNOA 5ELNA 2KQ3A 1CI3M 1PH7A 4N9TA 1KXLA 3RF2A 2ZJPA 1EYDA 3RR5A 1N32Q 1CTMA 1HNZH 4RGNA 4NXNQ 3KF6A 4CJ2C 4A3BG 3QOJA 4JYAH 4ABNA 1XYIA 4A3DB 4LMQD 3VR6A 1TU2B 1ZZKA 4OHJA 4XXEA 4X66Q 3CMEA 1S3OA 3G71A 1RTOA 3HKSA 1CKNA 1KABA 1HZBA 4JVHA 4WJ3M 1B1ZA 4IUPA 2B63G 1FNWA 2CHBD 3VR2A 1H9KA 4JI6L 1AN7A 1PH5A 4DV7L 2FINB 4LF9L 2SNSA 4B3RQ 1C0AA 1X9NA 5KYLA 1X3FA 4CJ1B 4DK6C 3NQIA 1C48A 1LTAD 2MGSA 1S72A 4KD4A 3D6CA 1Z9FA 3KDGA 3S1QB 2L4NA 1SE8A 1JC7A 1YHBA 1LLRD 5CBEE 4A3DH 2AWNA 1MI2A 2AWOA 4GKJH 3ERQA 3K0YA 5JJKA 4JI0Q 5L37A 4DPGA 1CKNB 2IW3A 2RSNA 5KIXA 2BCOA 3PCOB 1L1OB 2NN6I 3QIAA 2VXWA 2ZM6Q 2PZUA 4IQZA 4KD3A 1SROA 2I5LX 4JI7L 2F4VQ 1Q1BA 4ZKCB 1A2UA 4ZCKA 1B4OA 4CDEC 3OTOL 2B2YA 2RA4A 3EVQA 1FGBD 2B2VA 2ENBA 1EYCA 1NSNS 2QDBA 2BL5A 3BJUA 2UXDQ 1EYAA 1TWFB 1V1PA 4CJ0B 1SLJA 3IFTA 4DFAA 4DR4L 4UP7A 1IBKQ 3T1YQ 2VY3A 4JI5H 2B29A 2Z1CA 5CC4A 4DR3Q 1VQKA 2PI2E 3K58A 4L5QA 4O0AA 2L15A 1Y1WG 1JMCA 4IZ8A 1HR0Q 1XNQQ 4JI8L 1OXTA 4WJWA 3TEHB 1W2BA 4PMWA 1Q1EA 1TY2A 2VQFH 1NNXA 2F0KA 1EOVA 1ILQA 5FOBB 4GLXA 4GKKL 3F2CA 4LF7Q 1VQ8A 4O42A 2KA7A 3NE5B 2YQRA 4X64Q 3K5LA 1GM5A 3MXGA 3PQIA 4ID6A 1TWFH 2EQSA 1Q8KA 3TP8A 3SK4A 1HA5A 2B8FA 5IODA 1II3A 3KLWA 4A3EB 1STNA 2ZT9C 1Y1WH 2WFWA 4P71A 1S5CD 2AHOB 3SVMA 3A54A 2CCZA 2P2RA 1F9PA 1IKMA 2CQOA 1M4VA 2E5LQ 1I94L 4IN3A 1DD2A 2NYZD 4FO2A 1M8AA 1SNPA 1RD9D 4B8TA 3Q23A 2WB1E 4OWWB 5IWAQ 1N32L 4YIJA 4NXNL 2H4OA 2FMMA 1SNMA 2NWGA 4KKSA 3H15A 2DGRA 4FF4A 3ZJYC 3DHQA 3HOZB 1XTCD 4YWLA 2N55A 1I4GA 4X66L 4RG1A 4ODGA 3CCVA 5IGFA 1PRTD 1ASZA 3I4MG 1Z2IA 1OXVA 4DNIA 5ISRA 3HOZG 5ELCA 1B3AA 2NVQB 2A5HA 5I6WA 3ULLA 2IX1A 2UUAH 1A8VA 1D5MC 3X3NA 3C2PA 1SYBA 3Q22A 2K05A 2MP1A 2Z4HA 2TSSA 4B3RL 3GO5A 1WTVA 4C2MB 2P5ZX 5CV9A 3PV0A 5EKKA 1O7LA 3NSWA 3I55A 5HY6A 1UNSA 3NEMA 4JI1Q 3FAUA 4EC5A 1Q90A 2JEAI 2HUGA 1VQFA 3I4MH 3K7AH 2HT1A 5JPMC 5GROA 3A5ZB 3CCQA 3HOZH 3ERSX 3NQTA 1IYJB 4JI0L 1PFSA 4L8JA 1MHWC 4WANA 5C5MA 2K33A 3U4VA 2B2TA 2UXCH 1LT4D 2ZM6L 2WAQB 2F4VL 2PI2A 4C2MH 1NY4A 4RWSC 2XRQD 1TWHB 5EBDA 2G9DA 1PQXA 4B3TH 4MIUA 2A69C 2FHTA 3HKZE 2XGTA 1BOSA 4EVOA 2CTJA 1JJCB 4LW1A 4A93B 4JBMA 4NXMQ 1PFMA 3PGZA 2K5NA 3HS0C 2UXDL 3NTKA 2A1SA 1A62A 3STBD 3OW7A 2NZHA 1Y8OB 5I2XA 4XT3B 5DM63 1ZYRD 1TVXA 4KHZA 4DV1H 4BBSB 3T1YL 4EQ5A 1G91A 1F9RA 1F9SA 4DR3L 3VYUA 3PUXA 2QGQA 1T9HA 5HURA 3PUZA 3PIP3 1PMRA 5M3MG 2HHHH 1SMYD 1BQQT 1ENAA 3CF5A 4L63B 3T16A 1XNQL 1PYSB 2PW5A 3SGIA 3SK5A 1IBLH 3OHXC 3GDEA 3MXPA 3J80W 5LL6X 4LJZC 4LFAL 4IUUA 1X3GA 2HDMA 2F0HA 1NMFA 2MUYA 3J7YW 1TWHH 1EIHA 1BCPD 3I90A 4Z9CB 4LUVA 4LF7L 1OXUA 2F52A 2KCMA 1X0AA 4A3JB 5C4ZA 4X64L 1TQOA 3T4AC 2IT1A 3V69A 1VF5C 1T5EA 3MHBA 1T5XD 1UEBA 4BBSH 1LTSD 4J15A 4DV0Q 4DV4H 1CSQA 3HOVB 3P20A 4JC0A 3BYTB 1LUZA 3P7JA 2O4XA 4TSSA 3GP7A 1X32A 1XTDA 2EYMA 3KLSX 3GTGB 5IWAL 3HOVG 1PTOD 1RIPA 4KLKA 1MD2D 2Z6KA 2ZTCA 2BH8A 4BWGB 2A19A 2UU9Q 2SOBA 1VF7A 3MXNB 4HMJA 4OWXB 3QJYA 2WB1B 1Z47A 3K5NA 5J22A 3K6OA 3TQYA 2HDLA 5BN4A 3QOLA 3L2PA 4I7ZC 1ONLA 1X9ZA 5A2QL 3J7AV 1I6UA 1PH4A 1BUVT 4DUZH 3PO3G 1AE2A 3HOVH 2GN5A 1CA6A 2KHSA 3Q8DA 1SJHD 3MFGA 5KNDA 1R9TB 4XT1B 2EZVA 4DAVA 4JI1L 3RZOH 2CPMA 4QF4A 2JJQA 2BH2A 3DMUA 5KRUA 3OETA 2SNMA 3IKJA 3MAQA 4LFBH 3KOJA 4HJ9A 4G7ZC 3S1MB 2KVMA 1KNAA 4F88A 3M4OB 2JA8G 4G7HC 3PF4A 5M5XH 1W6JA 3L9AX 1LTGD 1YZ6A 1LTTD 3PO3H 4FNFA 2LRRA 3NWSA 3MEHA 4HJ8A 4J1MA 2Q8TA 2ICIA 3A8IE 3CCUA 1HZ9A 2O2LD 1SMXA 2R92B 2LY7A 1R9TH 2OQ0A 2B39A 4IPGA 4A3FG 1G6ZA 5IYCG 1ET9A 1RL2A 2D62A 4NXML 5BN5A 2RF4A 1YNJC 2ICEC 3K7UC 2JA8H 2VB2X 1BXTA 3HKZB 1BO0A 1B9NA 4CHTB 1JE5A 3N6RA 3S1MH 3PF5A 1STEA 3NTIA 3MVVA 1SR3A 2UUBQ 3I4OA 3ND9A 3RD4A 1B9MA 5IT9L 4K5XA 4QCLA 3FKIB 1X3PA 1ZKOA 4A75A 4BXXG 4NZTM 1VMPA 4DR7Q 4CGYB 1JOOA 3I91A 4A3FH 5IYCH 1HNWH 3J7AF 2R61A 4JI2L 5EGTA 2NVYB 3TMEA 2K52A 1AH9A 4X3SA 2CW0C 2B2YC 1F2MA 4FXDA 2XVSA 2XWJB 5FLXL 3DUZA 1XPOA 1N36L 4EGVA 4Y52H 4DR5H 2EJFC 1LABA 2AKWB 2PY9A 3RZDB 4DV0L 1YEZA 5T1GA 5M9OA 2ZJRA 1X4NA 5M3FG 3DWQA 4FDBA 1PH8A 3CMAA 4JI3Q 4G08A 2HD3A 2V1CC 1VCIA 4GLVB 1V8QA 1DGSA 3S17H 1KDBA 1LV9A 3OSOA 2R3ZA 2F0UA 3W1BA 1F2YA 1WD0A 1IL2A 2OT2A 1F2LA 1A3VA 3T13A 2UXBL 4DUYL 1HNXQ 3CPFA 1GVPA 1V8CA 1X56A 3CCLA 3H09A 1FL0A 4IPHA 1A3TA 5M3FH 4LF8L 1JWSD 1I4XA 4B9XA 2Q2UA 2CPQA 4MTKA 1TS4A 2CWHA 1HQMC 1DONA 2CTLA 1EQRA 2B2UC 4PV1C 3MC0B 4DAPA 2F0FA 4KKTA 1SYFA 5LMUH 1UEAB 4LFCH 4BBRG 4XQNA 3NP8A 1N33H 3WDNA 2CH4A 2XRSD 4X62L 1O78A 2K1BA 1KIXA 1SNOA 1RHPA 1STHA 2EJGC 3NHHA 3TS2A 1CM9A 2PW7A 1V9PA 1F9QA 1KAWA 5M5YB 4AM3A 5CMDA 1ILPA 1JORA 4DR6Q 3J81L 3EJIA 1GUSA 1LACA 5DAUA 2JA9A 2LXJA 3KF8A 4YCUA 2IWHA 4HCEA 1ZZJA 2KEDA 5EQ0A 1Q82C 4U673 2E2HH 4JI6H 1E22A 1EY0A 5IIFA 1ZTGA 2YV5A 3NELA 4DV7H 4LF9H 5D65A 3U58A 3H94A 4UAIA 1VQCA 1SSOA 3D3RA 4G57A 4K5WA 5I2YA 1TKWB 4JVYA 5IYDG 3RNUA 2ANNA 2CH4W 5M5YH 3NXWA 4O2DA 1NAPA 1XMQQ 4UY8C 1U9RA 4L6TB 1GOZA 1WCMG 2NVXH 2B2TC 2XTIA 1J8IA 3DLLA 4DR7L 5EJWA 1QILA 5J1ZA 3H91A 5F2DA 1K3RA 3LWEA 1FVIA 1KDAA 1RKNA 2FFKB 4JI7H 1HHVA 4J8QA 1JE4A 2RQXA 2CTKA 2KJXA 5IYDH 2MJHA 3OPOA 3OTOH 4TQUS 2E3UA 2HIXA 4IUVA 4RGOS 3GTJH 4A3IB 1KLUD 2F0MA 1J6QA 5KNCA 3UDGA 4K2LA 2A6HC 3T56B 4FJUA 1VQHA 3G48A 4A3IG 1LTRD 1V43A 4BY1G 2EYJA 2QDLA 1JQYD 5HGTA 2Y3MA 2PQUA 1KRSA 4RKLA 2Z9HA 1D1KA 3CKIB 4JI3L 4DR4H 5DEHA 3HOYG 1A3UA 2MFIA 4ZK9B 1DTJA 5K36G 3S9WA 1K8AC 3I73A 2VB3X 3EIVA 1K83B 3F2BA 3HOWG 2KUMA 1M1KC 1CSPA 4OGQC 4JI8H 2OXPA 1SAPA 1LT5D 4Y7NB 2JZXA 2MQHA 3KYHC 1HNXL 4LF6Q 3RLOA 1AN8A 2FPHX 1NR4A 3T51B 1E1OA 4A3IH 5G3LF 1H9RA 4GKKH 4BY1H 5A2QE 3EQLC 4OONA 1I6VC 3D4RA 1JT8A 1SE3A 4PQXA 3HOYH 1STGA 2F0WA 1I3QB 4K5VA 4YY3Q 3KUPA 2Q2TA 1FNUA 5K36H 3HOWH 4H8AA 2A73B 3K8AA 5EPLA 1EFWA 2IY5B 4B08A 4ZUJA 2E75C 3H3VH 3E5SA 1K83H 1TWCB 1Y69U 1I94H 2Z6KC 1IHZA 5ELOA 2VZAA 2XN9C 4LF4L 1KAAA 4MHEA 1XPRA 1N32H 4Y7NH 4NXNH 3PO2B 2D0OA 3R8BA 1RCVD 1S4ZA 3A7LA 1UAPA 4GNXA 1STBA 4R9WA 3D31A 4DR6L 2RDHA 4YCVA 4X66H 2L0CA 1XX8A 4A3DG 3ER0A 2JVZA 4LIJA 5K5PA 5ELFA 2G5DA 3W1GA 1GKHA 1L1OA 3Q24A 3HG9A 2EYOA 3HOUB 4KMUC 3CCSA 4HN7A 4B3RH 3F2DA 4QJFA 1C8CA 1SYGA 4LWCA 3SR1A 1YIJA 1QVGA 1DCZA 1TWCH 2ZXPA 2JYOA 1H9SB 2EJMA 5EKLA 3J80c 1LYLA 3PO2H 4OIJA 1XMQL 2VKCA 3U9OA 1YHQA 4DR2L 4GNXB 1VQJA 1AP0A 5IT9E 2A69D 5E7NA 3TP6A 2WAQE 3ULPA 3DM1A 2RHQB 1PRTB 4JI0H 2K5HA 4I7AA 2UUCQ 1TWGB 1X54A 1FJGQ 3R93A 1E1TA 2LTMA 2ZM6H 4CDCC 2F4VH 2WACA 3SE0A 5FLXE 4X65L 1D8LA 1YNNC 2EVBA 2HCCA 1ZEQX 1B3QA 2EY1A 2VS1A 2QCPX 4GKJQ 1S40A 1JJ2A 3QO2A 3S1QH 3VA7A 2F0VA 1ZZIA 2NZOA 3CC4A 2FJ2A 2EPBA 3MFYA 4RGMA 2UXDH 3VYSA 3SEBA 1CQVA 4BA2I 4OX9L 3T1YH 5JVH3 3BG3A 1NR2A 3AMUA 2L1BA 3D6WA 1QNKA 4DR3H 5DM73 1IKLA 4P74A 1GD7A 1XNQH 3EROA 1CK1A 3BDCA 2QILA 1EWCA 4I65A 2E2JB 4RHSA 4LFAH 2EE1A 4QB4A 4R4CA 4B3MQ 3EZJA 3C1FA 4LF6L 3J81i 5AJ3Q 4QMGA 1UE1A 2PO4A 3FMCA 1WTOA 1VQNA 2ZXOA 2PQAB 4KI0A 4LF7H 2R6GA 1UWVA 2F0JA 1TS2A 2QW7A 1ML0D 2F3WA 3LX0A 4X64H 3J7ZC 4YY3L 4KY6A 4RFBA 5ELEA 1KQSA 4X3KA 2VQFQ 1IBMQ 2OWOA 2DJFC 4A3KB 1ZXTA 2B2UA 3GTOB 4OD6A 1N8RC 4A3EG 4A3KG 1Q7YC 4H0LC 2DNEA 5A2QW 4CDDC 4DXFA 3H3VI 2L11A 4WFN3 2NVTB 1FKAH 3DM3A 3JAML 5FLMG 5FKAC 3J81E 1BCPB 1CZWA 4RMFA 2WV6D 5M5WB 1Q81C 2EYFA 1JOKA 4DR1H 1TWAB 2CTFA 5IGEA 4A3EH 1N34Q 4A3KH 3GTOH 1RDPD 4XTCS 2GVBA 1SNCA 3HGBA 5FLMH 1VDZA 2A6ED 3GABA 4WORA 4JI1H 1PTOB 1MGSA 3LNNA 3OW2A 1WJJA 2ZQEA 1Y8NB 4YWMA 3BDOA 2K6AA 1HXYD 1B2TA 5FJ8G 3WOEA 3KLRA 4IFDJ 4B9WA 4POFA 2RHSB 1EEID 2YTVA 1WTQA 1DOKA 1X3EA 1ET6A 4UHVA 3VR4A 2UUCL 4A3LG 1FJGL 4UP8A 2NVQH 1PH2A 3UDFA 4RAUC 1LTBD 1KC8C 2NZ1D 4XQJA 1EY7A 1XMOQ 2OTJA 4DV6Q 1K8OA 4DA2A 1PV4A 1G8ZD 1WVLA 2Q2HA 2WAQG 3FP9A 4LUOA 4C3HB 3W5OA 3QB3A 5FJ8H 1VIHA 1TXYA 2JA7B 2BA0A 3KDFB 4NXMH 3AU7A 4M8AA 3I7FA 4KTAA 4A93G 1LT6D 3NTHA 1IBKL 4A3LH 1AEXA 3E9HA 1XRHA 2F4IA 3EN2A 3FEWX 1OXSC 2G9HD 4WRDA 4P2CB 4B3TQ 5J3BA 5FLXW 4BBSG 4CDFC 1MSZA 1E7ZA 1HR0L 3TZUA 3HOXB 2PT7G 4JK1C 3H3VC 4JOIA 4B3ML 3KFUA 1SEBD 1VQIA 3JC66 1EWIA 4DV1Q 3C46A 1EQVA 1S5ED 3O13A 4DKAC 5JVG3 4X6AH 3MXNA 4HIMA 1N9WA 4JI2H 4B3SQ 4PG3A 1E2VA 4A93H 3CCMA 1IBLQ 1N36H 4A3JG 3GQBA 3CCRA 1TUAA 1I4QA 1S20A 2VQFL 1IBML 3MA2B 4HR7B 1QE6A 3M3YB 3IAYA 3M85A 4HIOA 4DV0H 2MPMA 5H1SE 2DY7A 4LF5Q 1R4QB 3BZCA 4CKCA 1HUMA 2SEBD 2E5LL 3NBHB 4IPCA 4DAYA 4E9JA 2Q8RE 2LSSA 1PXUA 1VQDA 2I5MX 3NPPA 5IGDA 4DV5Q 3C3LA 2EYLA 1F0XA 2AUJD 3H6MA 3U9SA 1TS3A 1CUKA 1TIID 1W3SA 2F0NA 2KENA 3VDYA 4JV5Q 1K73C 4C56C 1SE2A 3MZ5A 5C0XJ 4HAEA 3U4ZA 4AH6A 1K3BC 2UXBH 2CTEA 1NE3A 1EU3A 3E3XA 4K8IA 4YHHQ 3T1HQ 4A3JH 4DUYH 1KL9A 2I07B 4BS9A 1S5BD 4QIWE 4UP9A 2WB1G 5E4WC 3D4WA 4K0KQ 1JB7A 4LF8H 4NW2A 3K5MA 1N34L 1IYUA 2AUKA 2K5DA 2ZJQA 3RLNA 2KECA 1EU4A 3CRKC 1L2FA 2E2IB 1FGUA 1HZCA 1EWHA 4ZAIA 5J39A 4DAYB 4A3CG 1R4PB 3GTGH 1HJPA 4XIGS 2K75A 4DAMA 2CQAA 4E6IA 3PUVA 5D14A 4X62H 1KRTA 4HMIA 2BOSA 3VYTA 3FDTA 2N3SA 1Y8PB 1I5FA 3WOFA 4BY7B 1GUOA 1EY6A 3DEPA 1LT3D 2ZXRA 4GNXC 2KCCA 1QWYA 5C44B 1YBYA 1CKOA 2K5QA 2F0QA 2XIWA 2F0IA 1J5EQ 4P75A 4ZRZA 3VKEA 2HQLA 3TN2A 1EFID 1BR9A 1MJCA 1L1OC 1QOHA 4A76A 1XMOL 4DV6L 1QVFA 4A3CH 5I9OA 2LTLA 3OSSD 1IXRA 2E2IH 1DT4A 2OEOA 4JVZA 1PRTF 5C6AA 1V1QA 3CC7A 1GHJA 3TBIB 2B2WA 3OIQA 3GTPB 1QCBD 2R92G 4KJNA 5C4XB 5EAYA 1SNDA 5LL6S 1K0RA 2QEJC 2J7ZA 1WFQA 3CQZB 5FO7B 3CHBD 2EXZA 2M00A 2BDNA 1K9MC 2IPKD 1VQMA 3ICEA 3TS0A 4DU9A 3PIPA 3M4OH 3HKZG 3BDLA 3HP3A 3VYRA 5C44H 2Z6BA 1SBBB 4ALPA 1IYVA 3K57A 1PFBA 1GUNA 3JAMi 3ONAB 4RKBA 3AYHB 2A6HD 1K8MA 4F87A 1HA6A 4DR7H 3FKIG 4C3JB 5IGBA 4L5RC 4Q0FA 1FD7D 1BNZA 2A74C 1SFOB 1EQQA 4B3SL 2R92H 4G7OC 3GD7A 2H1EA 4GOPB 4C3JG 3GTPH 1SYCA 3A7AB 1FR3A 4A3GB 5JJLA 4GLAC 2DGYA 3CD6A 1NJIC 4JBJA 3M4YA 1EL0A 4DV3Q 3CQZH 5IE8A 1GUGA 1L0YB 1W6KA 4CBVA 1TR5A 4FVMA 5I9PA 1HNWQ 3AB9A 2JN4A 4LF5L 2XWBB 1I50B 4JI3H 5JPNC 2M6QA 3FKIH 2XSCA 3PIO3 1EY9A 4DV5L 1M90C 4XQQA 4DF7A 3JAME 3GTMB 1D7QA 1YJ9A 1Y14B 5CBAE 1Q86C 2UU9L 2E2DC 2FMRA 4C3JH 4JV5L 3QD7X 2NVYH 2JA5B 1SFOH 4HTHA 1EEFD 5EPJA 4JI4Q 4YHHL 2IX3A 3T1HL 1HNXH 4A3GH 1EUJA 1Z6HA 4K0KL 3TP7A 4AQYQ 4IURA 3RZDH 2G8YA 5BN3A 3K81C 1BCPF 1X6OA 5BR8Q 4FXGC 1AZPA 4QIWB 4A3MB 1LTLA 2VNUD 1SNQA 5A35A 3G7LA 3GTMH 3PMFA 3I56A 2A68C 5LMNQ 2PPBC 2GVAA 3NK9A 2YU9B 2ZTDA 2EDGA 5CV4A 3S2HB 4RCOA 4PDBA 2JA5H 3KDKA 1CFMA 4LF4H 1WD1A 3SK6A 1HPCA 4KK7A 2X69A 2H5XA 1WI5A 1S5FD 5LMUQ 2DY8A 1J5EL 2O4CA 1PTOF 5JOBA 3PUWA 2D9IA 2D9UA 2QA4A 3M7GA 4AIMA 3R2IA 1V9NA 1JCKB 3A56A 3P75A 1KD1C 1B50A 1NCVA 4X3TA 1VQ7A 2CWPA 3VR5A 4K6LA 5GQOA 1E3PA 3RLFA 2IL8A 3S2HH 1YNXA 3S1NB 2A8VA 4ULLA 2OTLA 2AQ1B 4OXPA 1QVCA 1WOCA 5IP9G 5NUCA 2VUMB 2UUBL 4JBKA 1XMQH 1YNND 5C4JB 4JI6Q 4DR2H 2XNAC 1SE4A 3S14B 2MJ8A 1MBYA 5KGUA 1YI2A 2WKDA 3A55A 4F7XA 3QR8A 4UDUC 2TMPA 4OELB 2JA6B 3RMHA 1VQGA 3TP5A 1VIGA 3ND8A 5AFWA 1E2WA 1TY0A 3CW2C 4V0BA 1XNRQ 2K50A 3NBIA 2IHEA 2O5JC 1QJOA 4PNYA 1MIUA 3TREA 4X65H 1HH2P 2KEEA 3S15B 4LK1C 5IP9H 5KYIA 4DV3L 2KHIA 3S1NH 3V2TA 5EPKA 3J7A5 4KY7A 2M9VA 3D0FA 2JP1A 3BVZA 5IY0A 3RUZA 1NUCA 4H44C 4DGZA 1HNWL 2Z4IA 5C4JH 3H0GB 4JG2A 4OX9H 1EZ6A 3PIOA 3E0EA 3UE0A 1BVSA 1PH3A 4M1UB 3L3OC 4N8FA 2Q8IB 3GTQB 3OWFA 2JA6H 4R4TA 2VQEQ 3K5OA 4JOIC 3GV3A 3CU7A 4K2KA 4JI4L 3UI2A 2NBFA 3ITPA 5JJIA 4PMCA 4LF6H 3E9IA 4DR4Q 3P1HA 4IOAA 3QWNA 1P8LA 4TVAB 3X3MA 3A5UA 2JE6I 3QG1A 4AQYL 2FMCA 4GN3B 1Q46A 3JAMW 3M4PA 5BR8L 1ENFA 1IL8A 4JI8Q 4YY3H 3KK7A 2PMZE 4DV2Q 2YTYA 5CV5A 2C5CA 4IJHA 4GZYC 4OO1G 2K28A 1B44D 1U4RA 2MNAA 5LMNL 4GKKQ 4KHPQ 3WWVA 4CKEA 1H9SA 3FVQA 1ESFA 5IYBG 1SDFA 2D0PA 1CA5A 5JEAJ 3CP0A 5C4HA 5LMUL 2K32A 1VQAA 4WJ4A 4XYOA 3I0PA 5EBCA 1SXTA 3PO2G 2VW9A 1J5KA 4H13C 1I6HB 5IGCA 1ESRA 2F0OA 4OO1H 1EQTA 1I94Q 1I3QH 4A3BB 1PLFA 1A0IA 3HZXA 1SRUA 1HNZQ 1QZHA 4FYDA 3V96A 4JYAQ 2DJGC 2GA4B 3R2TA 3HOUG 5FLXc 5IYBH 1JICA 2B63B 2EIFA 1IW7C 3AFQA 3OIPA 4K8JA 4KJOA 1HUNA 2LXKA 5T1IA 2JSOA 1U4LA 2CWAA 3MTSA 3S2DB 2LS01 3MWYW 4ZLTF 2IJ0A 4OWTB 3FPUB 3L7ZC 4DN4M 1I6HH 2R7DA 1BF4A 3HEJA 2DUDA 1VQ4A 2UUCH 2R93B 1FJGH 1WTPA 3J80i 3FHWA 4A3BH 4ILWA 5GAHC 2PNHA 1CZGA 1PZJD 1BBXC 3BYYB 2ES2A 4C3IB 1L0XB 3CCEA 1E0BA 1XNRL 3HOUH 1EY4A 3KF6B 4OIKA 1ASYA 2R93G 1OTCA 1WTWA 1EY5A 2E74C 3R3OA 1WTXA 4IO9A 1SEIA 2PZWA 2ASBA 4C1NI 4APVA 4C3IG 2L55A 1HR0W 4GOPC 2B2WC 2K04A 2PQAA 3CCJA 2B63H 2F0DA 2AXYA 4QL5A 4QY7A 1JWMD 4RA8A 2VL6A 3KBGA 4PZ8A 1K0SA 1DJRD 5I6YA 1JOQA 1A63A 2CVRA 2DNCA 3S2DH 1IBKH 1FNVA 3E6ZX 3DXJC 3MXUA 1DOLA 2RVLA 1PDQA 2D2CC 1EOTA 2HH3A 1ODHA 2Q2IA 1TWGH 3F2UA 1S03G 1I4PA 2R93H 1HR0H 2VQEL 1HCZA 2IHFA 3J80E 1LO5D 4TRDA 4C3IH 4KHVA 2YTXA 3TZDA 4B3MH 4R4OA 1VQOA 1E24A 2RCFA 4UPAA 4RCNA 2X6LA 1AZQA 2F0EA 4JI5Q 1VQ6A 2OPVA 1Y1WB 4YWKA 3J81c 3SHLA 1KNEA 1MSGA 2WP8J 3N52A 4R8IA 1DM0B 5CYUA 1I4HA 2JQOA 5FO8B 4ZQ3A 4DV2L 1SJED 2IX0A 2JK8A 1IBMH 4LFAQ 4O1NA 1RJTA 1PH6A 4ME5A 1G51A 2KHJA 2EY2A 3K0XA 2E5LH 2EY5A 4KHPL 1G2TA 2PMZB 5IWAH 3VA5A 2E2JH 4IFDG 5TSSA 2Z0SA 4POGA 4P73A 1V1PB 2BE5C 1A15A 1CKMA 2NTSA 3Q0AA 1KDCA 5GAEC 5GAGC 4H7BA 1KTKA 3MEFA 2R7ZB 4OO1I 1HNZL 3E0JA 1N34H 3J81j 3I4MB 3K7AB 4JYAL 2CFMA 4JW0A 2X06A 1A2TA 2I5HA 5DT9A 2R7ZG 1QB5D 1Y1VB 1OXXK 2K7VA 4IFDH 2N88A 3G6EA 5CV8A 4DR1Q 1Y1VG 2NVTH 2AQ3B 4MN3A 3KDFA 4KV6A 2UUAQ 2F3IA 3BVGA 4R4QA 1YITA 3OOCA 3I2ZA 1VQEA 2RBMA 3J7AK 5M5WH 2EY6A 3S16B 5CR3A 3UOEA 1DZ1A 1TWAH 2B3GA 4EQOA 2CWFA 1YNJD 3GTLB 2R7ZH 1PYBA 1PVOA 3CC2A 1EY8A 1KLGD 1XMOH 4DV6H 1EC6A 2K14A 1Y1VH 4NB3A 4GKJL 1C4QA 5IT9W 4EX5A 1NMGA 2RCNA 1A6XA 1H9JA 1DYQA 2PZTA 2M8WA 4NP5A 4DK3C 4S3SA 3I4NB 3G6JB 1PTOH 4C3HG 2F0GA 3NCVA 3I8ZA 1GO3E 2Y0SE 2UXCQ 5IP7G 3I4NG 1X3QA 2JA7G 5D3DA 1HQRD 2J4XA 4FF3A 2CW0D 3TDQA 3S16H 1J9OA 2N8NA 4J6HA 4HEDA 3DEOA 3NBHA 2L5TA 2HH2A 5JJZA 3GV6A 1Q8IA 1CQFA 2RDGA 3GTLH 1JJGA 4ZKBB 1BKBA 4RHRA 2YYZA 3IRBA 1BDOA 4ZUIA 5C0XG 3SXHA 3S1RB 4F8MA 5AJ3L 4NBQA 3A8JE 3HOXG 5M3MB 4JI5L 5DNFA 4C3HH 2WIIB 2PCFB 4B3SH 1GJXA 2K03A 2HHHQ 1PH9A 1WTJA 5IP7H 1STYA 2NB0A 3I4NH 2JA7H 5E1FA 4DK1A 3OYYA 1X65A 3FPPA 4HIKA 3CAMA 3AEVA 4WALA 3LGJA 4CKBA 4JPBW 4ME3A 1TT2A 2ID0A 4A4IA 1U4PA 3B6YA 1J4WA 4LF5H 1PZID 4JI2Q 1RF2D 5C0XH 1QUQA 1C7YA 4KN4C 4ZYSA 3HOXH 4QMFB 1D6EC 4DV5H 1D2BA 5CORA 3S1RH 1N36Q 1SYDA 5M3MH 2UU9H 4JV5H 1B70B 4R4IA 1PFNA 4DV4Q 2F0SA 5C3XA 1L0WA 2F0PA 4YHHH 3T1HH 3SK8A 5ELBA 1JR0D 3A8KE 4R1JA 2A68D 4Q5VA 2F3VA 3AEVB 4K0KH 1PYWD 3W2DA 4FF2A 3RZOB 5ELDA 3M3YH 4IALA 1EIYB 1WE8A 3BU2A 3CPWA 4HJ7A 1JWUD 1X4MA 2FXQA 1BBUA 3K59A 1P16A 1YJWA 3GTKB 2EYPA 2Z8LA 1CT1D 3J81W 3NUCA 4GS3A 4HJ5A 1QUQB 1XPUA 4QUFA 5KNBA 3ZYYX 2AMCB 4DUYQ 2UXBQ 1FYCA 4H02A 4IFDI 1ICWA 2ALYB 4NPSA 4DR1L 2RSOA 3EBEA 5CGKA 5M5XB 1VQLA 2F1MA 1AFPA 3PSIA 2K01A 2UUAL 2MO1A 5I4DA 3PO3B 4LF8Q 1HTPA 2NTTA 4N9PA 1BBWA 2SDFA 5LHY1 3UE1A 4DUZQ 2BDOA 2N78A 3K80C 4AYBE 3BVMA 2ZTEA 2PQEA 2M2LA 3AQQA 2PNRC 1MSHA 1PRTC 4BY7G 1J5EH 2LKVA 2KOLA 4QQBX 2V4DA 5C44G 1X55A 4X62Q 1LTID 2JA8B 4OCHA 3GTKH 2BA1A 4LFBQ 1STAA 4FF1A 4JCVE 1HFNA 4GOPA 1YVCA 1WVNA 4DXGA 2X6GA 3AFPA 4QGUA 3BS1A 2UXCL 4RH6A 1OO9B 2A6EC 1HFGA 4QUCA 2K4KA 1DOMA 3D8GA 2AQ2B 5C4XG 5EKIA 4BY7H 4NZRM 4B3TL 4X3UA 4A3FB 4RGTA 1UE7A 1AE3A 2UUBH 2Y0SB 1SYEA 1PH1A 1WHRA 5E4XA 3NWTA 3UDXA 2HCIA 2Y0SG 2QF7A 3F1ZA 4P72A 4DV1L 3JAMc 2C9OA 4FXKC 1H95A 1NBWA 1GUTA 3KLSA 1D5ZC 5LL6b 2DN8A 2QKIC 4YCWA 2HHHL 3GKUA 3OWEB 2J0TD 2OF1A 1SN8A 1WTHA 5C4XH 4HSVA 4G4KA 1ENCA 1IBLL 2LFNA 1KHMA 3G4SA 3U1KA 2CTMA 1HZAA 5G3LD 4DV3H 3S17B 4A3GG 2EOTA 1H9MA 2O5IC 4BA1I 3STBC 3LWUA 3KBXA
chains in the Genus database with same CATH topology
2F0TA 1G2SA 1QG7A 1ZYRC 3IFDA 3NENA 2NUCA 1VQ9A 3KJPA 5C5LA 1Z7TA 5CV7A 5E3FA 3Q6SA 1SMYC 3I4LA 4HCSA 5C0XI 4PMBA 2B2VC 3C1EA 1XXGA 4PZ7A 5IGGA 2R7FA 4DR5Q 5M3FB 5C3EB 3FRPB 3J80L 1GXDC 4IPDA 2JXMB 2KBNA 4DV4L 1B53A 1D5XC 4LNQA 1EIGA 1BCPC 1B8AA 1CHPD 4GN5A 4XYQA 4BXXH 5C3EG 4KN7C 3BZDB 5LMNW 2JA5G 5C3WA 4L5SA 2A1AA 3SDZA 1V1OA 5FO9B 1C9OA 4FP5D 1O7ZA 4JBWA 1QZGA 3A0JA 1O7YA 1GUWA 2RDFA 1I50H 2K5VA 3W3AA 4DNTB 1LM0A 3U50C 1EIFA 1VQ5A 4A3MG 1PA6A 4IUNA 2C35B 3F8TA 4NDXA 4PZ6A 1Q3LA 1PTOC 5C3EH 3A74A 1I4RA 1F2ZA 2EYHA 2F03A 4DUZL 4IUTA 4BBRB 5KEEA 4LUZA 3ULJA 2EXDA 4IOCA 1E2ZA 2E2HB 3OMCA 4LFCQ 1N33Q 1AW7A 3I3CA 4HIDA 1IW7D 1YJNA 4AYBB 3V05A 2KCTA 4U68A 4LFBL 1O7IA 4A3MH 4LF4Q 4AYBG 1QNUA 2ANRA 2N49A 1O80A 1B7YB 4NMZA 3URYA 2QNDA 2ATWA 2YU9H 3HRZC 5DLQE 1K8GA 3CXCA 5IOCA 1DXMA 2NVXB 1JB3A 2OCEA 1KHIA 3OMGA 2B8GA 1NTGA 4BBRH 5JAVA 2E8GA 2NN6G 3HFZB 1TS5A 4KKUA 2VUMG 4DV7Q 4LF9Q 3BZKA 4KY5A 2F0LA 4TKOB 2CKZB 1PZKD 3GTJB 4XDXA 1G6PA 3I72A 2D5DA 4V190 2JA6G 1G291 2OPUA 4R8NA 1WCMB 2MHVA 5FK9C 4DR2Q 5CV6A 4DNRB 3RN2A 1CHQD 3KF8B 2OQKA 5GADC 1VQPA 2HIVA 3EA6A 2QEXA 1D1IA 2NN6H 1RODA 2VUMH 1U0LA 1VQBA 2E76C 4NKLA 2HQEA 1K1GA 4MZ9A 3S14H 3T53B 4JI7Q 2KCNA 4DK0A 3VR3A 1WTRA 4X65Q 4L5TA 3H0GG 3OTOQ 4K14A 2K5WA 4K6DA 1UE6A 2RKSA 2MO0A 4DR5L 4IUQA 4BY1B 5JEAG 1U5KA 3M9BA 2I0QA 4HSPA 5HGQA 3DWPA 1WYDA 2LMCB 4OL7A 3PUYA 3L0OA 4HJAA 1Q12A 3HOYB 1VMCA 2WINB 1S5DD 1WCMH 3M4QA 3TRZA 3S15H 1XJVA 4OX9Q 5D3IB 1XWEA 3HOWB 1F77A 1PHJA 4EQPA 1GHKA 1HRJA 1MKHA 3M7NA 5COYA 3EFXD 3DWAA 3RN5A 3CRLC 4IJLA 3H0GH 4LAAA 1YHAA 1UE5A 2BE5D 4GN4B 2I46A 3TSSA 4C1NK 2L9HA 2JEBI 5JEAH 1VS0A 1UUPA 1U4MA 4MTNA 3GTQH 2L12A 3I70A 1MJEA 4EQNA 1IZ6A 3KJOA 1HTLD 1RTNA 2WKCA 3UDIA 3D4DA 3S24A 1EYGA 4LFCL 1N33L 1EZ8A 2PYKA 5IT9c 3IL8A 4MNOA 5ELNA 2KQ3A 1CI3M 1PH7A 4N9TA 1KXLA 2ZJPA 1EYDA 3RR5A 1N32Q 1CTMA 4RGNA 4NXNQ 3KF6A 4CJ2C 4A3BG 3QOJA 4ABNA 1XYIA 4A3DB 4LMQD 3VR6A 1TU2B 1ZZKA 4OHJA 4XXEA 4X66Q 3CMEA 1S3OA 3G71A 1RTOA 3HKSA 1CKNA 1KABA 1HZBA 4JVHA 4WJ3M 1B1ZA 4IUPA 2B63G 1FNWA 2CHBD 3VR2A 1H9KA 4JI6L 1PH5A 4DV7L 2FINB 4LF9L 2SNSA 4B3RQ 1C0AA 1X9NA 5KYLA 1X3FA 4CJ1B 4DK6C 3NQIA 1C48A 1LTAD 2MGSA 1S72A 4KD4A 3D6CA 1Z9FA 3S1QB 2L4NA 1SE8A 1JC7A 1YHBA 1LLRD 5CBEE 4A3DH 2AWNA 1MI2A 2AWOA 3ERQA 3K0YA 5JJKA 4JI0Q 4DPGA 1CKNB 2IW3A 2RSNA 5KIXA 2BCOA 3PCOB 2NN6I 1L1OB 3QIAA 2VXWA 2ZM6Q 2PZUA 4IQZA 4KD3A 1SROA 2I5LX 4JI7L 2F4VQ 1Q1BA 4ZKCB 1A2UA 1B4OA 3OTOL 2B2YA 2RA4A 3EVQA 1FGBD 2B2VA 2ENBA 1EYCA 1NSNS 2QDBA 2BL5A 3BJUA 2UXDQ 1EYAA 1TWFB 1V1PA 4CJ0B 4DFAA 3IFTA 1SLJA 4DR4L 4UP7A 1IBKQ 3T1YQ 2VY3A 2B29A 2Z1CA 5CC4A 4DR3Q 1VQKA 3K58A 2PI2E 4L5QA 4O0AA 2L15A 1Y1WG 1JMCA 4IZ8A 1HR0Q 1XNQQ 4JI8L 1OXTA 4WJWA 3TEHB 1W2BA 4PMWA 1Q1EA 1TY2A 2F0KA 1EOVA 1ILQA 5FOBB 4GLXA 4GKKL 3F2CA 4LF7Q 1VQ8A 4O42A 2KA7A 3NE5B 2YQRA 4X64Q 3K5LA 1GM5A 3MXGA 4ID6A 1TWFH 2EQSA 1Q8KA 3TP8A 3SK4A 1HA5A 2B8FA 5IODA 1II3A 4A3EB 3KLWA 1STNA 2ZT9C 1Y1WH 2WFWA 4P71A 1S5CD 3SVMA 2AHOB 3A54A 2CCZA 2P2RA 1F9PA 1IKMA 2CQOA 1M4VA 2E5LQ 1I94L 4IN3A 1DD2A 2NYZD 4FO2A 1M8AA 1SNPA 1RD9D 4B8TA 3Q23A 2WB1E 4OWWB 5IWAQ 1N32L 4YIJA 4NXNL 2H4OA 2FMMA 1SNMA 2NWGA 4KKSA 3H15A 2DGRA 4FF4A 3ZJYC 3DHQA 3HOZB 1XTCD 4YWLA 2N55A 1I4GA 4X66L 4RG1A 4ODGA 3CCVA 5IGFA 1PRTD 1ASZA 3I4MG 1OXVA 4DNIA 5ISRA 3HOZG 5ELCA 1B3AA 2NVQB 2A5HA 5I6WA 3ULLA 2IX1A 1A8VA 1D5MC 3X3NA 3C2PA 1SYBA 3Q22A 2K05A 2MP1A 2Z4HA 2TSSA 4B3RL 3GO5A 1WTVA 4C2MB 5CV9A 3PV0A 5EKKA 1O7LA 3NSWA 3I55A 5HY6A 1UNSA 3NEMA 4JI1Q 1Q90A 2JEAI 2HUGA 1VQFA 3I4MH 3K7AH 2HT1A 5JPMC 5GROA 3A5ZB 3CCQA 3HOZH 3ERSX 3NQTA 1IYJB 4JI0L 1PFSA 4L8JA 4WANA 5C5MA 2K33A 3U4VA 2B2TA 1LT4D 2ZM6L 2WAQB 2F4VL 2PI2A 4C2MH 4RWSC 1NY4A 2XRQD 1TWHB 5EBDA 2G9DA 4MIUA 2A69C 2FHTA 3HKZE 2XGTA 1BOSA 4EVOA 2CTJA 1JJCB 4LW1A 4A93B 4JBMA 4NXMQ 1PFMA 3PGZA 2K5NA 3HS0C 2UXDL 3NTKA 1A62A 3STBD 3OW7A 2NZHA 1Y8OB 5I2XA 4XT3B 5DM63 1ZYRD 1TVXA 4KHZA 4BBSB 3T1YL 1G91A 4EQ5A 1F9RA 1F9SA 4DR3L 3VYUA 3PUXA 2QGQA 1T9HA 5HURA 3PUZA 3PIP3 1PMRA 5M3MG 1SMYD 1BQQT 1ENAA 3CF5A 4L63B 3T16A 1XNQL 1PYSB 2PW5A 3SGIA 3SK5A 3OHXC 3GDEA 3MXPA 5LL6X 4LJZC 4LFAL 4IUUA 2HDMA 1X3GA 2F0HA 1NMFA 2MUYA 3J7YW 1EIHA 1TWHH 1BCPD 3I90A 4Z9CB 4LUVA 4LF7L 1OXUA 2F52A 2KCMA 4A3JB 5C4ZA 4X64L 1TQOA 3T4AC 2IT1A 3V69A 1VF5C 1T5EA 3MHBA 1T5XD 1UEBA 4BBSH 1LTSD 4J15A 4DV0Q 1CSQA 3HOVB 3P20A 4JC0A 3BYTB 1LUZA 3P7JA 2O4XA 4TSSA 3GP7A 1X32A 2EYMA 1XTDA 3KLSX 3GTGB 5IWAL 3HOVG 1PTOD 1RIPA 4KLKA 1MD2D 2Z6KA 2ZTCA 2BH8A 4BWGB 2A19A 2UU9Q 2SOBA 1VF7A 3MXNB 4HMJA 4OWXB 3QJYA 2WB1B 1Z47A 3K5NA 5J22A 3K6OA 3TQYA 2HDLA 5BN4A 3QOLA 3L2PA 4I7ZC 1ONLA 5A2QL 3J7AV 1PH4A 1BUVT 3PO3G 1AE2A 3HOVH 2GN5A 1CA6A 2KHSA 3Q8DA 1SJHD 3MFGA 5KNDA 1R9TB 4XT1B 2EZVA 4DAVA 4JI1L 3RZOH 4QF4A 2JJQA 2BH2A 3DMUA 5KRUA 2SNMA 3IKJA 3MAQA 3KOJA 4HJ9A 4G7ZC 3S1MB 2KVMA 1KNAA 4F88A 3M4OB 2JA8G 4G7HC 3PF4A 5M5XH 1W6JA 3L9AX 1LTGD 1YZ6A 1LTTD 3PO3H 4FNFA 3NWSA 3MEHA 4HJ8A 4J1MA 2Q8TA 2ICIA 3A8IE 3CCUA 2O2LD 1HZ9A 1SMXA 2R92B 2LY7A 1R9TH 2OQ0A 2B39A 4IPGA 1G6ZA 4A3FG 5IYCG 1ET9A 1RL2A 2D62A 4NXML 5BN5A 2RF4A 1YNJC 2ICEC 3K7UC 2JA8H 2VB2X 1BXTA 3HKZB 1BO0A 1B9NA 4CHTB 1JE5A 3N6RA 3S1MH 3PF5A 1STEA 3NTIA 3MVVA 1SR3A 2UUBQ 3I4OA 3ND9A 3RD4A 1B9MA 5IT9L 4K5XA 4QCLA 3FKIB 1X3PA 1ZKOA 4A75A 4BXXG 1VMPA 4DR7Q 4CGYB 1JOOA 3I91A 4A3FH 5IYCH 3J7AF 2R61A 4JI2L 5EGTA 2NVYB 3TMEA 2K52A 1AH9A 4X3SA 2CW0C 2B2YC 1F2MA 4FXDA 2XVSA 2XWJB 5FLXL 3DUZA 1XPOA 1N36L 4EGVA 4Y52H 2EJFC 1LABA 2AKWB 2PY9A 3RZDB 4DV0L 1YEZA 5T1GA 5M9OA 2ZJRA 1X4NA 5M3FG 3DWQA 4FDBA 1PH8A 3CMAA 4JI3Q 2V1CC 1VCIA 4GLVB 1V8QA 1DGSA 3S17H 1KDBA 1LV9A 3OSOA 2R3ZA 2F0UA 3W1BA 1F2YA 1WD0A 1IL2A 2OT2A 1F2LA 1A3VA 3T13A 2UXBL 4DUYL 1HNXQ 3CPFA 1GVPA 1X56A 3CCLA 3H09A 1FL0A 4IPHA 1A3TA 5M3FH 4LF8L 1JWSD 1I4XA 4B9XA 2Q2UA 2CPQA 1TS4A 1HQMC 1DONA 2CTLA 4PV1C 2B2UC 1EQRA 3MC0B 4DAPA 2F0FA 4KKTA 1SYFA 1UEAB 4BBRG 4XQNA 3NP8A 3WDNA 2XRSD 4X62L 1O78A 2K1BA 1KIXA 1SNOA 1RHPA 1STHA 2EJGC 3NHHA 3TS2A 1CM9A 2PW7A 1V9PA 1F9QA 1KAWA 5M5YB 4AM3A 5CMDA 1ILPA 1JORA 4DR6Q 3J81L 3EJIA 1GUSA 1LACA 5DAUA 2JA9A 3KF8A 2LXJA 4YCUA 2IWHA 4HCEA 1ZZJA 2KEDA 5EQ0A 1Q82C 4U673 2E2HH 1E22A 1EY0A 5IIFA 1ZTGA 2YV5A 3NELA 5D65A 3U58A 3H94A 4UAIA 1VQCA 1SSOA 3D3RA 4G57A 4K5WA 5I2YA 1TKWB 4JVYA 5IYDG 3RNUA 2ANNA 5M5YH 3NXWA 4O2DA 1NAPA 1XMQQ 4UY8C 1U9RA 4L6TB 1GOZA 1WCMG 2NVXH 2B2TC 2XTIA 1J8IA 3DLLA 4DR7L 5EJWA 1QILA 5J1ZA 3H91A 5F2DA 1K3RA 3LWEA 1FVIA 1KDAA 1RKNA 2FFKB 1HHVA 4J8QA 1JE4A 2RQXA 2CTKA 2KJXA 5IYDH 2MJHA 3OPOA 4TQUS 2E3UA 4RGOS 4IUVA 2HIXA 3GTJH 4A3IB 1KLUD 2F0MA 5KNCA 1J6QA 3UDGA 4K2LA 2A6HC 3T56B 1VQHA 3G48A 4A3IG 1LTRD 1V43A 5HGTA 2EYJA 4BY1G 1JQYD 2PQUA 1KRSA 4RKLA 1D1KA 3CKIB 4JI3L 5DEHA 3HOYG 1A3UA 2MFIA 4ZK9B 1DTJA 5K36G 3S9WA 1K8AC 3I73A 2VB3X 3EIVA 1K83B 3F2BA 3HOWG 2KUMA 1M1KC 1CSPA 4OGQC 2OXPA 1SAPA 1LT5D 4Y7NB 2JZXA 2MQHA 3KYHC 1HNXL 4LF6Q 3RLOA 1AN8A 1NR4A 3T51B 1E1OA 4A3IH 5G3LF 1H9RA 4BY1H 5A2QE 3EQLC 4OONA 1I6VC 3D4RA 1JT8A 1SE3A 4PQXA 3HOYH 1STGA 2F0WA 1I3QB 4K5VA 4YY3Q 3KUPA 2Q2TA 1FNUA 5K36H 3HOWH 2A73B 3K8AA 5EPLA 1EFWA 2IY5B 4B08A 4ZUJA 2E75C 3H3VH 3E5SA 1Y69U 1TWCB 1K83H 2Z6KC 1IHZA 5ELOA 2VZAA 2XN9C 4LF4L 1KAAA 4MHEA 1XPRA 4Y7NH 3PO2B 2D0OA 3R8BA 1RCVD 1S4ZA 3A7LA 1UAPA 4GNXA 1STBA 4R9WA 3D31A 4DR6L 2RDHA 4YCVA 2L0CA 1XX8A 4A3DG 3ER0A 2JVZA 4LIJA 5K5PA 5ELFA 3W1GA 1GKHA 1L1OA 3Q24A 3HG9A 2EYOA 3HOUB 4KMUC 3CCSA 4HN7A 3F2DA 4QJFA 1C8CA 1SYGA 4LWCA 3SR1A 1YIJA 1QVGA 1DCZA 1TWCH 2ZXPA 2JYOA 1H9SB 2EJMA 5EKLA 3J80c 1LYLA 3PO2H 4OIJA 1XMQL 3U9OA 1YHQA 4DR2L 1AP0A 1VQJA 4GNXB 5IT9E 2A69D 5E7NA 3TP6A 2WAQE 3ULPA 3DM1A 2RHQB 1PRTB 2K5HA 2UUCQ 1TWGB 1X54A 1FJGQ 3R93A 1E1TA 2WACA 3SE0A 5FLXE 4X65L 1D8LA 1YNNC 2EVBA 2HCCA 1ZEQX 2VS1A 2EY1A 2QCPX 4GKJQ 1S40A 1JJ2A 3QO2A 3S1QH 3VA7A 2F0VA 1ZZIA 2NZOA 3CC4A 2FJ2A 2EPBA 3MFYA 4RGMA 3VYSA 3SEBA 1CQVA 4BA2I 4OX9L 5JVH3 3BG3A 1NR2A 3AMUA 2L1BA 3D6WA 1QNKA 5DM73 1IKLA 4P74A 1GD7A 3EROA 1CK1A 3BDCA 2QILA 1EWCA 4I65A 2E2JB 4RHSA 2EE1A 4QB4A 4R4CA 4B3MQ 3C1FA 4LF6L 3J81i 5AJ3Q 4QMGA 2PO4A 1UE1A 3FMCA 1WTOA 1VQNA 2ZXOA 4KI0A 2PQAB 2R6GA 2F0JA 1UWVA 1TS2A 1ML0D 2F3WA 3LX0A 3J7ZC 4YY3L 4KY6A 4RFBA 5ELEA 1KQSA 4X3KA 2VQFQ 1IBMQ 2OWOA 4A3KB 3GTOB 1ZXTA 2B2UA 1N8RC 4A3EG 4A3KG 1Q7YC 4H0LC 2DNEA 4DXFA 3H3VI 2L11A 4WFN3 2NVTB 3DM3A 3JAML 5FLMG 5FKAC 3J81E 1BCPB 1CZWA 4RMFA 2WV6D 5M5WB 1Q81C 2EYFA 1JOKA 1TWAB 2CTFA 5IGEA 4A3EH 1N34Q 4A3KH 3GTOH 1RDPD 4XTCS 2GVBA 1SNCA 3HGBA 5FLMH 1VDZA 2A6ED 4WORA 1PTOB 1MGSA 3LNNA 3OW2A 1WJJA 1Y8NB 4YWMA 3BDOA 2K6AA 1HXYD 1B2TA 5FJ8G 3WOEA 3KLRA 4IFDJ 4B9WA 4POFA 2RHSB 1EEID 1WTQA 2YTVA 1DOKA 1X3EA 1ET6A 3VR4A 2UUCL 4A3LG 1FJGL 4UP8A 2NVQH 1PH2A 3UDFA 4RAUC 1LTBD 1KC8C 2NZ1D 4XQJA 1EY7A 1XMOQ 2OTJA 1K8OA 4DV6Q 4DA2A 1PV4A 1G8ZD 1WVLA 2Q2HA 2WAQG 3FP9A 4C3HB 4LUOA 3W5OA 3QB3A 5FJ8H 1VIHA 1TXYA 2JA7B 2BA0A 3KDFB 3AU7A 4M8AA 3I7FA 4KTAA 4A93G 1LT6D 3NTHA 1IBKL 4A3LH 1AEXA 3E9HA 2F4IA 3EN2A 3FEWX 1OXSC 2G9HD 4WRDA 4P2CB 4B3TQ 5J3BA 4BBSG 1E7ZA 1HR0L 3TZUA 3HOXB 4JK1C 3H3VC 4JOIA 4B3ML 3KFUA 1SEBD 1VQIA 3JC66 1EWIA 4DV1Q 3C46A 1EQVA 1S5ED 3O13A 5JVG3 4DKAC 4X6AH 3MXNA 4HIMA 1N9WA 4B3SQ 4PG3A 1E2VA 4A93H 3CCMA 1IBLQ 4A3JG 3GQBA 3CCRA 1TUAA 1I4QA 2VQFL 1IBML 3MA2B 4HR7B 1QE6A 3M3YB 3IAYA 3M85A 4HIOA 2MPMA 5H1SE 2DY7A 4LF5Q 1R4QB 4CKCA 3BZCA 1HUMA 2SEBD 2E5LL 3NBHB 4DAYA 4IPCA 2Q8RE 2LSSA 1PXUA 1VQDA 2I5MX 3NPPA 5IGDA 4DV5Q 3C3LA 2EYLA 2AUJD 3H6MA 3U9SA 1TS3A 1CUKA 1TIID 2F0NA 1W3SA 2KENA 3VDYA 4JV5Q 1K73C 4C56C 1SE2A 3MZ5A 5C0XJ 4HAEA 3U4ZA 4AH6A 2CTEA 1NE3A 1EU3A 4K8IA 4YHHQ 4A3JH 3T1HQ 1KL9A 2I07B 4BS9A 1S5BD 4QIWE 5E4WC 2WB1G 4UP9A 3D4WA 4K0KQ 1JB7A 4NW2A 3K5MA 1N34L 1IYUA 2AUKA 2K5DA 2ZJQA 3RLNA 2KECA 1EU4A 3CRKC 1L2FA 2E2IB 1FGUA 1HZCA 1EWHA 4ZAIA 5J39A 4DAYB 4A3CG 1R4PB 3GTGH 1HJPA 4XIGS 2K75A 4DAMA 2CQAA 4E6IA 3PUVA 5D14A 1KRTA 4HMIA 2BOSA 3VYTA 3FDTA 2N3SA 1Y8PB 1I5FA 3WOFA 4BY7B 1GUOA 1EY6A 3DEPA 1LT3D 2ZXRA 4GNXC 2KCCA 1QWYA 5C44B 1YBYA 1CKOA 2K5QA 2F0QA 2XIWA 2F0IA 1J5EQ 4P75A 4ZRZA 3VKEA 2HQLA 3TN2A 1EFID 1BR9A 1MJCA 1L1OC 1QOHA 4A76A 1XMOL 4DV6L 1QVFA 4A3CH 5I9OA 1IXRA 2E2IH 1DT4A 2OEOA 1PRTF 5C6AA 1V1QA 3CC7A 1GHJA 3TBIB 2B2WA 3OIQA 3GTPB 1QCBD 5C4XB 4KJNA 2R92G 5EAYA 1SNDA 5LL6S 1K0RA 2QEJC 2J7ZA 5FO7B 3CQZB 1WFQA 3CHBD 2EXZA 2M00A 2BDNA 1K9MC 2IPKD 1VQMA 3ICEA 3TS0A 4DU9A 3PIPA 3M4OH 3HKZG 3BDLA 3HP3A 3VYRA 5C44H 1SBBB 4ALPA 1IYVA 3K57A 1PFBA 1GUNA 3JAMi 3ONAB 4RKBA 3AYHB 2A6HD 1K8MA 4F87A 1HA6A 3FKIG 4C3JB 5IGBA 4L5RC 4Q0FA 1FD7D 1BNZA 2A74C 1SFOB 1EQQA 4B3SL 2R92H 4G7OC 3GD7A 2H1EA 4GOPB 4C3JG 3GTPH 1SYCA 3A7AB 1FR3A 4A3GB 5JJLA 4GLAC 2DGYA 3CD6A 1NJIC 4JBJA 3M4YA 1EL0A 4DV3Q 3CQZH 5IE8A 1GUGA 1L0YB 1W6KA 4CBVA 1TR5A 4FVMA 5I9PA 1HNWQ 3AB9A 4LF5L 2XWBB 1I50B 5JPNC 3FKIH 2XSCA 3PIO3 1EY9A 4DV5L 1M90C 4XQQA 4DF7A 3JAME 3GTMB 1D7QA 1YJ9A 1Y14B 5CBAE 1Q86C 2UU9L 2E2DC 2FMRA 4C3JH 4JV5L 2NVYH 2JA5B 1SFOH 4HTHA 1EEFD 5EPJA 4JI4Q 4YHHL 2IX3A 3T1HL 4A3GH 1EUJA 1Z6HA 4K0KL 3TP7A 4AQYQ 4IURA 3RZDH 5BN3A 3K81C 1BCPF 1X6OA 5BR8Q 4FXGC 1AZPA 4QIWB 4A3MB 1LTLA 2VNUD 1SNQA 5A35A 3G7LA 3GTMH 3PMFA 3I56A 2A68C 2PPBC 5LMNQ 2GVAA 3NK9A 2YU9B 2ZTDA 2EDGA 5CV4A 3S2HB 4RCOA 2JA5H 1CFMA 1WD1A 3SK6A 1HPCA 4KK7A 2X69A 2H5XA 1WI5A 1S5FD 5LMUQ 2DY8A 1J5EL 1PTOF 5JOBA 3PUWA 2D9UA 2QA4A 3M7GA 4AIMA 3R2IA 1JCKB 3A56A 3P75A 1B50A 1KD1C 1NCVA 4X3TA 1VQ7A 2CWPA 3VR5A 4K6LA 5GQOA 1E3PA 3RLFA 2IL8A 3S2HH 3S1NB 1YNXA 2A8VA 4ULLA 2OTLA 2AQ1B 4OXPA 1QVCA 1WOCA 5IP9G 5NUCA 2VUMB 2UUBL 4JBKA 1YNND 5C4JB 4JI6Q 2XNAC 1SE4A 3S14B 2MJ8A 1MBYA 5KGUA 1YI2A 2WKDA 3A55A 4F7XA 4UDUC 2TMPA 2JA6B 3RMHA 1VQGA 3TP5A 1VIGA 3ND8A 5AFWA 1E2WA 1TY0A 3CW2C 4V0BA 1XNRQ 2K50A 3NBIA 2O5JC 2IHEA 1QJOA 4PNYA 1MIUA 3TREA 1HH2P 2KEEA 3S15B 4LK1C 5IP9H 5KYIA 4DV3L 2KHIA 3S1NH 3V2TA 5EPKA 3J7A5 4KY7A 2M9VA 3D0FA 2JP1A 3BVZA 5IY0A 3RUZA 1NUCA 4H44C 4DGZA 1HNWL 2Z4IA 5C4JH 3H0GB 4JG2A 1EZ6A 3PIOA 3E0EA 3UE0A 1BVSA 1PH3A 4M1UB 3L3OC 2Q8IB 3GTQB 3OWFA 2JA6H 4R4TA 2VQEQ 3K5OA 4JOIC 3GV3A 3CU7A 4K2KA 4JI4L 3UI2A 2NBFA 3ITPA 5JJIA 4PMCA 3E9IA 4DR4Q 3P1HA 4IOAA 3QWNA 1P8LA 3X3MA 4TVAB 3A5UA 2JE6I 3QG1A 4AQYL 2FMCA 4GN3B 1Q46A 3M4PA 5BR8L 1ENFA 1IL8A 4JI8Q 3KK7A 2PMZE 4DV2Q 5CV5A 2YTYA 2C5CA 4GZYC 4IJHA 4OO1G 2K28A 1B44D 1U4RA 2MNAA 5LMNL 4GKKQ 4KHPQ 3WWVA 4CKEA 1H9SA 3FVQA 1ESFA 5IYBG 1SDFA 2D0PA 1CA5A 5JEAJ 3CP0A 5C4HA 5LMUL 2K32A 1VQAA 4WJ4A 4XYOA 5EBCA 1SXTA 3PO2G 2VW9A 1J5KA 4H13C 1I6HB 5IGCA 1ESRA 2F0OA 4OO1H 1EQTA 1I94Q 4A3BB 1I3QH 1PLFA 1A0IA 3HZXA 1SRUA 1HNZQ 1QZHA 4FYDA 3V96A 4JYAQ 2GA4B 3R2TA 3HOUG 5FLXc 5IYBH 1JICA 2B63B 2EIFA 1IW7C 3AFQA 3OIPA 4K8JA 4KJOA 1HUNA 5T1IA 2LXKA 2JSOA 1U4LA 2CWAA 3MTSA 3S2DB 2LS01 3MWYW 4ZLTF 2IJ0A 4OWTB 3FPUB 3L7ZC 4DN4M 1I6HH 2R7DA 1BF4A 3HEJA 2DUDA 1VQ4A 2R93B 1WTPA 3J80i 3FHWA 4A3BH 4ILWA 5GAHC 2PNHA 1CZGA 1PZJD 1BBXC 3BYYB 2ES2A 4C3IB 1L0XB 3CCEA 1E0BA 1XNRL 3HOUH 1EY4A 4OIKA 3KF6B 1ASYA 2R93G 1OTCA 1WTWA 1EY5A 2E74C 3R3OA 1WTXA 4IO9A 2PZWA 2ASBA 4C1NI 4C3IG 4APVA 2L55A 1HR0W 4GOPC 2B2WC 2K04A 2PQAA 3CCJA 2B63H 2F0DA 2AXYA 4QL5A 4QY7A 1JWMD 4RA8A 2VL6A 3KBGA 4PZ8A 1DJRD 5I6YA 1JOQA 1A63A 2CVRA 2DNCA 3S2DH 1FNVA 3E6ZX 3DXJC 3MXUA 1DOLA 2RVLA 1PDQA 2D2CC 1EOTA 2HH3A 2Q2IA 1TWGH 3F2UA 1I4PA 2R93H 2VQEL 1HCZA 2IHFA 3J80E 1LO5D 4TRDA 4C3IH 4KHVA 2YTXA 3TZDA 4R4OA 1VQOA 1E24A 4UPAA 4RCNA 2X6LA 1AZQA 2F0EA 4JI5Q 1VQ6A 2OPVA 1Y1WB 4YWKA 3J81c 3SHLA 1KNEA 1MSGA 2WP8J 3N52A 4R8IA 1DM0B 5CYUA 1I4HA 2JQOA 5FO8B 4ZQ3A 4DV2L 1SJED 2IX0A 2JK8A 4LFAQ 4O1NA 1RJTA 1PH6A 4ME5A 1G51A 2KHJA 2EY2A 3K0XA 2EY5A 4KHPL 1G2TA 2PMZB 3VA5A 2E2JH 4IFDG 5TSSA 2Z0SA 4POGA 4P73A 1V1PB 2BE5C 1A15A 1CKMA 2NTSA 3Q0AA 1KDCA 5GAEC 5GAGC 4H7BA 1KTKA 3MEFA 2R7ZB 4OO1I 1HNZL 3E0JA 3J81j 3I4MB 3K7AB 4JYAL 2CFMA 1A2TA 2I5HA 2R7ZG 1QB5D 1Y1VB 1OXXK 2K7VA 4IFDH 2N88A 3G6EA 5CV8A 4DR1Q 1Y1VG 2NVTH 2AQ3B 4MN3A 3KDFA 4KV6A 2UUAQ 2F3IA 3BVGA 4R4QA 1YITA 3OOCA 3I2ZA 1VQEA 2RBMA 5M5WH 2EY6A 3S16B 5CR3A 1DZ1A 4EQOA 1TWAH 2B3GA 1YNJD 3GTLB 2R7ZH 1PYBA 1PVOA 3CC2A 1EY8A 1KLGD 1EC6A 2K14A 1Y1VH 4NB3A 4GKJL 1C4QA 4EX5A 1NMGA 2RCNA 1A6XA 1H9JA 1DYQA 2PZTA 4NP5A 4DK3C 4S3SA 3I4NB 3G6JB 1PTOH 4C3HG 2F0GA 3I8ZA 1GO3E 2Y0SE 2UXCQ 5IP7G 3I4NG 1X3QA 2JA7G 5D3DA 1HQRD