2JE6I

Structure of a 9-subunit archaeal exosome
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
215
structure length
207
Chain Sequence
QEIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKSIFVANNGRIWAFSEEILIEAIRKIENESHIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA Channelling by the Archaeal Exosome.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
total genus 39
structure length 207
sequence length 215
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2je6I01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2je6I02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2je6I03
2B63H 1Q90A 1K3RA 1YNXA 3LGJA 4IPHA 4HJ7A 2A6ED 1WI5A 1PH1A 1Y14B 3F2CA 2ZT9C 4DV0L 1GUGA 3CCEA 2A68C 1VQKA 4LF9Q 5ELNA 1HNXQ 1Y1VG 3VR5A 5A35A 1S3OA 5FJ8G 3HOUH 2OQ0A 2F4VQ 2V1CC 3LNNA 1CKNB 5DLQE 3HOXH 3ULPA 4C3IH 3GTPH 3GD7A 4AQYQ 2N3SA 4DR6Q 4GZYC 1EUJA 3W1BA 2EJFC 3GQBA 2WAQG 5IWAL 3S2DH 3EIVA 4A3KG 2UXBL 3U4ZA 1MJEA 3I4MG 5GQOA 1YZ6A 2CKZB 3KF6B 4POFA 3K81C 5H1SE 3NEMA 4JCVE 5BR8L 4YHHL 1WFQA 2HIXA 5LMNW 2VNUD 3M9BA 2OPVA 2CQOA 1O7IA 2OCEA 1A63A 4HIOA 1CSQA 3EN2A 1XJVA 1NY4A 1NTGA 4NXNQ 1CKNA 5EAYA 4IJHA 1B9NA 1IW7D 2MNAA 4A3KH 4A3MG 4B3SQ 2JZXA 4NB3A 5JJKA 3CXCA 2R93H 1HR0W 2UUBQ 4AQYL 3HKSA 5LMUL 3PUZA 1HTPA 2EIFA 2BH2A 2OTJA 2ANNA 3M7NA 3S1RH 4YWMA 4JBJA 3PUXA 1HNXL 3FHWA 2R6GA 2E8GA 4AYBG 3OTOL 1HZ9A 3G6EA 3CCJA 3TS0A 1K1GA 2P2RA 3QIAA 4TQUS 2I5LX 3CW2C 5AJ3L 2R92H 3KFUA 1FR3A 2JA9A 4X6AH 4X66Q 3G71A 3NE5B 4DK1A 4DV4L 1YBYA 1XNQL 4A3FG 5IYBG 1HZCA 3I4LA 1GKHA 4GOPC 5IP9H 2VQEL 2ATWA 1X65A 3A8JE 2DGRA 3J81c 3UDXA 3RN2A 3I7FA 3F2DA 1XPOA 1EIYB 3TRZA 4LW1A 1NJIC 2ZTCA 1Q12A 1X54A 3HOVH 3BJUA 3PO2G 3VDYA 1KHMA 4PZ8A 3KJPA 1Z9FA 2XTIA 5GAEC 2LSSA 1GJXA 2R93G 4WJ3M 2IT1A 1H9SA 1HNWL 4JVYA 3QG1A 2BA1A 3U4VA 1JMCA 4DV4Q 5LMNQ 3PUYA 1HZBA 1VS0A 3DXJC 4DV3L 3HOWG 3QJYA 1T9HA 4YCVA 4X65L 2Q2UA 2E74C 1A62A 4JI7L 3GTKH 3A7AB 1SE8A 3S1QH 4BBRH 4DK0A 1UEBA 2MFIA 2ZJRA 4LK1C 3J81i 1TUAA 1IBLQ 1J5EL 3K8AA 3T1YQ 1VQNA 4L5SA 4HJAA 2I5MX 4UP7A 2DN8A 1N8RC 2ID0A 1JJGA 4C3HH 4BA2I 4BY1H 4POGA 1DTJA 1EQQA 5IYDH 4X64L 3HOUG 3BDOA 4JI0Q 3HGBA 1Y1VH 5FJ8H 2CTFA 1WCMG 3DLLA 1EWHA 3N6RA 2OQKA 4BA1I 5LMNL 4B3SL 2JA8G 3LWUA 3H94A 3OOCA 1X4NA 2MJHA 2E5LQ 4DR7Q 1N36L 2A1AA 1VQ9A 4I7ZC 2O5IC 3STBD 4ALPA 1JJCB 1GUSA 1HCZA 1E1TA 2A69D 1DD2A 2EVBA 1EWIA 1PA6A 1GHKA 2OWOA 4IPDA 4Y52H 3VR2A 3D31A 1HR0Q 2AMCB 3HOYG 3PO3H 4DNRB 2IX0A 4R4OA 5GROA 2JVZA 3FMCA 1UE7A 4NXNL 1C7YA 4B3TQ 1VQLA 2CTLA 2ZTDA 2UXDQ 3MXNB 3CCLA 4B3RQ 2NN6H 4L5RC 4OX9L 4OO1I 4LFBQ 2HH2A 4JI8Q 4A3EG 4LF7Q 1FYCA 3PF4A 4DR1Q 5C4XG 4KN7C 4EX5A 2CW0C 4LF9L 4KKUA 4QQBX 4JOIC 3I55A 4GNXC 4GOPB 2BL5A 5JJLA 1LACA 1UE6A 1X56A 4R1JA 2QA4A 4HIKA 3KDFA 2LXJA 2YQRA 1GHJA 2AUKA 1VQ7A 1QZHA 4PV1C 2A69C 1J6QA 1YVCA 1RIPA 1UWVA 4KMUC 4LFAQ 1CUKA 2XGTA 1XPUA 1GUNA 2DNEA 2KA7A 3EQLC 3VR6A 2K5HA 4MNOA 2WFWA 4OX9Q 3TREA 4LF4L 1X4MA 2UUAQ 4R4IA 4JI6L 2QEXA 4KHPL 4QY7A 1TKWB 4NXMQ 4A3CH 4LUVA 2PQAA 2QNDA 1BDOA 3RLFA 1OXSC 3ZJYC 3A7LA 4KKSA 3KF8B 4DKAC 4JI4L 4OO1H 4H02A 1VQ6A 4KKTA 1VQJA 3S24A 2B8FA 3ND9A 5K36H 1Q46A 2WB1G 5M3MG 3GTJH 1VQDA 3VR3A 2Q2HA 5IYCH 4JG2A 2ZJPA 2BDOA 1D7QA 3AEVA 4BXXG 4GKKQ 3L0OA 4DNIA 3I72A 3PF5A 2HQLA 5GADC 2Y0SE 3AQQA 5IP7G 2K7VA 4LUOA 4Y7NH 4DV2L 4GNXB 3GTQH 2KCTA 1FGUA 1VF7A 1SN8A 3OTOQ 3KYHC 3FP9A 1CSPA 2JA5H 3HFZB 2AXYA 2N8NA 1U5KA 4DR3L 4A3IH 1ZKOA 3A5UA 3UDFA 5IY0A 1E2WA 1BKBA 2UUBL 1E24A 4IOAA 4OXPA 2A6HC 4DAYB 4IFDI 5BN5A 2Z6KC 3PIPA 1H9JA 1PH9A 1PH4A 1VDZA 1Z7TA 1K73C 1P8LA 3CP0A 1JT8A 1PYSB 4KHPQ 3I2ZA 1YJ9A 1VQAA 2IX1A 2NN6G 2K5NA 4PG3A 1JJ2A 3K7AH 2EJMA 1IYVA 4LUZA 4JBMA 4A3DH 2OPUA 4DR7L 3SDZA 1TWAH 1Q7YC 1OXUA 2JA5G 3ULLA 3IRBA 4DV5Q 1DT4A 3MFYA 4DPGA 5JEAJ 4UY8C 1IW7C 3UDIA 1KRTA 2K5VA 4A93G 4A3BG 3J7A5 2D0OA 4K0KQ 3PIOA 3PGZA 3AEVB 2E2JH 4GLVB 3E0EA 1WCMH 2YU9H 3S2HH 1D8LA 1Q81C 3KJOA 1YI2A 1VQHA 4JI8L 3CPFA 2HT1A 5M3MH 5E7NA 1XMOL 2KENA 4B8TA 4WJ4A 1PH3A 4QIWE 4UPAA 4OO1G 4G7OC 1EC6A 1I3QH 4JI2L 4A3CG 3W3AA 2VY3A 4ME3A 2HH3A 1EFWA 4DR2L 4DR5Q 2ANRA 1DGSA 1C0AA 1WJJA 1CFMA 3SGIA 3M4OH 1O7LA 4IPCA 4AH6A 1LABA 4R4QA 4BBRG 1QZGA 4H0LC 5J3BA 1V8QA 2CTKA 4JI4Q 4GN3B 1PH5A 2YV5A 1HJPA 3JAMc 3TEHB 2GVBA 3E9IA 3KDFB 1DXMA 4BY7H 2B63G 2ZJQA 1K0RA 3IFTA 3F2BA 1N33L 2EDGA 1VIHA 3KLWA 4H44C 4HJ5A 2RHSB 5IT9c 1QVCA 3PO2H 1NMFA 3HOVG 5BR8Q 4DV7Q 2F4VL 3GTMH 1PH7A 1VQOA 4DR5L 4DR2Q 1OTCA 3VKEA 3CPWA 2RHQB 4JI5L 4EQ5A 5C4XH 1CTMA 2MO0A 3MEFA 1VQ4A 1QUQA 1EQRA 2VQFQ 3HKZG 4AIMA 4P75A 1R9TH 5IP9G 1CI3M 2A8VA 4PMWA 4MTNA 1M90C 1PH8A 4GLAC 3CCSA 1YHAA 1SRUA 1OXTA 1V9PA 2F52A 3AFPA 4IO9A 2UU9L 4JI1Q 3HOYH 4C3JH 1VQIA 1H95A 1HPCA 4L8JA 1AE2A 1HNWQ 1ZTGA 2GN5A 2BE5C 1IBLL 2R92G 1TWCH 1N9WA 3GTGH 4JK1C 2H5XA 1LUZA 3MXUA 2JJQA 3BZKA 4QJFA 3RR5A 1HH2P 4A3JG 4A3GH 2JA8H 4DV3Q 1A6XA 1V1QA 3HKZE 3I4NH 1X6OA 4C2MH 4GLXA 4B3MQ 1I50H 3HOZG 1O78A 1GD7A 1LM0A 3CMAA 1I94Q 2UUAL 4O0AA 1TU2B 1VCIA 1JE5A 4X62Q 5C4JH 3CC2A 2IHEA 3H0GH 3CCMA 4JI3L 5GAGC 4DV6Q 4DV1L 2MQHA 3PCOB 1PH2A 3D0FA 1S40A 1XNQQ 1XNRL 3STBC 2PY9A 4A3MH 4JI1L 3KLRA 1GUTA 4LF4Q 3CD6A 1ZZJA 4R4TA 3W5OA 4IFDH 4LF8L 1QVFA 4HIDA 4LJZC 2NVQH 2Q2IA 4IFDG 2NZHA 3S16H 2K75A 3ND8A 1B9MA 3Q8DA 3NELA 2CWPA 4FDBA 1Z6HA 1MKHA 4GN5A 1LTLA 1XTDA 4LWCA 4LNQA 3I4MH 2JA6G 5FLMG 2CTMA 3A0JA 1G51A 2B29A 2EQSA 1X3FA 4LFBL 4KHZA 3DM3A 4GN4B 4JVHA 3H0GG 3PV0A 3K0XA 3JAMi 3PSIA 1XMQL 4DUYQ 2MO1A 2YTYA 2OTLA 4HR7B 2AWNA 2CFMA 1TWFH 3HOXG 4DV2Q 4B3TL 4GKKL 4YCWA 2KCCA 5C0XJ 3I4NG 4GOPA 1VQPA 1SFOH 3S17H 2NN6I 4A3JH 1FJGQ 3S1MH 2IY5B 1IYUA 1S72A 2UXDL 4YHHQ 1X55A 3ERSX 4P74A 3BG3A 2WB1E 3TQYA 5JJIA 2PQUA 3BU2A 1Q82C 1N34Q 1BVSA 5IYBH 1PH6A 1YNNC 1L0WA 2JEAI 3U58A 1B8AA 2IHFA 2NVYH 2V4DA 2AWOA 1YEZA 4JI6Q 1ZZKA 4DNTB 2HIVA 5IYDG 4P73A 3OPOA 4YCUA 1ZZIA 3T51B 4JV5L 1EIFA 2O5JC 3M85A 1PHJA 1G6PA 4LFAL 3J80c 2ASBA 1UE5A 1G291 1I6VC 4KI0A 1NBWA 3T1YL 2FMRA 4YY3L 2F3IA 1YJWA 2UXCQ 2Q8IB 4QMFB 1X3EA 1VF5C 1H9RA 1X9NA 1KIXA 4OWXB 2HHHL 1I6HH 3CC4A 2L5TA 4RCNA 2AKWB 2R7FA 1EYGA 4BY7G 4IJLA 5FLMH 3AFQA 2JA6H 1Q8KA 4QGUA 2QGQA 2YTVA 2LXKA 3UE0A 1QVGA 4K0KL 2CTJA 4RG1A 4LF7L 3D4RA 2PPBC 5C44G 2KCMA 3AYHB 4X62L 2JA7H 3CCQA 4XTCS 4JYAL 1ZYRC 1AE3A 4TVAB 2ZM6L 2A6EC 1N34L 2BE5D 1HR0L 2BA0A 4PZ6A 2WAQE 4DV7L 1SMXA 1SMYC 4JI2Q 4IQZA 3F1ZA 1KD1C 2CTEA 1VQCA 2JK8A 2VW9A 1J4WA 3RZOH 1YNJC 1H9SB 1BBWA 3JC66 2L15A 1VQ8A 5HY6A 2FXQA 4HJ8A 1CKOA 1VQFA 3HOZH 1WOCA 3UE1A 1Q1BA 1RL2A 4YWKA 5M5WH 3M4PA 3A74A 4MZ9A 3A8IE 3GTLH 2K4KA 1E22A 4A3GG 1FVIA 1Y8OB 2JEBI 1K9MC 2E3UA 5KNCA 1K8OA 4DAMA 1KL9A 3WDNA 4OONA 1WYDA 2VQFL 3CC7A 3ICEA 2UXCL 3U50C 4LF8Q 4QL5A 1K83H 2F1MA 3RLOA 1IBKQ 1J5EQ 3L7ZC 2RCNA 2K33A 2PMZE 3KOJA 3T56B 1IBML 2E2IH 2KHIA 4IPGA 1SR3A 3OW2A 5BN3A 1XPRA 1N33Q 4BBSG 4OWTB 5M5YH 4IOCA 2QF7A 2ALYB 2N49A 4JI5Q 2GVAA 1PYBA 4NXML 3S14H 4GKJL 2PNHA 3J7ZC 2AHOB 3H3VI 4DV5L 3GDEA 3EBEA 3T53B 1IXRA 3I4OA 5LMUQ 1AH9A 3FPPA 2ZM6Q 4HIMA 1L1OA 5ELOA 3RNUA 1PFSA 1N36Q 1OXXK 2VQEQ 1YITA 5C3EH 2PI2E 2B8GA 2YYZA 1I94L 2VUMH 2EJGC 2UU9Q 2I5HA 4IFDJ 1Y69U 2ZTEA 4LFCL 4L5QA 2UXBQ 2D0PA 2YTXA 1HZAA 3GO5A 1UE1A 3UDGA 3I73A 3OW7A 2CPQA 1JB7A 3M4YA 2K52A 2JXMB 4YY3Q 3CCVA 1IL2A 2NVTH 5IP7H 1YJNA 4DR4L 1H9KA 2UUCQ 3E9HA 3F8TA 2PCFB 4KN4C 1KHIA 2K50A 5C0XG 5IE8A 4DR3Q 3KF6A 5M3FG 3V69A 1LYLA 2PQAB 2NZOA 3B6YA 2A6HD 1I5FA 3G48A 5IYCG 3CCRA 3T1HL 3RZDH 2KBNA 4JC0A 4O2DA 4A3LG 1E3PA 4LF5Q 4DR6L 4WANA 4HJ9A 1T5EA 1TWHH 4X65Q 4JI7Q 1Y1WH 4A3LH 5BN4A 4AYBE 4LFCQ 3H15A 1KC8C 2D2CC 3U9SA 5C0XH 1X3GA 1HNZL 1W3SA 2CWAA 2NVXH 3J80i 4L5TA 4DK6C 4A93H 2EXDA 3NENA 1B7YB 3A8KE 4WALA 5KNDA 2Y0SG 3TZUA 1PMRA 2DNCA 2E2HH 2R7ZG 3FKIH 4A4IA 3CRKC 1NMGA 4TKOB 1EOVA 1ASZA 1K8AC 1XMQQ 3OYYA 3CCUA 4A3DG 1PV4A 1C9OA 2E5LL 1FL0A 1WVNA 1MIUA 4LF5L 1P16A 1OXVA 4OGQC 5JEAH 2PI2A 2PNRC 1Z47A 5FLXc 1HNZQ 4R4CA 1L1OB 2VZAA 4DR4Q 1H9MA 2K14A 1ONLA 5JEAG 2LMCB 1NE3A 4AM3A 5IWAQ 2I0QA 1MJCA 1VQBA 1SLJA 1TWGH 1XMOQ 3GTOH 4OWWB 1KQSA 3T1HQ 4B3RL 3U1KA 2HHHQ 4RMFA 1VIGA 2VS1A 4A3IG 4APVA 1QJOA 3K80C 3AB9A 5C0XI 3FKIG 4A3BH 3PUWA 2R7ZH 1Q1EA 4XIGS 2RF4A 3CMEA 1A0IA 1Y8PB 2ES2A 2Q2TA 1XNRQ 3K7UC 1Y8NB 1E1OA 1ASYA 1GUOA 2JE6I 3BZCA 1A8VA 4PZ7A 4P72A 3ULJA 1E2VA 2R7DA 3CQZH 1CKMA 3RLNA 5HGQA 4BXXH 1VQGA 4JYAQ 2VL6A 1J5KA 4UP8A 4LIJA 2N78A 1VQEA 1Y1WG 4GKJQ 2A19A 2E75C 5K36G 4DUZQ 4GS3A 2Z0SA 4GNXA 2B3GA 4BY1G 1VQ5A 1GVPA 4JV5Q 1E2ZA 5M5XH 1FJGL 1K8GA 2AUJD 3CF5A 3P20A 5M3FH 3TS2A 2CCZA 4A75A 1N32L 4NBQA 5KNBA 4LF6L 1V43A 3WWVA 1VQMA 4JI0L 3CRLC 1U0LA 2BH8A 4X64Q 1IYJB 5AJ3Q 2JA7G 4X66L 3M3YH 4DUYL 1KRSA 4P71A 3L2PA 1IZ6A 2Z6KA 5C44H 1YHBA 1GM5A 4JBKA 4G7HC 3S1NH 4A76A 2KHJA 1YHQA 4KLKA 3VA7A 2WP8J 4DK3C 3HOWH 4H13C 3M4QA 1TXYA 3PUVA 1B70B 3NBHB 4YWLA 1IBKL 1IBMQ 2UUCL 2VUMG 5C3EG 4DV0Q 1PVOA 3G4SA 2A68D 2K32A 1HQMC 1BBUA 2D62A 4UP9A 3W1GA 3VR4A 1SROA 3I56A 1M1KC 1GO3E 3IKJA 2E76C 1DCZA 1E7ZA 4JOIA 3J81j 3A5ZB 1KAWA 3SE0A 1L1OC 4NPSA 4DR1L 1YIJA 4B3ML 4LF6Q 5GAHC 3CAMA 3H3VH 1N32Q 4A3EH 1QUQB 2C35B 2D5DA 1K8MA 4JBWA 2DUDA 4DV1Q 1W2BA 1WE8A 4DV6L 3RN5A 4G7ZC 1Q86C 4JI3Q 3S15H 2JQOA 4DUZL 4BBSH 4J15A 1L2FA 1KXLA 4A3FH 3PO3G 2DGYA 3ER0A
chains in the Genus database with same CATH superfamily
3TP6A 1Q90A 2B2TA 4IPHA 3F2CA 3HOVB 1K3BC 3HOWB 3E6ZX 1HR0H 1XWEA 1S3OA 1N36H 1CKNB 2PT7G 2PW5A 3DHQA 4C3IH 2EOTA 3GTPH 3TP7A 2N3SA 5EPJA 4DR6Q 3KLSX 3J81E 4GZYC 3W1BA 2EJFC 1EY5A 2UXBL 4HMIA 5A2QL 1T5XD 3K81C 2CWHA 1F9QA 1JR0D 1EY9A 3BDCA 1Y1WB 1O7IA 4IUNA 1CSQA 3EROA 4A3DB 1NY4A 1LTBD 5EAYA 4B3SQ 2MNAA 4NB3A 2R93H 3EJIA 5J39A 1K28A 1B1ZA 1I4RA 4ZRZA 1XXGA 2Z1CA 4YWMA 4JBJA 1L0XB 3MHBA 3PUXA 3S17B 5D3DA 2E8GA 1K1GA 3C2PA 2P2RA 1HZ9A 5C4XB 3QIAA 4TQUS 2I5LX 1FGBD 2RBMA 2JA9A 1W6KA 4X66Q 1LT4D 4DK1A 4DV4L 1YBYA 4ME5A 5IYBG 3GTOB 2ATWA 1X65A 3J81c 3UDXA 3MTSA 2D9UA 3RN2A 2SNMA 2ZTCA 1SMYD 5FLXW 3HOVH 3PO2G 2D9IA 1KHMA 1IBKH 3KJPA 5CV6A 2LSSA 4X66H 1GJXA 2R93G 3NSWA 3U4VA 5FO7B 4Q0FA 3GTPB 1BR9A 2QDLA 1DM0B 1A62A 3A7AB 5F2DA 4DK0A 2AQ1B 4PNYA 1N33H 3MXPA 4JYAH 1TUAA 1EY6A 2ICEC 1VQNA 2HDMA 3GTJB 4HJAA 4JI4H 4UP7A 1RJTA 2K03A 4B3SH 4C3HH 3EFXD 3D6CA 1PRTD 5I9PA 1EQQA 1A3UA 1BCPF 4ZK9B 3VYTA 2CTFA 5LMNL 2MJHA 2O4CA 3R2TA 2TSSA 3HOXB 1PRTF 3STBD 1V9NA 1E1TA 5J1ZA 1EWIA 4IPDA 4Y52H 3D31A 4JI8H 2AMCB 4C1NI 1C7YA 4XQQA 1VQLA 4N9PA 3CCLA 2NN6H 2RSNA 2HH2A 1BCPC 3PF4A 2DY7A 4K2LA 4EX5A 5C5LA 4V190 1TWAB 1S5ED 4XT1B 3BVZA 2AUKA 4ABNA 5LL6S 5CBEE 1XPUA 4A3JB 1V1PA 3EQLC 4MNOA 2WFWA 1LTTD 2UUAQ 4R4IA 2QDBA 3T16A 2QEXA 4HN7A 4QY7A 4A3CH 2QNDA 1BDOA 3RLFA 3ZJYC 3A7LA 4KKSA 4H02A 3S24A 3GTJH 4S3SA 3RZOB 4BXXG 4GKKQ 3CKIB 3QR8A 2NVXB 3BZDB 1QCBD 3ERQA 1SN8A 2JA5H 5BR8H 2F0WA 1ZKOA 4ZCKA 3A5UA 3UDFA 2E2IB 4DAYB 1LO5D 2SEBD 2Z6KC 5EJWA 3PIPA 1H9JA 1PH4A 1VDZA 2A73B 3G6JB 3CP0A 1EYDA 3TDQA 1VQAA 2IX1A 5G3LD 2K5NA 4PG3A 2XWJB 2EJMA 3P7JA 4DR7L 1TWAH 5CV5A 5JPNC 1F2ZA 3E0JA 4A93G 2D0OA 3PGZA 4GLVB 3E0EA 1D8LA 3KJOA 1YI2A 2HT1A 3CPFA 5E7NA 2KENA 2J4XA 4UPAA 1PQXA 2FINB 2Z9HA 1EC6A 1X9ZA 3W3AA 1EFWA 4DR2L 1DGSA 3M4OH 1CFMA 1O7LA 5FLXL 4IPCA 2HHHH 1LABA 4R4QA 4BBRG 3FVQA 4JI4Q 1SNOA 1BOSA 1G8ZD 3KDFB 3HG9A 1SYFA 2JYOA 3IFTA 3R3OA 1PTOC 2RKSA 3NQTA 3KLWA 1R4PB 4HJ5A 2ZXPA 4JI7H 3VKEA 1STEA 4X3TA 4DR2Q 1OTCA 3EVQA 2MHVA 2NB0A 1EQRA 4CJ0B 1CI3M 1JICA 4K0KH 3QOJA 2WKDA 3AFPA 4MIUA 1KTKA 1NR2A 4UAIA 4JI1Q 2P5ZX 3H6MA 1EIHA 2GN5A 2AQ2B 2JJQA 1PRTB 3HKZE 4GLXA 1O78A 1I94Q 5IOCA 3IL8A 1TU2B 4X62Q 1JE5A 5C4JH 1XNRL 4G4KA 1XNQQ 3LX0A 2MUYA 2WB1B 4JI1L 3K0YA 4DUYH 2A74C 3KLRA 3UOEA 1GUTA 4R4TA 2SDFA 1LTRD 2NZHA 4GN5A 3ND8A 4AYBB 3Q8DA 4IFDI 4LNQA 1Z6HA 2DY8A 5IODA 3SR1A 2L55A 4DUYQ 2XN9C 4B9WA 3HOXG 2OTLA 4GKKL 5LMNH 1K0SA 3KBGA 1RF2D 1S72A 5DNFA 2UXDL 2IY5B 1CQFA 1PFNA 3S2DB 1TVXA 1BVSA 2AQ3B 3PMFA 1CT1D 3U58A 4H7BA 1B8AA 4DNTB 2HIVA 2O2LD 3OPOA 4YCUA 5JPMC 1ZZIA 3T51B 4M8AA 2O5JC 1UE5A 4MN3A 1NBWA 1EU4A 1D1IA 3HP3A 4YY3L 2UXCQ 2HHHL 3GTLB 1EYGA 4J1MA 4RCNA 5HURA 4IJLA 5FLMH 2SOBA 2JA6H 2LTMA 4LF4H 4DR1H 2QGQA 2KQ3A 2YTVA 2LXKA 2HUGA 3UE0A 4K0KL 1JCKB 4ZKBB 2CTJA 5C44G 3RZDB 2RA4A 1AE3A 1ZYRC 2A6EC 3VA5A 1TS5A 2BCOA 1KD1C 3CHBD 1AEXA 3JC66 2L15A 2L1BA 3NHHA 4HJ8A 2F3WA 4Y7NB 4QCLA 3A74A 1FVIA 2JEBI 4OONA 2Y3MA 4K14A 3U50C 4A3BG 1IBKQ 1S5FD 2BOSA 5BN3A 5M5YH 4HTHA 2QF7A 1S5CD 2F0UA 1QOHA 2NVQB 4XDXA 1RCVD 3H3VI 3GDEA 2DJFC 3WOFA 5LMUQ 3FPPA 4HIMA 1Z2IA 1PFSA 2F0KA 2PI2E 2B8GA 2SNSA 4HCEA 2I5HA 3J7YW 4OEMB 4LFCL 1UAPA 4KJNA 1U4PA 4NZTM 2YTXA 1QILA 4I65A 3S1RB 5C4JB 1RTOA 1SYEA 2JA6B 2F0JA 3C46A 4CDFC 3GKUA 4Q5VA 5C5MA 5IE8A 5C0XG 3KF6A 2IL8A 1YITA 3MXGA 5DM73 3RZDH 2A6HD 4A3LG 3DMUA 4WANA 1ZXTA 2KBNA 1E3PA 4X64H 4A3FB 2EY5A 4HJ9A 3H91A 4LFCQ 2LRRA 4CGYB 3QO2A 2CWAA 2Y0SB 1SNPA 4L5TA 2EXDA 3U9OA 2KVMA 4F88A 1A2UA 1PZKD 2DNCA 1ASZA 5IGDA 1UUPA 3NTIA 1PV4A 2XVSA 1OXVA 2K5QA 4ODGA 2PI2A 1WTQA 2VZAA 3K57A 5M5YB 2K14A 4M1UB 4BWGB 2CWFA 5JJZA 1M8AA 1OO9B 2I0QA 4RH6A 1MJCA 4OWWB 2HHHQ 3DUZA 5A2QW 5D3IB 4A3IG 4APVA 1CHPD 4FJUA 4XIGS 5CYUA 2B2VC 2Q2TA 4PZ7A 5A2QE 4P72A 3ULJA 3S2HB 3HRZC 3D6WA 1XX8A 1CKMA 4MTKA 5HGQA 1I4HA 1VQGA 1WTPA 1Q8IA 1HNXH 4GKJQ 2E75C 2F4VH 4DUZQ 2Z0SA 5DM63 1VQ5A 3J7AF 4C3HG 1NCVA 3P20A 1N32L 1AZPA 1V43A 1TY0A 1VQMA 3CRLC 4LF5H 1ENCA 2PZTA 4X66L 3M4OB 2B63B 3R2IA 4KJOA 1Q3LA 4HSPA 1YHQA 4DR7H 2VB3X 4KLKA 2WP8J 1R4QB 3M4QA 2JP1A 1IBMQ 3HS0C 2K32A 1LTAD 2VKCA 2D62A 2IX3A 1M1KC 3IKJA 1DCZA 3J81j 3A5ZB 1KAWA 3SE0A 2NVTB 3TBIB 1HFNA 3H3VH 2MJ8A 1DOKA 4WFN3 2D5DA 1W2BA 2HDLA 3RN5A 1Q86C 4G7ZC 3S15H 2PQUA 4DUZL 4J15A 1VMPA 1CZWA 1MGSA 3ER0A 1YNXA 4RWSC 3SK4A 4HJ7A 2A6ED 2KEEA 1GUGA 4IUVA 4LF9Q 1HNXQ 5LHY1 1WTJA 1Y1VG 5C3WA 3HOUH 2I46A 2OQ0A 2V1CC 3ULPA 3FKIB 4FXGC 4OL7A 3GD7A 3BYTB 4ZAIA 1EUJA 3I3CA 2H4OA 2F0QA 1MJEA 5GQOA 1YZ6A 2E2JH 4DR6H 2KOLA 3NEMA 2OPVA 3M9BA 1QG7A 5KYIA 4FVMA 5IWAH 3NQIA 2OCEA 5ELBA 3F2UA 2L9HA 1B9NA 4IJHA 1ML0D 4O1NA 2CH4A 3CXCA 1HR0W 5LMUL 3PUZA 1WVLA 2F0SA 3ITPA 3CCJA 3TS0A 2ENBA 2R92H 5EBCA 5AJ3L 1FR3A 3KUPA 4B3MH 1ESFA 3I8ZA 2ZM6H 1XNQL 3FPUB 1HZCA 4WJWA 5IP9H 4Z9CB 2VQEL 4LF7H 1TS3A 2Q8TA 2F0IA 5LL6X 1UNSA 4B3RH 1CZGA 1TQOA 4IUTA 4KK7A 3SK8A 3OSOA 1NSNS 3NP8A 2WKCA 1CHQD 1E0BA 1G6ZA 3OIPA 3SK5A 1DJRD 1H9SA 4FXKC 3QG1A 3I91A 5CBAE 1VS0A 2N88A 3NBIA 4DV3L 1XNRH 5K5PA 3V96A 2LY7A 4X65L 3S1QH 2MFIA 2ZJRA 4LK1C 2JA7B 1J5EL 2FHTA 2PZWA 4E6IA 3IFDA 1DTJA 2F0FA 5C3EB 3BDOA 5FJ8H 2JSOA 2EYMA 1WCMG 3DLLA 4RKLA 3LWUA 1X4NA 2E5LQ 1JWSD 1WCMB 1F9PA 4OIKA 4I7ZC 3CQZB 1JJCB 5D14A 1PA6A 5M3MB 3PO3H 1RD9D 2JVZA 5ELFA 3MXNA 4B3TQ 1UE7A 2ZTDA 2UXDQ 4L5RC 4A3EG 4DR1Q 4LF9L 1F2YA 4KKUA 4QQBX 4GNXC 1LTSD 4QUCA 4R1JA 5I6YA 4HIKA 3KDFA 4KD4A 4DR2H 4WORA 1GHJA 1VQ7A 3CU7A 4RCOA 1QZHA 2F0PA 1CA6A 1RIPA 4DAVA 1J9OA 3KK7A 2DNEA 2KA7A 3VR6A 3S1MB 2UXCH 2HQEA 4LF4L 1YNND 4IN3A 4OHJA 4JI6L 4KHPL 1TKWB 4NXMQ 2PQAA 3QWNA 1EU3A 2CW0D 1VQ6A 2FPHX 2B8FA 3KBXA 5K36H 2WB1G 2C5CA 1JORA 1VQDA 4IUQA 5IYCH 2BDOA 4KY7A 1ICFB 1KNEA 3I72A 5IP7G 1JWUD 2K7VA 4LUOA 4Y7NH 3BVGA 3DM1A 1VF7A 1TS2A 3L9AX 2AXYA 2N8NA 3A55A 4DV7H 5IY0A 2UXDH 1EZ6A 3MC0B 1JB3A 3MVVA 1E24A 5FKAC 1AP0A 4DXFA 1MSHA 1K73C 1P8LA 1IL8A 5CC4A 4JI2H 4KHPQ 3I2ZA 4WRDA 1TWGB 2NVYB 1JJ2A 3KDKA 3K7AH 5IT9E 4JBMA 4LUZA 3NCVA 1OXUA 5IGCA 2JA5G 4ID6A 4FF2A 3KDGA 4UY8C 4DPGA 5JEAJ 2K5VA 3D8GA 4ZUIA 2XRQD 1S20A 3PIOA 1SNDA 3S2HH 1Q81C 1VQHA 2EZVA 1U4LA 4NXMH 3S1QB 1XMOL 2EYHA 1PH3A 1I3QH 5M3FB 4A3CG 1HUMA 4HMJA 4DR5Q 1S03G 1WJJA 3T4AC 1FNWA 4FXDA 1V8QA 4GN3B 4DR3H 1HJPA 2EE1A 1O7ZA 4BY7H 3OWEB 3NUCA 3F2BA 1F9SA 2WINB 4H44C 5IT9c 3EA6A 3NXWA 1JC7A 3GTMH 1N34H 2MGSA 3CPWA 1CTMA 3MEFA 1QUQA 3RMHA 3HKZG 4P75A 5JAVA 3X3NA 2A8VA 1PXUA 2TMPA 1M90C 2BDNA 1SRUA 2UU9L 1HPCA 4A3KB 1AE2A 1IKMA 4OD6A 5ISRA 5KEEA 3MWYW 4JK1C 1NUCA 3BZKA 1DZ1A 4A3GH 5IGEA 2M8WA 1A6XA 1V1QA 2X06A 1PLFA 1I50H 1LM0A 3CMAA 4O0AA 1VCIA 2JA5B 1STBA 3H09A 4LF8H 1I6UA 2HCCA 4DV1L 1UG8A 4JPBW 2PY9A 3STBC 2K6AA 1R9TB 4A3MH 3CD6A 2E2JB 4IFDH 2NBFA 1DOLA 2HCIA 2K75A 3C1FA 4EQNA 1ILPA 3I4MH 2WACA 2X69A 1SNQA 2CTMA 3A0JA 1G51A 2EQSA 4E9JA 3H0GG 3PV0A 3JAMi 1BUVT 3I4NB 1SE3A 5I9OA 1TWFH 3I4NG 4MHEA 1SFOH 1AFPA 4RFBA 4QB4A 1Q82C 5IYBH 1PH6A 1YNNC 1L0WA 1C8CA 2JEAI 1MD2D 2NVYH 2AWOA 4XXEA 4P73A 1EYAA 5T1IA 1ZEQX 3GABA 2ASBA 3J80c 2LFNA 2F3IA 1X9NA 1H9RA 4OWXB 4NKLA 3CC4A 2L5TA 4GKKH 3RUZA 1Q8KA 4QGUA 1QVGA 1WD1A 4RG1A 2PPBC 5T1GA 1S5DD 2JA7H 3CCQA 3E3XA 1HR0L 1KNAA 2EYLA 1SMYC 4JI2Q 4IQZA 1FD7D 1VQCA 1YNJC 4C3IG 3QD7X 1VQ8A 2NWGA 2K1HA 1CKOA 1MI2A 3HOZH 1WOCA 4YWKA 1PFMA 3M4PA 4MZ9A 3A8IE 5HGTA 4AQYH 4KHVA 2E3UA 3ICEA 1L0YB 3KOJA 3L7ZC 3TSSA 3J80E 1WHRA 3JAMW 4U68A 3OW2A 3BYYB 1D5ZC 4BBSG 5EBDA 5KRUA 4JI5Q 2RDGA 4GKJL 2PNHA 4IZ8A 1BO0A 2ZXOA 4XT3B 1XMQH 3T53B 1IXRA 5C44B 3S1NB 1AH9A 2ZM6Q 5ELOA 1OXXK 4R9WA 2VQEQ 1KDBA 2VUMH 2YYZA 3DWQA 5TSSA 4A93B 5LMUH 1Y69U 3O13A 4RGTA 3GO5A 2EY2A 1F0XA 1DONA 2KEDA 1K83B 2JXMB 5CV4A 1YJNA 1H9KA 1DYQA 3E9HA 4DR4L 1VMCA 3OHXC 1LYLA 4JV5Q 2NZOA 3CCRA 1XTCD 3T1HL 4DR6L 4O2DA 2XNAC 1T5EA 4JI7Q 4JI6H 2M6QA 1RKNA 1X3GA 4X3SA 4OELB 2R7ZB 5IT9L 3NENA 1TWFB 2Y0SG 3FEWX 1PMRA 3TZUA 2R7ZG 4A4IA 1EOVA 1K8AC 4OX9H 2JN4A 2OT2A 1SXTA 3OYYA 3CCUA 4A3DG 1C9OA 2K28A 2E5LL 1WVNA 4JI5H 1IHZA 4I7AA 1Z47A 2PNRC 1L1OB 1NAPA 2RQXA 5G3LF 2NUCA 1NE3A 1JOQA 4AM3A 1VQBA 1TWGH 1XMOQ 1KQSA 5EPLA 3T1HQ 4RMFA 3J7AV 1QJOA 3K80C 3AB9A 3FKIG 4DGZA 4FF1A 5D65A 2ES2A 1B3AA 2B2WC 3K7UC 2JA8B 1Y8NB 1A3TA 1E1OA 1MBYA 2E2HB 1A8VA 2B39A 1E2VA 3OTOH 1ODHA 1J5KA 2VL6A 4LIJA 1Y1WG 2A19A 4BY1G 1TIID 2MP1A 4R8NA 1AW7A 1RODA 1FJGL 1K8GA 2AUJD 5M3FH 2F0NA 1HA5A 2CCZA 4NBQA 5KNBA 2BH8A 2JA7G 1A3VA 4DUYL 4JI1H 2Z6KA 1YHBA 3OWFA 2O4XA 4A76A 5FO9B 4TRDA 3HOWH 4DF7A 1KDCA 1B70B 4YWLA 2F0GA 1PVOA 1HQMC 2QCPX 4UP9A 3W1GA 1SROA 3VR4A 1CK1A 4JOIA 2C9OA 4NPSA 5L37A 3DWPA 4BBRB 1EOTA 4K5VA 5I6WA 3VYUA 4HCSA 1DT4A 1TS4A 4A3FH 1II3A 1EEFD 1Y14B 2XIWA 2ZT9C 5M9OA 1TR5A 5AFWA 2EYJA 3CCEA 2A68C 4DV0L 1B4OA 1RHPA 1VQKA 1BNZA 1S4ZA 5ELNA 4A3GB 1HXYD 1C48A 3VR5A 5ELEA 2F4VQ 3LNNA 5DLQE 4U673 2PO4A 1SNCA 2K1BA 4AQYQ 5IWAL 3EIVA 4A3KG 4DV5H 1G2SA 4ZQ3A 3U4ZA 3I4MG 3KF6B 1KABA 4XYQA 4POFA 2J7ZA 5I2XA 4YHHL 4DV7L 1WFQA 5LMNW 1A63A 1XJVA 3EN2A 4NXNQ 1CKNA 2OXPA 4A3MG 1IW7D 4K5XA 3VYSA 5JJKA 3S9WA 3H3VC 4K2KA 2F0EA 2UUBQ 4LFCH 1STHA 5NUCA 3HKSA 1HTPA 2BH2A 2OTJA 2R61A 2ANNA 1I4QA 3M7NA 1C4QA 4DV6H 4AYBG 3OTOL 3CW2C 3KFUA 1EQTA 3G71A 3NE5B 2Z8LA 3I4LA 4XQNA 3FAUA 3I7FA 3F2DA 3TRZA 1EIYB 2F0OA 1Q12A 1X54A 2R93B 1X3QA 2Z4IA 4KV6A 3VDYA 4PZ8A 1XRHA 4DAYA 1KLGD 2PZUA 2BA1A 4DV4Q 3PUYA 3DXJC 1ILQA 3NPPA 3QJYA 4JVZA 5CORA 2Q2UA 1GXDC 3EZJA 1SE8A 1UEBA 1SSOA 2N55A 1IBLQ 4L5SA 1I94H 4RHRA 2DN8A 1JJGA 4BA2I 2RDFA 4RAUC 4RKBA 4POGA 3Q24A 4JI0Q 1W6JA 1EY0A 2NYZD 2OQKA 3N6RA 3H94A 1N36L 1SFOB 1GOZA 1VQ9A 2YU9B 4ALPA 2B2YC 2LS01 2EVBA 2OWOA 2B2TC 3N52A 1SNMA 4CBVA 4UHVA 2CTLA 1GUWA 1I4GA 3HZXA 4B3RQ 4OO1I 4NZRM 4JI8Q 4LF7Q 1JQYD 1FYCA 5C4XG 2CW0C 3I55A 4GOPB 2BL5A 5JJLA 1UE6A 1X56A 1HFGA 4F87A 2YQRA 3NWSA 3GR5A 1FNUA 1J6QA 1YVCA 2A69C 4KMUC 4LFAQ 2K5HA 2X6GA 4ILWA 3PO2B 2F0TA 3TREA 3R8BA 2R92B 2K5WA 4LUVA 4DKAC 4JI4L 4OO1H 3LWEA 4KKTA 1Q46A 5EKLA 4RHSA 2Q2HA 3K5LA 2ZJPA 4B9XA 1D7QA 4X3UA 3K58A 3AEVA 1SYGA 4FO2A 2HQLA 5GADC 2Y0SE 3AQQA 4DV2L 2FJ2A 1FGUA 1PDQA 2QKIC 3FRPB 3FP9A 3DEPA 1U5KA 3H0GB 2UUBL 3NTHA 5IGFA 4JW0A 5BN5A 4K6DA 1STYA 1Z7TA 3ONAB 3K5NA 1X3PA 3HOYB 3M3YB 2J0TD 1U4MA 4A3DH 2OPUA 3SDZA 1Q7YC 3ULLA 3IRBA 1A2TA 3UDIA 3J7A5 4K0KQ 2EY1A 4CDCC 3V2TA 1WCMH 4LMQD 1RTNA 1D1KA 5M3MH 4B8TA 1JWMD 4QIWE 2UUAH 4G7OC 1HNZH 1PTOB 4BBSB 1F2MA 1UEAB 3RD4A 1ENFA 2Z6BA 4B8CD 2VY3A 4ME3A 2HH3A 2ANRA 5IT9W 1KAAA 3DEOA 2LF0A 1V1OA 4H0LC 1MHWC 1QZGA 5EPKA 5J3BA 1PH5A 1DOMA 3E9IA 4ZUJA 1DXMA 2FMCA 2PMZB 1K0RA 2RSOA 5EGTA 2IWHA 3MZ5A 4EVOA 2F3VA 1VIHA 4DV2H 2RHSB 1NMFA 4X65H 5BR8Q 2F4VL 1VQOA 4K8JA 4A3EB 2RHQB 4EQ5A 1VQ4A 4FF4A 5IP9G 4YHHH 4XYOA 1D6EC 1PH8A 4CDEC 3CCSA 1YHAA 4IO9A 1OXTA 1V9PA 3Q0AA 3HOYH 3S14B 2F0HA 4C3JH 1VQIA 4L8JA 1HNWQ 2BE5C 1IBLL 4J8QA 1TWCH 2R92G 1N9WA 3NBHA 3GTGH 2H5XA 3MXUA 1EFID 4A3JG 1MSGA 2JA8H 4DV3Q 2B2UC 4C2MH 3HOZG 2OF1A 2EYPA 1PFBA 2I07B 1S5BD 4JI3L 3CCMA 4DV6Q 2MQHA 1PH2A 1EY4A 1S40A 1ZZJA 2F0DA 3SK6A 1QVFA 3W5OA 4HIDA 2Q2IA 4V0BA 3S16H 4FDBA 1B9MA 2K05A 5C4HA 3A56A 3WOEA 1LTLA 1XTDA 3K7AB 4N8X1 1X3FA 2GA4B 3I70A 4KHZA 3DM3A 5EKKA 3OETA 2MO1A 1RDPD 2AWNA 4DV2Q 2CFMA 1SJED 4B3TL 4YCWA 1STAA 2KCCA 5C0XJ 4GOPA 5CV8A 4A3JH 3FDTA 5EQ0A 1IYUA 3Q6SA 1X55A 3ERSX 4P74A 3TQYA 2WB1E 1JOOA 1O80A 4C3JG 1SJHD 5EKIA 5J22A 2IHFA 2F4IA 1YEZA 1ZZKA 2CPMA 3HKZB 1EIFA 4JV5L 5E3FA 1PHJA 2B2YA 1STGA 1G6PA 2FMRA 1I6VC 2ZXRA 4DV1H 1LTID 1YNJD 1YJWA 2Q8IB 1X3EA 2AKWB 3AFQA 3P1HA 3V05A 2VXWA 4RGNA 3GTMB 2KUMA 2M9VA 3TMEA 3AYHB 4X62L 1JE4A 3D3RA 4JYAL 3BVMA 4TVAB 1TWHB 5IGBA 4PZ6A 2WAQE 1BXTA 1LT6D 2JK8A 2VW9A 4DFAA 2CTEA 5DT9A 1TY2A 1J4WA 1BCPD 1BBWA 2PYKA 1VQFA 2XWBB 1Q1BA 1RL2A 5M5WH 5DEHA 3GTQB 3GTLH 1WTOA 4A3GG 1E22A 3D4WA 3J80L 1K9MC 5KNCA 2QILA 3WDNA 1WYDA 2UXCL 4LF8Q 4ZKCB 2B63G 2F1MA 1IBML 1J5EQ 2RCNA 2B2WA 3T56B 1SR3A 1FNVA 1XPRA 1TT2A 4OWTB 4IOCA 2IW3A 4DV4H 2N49A 1PRTC 2GVAA 4KY6A 3S14H 4QMGA 2AHOB 4DV5L 3EBEA 2UU9H 4IUPA 5C3EH 2A5HA 4LF6H 2EJGC 3NTKA 4IFDJ 4NP5A 3OMCA 2ZTEA 4F8MA 4L5QA 1MSZA 1QB5D 1HZAA 1SYCA 3UDGA 2CPQA 2L11A 1JB7A 4FF3A 2K52A 1EWCA 4YY3Q 1IL2A 5I4DA 3F8TA 4HAEA 2PCFB 1KHIA 2K50A 3X3MA 3R93A 2PQAB 3B6YA 1I4XA 1I5FA 1PZID 3G48A 1HTLD 4PMBA 4LF5Q 1TWHH 2UXBH 4A3LH 5BN4A 1EY7A 2D2CC 3U9SA 5C0XH 1W3SA 5DAUA 4KY5A 3J80i 4DK6C 1B7YB 4UDUC 4WALA 4CKEA 4FP5D 5KNDA 3M7GA 1XMOH 2X6LA 4C3IB 3J7AK 2PW7A 4NMZA 1NMGA 4TKOB 1KDAA 4X3KA 4FNFA 2M2LA 3MFGA 5ELDA 1FL0A 1MIUA 4J6HA 1EY8A 4OGQC 5I2YA 5JEAH 1ENAA 1H9MA 5JEAG 4OCHA 5IWAQ 4B3RL 3U1KA 4EQOA 1VIGA 2RVLA 5C0XI 2F03A 3Q22A 4A3BH 3PUWA 4F7XA 1Q1EA 2FFMA 1A0IA 1GUOA 2JE6I 3BZCA 2R7DA 1EQVA 3CQZH 1G2TA 3RLNA 5E1FA 3AMUA 3GV3A 4JYAQ 2XRSD 2A1SA 2N78A 3PO3B 5K36G 4N9TA 3K59A 2B3GA 1GVPA 1B50A 1E2ZA 5M5XH 5JJIA 1LT5D 3CF5A 3TS2A 3S15B 3SHLA 4LF6L 3WWVA 1AN8A 4X64Q 1IYJB 1KRSA 3L2PA 5C44H 3S1NH 4OIJA 2KJXA 2KHJA 3VA7A 5JOBA 4DK3C 4HSVA 1TXYA 1IBKL 2UUCL 5C3EG 4DV0Q 2A68D 3HOUB 5CGKA 1NR4A 5JVG3 1IBMH 2ZJQA 2CQAA 4DR1L 4LF6Q 5CMDA 5GAHC 1G91A 2CH4W 4A3EH 3Q23A 1QUQB 4JBWA 4DV6L 1I3QB 4JI3Q 1KXLA 3PO3G 4YY3H 2B63H 1K3RA 3LGJA 4LF9H 1WI5A 2Z4HA 1WD0A 1PH1A 3MAQA 4RGMA 4DUZH 1EIGA 5C6AA 5FJ8G 5A35A 4BY7B 4B08A 3HOXH 1VBIA 3SB1A 3S2DH 2WAQG 1NNXA 3GQBA 2MPMA 1PTOH 2CKZB 1D5XC 5BR8L 3J80W 5H1SE 4JCVE 1HA6A 2HIXA 2VNUD 1SE2A 2CQOA 2RDHA 4YIJA 2LTLA 3QOLA 4HIOA 4BY1B 1QE6A 1NTGA 2JZXA 1F77A 4A3KH 5FOBB 1LLRD 2IJ0A 1N32H 4PQXA 1D5MC 4AQYL 2EIFA 1HNWH 3S1RH 4TSSA 1HNXL 3FHWA 2R6GA 3G6EA 4ULLA 3I0PA 5C3XA 3I90A 4X6AH 2XSCA 4G08A 1SDFA 5CR3A 3KLSA 4A3FG 3OSSD 2R3ZA 1GKHA 4GOPC 4NW2A 3A8JE 2DGRA 3I4MB 1TWCB 1XPOA 4L6TB 4LW1A 2EYOA 1NJIC 2F0MA 3BJUA 3VYRA 1B44D 1Z9FA 2XTIA 5GAEC 4WJ3M 4JVYA 2IT1A 1HNWL 4CKBA 1JMCA 5LMNQ 3HOWG 1HZBA 1FJGH 1T9HA 3PQIA 4YCVA 4JI7L 2E74C 5FK9C 4DN4M 3GTKH 4JI0H 4BBRH 5M5XB 3HEJA 1ET9A 2G9DA 3J81i 4DU9A 3K8AA 3T1YQ 1WTXA 1KLUD 1CA5A 2I5MX 1N8RC 3S16B 1AZQA 4CJ1B 2ID0A 1B3QA 4BY1H 1IBLH 3P75A 4K8IA 3RF2A 4CJ2C 4EGVA 4X64L 1M4VA 3HOUG 1Y1VH 3HGBA 1ET6A 1I4PA 4B3SL 1EWHA 2JA8G 4BA1I 1J8IA 3OOCA 2A1AA 3T1YH 2VB2X 2O5IC 1GUSA 1HCZA 1A15A 2A69D 1DD2A 1GHKA 3VR2A 1BQQT 1HR0Q 3HOYG 4DNRB 2IX0A 4R4OA 5GROA 3FMCA 4NXNL 3MXNB 5CV9A 1QWYA 4OX9L 3K5OA 4LFBQ 2G9HD 4KN7C 4JOIC 4NXNH 1LACA 2QA4A 1JOKA 2G5DA 2LXJA 4PV1C 2WV6D 4DAPA 1UWVA 3DWAA 1CUKA 2XGTA 1WTVA 4LFBH 1GUNA 1WTHA 4C1NK 4OX9Q 3A54A 1PTOD 1X4MA 1PZJD 1SEBD 1OXSC 3KF8B 1ICWA 1VQJA 3ND9A 5IIFA 2E5LH 5M3MG 3VR3A 4RGOS 2F0VA 4JG2A 1NXUA 1SEIA 3L3OC 3L0OA 4DNIA 4DV0H 3PF5A 1EEID 4GNXB 4DXGA 3GTQH 2KCTA 2VUMB 1Y1VB 3OTOQ 3G7LA 3KYHC 1CSPA 3HFZB 4DR3L 4A3IH 3PIO3 1BKBA 1E2WA 4IOAA 4OXPA 2A6HC 4H8AA 4IUUA 1ZYRD 3AU7A 4L63B 1PH9A 3J81L 1JT8A 1PYSB 1J5EH 1YJ9A 2NN6G 3SXHA 1IYVA 3OIQA 4DV5Q 4DV3H 3MFYA 1U4RA 1X0AA 1IW7C 1FKAH 1KRTA 1BF4A 3J81W 3AEVB 2YU9H 3GP7A 4JI8L 3GTKB 3E5SA 2E2DC 4QUFA 1ESRA 2Q8RE 4OO1G 1LTGD 4JI2L 3NWTA 3K5MA 5JVH3 1XNQH 1C0AA 3SGIA 2NTTA 4AH6A 2KHSA 2CTKA 3W2DA 2YV5A 3JAMc 3TEHB 2GVBA 1I50B 1EYCA 1N33L 2EDGA 4LFAH 1V8CA 1QVCA 3PO2H 3HOVG 4DV7Q 3URYA 1PH7A 4DR5L 1HQRD 2QW7A 4LAAA 5C4XH 4JI5L 2MO0A 2VQFQ 1R9TH 1B53A 2QEJC 2HD3A 4AIMA 4RA8A 2LKVA 4PMWA 4DA2A 4EQPA 4MTNA 4GLAC 4FJSA 2F52A 4KHPH 5COYA 2WAQB 1H95A 2ZQEA 2CVRA 1ZTGA 4A3BB 3TN2A 2FMMA 1PYWD 2RCFA 1LUZA 4QJFA 1AN7A 3RR5A 1HH2P 1CM9A 4QF4A 4DR7Q 3I4NH 1X6OA 4CDDC 1O7YA 4B3MQ 1GD7A 2UUAL 2UUCH 3GV6A 3TP5A 2IHEA 3H0GH 4C56C 3CC2A 5GAGC 3T1HH 2L0CA 3PCOB 3D0FA 4DR4H 3C1EA 3JAME 4LF4Q 3OMGA 4LF8L 4LJZC 2NVQH 1XYIA 4IFDG 2EXZA 4WJ4A 4PDBA 3NELA 2CWPA 1MKHA 4X62H 4LWCA 2JA6G 5FLMG 2B29A 4LFBL 4GN4B 4JVHA 1LT3D 3K0XA 3PSIA 2DJGC 1XMQL 2YTYA 4HR7B 1VQPA 3S17H 2NN6I 3S1MH 1FJGQ 2F0LA 4YHHQ 3BG3A 4A3MB 3BU2A 1N34Q 4JV5H 4NDXA 2V4DA 4JI6Q 4DR5H 4N8FA 4ZLTF 5IYDG 1BCPB 3M85A 3T13A 4LFAL 4XQJA 3T1YL 1G291 1BBXC 4KI0A 5E4XA 4QMFB 1KIXA 1VF5C 1HRJA 1I6HH 2R7FA 5KGUA 4BY7G 2PQEA 2KECA 4FYDA 4LF7L 2VQEH 3D4RA 2KCMA 4O42A 2L4NA 4XTCS 3NK9A 2ZM6L 1N34L 2BE5D 2BA0A 2B2UA 4C3HB 1SMXA 3F1ZA 3MA2B 1EL0A 4C3JB 3RZOH 1H9SB 1IKLA 1STNA 5HY6A 2FXQA 4HEDA 3UE1A 3GTGB 4P2CB 2K4KA 1Y8OB 4C2MB 1HHVA 2VQFL 4DAMA 1KL9A 5CV7A 3CC7A 1K8OA 4QL5A 1SYDA 1K83H 3RLOA 5LL6b 2E2IH 2K33A 2PMZE 2EYFA 2KHIA 4IPGA 1SBBB 1N33Q 5KIXA 2ALYB 4CHTB 4ZYSA 1PYBA 4NXML 2NTSA 3J7ZC 3K6OA 3I4OA 1L1OA 3RNUA 1N36Q 3HOZB 2G8YA 4KTAA 1I94L 5FLXE 4QIWB 2UU9Q 1X32A 2UXBQ 1D2BA 2D0PA 1I6HB 1UE1A 3I73A 3OW7A 1QNUA 3M4YA 3CCVA 2NVTH 2NZ1D 2IPKD 1SE4A 5IP7H 2UUCQ 2OEOA 4KN4C 4DR3Q 5M3FG 3V69A 3ZYYX 5IYCG 4JC0A 1LV9A 3C3LA 4X65Q 1Y1WH 1V1PB 4AYBE 3TP8A 3H15A 1KC8C 1HNZL 2WIIB 2NVXH 2K01A 4G57A 4A93H 2FFKB 3A8KE 1WTRA 1F9RA 2E2HH 4K5WA 3FKIH 3CRKC 5E4WC 3JAML 1XMQQ 2EPBA 4LF5L 5KYLA 1P16A 1SAPA 3UI2A 5FLXc 1HNZQ 4R4CA 3D4DA 4DR4Q 4KD3A 1ONLA 2LMCB 3GTOH 1SLJA 4PMCA 1PTOF 1U9RA 1WTWA 1CQVA 2VS1A 2R7ZH 5ELCA 2RF4A 3CMEA 5FO8B 2UUBH 1Y8PB 1XNRQ 5M5WB 4B3TH 1ASYA 2ICIA 4IALA 4BXXH 4UP8A 1VQEA 3PIP3 2B2VA 4GNXA 4GS3A 3IAYA 2VQFH 3TZDA 1SYBA 4A75A 3BS1A 4BS9A 5C4ZA 4JI0L 5AJ3Q 1U0LA 3M3YH 4K6LA 1QNKA 3MEHA 4P71A 1GM5A 3KF8A 1IZ6A 4EC5A 4JBKA 3SVMA 4G7HC 2K04A 4JI3H 4GKJH 3SEBA 4H13C 1HUNA 3PUVA 2H1EA 3NBHB 1F2LA 4IURA 2VUMG 3G4SA 2KCNA 1BBUA 4A3IB 3I56A 1GO3E 2E76C 1E7ZA 1YIJA 1L1OC 2CHBD 4B3ML 1N32Q 2L12A 2K5DA 3CAMA 1B2TA 5IGGA 1EZ8A 2C35B 2EY6A 3BDLA 1K8MA 4DV1Q 2DUDA 1WE8A 5IYDH 4BBSH 3QB3A 2JQOA 4CKCA 1L2FA 4R8IA 2M00A 2DGYA
chains in the Genus database with same CATH topology
3TP6A 1Q90A 2B2TA 4IPHA 3HOVB 3F2CA 3HOWB 3E6ZX 1XWEA 1S3OA 1CKNB 2PW5A 3DHQA 4C3IH 2EOTA 3GTPH 3TP7A 2N3SA 5EPJA 4DR6Q 3KLSX 3J81E 4GZYC 3W1BA 2EJFC 1EY5A 2UXBL 4HMIA 5A2QL 1T5XD 3K81C 1F9QA 1JR0D 1EY9A 3BDCA 1Y1WB 4IUNA 1O7IA 3EROA 4A3DB 1CSQA 1NY4A 1LTBD 5EAYA 4B3SQ 2MNAA 4NB3A 2R93H 3EJIA 5J39A 1B1ZA 1I4RA 4ZRZA 1XXGA 2Z1CA 4YWMA 4JBJA 1L0XB 3MHBA 3PUXA 3S17B 5D3DA 2E8GA 1K1GA 3C2PA 2P2RA 1HZ9A 5C4XB 3QIAA 4TQUS 2I5LX 1FGBD 2RBMA 2JA9A 1W6KA 4X66Q 1LT4D 4DK1A 4DV4L 1YBYA 4ME5A 5IYBG 3GTOB 2ATWA 1X65A 3J81c 3UDXA 3MTSA 2D9UA 3RN2A 2SNMA 2ZTCA 1SMYD 3HOVH 3PO2G 1KHMA 3KJPA 5CV6A 2LSSA 1GJXA 2R93G 3NSWA 3U4VA 5FO7B 4Q0FA 3GTPB 1BR9A 1DM0B 1A62A 3A7AB 5F2DA 4DK0A 2AQ1B 4PNYA 3MXPA 1TUAA 1EY6A 2ICEC 1VQNA 2HDMA 3GTJB 4HJAA 4UP7A 1RJTA 2K03A 4C3HH 3EFXD 3D6CA 1PRTD 5I9PA 1EQQA 1A3UA 1BCPF 4ZK9B 3VYTA 2CTFA 5LMNL 2MJHA 3R2TA 2TSSA 3HOXB 1PRTF 3STBD 1E1TA 5J1ZA 1EWIA 4IPDA 4Y52H 3D31A 2AMCB 4C1NI 1C7YA 4XQQA 1VQLA 4N9PA 3CCLA 2NN6H 2RSNA 2HH2A 1BCPC 3PF4A 2DY7A 4K2LA 4EX5A 5C5LA 4V190 1TWAB 1S5ED 4XT1B 3BVZA 2AUKA 4ABNA 5LL6S 5CBEE 1XPUA 4A3JB 1V1PA 3EQLC 4MNOA 2WFWA 1LTTD 2UUAQ 4R4IA 2QDBA 3T16A 2QEXA 4HN7A 4QY7A 4A3CH 2QNDA 1BDOA 3RLFA 3ZJYC 3A7LA 4KKSA 4H02A 3S24A 3GTJH 4S3SA 3RZOB 4BXXG 4GKKQ 3CKIB 2NVXB 3BZDB 1QCBD 3ERQA 1SN8A 2JA5H 2F0WA 1ZKOA 3A5UA 3UDFA 2E2IB 4DAYB 1LO5D 2SEBD 2Z6KC 5EJWA 3PIPA 1H9JA 1PH4A 1VDZA 2A73B 3G6JB 3CP0A 1EYDA 3TDQA 2IX1A 1VQAA 5G3LD 2K5NA 4PG3A 2XWJB 2EJMA 3P7JA 4DR7L 1TWAH 5CV5A 5JPNC 1F2ZA 3E0JA 4A93G 2D0OA 3PGZA 4GLVB 3E0EA 1D8LA 3KJOA 1YI2A 2HT1A 3CPFA 5E7NA 2KENA 2J4XA 4UPAA 2FINB 1EC6A 3W3AA 1EFWA 4DR2L 1DGSA 3M4OH 1CFMA 1O7LA 5FLXL 4IPCA 1LABA 4R4QA 4BBRG 3FVQA 4JI4Q 1SNOA 1BOSA 1G8ZD 3KDFB 3HG9A 1SYFA 2JYOA 3IFTA 3R3OA 1PTOC 2RKSA 3NQTA 3KLWA 1R4PB 4HJ5A 2ZXPA 3VKEA 1STEA 4X3TA 4DR2Q 1OTCA 3EVQA 2MHVA 2NB0A 1EQRA 4CJ0B 1CI3M 1JICA 3QOJA 2WKDA 3AFPA 4MIUA 1KTKA 1NR2A 4UAIA 4JI1Q 3H6MA 1EIHA 2GN5A 2AQ2B 2JJQA 1PRTB 3HKZE 4GLXA 1O78A 1I94Q 5IOCA 3IL8A 1TU2B 4X62Q 1JE5A 5C4JH 1XNRL 4G4KA 1XNQQ 3LX0A 2MUYA 2WB1B 4JI1L 3K0YA 2A74C 3KLRA 1GUTA 4R4TA 2SDFA 1LTRD 2NZHA 4GN5A 3ND8A 4AYBB 4IFDI 3Q8DA 4LNQA 1Z6HA 2DY8A 5IODA 3SR1A 2L55A 4DUYQ 2XN9C 4B9WA 3HOXG 2OTLA 4GKKL 3KBGA 1RF2D 1S72A 5DNFA 2UXDL 2IY5B 1CQFA 1PFNA 3S2DB 1TVXA 1BVSA 2AQ3B 3PMFA 1CT1D 3U58A 4H7BA 1B8AA 4DNTB 2HIVA 2O2LD 3OPOA 5JPMC 4YCUA 1ZZIA 3T51B 4M8AA 2O5JC 1UE5A 4MN3A 1NBWA 1EU4A 1D1IA 3HP3A 4YY3L 2UXCQ 2HHHL 3GTLB 1EYGA 4J1MA 4RCNA 5HURA 4IJLA 5FLMH 2SOBA 2JA6H 2QGQA 2KQ3A 2YTVA 2LXKA 2HUGA 3UE0A 4K0KL 1JCKB 4ZKBB 2CTJA 5C44G 3RZDB 2RA4A 1ZYRC 1AE3A 2A6EC 3VA5A 1TS5A 2BCOA 1KD1C 1AEXA 3CHBD 3JC66 2L15A 2L1BA 3NHHA 4HJ8A 2F3WA 4Y7NB 4QCLA 3A74A 1FVIA 2JEBI 4OONA 4K14A 3U50C 4A3BG 1IBKQ 1S5FD 2BOSA 5BN3A 5M5YH 4HTHA 2QF7A 1S5CD 2F0UA 1QOHA 2NVQB 4XDXA 1RCVD 3H3VI 3GDEA 3WOFA 5LMUQ 3FPPA 4HIMA 1PFSA 2F0KA 4HCEA 2B8GA 2SNSA 2PI2E 2I5HA 3J7YW 4LFCL 1UAPA 4KJNA 1U4PA 2YTXA 1QILA 4I65A 3S1RB 5C4JB 1RTOA 1SYEA 2JA6B 2F0JA 3C46A 4Q5VA 5C5MA 5C0XG 5IE8A 3KF6A 2IL8A 1YITA 3MXGA 5DM73 3RZDH 2A6HD 4A3LG 3DMUA 4WANA 1ZXTA 2KBNA 1E3PA 4A3FB 2EY5A 4HJ9A 3H91A 4LFCQ 4CGYB 3QO2A 2CWAA 2Y0SB 1SNPA 4L5TA 2EXDA 3U9OA 2KVMA 4F88A 1A2UA 1PZKD 2DNCA 1ASZA 5IGDA 1UUPA 3NTIA 1PV4A 2XVSA 1OXVA 2K5QA 4ODGA 2PI2A 1WTQA 2VZAA 3K57A 5M5YB 2K14A 4M1UB 4BWGB 5JJZA 1M8AA 1OO9B 2I0QA 4RH6A 1MJCA 4OWWB 2HHHQ 3DUZA 5D3IB 4A3IG 4APVA 1CHPD 4XIGS 5CYUA 2B2VC 2Q2TA 4PZ7A 5A2QE 4P72A 3ULJA 3S2HB 3HRZC 3D6WA 1XX8A 1CKMA 5HGQA 1I4HA 1VQGA 1WTPA 1Q8IA 4GKJQ 2E75C 4DUZQ 5DM63 2Z0SA 1VQ5A 3J7AF 4C3HG 1NCVA 3P20A 1N32L 1AZPA 1V43A 1TY0A 1VQMA 3CRLC 1ENCA 2PZTA 3M4OB 4X66L 2B63B 3R2IA 4KJOA 1Q3LA 4HSPA 1YHQA 2VB3X 4KLKA 2WP8J 1R4QB 3M4QA 2JP1A 1IBMQ 3HS0C 2K32A 1LTAD 2D62A 2IX3A 1M1KC 3IKJA 1DCZA 3J81j 2NVTB 1KAWA 3SE0A 3A5ZB 3TBIB 1HFNA 3H3VH 2MJ8A 1DOKA 4WFN3 2D5DA 1W2BA 2HDLA 3RN5A 1Q86C 4G7ZC 3S15H 2PQUA 4DUZL 4J15A 1VMPA 1CZWA 1MGSA 3ER0A 1YNXA 4RWSC 3SK4A 4HJ7A 2A6ED 2KEEA 1GUGA 4IUVA 4LF9Q 1HNXQ 5LHY1 1Y1VG 5C3WA 3HOUH 2I46A 2OQ0A 2V1CC 3ULPA 3FKIB 4FXGC 4OL7A 3GD7A 3BYTB 4ZAIA 1EUJA 3I3CA 2H4OA 2F0QA 1MJEA 5GQOA 1YZ6A 2E2JH 2KOLA 3NEMA 2OPVA 3M9BA 1QG7A 5KYIA 4FVMA 3NQIA 2OCEA 5ELBA 3F2UA 2L9HA 1B9NA 4IJHA 1ML0D 4O1NA 3CXCA 1HR0W 5LMUL 3PUZA 1WVLA 2F0SA 3ITPA 3CCJA 3TS0A 2ENBA 2R92H 5EBCA 5AJ3L 1FR3A 3KUPA 1ESFA 3I8ZA 1XNQL 3FPUB 1HZCA 4WJWA 5IP9H 4Z9CB 2VQEL 1TS3A 2Q8TA 2F0IA 5LL6X 1UNSA 1CZGA 1TQOA 4IUTA 4KK7A 3SK8A 3OSOA 1NSNS 3NP8A 2WKCA 1CHQD 1E0BA 1G6ZA 3OIPA 3SK5A 1DJRD 1H9SA 4FXKC 3QG1A 3I91A 5CBAE 2N88A 3NBIA 1VS0A 4DV3L 5K5PA 3V96A 2LY7A 4X65L 3S1QH 2MFIA 2ZJRA 4LK1C 2JA7B 1J5EL 2FHTA 2PZWA 4E6IA 3IFDA 1DTJA 2F0FA 5C3EB 3BDOA 5FJ8H 2JSOA 2EYMA 1WCMG 3DLLA 4RKLA 3LWUA 1X4NA 2E5LQ 1JWSD 1WCMB 1F9PA 4I7ZC 4OIKA 3CQZB 1JJCB 5D14A 1PA6A 5M3MB 3PO3H 1RD9D 2JVZA 5ELFA 3MXNA 4B3TQ 1UE7A 2ZTDA 2UXDQ 4L5RC 4A3EG 4DR1Q 4LF9L 1F2YA 4KKUA 4QQBX 4GNXC 1LTSD 4QUCA 4R1JA 5I6YA 4HIKA 3KDFA 4KD4A 4WORA 1GHJA 1VQ7A 3CU7A 4RCOA 1CA6A 2F0PA 1QZHA 4DAVA 1RIPA 1J9OA 3KK7A 2DNEA 2KA7A 3VR6A 3S1MB 2HQEA 4LF4L 1YNND 4IN3A 4OHJA 4JI6L 4KHPL 1TKWB 4NXMQ 2PQAA 3QWNA 1EU3A 2CW0D 1VQ6A 2B8FA 3KBXA 5K36H 1JORA 2C5CA 2WB1G 4IUQA 1VQDA 5IYCH 2BDOA 4KY7A 1KNEA 3I72A 5IP7G 1JWUD 2K7VA 4LUOA 4Y7NH 3BVGA 3DM1A 1VF7A 1TS2A 3L9AX 2AXYA 3A55A 2N8NA 5IY0A 1EZ6A 3MC0B 1JB3A 3MVVA 5FKAC 1E24A 1AP0A 4DXFA 1MSHA 1K73C 1P8LA 1IL8A 5CC4A 4KHPQ 4WRDA 3I2ZA 1TWGB 2NVYB 1JJ2A 3K7AH 5IT9E 4JBMA 4LUZA 1OXUA 5IGCA 2JA5G 4ID6A 4FF2A 4UY8C 4DPGA 5JEAJ 2K5VA 3D8GA 4ZUIA 2XRQD 3PIOA 1SNDA 3S2HH 1Q81C 1VQHA 2EZVA 1U4LA 3S1QB 1XMOL 2EYHA 1PH3A 1I3QH 5M3FB 4A3CG 1HUMA 4HMJA 4DR5Q 1WJJA 3T4AC 1FNWA 4FXDA 1V8QA 4GN3B 1HJPA 2EE1A 1O7ZA 4BY7H 3OWEB 3NUCA 3F2BA 1F9SA 2WINB 4H44C 5IT9c 3EA6A 3NXWA 1JC7A 3GTMH 2MGSA 3CPWA 1CTMA 3MEFA 3RMHA 1QUQA 3HKZG 4P75A 5JAVA 3X3NA 2A8VA 1PXUA 2TMPA 1M90C 2BDNA 1SRUA 2UU9L 1HPCA 4A3KB 1IKMA 1AE2A 5ISRA 5KEEA 3MWYW 4JK1C 1NUCA 1DZ1A 3BZKA 4A3GH 5IGEA 1A6XA 1V1QA 1PLFA 1I50H 1LM0A 3CMAA 4O0AA 1VCIA 2JA5B 1STBA 3H09A 2HCCA 4DV1L 2PY9A 3STBC 2K6AA 1R9TB 4A3MH 3CD6A 2E2JB 4IFDH 2NBFA 1DOLA 2HCIA 3C1FA 4EQNA 1ILPA 2K75A 3I4MH 2WACA 2X69A 1SNQA 2CTMA 3A0JA 1G51A 2EQSA 3H0GG 3PV0A 3JAMi 1BUVT 3I4NB 1SE3A 5I9OA 1TWFH 3I4NG 4MHEA 1SFOH 1AFPA 4RFBA 4QB4A 1Q82C 5IYBH 1PH6A 1YNNC 1L0WA 1C8CA 2JEAI 1MD2D 2NVYH 2AWOA 4XXEA 4P73A 1EYAA 5T1IA 1ZEQX 2ASBA 3J80c 2LFNA 2F3IA 1X9NA 1H9RA 4OWXB 4NKLA 3CC4A 2L5TA 3RUZA 1Q8KA 4QGUA 1QVGA 1WD1A 4RG1A 2PPBC 5T1GA 1S5DD 2JA7H 3CCQA 1HR0L 1KNAA 2EYLA 1SMYC 4JI2Q 4IQZA 1FD7D 1VQCA 1YNJC 4C3IG 1VQ8A 2NWGA 1CKOA 1MI2A 3HOZH 1WOCA 4YWKA 1PFMA 3M4PA 4MZ9A 3A8IE 5HGTA 4KHVA 2E3UA 3ICEA 1L0YB 3L7ZC 3TSSA 3J80E 3KOJA 4U68A 3OW2A 3BYYB 1D5ZC 4BBSG 5EBDA 5KRUA 4JI5Q 2RDGA 4GKJL 2PNHA 4IZ8A 1BO0A 2ZXOA 4XT3B 3T53B 5C44B 3S1NB 1IXRA 1AH9A 2ZM6Q 5ELOA 1OXXK 4R9WA 2VQEQ 1KDBA 2VUMH 2YYZA 3DWQA 5TSSA 4A93B 1Y69U 3O13A 4RGTA 3GO5A 2EY2A 1DONA 2KEDA 1K83B 2JXMB 5CV4A 1YJNA 1H9KA 1DYQA 3E9HA 4DR4L 1VMCA 3OHXC 1LYLA 4JV5Q 2NZOA 3CCRA 1XTCD 3T1HL 4DR6L 4O2DA 2XNAC 1T5EA 4JI7Q 1RKNA 1X3GA 4X3SA 2R7ZB 5IT9L 3NENA 1TWFB 2Y0SG 3FEWX 1PMRA 3TZUA 2R7ZG 4A4IA 1EOVA 1K8AC 2OT2A 3OYYA 1SXTA 3CCUA 4A3DG 1C9OA 2K28A 2E5LL 1WVNA 1IHZA 1Z47A 2PNRC 1L1OB 1NAPA 2RQXA 5G3LF 2NUCA 1JOQA 1NE3A 4AM3A 1VQBA 1TWGH 1XMOQ 1KQSA 5EPLA 3T1HQ 4RMFA 3J7AV 1QJOA 3K80C 3AB9A 3FKIG 4DGZA 4FF1A 5D65A 2ES2A 1B3AA 2B2WC 3K7UC 2JA8B 1Y8NB 1A3TA 1MBYA 2E2HB 1E1OA 1A8VA 2B39A 1E2VA 1J5KA 2VL6A 4LIJA 1Y1WG 2A19A 4BY1G 1TIID 2MP1A 4R8NA 1AW7A 1RODA 1FJGL 1K8GA 2AUJD 5M3FH 2F0NA 1HA5A 2CCZA 4NBQA 5KNBA 2BH8A 2JA7G 1A3VA 4DUYL 2Z6KA 1YHBA 3OWFA 2O4XA 4A76A 5FO9B 4TRDA 3HOWH 4DF7A 1KDCA 1B70B 4YWLA 2F0GA 1PVOA 1HQMC 2QCPX 4UP9A 3W1GA 3VR4A 1SROA 1CK1A 4JOIA 2C9OA 4NPSA 3DWPA 4BBRB 1EOTA 4K5VA 5I6WA 3VYUA 4HCSA 1DT4A 1TS4A 4A3FH 1II3A 1EEFD 1Y14B 2XIWA 2ZT9C 5M9OA 1TR5A 5AFWA 2EYJA 3CCEA 2A68C 4DV0L 1B4OA 1RHPA 1VQKA 1BNZA 1S4ZA 4A3GB 5ELNA 1HXYD 1C48A 3VR5A 5ELEA 2F4VQ 3LNNA 5DLQE 4U673 2PO4A 1SNCA 2K1BA 4AQYQ 5IWAL 3EIVA 4A3KG 1G2SA 4ZQ3A 3U4ZA 3I4MG 3KF6B 1KABA 4XYQA 5I2XA 2J7ZA 4POFA 4YHHL 4DV7L 1WFQA 5LMNW 1A63A 1XJVA 3EN2A 4NXNQ 2OXPA 1CKNA 4A3MG 1IW7D 4K5XA 3VYSA 5JJKA 3S9WA 3H3VC 4K2KA 2F0EA 2UUBQ 1STHA 5NUCA 3HKSA 1HTPA 2BH2A 2OTJA 2R61A 2ANNA 1I4QA 3M7NA 1C4QA 4AYBG 3OTOL 3CW2C 3KFUA 1EQTA 3G71A 3NE5B 2Z8LA 3I4LA 4XQNA 3I7FA 3F2DA 3TRZA 1EIYB 2F0OA 1Q12A 2R93B 1X54A 1X3QA 2Z4IA 4KV6A 3VDYA 4PZ8A 4DAYA 1KLGD 2PZUA 2BA1A 4DV4Q 3PUYA 3DXJC 1ILQA 3NPPA 3QJYA 5CORA 2Q2UA 1GXDC 1SE8A 1UEBA 1SSOA 2N55A 1IBLQ 4L5SA 4RHRA 2DN8A 1JJGA 4BA2I 2RDFA 4RAUC 4RKBA 4POGA 3Q24A 4JI0Q 1W6JA 1EY0A 2NYZD 3N6RA 2OQKA 3H94A 1N36L 1SFOB 1GOZA 2YU9B 1VQ9A 4ALPA 2B2YC 2LS01 2EVBA 2OWOA 2B2TC 3N52A 1SNMA 4CBVA 2CTLA 1GUWA 1I4GA 3HZXA 4OO1I 4B3RQ 4JI8Q 4LF7Q 1JQYD 1FYCA 5C4XG 2CW0C 3I55A 4GOPB 2BL5A 5JJLA 1UE6A 1X56A 1HFGA 4F87A 2YQRA 3NWSA 1FNUA 2A69C 1J6QA 1YVCA 4KMUC 4LFAQ 2K5HA 2X6GA 4ILWA 3PO2B 2F0TA 3TREA 3R8BA 2R92B 2K5WA 4LUVA 4DKAC 4JI4L 4OO1H 3LWEA 4KKTA 5EKLA 1Q46A 4RHSA 2Q2HA 3K5LA 2ZJPA 4B9XA 1D7QA 4X3UA 3K58A 3AEVA 1SYGA 4FO2A 2HQLA 5GADC 2Y0SE 3AQQA 4DV2L 2FJ2A 1FGUA 1PDQA 2QKIC 3FRPB 3FP9A 3DEPA 3H0GB 1U5KA 2UUBL 3NTHA 5IGFA 5BN5A 4K6DA 1STYA 1Z7TA 3ONAB 3K5NA 1X3PA 3HOYB 3M3YB 2J0TD 1U4MA 4A3DH 2OPUA 3SDZA 1Q7YC 3ULLA 3IRBA 1A2TA 3UDIA 3J7A5 4K0KQ 2EY1A 3V2TA 1WCMH 4LMQD 1RTNA 1D1KA 5M3MH 4B8TA 1JWMD 4QIWE 4G7OC 1PTOB 4BBSB 1F2MA 1UEAB 3RD4A 1ENFA 2VY3A 4ME3A 2HH3A 2ANRA 1KAAA 3DEOA 1V1OA 4H0LC 1QZGA 5EPKA 5J3BA 1PH5A 1DOMA 4ZUJA 3E9IA 1DXMA 2FMCA 2PMZB 1K0RA 2RSOA 5EGTA 2IWHA 3MZ5A 4EVOA 2F3VA 1VIHA 2RHSB 1NMFA 5BR8Q 2F4VL 1VQOA 4K8JA 4A3EB 2RHQB 4EQ5A 1VQ4A 4FF4A 5IP9G 4XYOA 1D6EC 1PH8A 3CCSA 3S14B 1YHAA 1OXTA 3Q0AA 1V9PA 4IO9A 3HOYH 2F0HA 4C3JH 1VQIA 4L8JA 1HNWQ 2BE5C 1IBLL 4J8QA 1TWCH 2R92G 1N9WA 3NBHA 3GTGH 2H5XA 3MXUA 1EFID 4A3JG 1MSGA 2JA8H 4DV3Q 2B2UC 4C2MH 3HOZG 2OF1A 2EYPA 1PFBA 2I07B 1S5BD 4JI3L 3CCMA 4DV6Q 2MQHA 1PH2A 1EY4A 1S40A 1ZZJA 2F0DA 3SK6A 1QVFA 3W5OA 4HIDA 4V0BA 2Q2IA 3S16H 1B9MA 2K05A 5C4HA 4FDBA 3A56A 3WOEA 3K7AB 1LTLA 1XTDA 1X3FA 2GA4B 3I70A 4KHZA 3DM3A 5EKKA 2MO1A 1RDPD 2AWNA 4DV2Q 2CFMA 1SJED 4B3TL 4YCWA 1STAA 2KCCA 5C0XJ 4GOPA 5CV8A 4A3JH 3FDTA 5EQ0A 1IYUA 3Q6SA 1X55A 3ERSX 4P74A 3TQYA 2WB1E 1JOOA 1O80A 4C3JG 1SJHD 5EKIA 5J22A 2IHFA 2F4IA 1YEZA 1ZZKA 3HKZB 1EIFA 4JV5L 5E3FA 1PHJA 2B2YA 1STGA 1G6PA 2FMRA 1I6VC 2ZXRA 1LTID 1YNJD 1YJWA 2Q8IB 1X3EA 2AKWB 3AFQA 3P1HA 3V05A 2VXWA 4RGNA 3GTMB 2KUMA 2M9VA 3TMEA 3AYHB 4X62L 1JE4A 3D3RA 4JYAL 3BVMA 5IGBA 1TWHB 4TVAB 4PZ6A 2WAQE 1BXTA 1LT6D 2JK8A 2VW9A 4DFAA 2CTEA 1J4WA 1TY2A 1BCPD 2PYKA 1BBWA 1VQFA 2XWBB 1Q1BA 1RL2A 5M5WH 5DEHA 3GTQB 3GTLH 1WTOA 4A3GG 1E22A 3D4WA 3J80L 1K9MC 5KNCA 2QILA 3WDNA 1WYDA 2UXCL 4LF8Q 4ZKCB 2B63G 2F1MA 1IBML 1J5EQ 2RCNA 2B2WA 3T56B 1SR3A 1FNVA 1XPRA 1TT2A 4OWTB 4IOCA 2IW3A 2N49A 1PRTC 4KY6A 2GVAA 3S14H 4QMGA 2AHOB 4DV5L 3EBEA 4IUPA 5C3EH 2A5HA 2EJGC 3NTKA 4IFDJ 4NP5A 3OMCA 4F8MA 2ZTEA 4L5QA 1QB5D 1HZAA 1SYCA 3UDGA 2CPQA 2L11A 4FF3A 1JB7A 2K52A 1EWCA 4YY3Q 1IL2A 5I4DA 3F8TA 4HAEA 2PCFB 3X3MA 1KHIA 2K50A 3R93A 2PQAB 3B6YA 1I4XA 1PZID 4PMBA 1I5FA 1HTLD 3G48A 4LF5Q 1TWHH 4A3LH 5BN4A 1EY7A 2D2CC 3U9SA 5C0XH 1W3SA 5DAUA 4KY5A 3J80i 4DK6C 1B7YB 4UDUC 4WALA 4CKEA 4FP5D 5KNDA 3M7GA 2X6LA 4C3IB 2PW7A 4NMZA 1NMGA 4TKOB 1KDAA 4X3KA 4FNFA 2M2LA 3MFGA 5ELDA 1FL0A 1MIUA 4J6HA 1EY8A 5JEAH 4OGQC 5I2YA 1ENAA 1H9MA 5JEAG 5IWAQ 4B3RL 3U1KA 4EQOA 1VIGA 2RVLA 5C0XI 2F03A 3Q22A 4A3BH 3PUWA 4F7XA 1Q1EA 1A0IA 1GUOA 2JE6I 3BZCA 2R7DA 1EQVA 3CQZH 1G2TA 3RLNA 5E1FA 3AMUA 3GV3A 4JYAQ 2XRSD 3PO3B 2N78A 5K36G 4N9TA 3K59A 2B3GA 1GVPA 1B50A 1E2ZA 5M5XH 5JJIA 1LT5D 3CF5A 3TS2A 3S15B 3SHLA 4LF6L 3WWVA 1AN8A 4X64Q 1IYJB 1KRSA 3L2PA 5C44H 3S1NH 4OIJA 2KJXA 2KHJA 3VA7A 5JOBA 4DK3C 4HSVA 1TXYA 1IBKL 2UUCL 5C3EG 4DV0Q 2A68D 3HOUB 5CGKA 1NR4A 5JVG3 2ZJQA 2CQAA 4DR1L 4LF6Q 5CMDA 1G91A 5GAHC 4A3EH 3Q23A 1QUQB 4JBWA 4DV6L 1I3QB 4JI3Q 1KXLA 3PO3G 2B63H 1K3RA 3LGJA 1WI5A 2Z4HA 1WD0A 1PH1A 3MAQA 4RGMA 1EIGA 5C6AA 5FJ8G 5A35A 4BY7B 4B08A 3HOXH 3S2DH 2WAQG 3GQBA 2MPMA 1PTOH 2CKZB 1D5XC 5BR8L 1HA6A 4JCVE 5H1SE 2HIXA 2VNUD 1SE2A 2RDHA 2CQOA 4YIJA 3QOLA 4HIOA 4BY1B 1QE6A 1NTGA 2JZXA 1F77A 4A3KH 5FOBB 1LLRD 2IJ0A 4PQXA 1D5MC 4AQYL 2EIFA 3S1RH 4TSSA 1HNXL 3FHWA 2R6GA 3G6EA 4ULLA 5C3XA 3I90A 4X6AH 2XSCA 1SDFA 5CR3A 3KLSA 4A3FG 2R3ZA 1GKHA 4GOPC 4NW2A 3A8JE 2DGRA 3I4MB 1TWCB 1XPOA 4L6TB 4LW1A 2EYOA 1NJIC 2F0MA 3BJUA 3VYRA 1B44D 1Z9FA 2XTIA 5GAEC 4WJ3M 4JVYA 2IT1A 1HNWL 4CKBA 1JMCA 5LMNQ 3HOWG 1HZBA 1T9HA 4YCVA 4JI7L 3GTKH 2E74C 5FK9C 4DN4M 4BBRH 5M5XB 3HEJA 1ET9A 2G9DA 3J81i 4DU9A 3K8AA 3T1YQ 1WTXA 1KLUD 1CA5A 3S16B 2I5MX 1N8RC 1AZQA 4CJ1B 2ID0A 4BY1H 3P75A 4K8IA 4CJ2C 4EGVA 4X64L 1M4VA 3HOUG 3HGBA 1Y1VH 1ET6A 1I4PA 4B3SL 1EWHA 2JA8G 4BA1I 1J8IA 3OOCA 2A1AA 2VB2X 2O5IC 1GUSA 1HCZA 1A15A 2A69D 1DD2A 1GHKA 3VR2A 1BQQT 1HR0Q 3HOYG 4DNRB 2IX0A 4R4OA 5GROA 3FMCA 4NXNL 3MXNB 5CV9A 1QWYA 4OX9L 3K5OA 4LFBQ 2G9HD 4KN7C 4JOIC 1LACA 2QA4A 1JOKA 2LXJA 4PV1C 2WV6D 4DAPA 1UWVA 3DWAA 1CUKA 2XGTA 1WTVA 1GUNA 4C1NK 4OX9Q 3A54A 1PTOD 1X4MA 1PZJD 1SEBD 1OXSC 3KF8B 1ICWA 1VQJA 3ND9A 5IIFA 5M3MG 3VR3A 4RGOS 2F0VA 4JG2A 3L3OC 3L0OA 4DNIA 3PF5A 1EEID 4GNXB 4DXGA 3GTQH 2KCTA 2VUMB 1Y1VB 3OTOQ 3G7LA 3KYHC 1CSPA 3HFZB 4DR3L 4A3IH 3PIO3 1E2WA 1BKBA 4IOAA 4OXPA 2A6HC 4IUUA 1ZYRD 3AU7A 4L63B 1PH9A 3J81L 1JT8A 1PYSB 1YJ9A 2NN6G 3SXHA 1IYVA 3OIQA 4DV5Q 3MFYA 1U4RA 1IW7C 1KRTA 1BF4A 3AEVB 2YU9H 3GP7A 3GTKB 4JI8L 3E5SA 2E2DC 4QUFA 1ESRA 2Q8RE 4OO1G 1LTGD 4JI2L 3NWTA 3K5MA 5JVH3 1C0AA 3SGIA 2NTTA 4AH6A 2KHSA 2CTKA 3W2DA 2YV5A 3JAMc 3TEHB 2GVBA 1I50B 1EYCA 1N33L 2EDGA 1QVCA 3PO2H 3HOVG 4DV7Q 3URYA 1PH7A 4DR5L 1HQRD 4LAAA 5C4XH 4JI5L 2MO0A 2VQFQ 1R9TH 1B53A 2QEJC 4AIMA 4RA8A 2LKVA 4PMWA 4DA2A 4EQPA 4MTNA 4GLAC 2F52A 5COYA 2WAQB 1H95A 2CVRA 1ZTGA 4A3BB 3TN2A 2FMMA 1PYWD 1LUZA 4QJFA 3RR5A 1HH2P 1CM9A 4QF4A 4DR7Q 3I4NH 1X6OA 4B3MQ 1O7YA 1GD7A 2UUAL 3GV6A 3TP5A 2IHEA 3H0GH 4C56C 3CC2A 5GAGC 2L0CA 3PCOB 3D0FA 3C1EA 3JAME 4LF4Q 3OMGA 4LF8L 4LJZC 2NVQH 1XYIA 4IFDG 2EXZA 4WJ4A 3NELA 2CWPA 1MKHA 4LWCA 2JA6G 5FLMG 2B29A 4LFBL 4GN4B