2JE6I

Structure of a 9-subunit archaeal exosome
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
215
structure length
207
Chain Sequence
QEIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKSIFVANNGRIWAFSEEILIEAIRKIENESHIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA Channelling by the Archaeal Exosome.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
total genus 39
structure length 207
sequence length 215
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2je6I01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2je6I02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2je6I03
2HH2A 3KF6B 3A0JA 1YHAA 3RLFA 3M4QA 4R4OA 5C3EG 4A3EG 2UXCQ 1GVPA 3S1QH 3CC4A 1ZZKA 3S16H 4R4CA 5GAGC 3I55A 1Q81C 1VQDA 2AWNA 2YTYA 3M9BA 2FMRA 1X56A 3LNNA 4JI6Q 1B9MA 4DPGA 4LF7L 1Z7TA 3F2CA 4B3ML 4NBQA 2JA6H 2A8VA 1GUGA 4DR5L 3OOCA 1GHJA 1Z9FA 1U5KA 4DUZL 1G291 1K0RA 4YHHQ 1IL2A 3PUYA 1UEBA 2N78A 4QL5A 3J7ZC 2MNAA 4WANA 4JVHA 3P20A 4DNTB 1TWCH 2R6GA 3RR5A 1JB7A 3CCRA 4QQBX 3KLWA 5IYCG 1Y8OB 3U58A 4LFCQ 4GKKQ 1H9SA 4B3RL 4KHPQ 3NBHB 1VQIA 3K0XA 3J81j 3BU2A 1YHBA 1QVFA 3CQZH 4JI5Q 2WP8J 4L5QA 1YNNC 1YJWA 1ZTGA 4A3JH 1PVOA 1AH9A 1U0LA 5LMUQ 1FYCA 5JEAG 1MIUA 2KCMA 1I5FA 2YV5A 4IPDA 4BXXG 1WVNA 1DGSA 2HQLA 2UU9L 3GTJH 4BY7H 4JI4L 5M3FH 2E3UA 1NMGA 3CCQA 2K7VA 1KAWA 2RF4A 1FVIA 4MTNA 3TREA 1T9HA 4IO9A 4ALPA 3T1HQ 2E2JH 4AH6A 1UE7A 1EWIA 5IP7H 2PQUA 1H9KA 1VQBA 3TEHB 1LM0A 3HOVG 4TQUS 4OGQC 2CWAA 4Y7NH 1L2FA 2K4KA 4HJ5A 1KQSA 4LW1A 1WI5A 4NB3A 4Y52H 2YTVA 4LF5L 3CF5A 2AUKA 2ASBA 1VQCA 4BY7G 3FP9A 4UPAA 4LF8Q 2YQRA 1HZAA 1VF5C 1X65A 3MEFA 4LK1C 5DLQE 3K7AH 2Q2HA 4IJLA 2YYZA 4LWCA 3W1BA 1VQOA 2NZOA 2IT1A 2KHJA 4IPCA 1TWHH 1GUSA 4A3IG 1HR0W 4DV5Q 2EIFA 2VUMG 1CUKA 2PI2E 4JOIC 5A35A 4OX9L 2E74C 2OTLA 4DV2Q 2AUJD 1K8MA 2JE6I 2WFWA 2Z6KC 4POFA 3HOUH 3G71A 4A3CH 1HZCA 5KNDA 4X62L 4KKSA 2UUAL 4J15A 1XNQL 5ELOA 2I0QA 1SMXA 2O5IC 2UUCQ 3NENA 3LWUA 4IFDH 1Z6HA 2R7DA 3G4SA 3H94A 1PMRA 1TU2B 2Q2UA 1Y1VG 3HKZE 1B9NA 5C0XI 1IBML 2CCZA 4WJ3M 5IYBH 3VR4A 1A0IA 3CCJA 1YNXA 4YWLA 4DV7Q 3KLRA 4GZYC 4NPSA 4YHHL 3GD7A 1CTMA 2E75C 1E7ZA 2AHOB 2LXJA 2V1CC 3HKZG 1VQ6A 4YWMA 5AJ3L 2V4DA 2LSSA 3A8JE 3AFPA 1H9MA 5IP7G 4JBKA 1L1OB 4GOPA 2E2IH 1OXXK 3MXNB 4LF6Q 1Q86C 4OWWB 2DN8A 2F4VQ 2JXMB 2NN6I 2A19A 4JI1Q 4HJ7A 2ALYB 3BZCA 1O7IA 4A93G 1QUQA 3PSIA 2N49A 2ZJQA 5EAYA 2XTIA 2H5XA 1VQHA 4MZ9A 4AIMA 1EIYB 5BN4A 1V8QA 3VR5A 4DR2Q 3NEMA 1N8RC 2R92G 4JG2A 3D0FA 4YY3Q 3I4MG 1N32Q 1LABA 4BBRG 5C0XG 2K14A 4BA1I 1EFWA 4GKJQ 1WCMG 2K5HA 5IP9G 4IOCA 2CPQA 4JV5Q 1JE5A 4YCUA 5LMNL 5IYCH 3EQLC 4C3JH 4GN3B 1X54A 3KDFA 4K0KQ 1GUNA 1YBYA 5BN3A 1D8LA 1SMYC 2F3IA 3UE1A 4DR4L 2QNDA 3CXCA 2K33A 2K32A 1ZKOA 2R93G 2K5VA 1Q1EA 4OXPA 4LFAQ 2UUBQ 2CTLA 3T1YL 1AE3A 2EJGC 5IY0A 3E9HA 2JEAI 3M4YA 1RIPA 5M5WH 5C0XJ 3KJOA 2JEBI 1L0WA 1BBUA 1BDOA 4QMFB 1GJXA 2PQAB 3CMEA 1B70B 2D0OA 3G48A 3PUVA 5GADC 1G51A 2JA8G 1KHIA 3SDZA 1Q12A 4GN4B 4JBWA 4QIWE 3HOZG 3D4RA 4LFCL 4IQZA 4DV2L 4JVYA 2VQEQ 5H1SE 1LTLA 1QVCA 2BH8A 1YJ9A 3TZUA 1J5EQ 4L5TA 1PH7A 2GN5A 2BA1A 4H44C 3CCLA 3I4NH 2I5LX 3GTOH 2CTKA 3I4LA 3VR6A 4H13C 2JA8H 3CD6A 1ZZJA 1GUTA 3G6EA 4NXML 4I7ZC 4JI0L 5C44G 1VQLA 4PV1C 4JI4Q 2VL6A 1OXTA 4OO1G 3B6YA 2A1AA 4DV0L 1Y1WH 1KHMA 1YI2A 4IPHA 3DLLA 1PV4A 1RL2A 4TVAB 3CCMA 1M1KC 3U50C 3CMAA 4A3BG 5FJ8H 3CC2A 2MO1A 3KFUA 1W2BA 5IWAL 2Z0SA 3T53B 1YIJA 4C2MH 1X55A 4LF9Q 1O78A 3W1GA 4DR1L 1Q46A 1CSPA 2HT1A 1JJGA 4R4QA 4DR3Q 3PO3G 5JJIA 2Y0SE 2P2RA 2B8GA 4A3FH 4JI7L 3AYHB 4DUYL 5KNBA 1N34Q 3GTGH 3CRKC 3WWVA 4A75A 5JJKA 4BBRH 3OW7A 1DCZA 4KN4C 3HOWH 4PZ7A 4GLVB 2LXKA 1QVGA 4RCNA 1EIFA 1J4WA 3KOJA 2ZT9C 2BE5D 2QF7A 3CPWA 1CSQA 1NMFA 2KCTA 3F8TA 1DTJA 5J3BA 1BVSA 4PZ6A 4A3MG 4YCWA 4JI3Q 1IZ6A 4X6AH 2CTJA 2CTFA 4LUOA 3PO3H 1PH5A 5K36H 2A68C 1FJGQ 1VQAA 3CCSA 4LIJA 2AXYA 3ULLA 4DAMA 2YTXA 2F52A 4X62Q 2UUAQ 1MJEA 3ULPA 2JA5G 2B63G 2PI2A 3GTLH 1FR3A 4YCVA 3T1YQ 3FKIH 3EN2A 2IX1A 3TS2A 2WAQE 1IW7D 3KJPA 3VDYA 1AE2A 3AQQA 4X64L 1VQ4A 2ATWA 1X3FA 3PF5A 1FGUA 3TRZA 4LJZC 3S1RH 4R1JA 5BR8Q 1Y1VH 4G7ZC 1E24A 4OWXB 4X65L 1WJJA 5M3MH 1EQRA 3IRBA 5C4XG 1YZ6A 3J81i 1HNXQ 3KDFB 4DV3Q 3T56B 1OTCA 4P73A 4LF4L 1VQ5A 4A3JG 2RHSB 4LF6L 4LNQA 2D5DA 2CFMA 2F4VL 1WE8A 2PNHA 3A5ZB 1KC8C 1LUZA 1EWHA 3S1NH 4JI1L 4JCVE 3U1KA 5KNCA 3K7UC 2B29A 3A7AB 5HGQA 2IHFA 1XMOL 1N9WA 1X6OA 1VQ9A 1A8VA 1KL9A 1JJCB 4HIDA 1N32L 3PO2H 1UWVA 2JA6G 4TKOB 4KLKA 3UDFA 1E1TA 1HR0Q 4X66L 4BBSG 4DR6L 1MKHA 1X4MA 4G7OC 2HHHL 3I56A 1Z47A 3STBD 4DK6C 1EC6A 2IHEA 1E1OA 2DUDA 2GVBA 3CRLC 2HIVA 1W3SA 3UDXA 1XPRA 2UXDL 4DR4Q 3HFZB 2VZAA 4WJ4A 4DV1L 3FMCA 4O0AA 1TWAH 3OTOQ 3RZOH 3VKEA 1XMQQ 1A6XA 5JJLA 3EIVA 1VCIA 2PPBC 1PYSB 4UP8A 3UE0A 4DR5Q 3GO5A 3KF6A 1GO3E 4IOAA 4WALA 2NN6G 1KRSA 1YHQA 3JAMc 3K81C 3F2BA 2CTMA 1NTGA 3HOXG 3K8AA 1YJNA 1VQKA 5M3FG 3I4MH 4OX9Q 4JYAL 3HGBA 1PYBA 4LFBQ 1E2VA 4IFDJ 2JA7G 2JA7H 4JC0A 2R7ZH 5JEAH 1NJIC 1Y8PB 1SE8A 3Q8DA 4APVA 2UUCL 4B3TL 4QY7A 2A6EC 3N6RA 3PUXA 2MQHA 3M4OH 4DKAC 2NN6H 2K50A 5C4JH 1UE5A 2MFIA 2VNUD 1IXRA 2DGRA 1QJOA 4P72A 2NVYH 5FLMG 1SRUA 1HNWQ 1Y69U 3S15H 1PFSA 4ME3A 3PF4A 3MXUA 1VQGA 1TUAA 4AYBE 1CI3M 1SROA 3KYHC 1NBWA 2XGTA 2K5NA 1CKOA 3L7ZC 4X65Q 2DGYA 1E22A 4NXNL 2L5TA 1YNJC 2A6ED 3F2DA 3CCUA 1HNXL 3H3VI 2KA7A 4BBSH 1IW7C 1VIHA 2WB1E 1D7QA 2EJFC 1GUOA 1E2ZA 3TS0A 4LF4Q 3PO2G 1GD7A 4IJHA 2OWOA 2RHQB 5IWAQ 4GKKL 4B3RQ 4UY8C 4KHPL 5GAHC 4LF8L 5LMNW 3ERSX 1MJCA 1A63A 1DT4A 4XIGS 3U4VA 1IYVA 1GKHA 1Y14B 3K80C 1Y8NB 3HOYH 3HOYG 4G7HC 5FLXc 2ZM6L 1C9OA 1WYDA 4DUYQ 1C7YA 2VUMH 2UXBL 3MFYA 4BA2I 2N8NA 5C0XH 3RN5A 2EVBA 1CKMA 2WAQG 3AB9A 3M7NA 1BKBA 5IYDG 1HNZQ 1VQJA 5E7NA 4A3KH 1H9SB 1ONLA 4AYBG 3ER0A 4PG3A 1Q82C 3U4ZA 1HQMC 1TXYA 4JI2Q 4HIKA 3T1HL 2I5MX 2IY5B 2Y0SG 3ND8A 1Q1BA 4JI3L 1XNQQ 1DXMA 1GM5A 4A93H 2BL5A 4B8TA 3GDEA 2UUBL 3RNUA 4LFAL 2BH2A 1CKNA 4QJFA 3STBC 4A76A 1C0AA 1PH3A 2UXDQ 5M5YH 2JVZA 3OPOA 4DV1Q 1ZZIA 3J80i 1IBMQ 1H95A 3T51B 2Q2TA 3RLOA 2NVQH 1A62A 1N33L 2BA0A 2JA5H 1ZYRC 4JK1C 4EQ5A 4JI6L 2C35B 4R4TA 1G6PA 1WFQA 3AFQA 1V1QA 5IT9c 4H02A 1WOCA 4DAYB 3CP0A 1PH4A 1HJPA 1K8OA 5BR8L 1ASZA 4DV6Q 3QG1A 2KENA 4OWTB 3J81c 3A8KE 3A74A 1BBWA 3H15A 1EQQA 4YWKA 1PH1A 1EYGA 4BXXH 3OYYA 4LFBL 1I6HH 1N36Q 4B3SL 3AEVB 1HPCA 1PH8A 1E3PA 1HZBA 1L1OC 2CWPA 4OO1I 3S17H 2D62A 3M4PA 4B3TQ 3PCOB 1SR3A 2AMCB 2YU9H 4JI5L 4A3CG 3HOUG 4JI0Q 4DR2L 4O2DA 2EDGA 1IBLL 2CKZB 3ULJA 3BJUA 5M5XH 2GVAA 1L1OA 4GOPB 4AM3A 3DM3A 2E5LQ 2HIXA 1KRTA 3CCVA 1S72A 4DR7Q 5GQOA 1VQ8A 4A3BH 3A8IE 2PQAA 1Q90A 2HH3A 1YITA 5C4XH 5M3MG 4DR6Q 3E9IA 2EXDA 1I94Q 2O5JC 1HTPA 2A68D 1JJ2A 2HHHQ 3H0GH 2ES2A 2A6HD 4HR7B 4AQYL 1Y1WG 2PMZE 3UDGA 1VQMA 3CPFA 2AKWB 1NY4A 3PIPA 2NVXH 1K9MC 4HJAA 3M3YH 4IFDI 5C3EH 3L2PA 1T5EA 3HOVH 2JA9A 1H9JA 2VW9A 4KMUC 1XMQL 3NE5B 4UP7A 1J5KA 1S3OA 2B63H 4RMFA 4GNXA 1EUJA 1CFMA 2JJQA 3HKSA 5ELNA 2VQFL 1XPOA 1QZHA 1PA6A 4L5SA 1Q7YC 1J6QA 1KD1C 1K8GA 4BY1H 3PUZA 4A3DH 4JYAQ 4A4IA 2F1MA 4A3MH 3IFTA 2VQEL 3I72A 2BDOA 2Z6KA 1FJGL 3AEVA 2UXCL 1PH9A 1K73C 3PV0A 2ZTCA 3QJYA 2DNEA 4FDBA 2B8FA 5LMNQ 1X3EA 2E8GA 2KBNA 2DNCA 1EOVA 4JI8L 3SGIA 4K0KL 1K1GA 2QEXA 2JQOA 3CC7A 4POGA 4DV4L 1QUQB 1KXLA 4GLXA 2D2CC 2PCFB 1UE1A 3A5UA 4A3FG 1PH6A 1IBKQ 3H3VH 4LF7Q 1VS0A 3D31A 2ZTEA 4RG1A 5GROA 2JZXA 1FL0A 3RLNA 1YEZA 2EJMA 1XNRQ 1VQFA 4HIMA 1JT8A 1VIGA 3CAMA 1TKWB 3M85A 2A69D 1IYUA 3J7A5 4DNIA 3BDOA 3DXJC 3V69A 4PZ8A 5FJ8G 5K36G 3PUWA 1I3QH 1V9PA 4KI0A 4DV7L 4DV6L 3BZKA 2N3SA 4PMWA 4LF9L 1CKNB 4L5RC 3GTQH 1K83H 5AJ3Q 3I2ZA 1N36L 5HY6A 4KKTA 1B8AA 4B3SQ 2R7FA 1X9NA 1X4NA 5LMUL 2R92H 2K52A 4P71A 3GTPH 2CW0C 2K75A 3HOWG 4A3EH 1XMOQ 3EBEA 1QZGA 1SLJA 4GLAC 4JBJA 1I6VC 4C3IH 1IBLQ 2KCCA 2OCEA 2QGQA 2FXQA 3PIOA 2Q8IB 4BY1G 4HJ9A 3VR2A 3ZJYC 1JMCA 4A3DG 2ANRA 1K8AC 4X66Q 4NXMQ 4DK3C 2PY9A 3KF8B 4R4IA 3HOZH 4YY3L 3GTKH 4A3LH 4DR7L 4L8JA 2I5HA 2A69C 3BG3A 4QGUA 2ZJRA 1S40A 4JBMA 4GNXC 4JI2L 3IKJA 3E0EA 4DNRB 1IYJB 4KN7C 4JV5L 2UXBQ 3LGJA 3SE0A 1GHKA 2NVTH 1P8LA 1KIXA 2OPUA 4OO1H 3H0GG 2QA4A 1ASYA 4DK0A 1XTDA 1SFOH 2ANNA 5C44H 1TWGH 1X3GA 1OXVA 3FKIG 4B3MQ 3VR3A 3S24A 1VQ7A 3L0OA 1R9TH 2E2HH 3RZDH 3ICEA 4A3GG 1N33Q 1UE6A 4A3KG 2CTEA 4LUVA 4DUZQ 4P75A 2VQFQ 1HH2P 4LUZA 5IYDH 3QIAA 4HIOA 1VF7A 4DV5L 1NE3A 3I4OA 2OTJA 3WDNA 3J80c 1Q8KA 2NZHA 1I50H 3UDIA 1WCMH 1DD2A 4C3HH 2OQKA 3RN2A 1OXUA 3I73A 3GQBA 3ND9A 2Q2IA 4JOIA 4OONA 4A3IH 3CW2C 3S1MH 2L15A 4JI8Q 3S2HH 2E76C 3W3AA 3GTMH 3FPPA 1J5EL 1VQEA 2LMCB 4DV4Q 1VQPA 4GOPC 1P16A 2UU9Q 1M90C 1E2WA 3U9SA 4IPGA 5GAEC 1IBKL 1K3RA 5JEAJ 2A6HC 2WB1G 2OPVA 3TQYA 1PH2A 1HR0L 2CQOA 2RCNA 3FHWA 1XNRL 2R93H 2OQ0A 4H0LC 2B3GA 3W5OA 5IE8A 4NXNQ 2MO0A 4X64Q 2E5LL 1HZ9A 2VY3A 4GN5A 4DV0Q 3OW2A 3S14H 4A3GH 1OXSC 5FLMH 1HNWL 2VS1A 3S2DH 1I94L 2JK8A 2PNRC 4P74A 2ZJPA 1VQNA 1VDZA 5IP9H 3VA7A 2KHIA 4GS3A 3OTOL 1V43A 4DV3L 3I7FA 5IYBG 4AQYQ 2AWOA 2ID0A 4LF5Q 4XTCS 1YVCA 3JAMi 1B7YB 1O7LA 3F1ZA 1H9RA 2ZM6Q 3CCEA 5BN5A 4EX5A 3PGZA 2IX0A 2D0PA 4MNOA 2BE5C 2R7ZG 1HCZA 4IFDG 4KKUA 4UP9A 4DR1Q 2MJHA 2EQSA 4DR3L 4A3LG 4DK1A 1HNZL 3NELA 4JI7Q 1XJVA 3HOXH 4KHZA 4HJ8A 1N34L 3I4NG 3A7LA 2ZTDA 1LACA 3JC66 1PHJA 4GKJL 4GNXB 1TWFH 1LYLA 1SN8A 1XPUA
chains in the Genus database with same CATH superfamily
1YHAA 2UXCQ 3ITPA 1GVPA 1PFMA 1HNXH 1VQDA 2AWNA 4E9JA 3MXGA 4LF7L 2MPMA 1LTSD 2A8VA 1HXYD 4DUZL 1G291 4X3SA 4ILWA 3PUYA 4QL5A 5I2YA 4WANA 4JI7H 3E3XA 4DNTB 1EYDA 2QKIC 1JB7A 4QQBX 3KLWA 5IYCG 1Y8OB 4B3RL 4KHPQ 2F0KA 3NBHB 2LTLA 1YHBA 1QVFA 1ZTGA 5ISRA 4A3JH 3H3VC 3FRPB 1MIUA 2JN4A 2K5QA 4JW0A 2YV5A 1KDCA 2OF1A 1DGSA 2H4OA 3WOFA 1JWUD 5EPLA 4JI4L 5M3FH 3MZ5A 2E3UA 1KAWA 4MTNA 2UXBH 1JOOA 2PQUA 2WKCA 1VQBA 3TEHB 1LM0A 4Y52H 1L2FA 2K4KA 2YTVA 4LF5L 1V8CA 1FNVA 4V0BA 2KEDA 4X3KA 4LF8Q 2YQRA 1VF5C 5DAUA 4LK1C 1VQOA 4RA8A 1GUSA 3MC0B 1ILQA 2EIFA 1CUKA 2PI2E 4JOIC 1QE6A 5A35A 2OTLA 1K8MA 1TS5A 4ZUJA 3NCVA 2HQEA 4A3CH 4DR4H 4X62L 1G6ZA 2K28A 3CKIB 1J8IA 2Y3MA 1Z6HA 1RTOA 5C0XI 3VR4A 1A0IA 4NXMH 3WOEA 1NCVA 3S15H 4YHHL 1CTMA 1E7ZA 2E75C 2Y0SB 1TY2A 3A8JE 4GOPA 2UXDH 3M7GA 5JJZA 2F0MA 2DN8A 4LFCH 2A19A 4JI1Q 2KVMA 3VYUA 2R92B 3J80E 3S2DB 3HOUB 4FVMA 2XTIA 2H5XA 1VQHA 4AIMA 1J9OA 2AQ2B 5EPJA 3VR5A 2R92G 1N32Q 4JG2A 1EEFD 2L12A 3M4OB 2K5HA 2CPQA 4YCUA 5LMNL 3ERQA 2R3ZA 4J6HA 1D8LA 1UEAB 3D6WA 2K33A 2F3VA 2K5VA 5EKKA 3T1YL 4OCHA 2OEOA 4DV0H 1CA5A 5M5WH 3KJOA 4QUCA 1QWYA 4IZ8A 1BBUA 4QMFB 3CMEA 1B70B 5EKIA 3NPPA 4CJ0B 5I4DA 5EQ0A 1KHIA 4DXFA 3SDZA 2QW7A 1ML0D 1QVCA 2N88A 3BS1A 1J5EQ 2OT2A 2GN5A 3OMCA 4H44C 2EOTA 4RWSC 1PRTF 1AN7A 4I7ZC 1F9RA 2Z9HA 4DU9A 4DV0L 3Q22A 3DLLA 1WD1A 1PV4A 1ILPA 3NBIA 1I4PA 4TVAB 1SDFA 3OWFA 1PTOB 3CMAA 4RHSA 1KLGD 1W2BA 5IWAL 4C2MH 3GV6A 1I4GA 3TBIB 4OX9H 4R4QA 5FO8B 4DR3Q 2Y0SE 4DV2H 5JJKA 3OW7A 1DCZA 4JI0H 1ASZA 2BE5D 2QF7A 3TP8A 5J3BA 1BVSA 4JI3Q 2ICEC 3PO3H 5LL6S 2AXYA 1JCKB 4OELB 1MJEA 2MHVA 3J81W 1FR3A 4YHHH 3EN2A 2IX1A 3TS2A 2WAQE 3MHBA 1VQ4A 1X3FA 4LJZC 3HS0C 3T16A 4X65L 1E24A 5C4XG 1EQRA 3IRBA 4I7AA 4CKCA 3FVQA 2A1SA 4ABNA 1OTCA 4LF4L 3K58A 2RHSB 2CFMA 4ZUIA 3GTPB 2F4VL 1KC8C 1LTBD 1EWHA 2RA4A 3U1KA 1QOHA 5HGQA 5KYLA 2IHFA 5FK9C 5CV8A 1VQ9A 2FMCA 2FHTA 4TKOB 4BBSG 1WTHA 4G7OC 4LF5H 5JVG3 1E1OA 2DUDA 3UDXA 3CRLC 2FFMA 1W3SA 1XPRA 4DR4Q 5C6AA 4B8CD 4O0AA 3OHXC 1TWAH 5ELDA 3G7LA 2PPBC 1LT5D 3UE0A 4WALA 1HFGA 5DEHA 5JOBA 1YHQA 3JAMc 3NUCA 1TIID 4JI4H 1YJNA 3HGBA 3BVZA 1PYBA 4LFBQ 1E2VA 2L55A 3OIQA 2JA7H 1JICA 1NJIC 4DAYA 3QWNA 3N6RA 3PUXA 3M4OH 1ENCA 3I4NB 4A3KB 3V2TA 4C3JB 5FLMG 2P5ZX 3NBHA 1SRUA 1STHA 3FDTA 2R93B 4ME3A 1OO9B 1CI3M 1SROA 1A3VA 1CKOA 2M8WA 1E22A 2L5TA 1TWGB 1YNJC 1VIHA 1HNXL 1ENFA 3VYRA 3QD7X 5LMUH 1D7QA 3PO2G 1E2ZA 1HNWQ 4IJHA 4B3RQ 4KHPL 2RHQB 2A73B 2F03A 4WRDA 3OIPA 4XIGS 1IYVA 4Q0FA 3HOYG 5FLXc 3TP6A 2N8NA 1BR9A 1ICWA 2SOBA 5IYDG 3M7NA 2KCNA 1HNZQ 1H9SB 3ER0A 4JI2Q 2VB2X 2IY5B 4O42A 2L0CA 2N55A 3ND8A 1Q1BA 4JI3L 1DXMA 2K1HA 2BL5A 2UUBL 4K0KH 4ZYSA 4MN3A 1PH3A 2UXDQ 5M5YH 3J7AF 4DV1Q 1ZZIA 2KEEA 1TY0A 1H95A 2Q2TA 3FKIB 2NVQH 1N33L 4JI6L 1G6PA 1NXUA 3KDGA 4DAYB 2K04A 4NMZA 4HMJA 2KENA 4OWTB 3J81c 5A2QE 1B53A 1SJHD 4YWKA 1HNZH 3BVMA 2FFKB 3HP3A 1PH8A 4AQYH 3FAUA 1L1OC 2H1EA 4WFN3 1JQYD 2D62A 3S17H 3PCOB 2EY2A 2YU9H 4A3CG 4JI5L 3V69A 3GTJB 3I8ZA 1S20A 4XXEA 1RTNA 1N34H 4B3RH 1O80A 2F0HA 2HIXA 5GQOA 4A3BH 1Q90A 2NVQB 5C4XH 4HCEA 2A6HD 4HR7B 1HUMA 1MGSA 3PIPA 4HJAA 4IFDI 5C3EH 2E5LH 2DJGC 2VW9A 4KMUC 5JVH3 4QUFA 1J5KA 1S3OA 1CZWA 1CFMA 2VQFL 1K8GA 3PUZA 2HCCA 4A4IA 4A3MH 1XTCD 2EYOA 2CWFA 1WTXA 1PH9A 4FDBA 4ODGA 1RD9D 2F0SA 5LMNQ 4ME5A 2E8GA 1EOVA 1K0SA 3A55A 4LFAH 2QEXA 3C46A 1S5BD 2J4XA 4GLXA 1KXLA 2SNSA 1UE1A 1BF4A 1IBKQ 1IKLA 2JZXA 1VIGA 2EJMA 3CAMA 2A69D 3BDOA 3QOJA 3S1RB 5K36G 1V9PA 1CHPD 4DV7L 1WVLA 3BZKA 2N3SA 3GTQH 1K83H 2F0FA 3I2ZA 4B3SQ 1B8AA 2R7FA 4IUPA 1X9NA 1F0XA 1J5EH 2UXCH 1FJGH 4P71A 1V1OA 1QZGA 2R7ZB 1I50B 1I6VC 3S16H 2C9OA 5I2XA 2FMMA 3E0JA 3KF8B 3PO2B 4L8JA 4JI2L 4CDDC 1SNPA 3IKJA 4DNRB 1QG7A 3VYSA 2XNAC 2NVTH 2OPUA 4JI3H 4FNFA 2QA4A 1SFOH 1BCPF 1CK1A 3S24A 3VR3A 4A3GG 1N33Q 4A3KG 2RQXA 1WTRA 4LUZA 4HIOA 1NE3A 1STNA 4C3IB 4DAPA 1WCMH 1KAAA 4C3HH 3S1MH 1D5XC 3GQBA 4AYBB 2F0WA 1JB3A 3CW2C 2L15A 3GTOB 5I6YA 2LMCB 1VQPA 5A2QL 2UU9Q 1SYBA 4N9PA 1K3RA 1LTGD 2WB1G 3L3OC 3I3CA 2B2TA 2CPMA 5IE8A 2A74C 3OW2A 4MIUA 1HNWL 3GP7A 5T1IA 1TQOA 1S03G 4RKBA 5IP9H 4BBSB 2DY7A 1V43A 2EYMA 4LF5Q 2AWOA 4BS9A 4XTCS 1CA6A 3CCEA 2ZM6Q 4EX5A 3PIO3 2BE5C 2MJHA 1I6HB 1HNZL 4JVZA 3HOXH 1XJVA 5D3IB 4HJ8A 1SE3A 2ZTDA 1LACA 2F0GA 2F0UA 4GKJL 3O13A 1TWFH 4GNXB 1IBLH 1XPUA 3A0JA 5D14A 4A3EG 1ZZKA 5M3FB 4UAIA 2HCIA 2XWBB 1B2TA 2QEJC 1Q81C 2YTYA 3M9BA 5DNFA 3LNNA 4JI6Q 1B9MA 1O7ZA 4DV6H 1SAPA 1GUGA 1Z9FA 1U5KA 1K0RA 4YHHQ 2N78A 1EY4A 3P20A 1TWCH 5EBDA 2F4IA 2R6GA 2XRSD 4JVHA 1EY7A 4DF7A 2NB0A 4LFCQ 1CM9A 1CHQD 1VQIA 1BNZA 2UUCH 4DR2H 1YNNC 3NTHA 4LF4H 5TSSA 1FYCA 2KCMA 4KHPH 4IPDA 4JV5H 4JYAH 3R2IA 3KBGA 3GTJH 4BY7H 3MXNA 1WTWA 1QILA 2RF4A 2ZM6H 4CDCC 1KNAA 1PDQA 3LWEA 5IP7H 4J8QA 4TQUS 2CWAA 1KQSA 4LW1A 4FO2A 3U9OA 3SK8A 2HHHH 1ZEQX 3QR8A 5KRUA 4Q5VA 1VQCA 4BY7G 4A3FB 4UPAA 1HZAA 3I90A 1X65A 3K7AH 2Q2HA 3W1BA 1JWMD 1GXDC 4DV5Q 1QNKA 2MP1A 1DONA 2CH4W 4A3MB 4OX9L 2NWGA 1EIHA 3HOUH 3G71A 1B4OA 4RGTA 4L6TB 4KKSA 2I0QA 1SMXA 2UUCQ 4RHRA 3TP7A 1RHPA 2R7DA 3G4SA 3JAMW 5E3FA 2Q2UA 1Y1VG 2CCZA 1B9NA 1IBML 5IYBH 3NTIA 2IX3A 3RF2A 4YWLA 4NPSA 4GZYC 3BZDB 2LXJA 5AJ3L 3KUPA 2JSOA 2LSSA 1PZKD 3AFPA 1H9MA 2X69A 4OHJA 3MXNB 1Q86C 5M5WB 4F87A 4HCSA 4HJ7A 2ALYB 1O7IA 2I46A 3K57A 1QUQA 3J80W 5I6WA 2ZJQA 5IGFA 4MZ9A 1EIYB 5BN4A 4FXDA 1F2MA 3NEMA 5CBEE 1IBMH 1LABA 3TN2A 4KY5A 4GKJQ 3SXHA 4JI1H 1JE5A 3HOZB 3T1YH 2G9DA 4C3JH 4GN3B 1X54A 1GUNA 1WTJA 5BN3A 3HKZB 1TT2A 4K5XA 3CXCA 3S15B 2K32A 1RKNA 1ZKOA 2R93G 4LFAQ 2CTLA 2CTKA 5LMNH 4C3JG 4OD6A 2K5WA 4N9TA 2R61A 4C2MB 3G48A 2PZWA 1Q12A 1XMOH 1Q8IA 2F0VA 4LFCL 4DV2L 4JVYA 5E4XA 3S17B 2BH8A 4C3HB 4L5TA 4BBRB 3EFXD 3I4NH 3IFDA 3GTOH 4RGNA 3VR6A 4H13C 2JA8H 3VA5A 1GUTA 3G6EA 3EA6A 4NXML 1EY0A 5C44G 1WTQA 1VQLA 4PV1C 4RH6A 3B6YA 1Y1WH 4K5VA 1YI2A 4IPHA 1AW7A 2O4CA 2NBFA 3U50C 4A3BG 4FJUA 4FP5D 5ELFA 2RSOA 1YIJA 1STYA 4DR1L 1JJGA 3EJIA 1EEID 1TWCB 3EVQA 3PO3G 1LT4D 3AYHB 5KNBA 1N34Q 3CRKC 2B2UC 4KN4C 4BBRH 4BWGB 4RAUC 1EIFA 1STAA 4RCNA 3CPWA 2YU9B 2WACA 1NMFA 4QCLA 4YCWA 1IZ6A 4LUOA 3CCSA 2PI2A 3GTLH 4YCVA 1X0AA 3FKIH 3A56A 1AE2A 3AQQA 2ATWA 1HRJA 3PF5A 3TRZA 3S1RH 1HHVA 5BR8Q 1NAPA 2NVXB 4OWXB 4G57A 5IT9L 1IL8A 1HNXQ 3GTQB 3HOVB 3C2PA 1M8AA 4DV3Q 1NSNS 2IPKD 4RGOS 4PMBA 3MTSA 4LF6L 2D5DA 1LTAD 1D1IA 2KQ3A 4CBVA 1WE8A 1F2YA 1LUZA 5NUCA 2EPBA 2Z8LA 3S1NH 1HNWH 3OSOA 3K7UC 2B29A 3A7AB 2K05A 4X66H 1X6OA 3H6MA 1UWVA 4LF7H 1HR0Q 1E1TA 4X66L 1X4MA 3I56A 1L0XB 2HIVA 4WJ4A 3FPUB 1LV9A 4ZRZA 2L9HA 3T13A 2DJFC 3EIVA 1PYSB 2NUCA 4UP8A 1BBXC 3GO5A 3KF6A 5C5LA 2B63B 1B44D 3F2BA 2CTMA 1E0BA 1NTGA 3HOXG 3I4MH 4OX9Q 1A3TA 1WTVA 3V05A 5C4ZA 2CW0D 2PYKA 2KOLA 4DGZA 4B3TL 1YNJD 5CBAE 5C4JH 1LLRD 1EYCA 5LL6X 4AYBE 1TWAB 3DWPA 4MTKA 2K5NA 4ZLTF 4KD3A 2DGYA 2M9VA 3DWAA 4NXNL 3F2DA 4BBSH 1ZYRD 2KA7A 5ELBA 1IW7C 1WTPA 1MBYA 2WB1E 2PW7A 1GUOA 3RD4A 4LF4Q 4IUTA 5CV4A 5J22A 5GAHC 1A63A 5LMNW 1DT4A 1MJCA 3K80C 1Y8NB 1HA6A 1WYDA 3MFYA 3RN5A 5C0XH 2EVBA 3HOWB 2KHSA 1VQJA 1ONLA 3U4ZA 1TXYA 4HIKA 2Y0SG 2FINB 2TSSA 1XNQQ 4KY6A 4LFAL 3RNUA 2BH2A 1QNUA 3R93A 3OPOA 4XT3B 2HUGA 3KK7A 3J80i 1B50A 2B2YA 3MAQA 1PRTB 4JPBW 1DZ1A 1ZYRC 4JK1C 2C35B 4R4TA 2X06A 5IT9c 1XRHA 4CDFC 2F0TA 1FNUA 1PTOF 3CP0A 1EQVA 5BR8L 3MFGA 1MD2D 3QO2A 4DV6Q 1X3PA 3QG1A 1ET6A 1EYGA 1DJRD 3A74A 1EQQA 1LT3D 3H15A 1PH1A 3J7AK 3OYYA 3X3NA 4A3IB 3J7AV 1C48A 1VMCA 3UI2A 2NTTA 1NNXA 2CWPA 1XNQH 2AMCB 4BY1B 4A3DB 4O2DA 3OSSD 2EDGA 4EGVA 2CKZB 3ULJA 4A93B 4WORA 1L1OA 4RGMA 2FPHX 3DM3A 3HZXA 3CCVA 1KRTA 1M4VA 1ESRA 1VQ8A 1MSZA 2LRRA 2PQAA 1HTPA 1BUVT 3H0GH 4HAEA 2ES2A 4KTAA 1EL0A 4AQYL 1VQMA 3TP5A 1B3AA 1NY4A 1JR0D 3SK5A 1BXTA 3Q23A 3KLSX 1H9JA 1XMQL 3NE5B 4UP7A 2RKSA 2B63H 4K2KA 4RMFA 4GNXA 1QZHA 1PA6A 4NBQA 2ICIA 3C1FA 1TWFB 2F0IA 2LF0A 1N33H 4JYAQ 5IGGA 2MJ8A 1WHRA 2F1MA 5E1FA 2VQEL 3I72A 2BDOA 4LMQD 5CC4A 5ELCA 3QJYA 1X3EA 2KBNA 2DNCA 4K0KL 2UUBH 3CC7A 4DV4L 1QUQB 3CU7A 1PH6A 3A5UA 1SMYD 2WKDA 2NVYB 4I65A 1YNND 2ZXOA 1FL0A 1VQFA 3NK9A 2ZQEA 4K8JA 1TKWB 3M85A 3J7A5 1F9PA 5C3EB 3DXJC 2NVTB 1ZXTA 5FJ8G 1I3QH 3PUWA 4F7XA 1HR0H 1G2TA 4KI0A 1AFPA 4PMWA 1CKNB 4L5RC 1N36L 3PIP3 5LMUL 3GTPH 2K75A 3EBEA 3NWTA 1X3QA 4JBJA 1IBLQ 4C3IH 4B8TA 2KCCA 2OCEA 2X6GA 3PIOA 1VBIA 4BY1G 4A3DG 4X66Q 4CJ1B 2PY9A 4R4IA 3D3RA 2GA4B 4QGUA 4KD4A 4GNXC 4ZKBB 4JV5L 2Q8RE 1LTTD 3SR1A 1DOLA 1KIXA 4S3SA 4FF1A 3H0GG 1ASYA 1XTDA 2ANNA 1TWGH 1X3GA 2E2HH 3MA2B 3L0OA 1R9TH 4FF4A 3G6JB 4LUVA 5LL6b 1HH2P 5IOCA 5D65A 4EQPA 3J80c 2NZHA 4DV4H 4LF8H 1AEXA 3I70A 3RN2A 1OXUA 4JOIA 2VXWA 5T1GA 2QDLA 2E76C 3W3AA 3J7YW 3SHLA 4KV6A 1JOKA 1JWSD 4GOPC 1G91A 1M90C 1I6UA 1IBKL 2TMPA 2OPVA 2IW3A 3NQIA 4H0LC 2B3GA 4NXNQ 4J1MA 4X64Q 1EU4A 2VY3A 4DV0Q 1EFID 5FLMH 2JK8A 2E2IB 1VQNA 2Z6BA 1EC6A 3OTOL 1TVXA 4DV3L 4AQYQ 5IYBG 2ID0A 5HURA 4MHEA 1YVCA 1DM0B 1B7YB 4DN4M 3JAMi 3T1HH 5BN5A 4MNOA 2IX0A 2RDGA 4IFDG 4KKUA 4DR3L 4R8IA 3NELA 1IHZA 1PZID 5G3LD 3S2HB 3A7LA 4G08A 1SN8A 4LAAA 4A3JB 2HH2A 3KF6B 1SEBD 3M4QA 1EZ8A 3RLFA 4R4OA 3S1QH 3CC4A 4R4CA 5EGTA 5GAGC 1N36H 2FMRA 1X56A 1F77A 4DPGA 1Z7TA 3C1EA 3F2CA 2JA6H 3OOCA 1IL2A 3DM1A 1UEBA 4FXKC 2MNAA 2F0JA 3RR5A 4B9XA 2PZUA 3LX0A 4GKKQ 3U58A 1H9SA 3K0XA 1EU3A 3BU2A 5IWAH 1HQRD 3CQZH 2WP8J 5LMUQ 2LS01 5JEAG 4TRDA 4BXXG 2HQLA 2OXPA 2UU9L 2BCOA 4JI2H 1NMGA 1PZJD 4X64H 2K7VA 1Y1WB 4ALPA 3T1HQ 1T9HA 1Q3LA 2E2JH 1UE7A 1EWIA 1FGBD 1H9KA 5CGKA 3HOVG 3ZYYX 4OGQC 4HJ5A 1WI5A 5LHY1 2ASBA 5IGEA 4FYDA 4PMCA 3FP9A 4XT1B 3MEFA 4DV7H 3CQZB 2YYZA 4LWCA 2F0QA 2F0LA 5J39A 3TMEA 1TWHH 2L4NA 1HR0W 2VUMG 1GUWA 4DV2Q 3NP8A 2E2DC 2Z6KC 4N8FA 4F88A 1HZCA 5KNDA 2LY7A 1XNQL 5ELOA 3LWUA 3H94A 1PMRA 4IUUA 3HKZE 2B2VC 4NDXA 5COYA 2FJ2A 1LTID 3GD7A 5M3MB 4PDBA 3X3MA 2V4DA 2SEBD 2LFNA 5IP7G 3Q6SA 1L1OB 3P7JA 2E2IH 1OXXK 3ONAB 2F4VQ 2JXMB 3S1NB 4HN7A 5IGCA 4N8X1 2EXZA 2N49A 3PSIA 4L63B 5EAYA 4DR2Q 4YY3Q 3D0FA 3BDLA 3I4MG 4BBRG 5CMDA 4BA1I 1XXGA 1EFWA 1WCMG 4IOCA 4JV5Q 2L11A 1UG8A 1QB5D 2G8YA 3EQLC 2JA8B 1TS3A 1SYGA 1K3BC 3IAYA 4X62H 1S4ZA 1SMYC 2F3IA 4DR4L 4P2CB 4CGYB 2QNDA 5IODA 1Q1EA 2UUBQ 1G2SA 2EYJA 4HSVA 3S14B 4ZQ3A 1AE3A 3SK4A 5IY0A 2JEAI 1RIPA 4CHTB 2JEBI 1L0WA 5FO9B 1KDAA 2HD3A 2PQAB 1GJXA 1LO5D 2DY8A 2D0OA 3PUVA 4JI6H 5DM73 5GADC 2JA7B 2JA8G 5KEEA 3D4RA 4DUYH 2VQEQ 1WCMB 1LTLA 4CKBA 2XN9C 3TZUA 1PH7A 3CCLA 2I5LX 2RDHA 2B2WA 2JYOA 3CD6A 1ZZJA 2F0PA 3K5MA 1II3A 4JI4Q 2VL6A 3RUZA 4OO1G 2A1AA 4Z9CB 1KHMA 1HA5A 5CV9A 2IWHA 1RL2A 5EKLA 3CCMA 5FO7B 5ELEA 1RF2D 5EBCA 1SNQA 3CC2A 2MO1A 1CZGA 1SNOA 3PQIA 4DFAA 3T53B 3SB1A 1X55A 1O78A 1Q46A 1CSPA 3QB3A 4PNYA 2B8GA 4K5WA 1SNDA 4JI7L 3GTGH 4A75A 1MSHA 4DUZH 2G9HD 3HOWH 4PZ7A 1MSGA 1QVGA 1J4WA 3KOJA 2ZT9C 4OIJA 2KCTA 4IN3A 4R9WA 1B3QA 1DTJA 4PZ6A 4A3MG 1PH5A 3OWEB 2A68C 4LIJA 1VQAA 4DAMA 4FJSA 4OIKA 2F52A 4X62Q 2JA5G 3ULPA 1IW7D 3VDYA 2JA5B 1FGUA 1V1PB 1Y1VH 4G7ZC 5M3MH 4QB4A 1I4RA 1YZ6A 2EYHA 3J81i 2MUYA 4P73A 4A3JG 1D2BA 3A5ZB 3AU7A 2RBMA 4JI1L 5KNCA 4XQJA 1PFBA 1N9WA 2QCPX 1A8VA 1KL9A 1N32L 4NW2A 2JA6G 2KUMA 3UDFA 4DR6L 3NSWA 1Z47A 3STBD 1EZ6A 2ZXPA 1KTKA 1PXUA 3HFZB 4Y7NB 4DR1H 3MVVA 2F4VH 3DEPA 3M3YB 3OTOQ 1A6XA 4DR5Q 1GO3E 2B39A 3E6ZX 4X65H 1VQKA 3K8AA 2UU9H 4IFDJ 4JC0A 3K5NA 2R7ZH 1Y8PB 4RKLA 3Q8DA 2RDFA 3GTMB 1ODHA 4QY7A 2NN6H 2K50A 2JP1A 1QJOA 1ESFA 4P72A 4IUVA 2EY5A 1Y69U 2B2TC 3J81E 1PFSA 1VQGA 1TUAA 1R4PB 5IGDA 1ICFB 2XGTA 2ENBA 2M2LA 3L7ZC 2A6ED 4X3UA 5DT9A 4HMIA 5FLXL 2EJFC 2XIWA 3N52A 3TS0A 1GD7A 1D1KA 3H91A 4GKKL 5IWAQ 2WB1B 1GKHA 1Y14B 1EY5A 4G7HC 2ZM6L 3GV3A 4BA2I 2WAQG 1CKMA 1S5DD 5E7NA 5I9PA 1Q82C 3EZJA 4PG3A 5L37A 1HQMC 3T1HL 2I5MX 5IGBA 3S1QB 4B3MH 4DV3H 4CDEC 4A76A 4H7BA 4M8AA 1IBMQ 4A3GB 3T51B 3RLOA 1VMPA 1A62A 5CORA 4EQ5A 1WFQA 3AFQA 1L0YB 1V1QA 1XYIA 1XX8A 1WOCA 1EOTA 3NXWA 3A8KE 2VUMB 1AP0A 1U9RA 1N36Q 1E3PA 1HZBA 4OO1I 3M4PA 4LF9H 1EY8A 4B3TQ 1MI2A 4K6DA 3MWYW 2SDFA 1IBLL 1AN8A 5M5XH 3KBXA 2GVAA 1K28A 3NHHA 1AZQA 2E5LQ 1PTOD 3K5OA 1S72A 3GTLB 4ULLA 1F2ZA 3A8IE 2HH3A 4DR6Q 5M3MG 1I94Q 1STEA 2O5JC 5EPKA 1SBBB 3MXPA 4JI8H 2RSNA 1Y1WG 2PMZE 3D8GA 3KF8A 4RFBA 1SYCA 1Y1VB 3M3YH 3L2PA 4LFBH 1T5EA 3HOVH 5FLXE 1VQ5A 1EUJA 5ELNA 5KYIA 2F0DA 1J6QA 2Z1CA 5D3DA 3OMGA 4DR3H 4UHVA 2B8FA 2BOSA 4JI8L 1NR2A 3SGIA 2JQOA 2VB3X 2D2CC 2PCFB 3H3VH 3OTOH 3HG9A 1CQFA 1U4LA 1VS0A 2ZTEA 3D31A 4RG1A 2Q8TA 3RLNA 5FOBB 4HIMA 3AMUA 4DR7H 1IYUA 4IUQA 4PZ8A 2CQAA 4DV6L 3URYA 4LF9L 5AJ3Q 1X32A 4KKTA 5HY6A 5C5MA 1SYDA 1UUPA 4KHVA 2K52A 2WAQB 1AZPA 4DXGA 1SLJA 4GLAC 3KLSA 5KGUA 2QGQA 1W6KA 4FF3A 5J1ZA 3ZJYC 3BDCA 1K8AC 5CV6A 4DR7L 2QILA 2I5HA 2A69C 3BG3A 5I9OA 1S40A 2NZ1D 5JJLA 4K14A 1IYJB 4KN7C 1A15A 3Q0AA 2EZVA 1P8LA 4XQQA 1EY6A 4C56C 1Z2IA 4DK0A 1BCPC 2O4XA 5C44H 4H8AA 1PLFA 3RZOB 1I4QA 4XYQA 3ICEA 1UE6A 4DUZQ 4P75A 4EQNA 1VF7A 4DV5L 2OTJA 3I4OA 1I50H 3UDIA 5FKAC 1DD2A 2OQKA 4A3IH 2XRQD 4QF4A 3S2HH 3FPPA 1VQEA 4DV4Q 1P16A 3VYTA 4DAVA 4U68A 1E2WA 3U9SA 1F2LA 1U4MA 2A6HC 5JEAJ 5M5XB 3TQYA 3I91A 1HR0L 1A2UA 2R93H 1XNRL 3W5OA 2E5LL 4GN5A 1I4HA 3SK6A 1OXSC 1EYAA 4DA2A 2SNMA 2VS1A 1S5CD 4IURA 3JAML 2ZJPA 2PNRC 4P74A 4B08A 4U673 1I94L 4EC5A 2KHIA 1SSOA 2JA6B 3I7FA 1S5FD 1O7LA 4IUNA 4B9WA 1H9RA 2D0PA 1HCZA 4DR1Q 4UP9A 2G5DA 4A3LG 5G3LF 1TS2A 1N34L 3JC66 5JPMC 2IJ0A 1LYLA 4M1UB 4JI5H 1S5ED 2B2UA 3BVGA 5C3EG 2B2YC 4KY7A 1PTOC 2F0NA 3I55A 5M5YB 4ZK9B 3H0GB 4B3ML 1N32H 4DR5L 1GHJA 5IT9W 2B2WC 3PMFA 2BDNA 3RMHA 3J7ZC 1C4QA 3CCRA 4QIWB 2PW5A 3J81j 1SNCA 3K7AB 4JI5Q 4L5QA 1YJWA 4C1NK 1PVOA 3DEOA 1U0LA 3IL8A 1AH9A 1I5FA 4GKKH 1EQTA 1WVNA 3GABA 2PT7G 3CCQA 4CJ2C 5K5PA 3TREA 4IO9A 1FVIA 4AH6A 3F2UA 1DOMA 1PTOH 2F3WA 5C4XB 4Y7NH 1B1ZA 4KJOA 4NB3A 5CYUA 2O2LD 3J81L 1D5MC 3K0YA 3E5SA 3CF5A 2AUKA 5C44B 2CVRA 3D4DA 4ZKCB 2KECA 3R8BA 5DLQE 4IJLA 4NZTM 2NZOA 2IT1A 2KHJA 3A54A 4IPCA 4A3IG 1PRTC 4C3HG 2EY1A 3GR5A 2E74C 2PMZB 3S2DH 2AUJD 2JE6I 2WFWA 4POFA 3KDKA 2WV6D 2NTSA 2E2JB 2UUAL 1SE4A 4J15A 3S9WA 3K6OA 2O5IC 3NENA 4IFDH 1TU2B 5HGTA 4WJ3M 1JE4A 5C4HA 1NUCA 2HDLA 3CCJA 1YNXA 3BYYB 1O7YA 4DV7Q 3KLRA 3TDQA 1VQ6A 2V1CC 2AHOB 3HKZG 4YWMA 1I3QB 2EY6A 3C3LA 4JBKA 5A2QW 4LF6Q 2PZTA 3P1HA 1TWHB 4OWWB 2NN6I 2WIIB 3I4MB 3BZCA 4A93G 4UDUC 1SJED 4B3TH 2K03A 3R3OA 1V8QA 1N8RC 5IIFA 2K14A 5C0XG 5IP9G 5AFWA 5C4JB 5IYCH 1RDPD 3GTKB 3KDFA 4K0KQ 1YBYA 2EYPA 2UUAH 3UE1A 1KDBA 4OXPA 2EJGC 4B3SH 3E9HA 3M4YA 4C1NI 2CHBD 2EYLA 5C0XJ 3DHQA 1BDOA 2XVSA 3NWSA 1G51A 1D5ZC 4TSSA 4GN4B 4JBWA 4QIWE 3HOZG 4IQZA 1YJ9A 5H1SE 3GTGB 2BA1A 4EQOA 4LF6H 3D4WA 3I4LA 1HFNA 4PQXA 4O1NA 2RVLA 4JI0L 3HRZC 3K59A 1OXTA 2AQ1B 1M1KC 5FJ8H 3KFUA 2Z0SA 4LF9Q 2WINB 3W1GA 1A2TA 2HT1A 2P2RA 5JJIA 4F8MA 1IKMA 2I07B 4A3FH 4DUYL 3WWVA 3Q24A 3MEHA 4DR5H 4GLVB 2LXKA 1FNWA 2LTMA 4KJNA 3DUZA 5JPNC 1ET9A 1CSQA 1BQQT 3F8TA 5KIXA 2CTJA 4X6AH 2CTFA 3NTKA 5DM63 5K36H 1FJGQ 1RJTA 2Z4IA 3ULLA 2YTXA 2B63G 2UUAQ 2Z4HA 4X3TA 2IL8A 3T1YQ 2MGSA 3CHBD 3KJPA 4XDXA 1JOQA 4X64L 4R1JA 4E6IA 4YIJA 1WJJA 3HEJA 1G8ZD 1W6JA 1K83B 2J7ZA 3KDFB 3T56B 5FLXW 4LNQA 4DV1H 2PNHA 4K2LA 2K1BA 4JCVE 1PYWD 3SVMA 2M00A 4OL7A 1BOSA 3PO3B 4ID6A 1F9QA 3SEBA 1XMOL 2NYZD 1XNRH 1JJCB 4HIDA 3PO2H 4KLKA 4A3BB 4G4KA 1MKHA 2HHHL 4DK6C 2IHEA 2GVBA 2UXDL 1U4PA 2VZAA 4WJWA 4DV1L 1ENAA 3FMCA 3RZOH 3VKEA 1XMQQ 2E2HB 1VCIA 4IOAA 4DV5H 2NN6G 4ZCKA 1KRSA 3K81C 3AEVB 4JYAL 5M3FG 1PFNA 1EY9A 2JA7G 3P75A 5JEAH 1SE8A 1C8CA 4APVA 2UUCL 5CV5A 2A6EC 2MQHA 4DKAC 1UE5A 2MFIA 2VNUD 1IXRA 3EROA 2DGRA 5EJWA 2NVYH 3H09A 4HSPA 3PF4A 3MXUA 3KYHC 1SXTA 1NBWA 2VKCA 4RCOA 1T5XD 4X65Q 2D9IA 3CCUA 5C3XA 2X6LA 3H3VI 3NQTA 1UNSA 2PQEA 2OWOA 4UY8C 4LF8L 3ERSX 3TZDA 3U4VA 3HOYH 4GKJH 1C7YA 3QOLA 4DUYQ 1C9OA 2UXBL 2VUMH 2ZXRA 3AB9A 1BKBA 1BCPD 3UOEA 4A3KH 4AYBG 1RODA 2XWJB 1U4RA 4A93H 1SNMA 1GM5A 3GDEA 1C0AA 1EWCA 2C5CA 1CKNA 4QJFA 3STBC 3TSSA 1F9SA 1DYQA 2JVZA 4EVOA 2BA0A 2JA5H 4H02A 1PH4A 3J80L 1GOZA 1HJPA 1K8OA 3FEWX 2F0OA 1BBWA 1JORA 4LFBL 4BXXH 4NZRM 1I6HH 5JAVA 1QCBD 4B3SL 1HTLD 3S1MB 1HPCA 1SE2A 2AQ3B 3D6CA 1SR3A 4R8NA 2HDMA 4ZAIA 3HOUG 4JI0Q 1KLUD 4DR2L 4BY7B 3BJUA 1V9NA 2KJXA 4GOPB 1BCPB 3DWQA 4FF2A 4AM3A 2QDBA 4DR7Q 2PO4A 1X9ZA 5F2DA 1PRTD 1YITA 3E9IA 2EXDA 2HHHQ 2A68D 1JJ2A 1IBKH 1TR5A 1BO0A 3UDGA 3CPFA 2AKWB 2NVXH 1K9MC 2VQEH 2JA9A 2CWHA 3I0PA 1XPOA 2JJQA 3HKSA 4L5SA 4HTHA 2EYFA 1Q7YC 4BY1H 1KD1C 4A3DH 4K6LA 1XMQH 3DMUA 1JC7A 2J0TD 3IFTA 2RCFA 2Z6KA 1FJGL 3AEVA 2UXCL 4IALA 2ZTCA 3PV0A 1K73C 2DNEA 1FKAH 1EIGA 1MHWC 1K1GA 3S16B 4XYOA 1STBA 4POGA 1NR4A 1KNEA 4A3FG 4LF7Q 5GROA 3JAME 1YEZA 1CQVA 1XNRQ 1JT8A 4DNIA 3L9AX 1FD7D 3GKUA 1SFOB 2B2VA 4NKLA 1KABA 3RZDB 1X4NA 2R92H 1SYEA 1RCVD 2CW0C 3HOWG 4A3EH 1XMOQ 4YY3H 1WD0A 5BR8H 2D9UA 3HOYB 3R2TA 2FXQA 4HJ9A 2Q8IB 1JMCA 3VR2A 2ANRA 4NXMQ 1UAPA 4DK3C 3HOZH 4YY3L 2K6AA 3GTKH 1LTRD 4A3LH 4QMGA 2ZJRA 4JBMA 1V1PA 3E0EA 3LGJA 5CV7A 3SE0A 3V96A 1GHKA 1SEIA 2CH4A 4OO1H 2A5HA 5IT9E 3OETA 2K01A 4XQNA 1OXVA 3FKIG 4B3MQ 1VQ7A 4V190 1R4QB 3RZDH 2F0EA 2CTEA 3W2DA 2VQFQ 1HUNA 5IYDH 3QIAA 1LT6D 4A3EB 3WDNA 4C3IG 1DOKA 1SYFA 1Q8KA 4FXGC 4K8IA 3I73A 4OONA 2Q2IA 3ND9A 1PQXA 4JI8Q 3HOXB 3GTMH 1J5EL 1TS4A 4NXNH 4DR6H 4IPGA 5GAEC 4NP5A 1PH2A 2CQOA 2RCNA 3FHWA 2EE1A 4KK7A 5C3WA 2OQ0A 2K5DA 1STGA 1D6EC 2MO0A 1HZ9A 3BYTB 3S14H 4A3GH 1R9TB 1A3UA 1VDZA 3VA7A 4GS3A 1XWEA 3T4AC 5E4WC 4CKEA 3F1ZA 2UXBQ 2L1BA 3PGZA 2R7ZG 5CR3A 1I94H 5M9OA 2EQSA 3K5LA 2M6QA 4DK1A 4JI7Q 1I4XA 4KHZA 3I4NG 2XSCA 1PHJA 2LKVA 4OEMB 1CT1D 1WTOA 4HEDA 2VQFH
chains in the Genus database with same CATH topology
1YHAA 2UXCQ 3ITPA 1GVPA 1PFMA 1VQDA 2AWNA 3MXGA 4LF7L 2MPMA 1LTSD 2A8VA 1HXYD 4DUZL 1G291 4X3SA 4ILWA 3PUYA 5I2YA 4QL5A 4WANA 4DNTB 1JB7A 1EYDA 2QKIC 4QQBX 3KLWA 5IYCG 1Y8OB 4B3RL 4KHPQ 2F0KA 3NBHB 1YHBA 1QVFA 1ZTGA 5ISRA 3H3VC 4A3JH 3FRPB 1MIUA 2K5QA 2YV5A 1KDCA 2OF1A 1DGSA 2H4OA 3WOFA 1JWUD 5EPLA 4JI4L 5M3FH 3MZ5A 2E3UA 1KAWA 4MTNA 1JOOA 2PQUA 2WKCA 1VQBA 3TEHB 1LM0A 4Y52H 1L2FA 2K4KA 2YTVA 4LF5L 1FNVA 4V0BA 2KEDA 4X3KA 4LF8Q 2YQRA 1VF5C 5DAUA 4LK1C 1VQOA 4RA8A 1GUSA 3MC0B 1ILQA 2EIFA 1CUKA 2PI2E 4JOIC 1QE6A 5A35A 2OTLA 1K8MA 1TS5A 4ZUJA 2HQEA 4A3CH 1G6ZA 4X62L 2K28A 3CKIB 1J8IA 1Z6HA 1RTOA 5C0XI 3VR4A 1A0IA 3WOEA 1NCVA 3S15H 4YHHL 1CTMA 2E75C 1E7ZA 2Y0SB 1TY2A 3A8JE 4GOPA 3M7GA 5JJZA 2F0MA 2DN8A 2A19A 4JI1Q 2KVMA 3VYUA 2R92B 3J80E 3S2DB 3HOUB 4FVMA 2XTIA 2H5XA 1VQHA 4AIMA 1J9OA 2AQ2B 5EPJA 3VR5A 2R92G 1N32Q 4JG2A 1EEFD 2L12A 3M4OB 2K5HA 2CPQA 4YCUA 5LMNL 3ERQA 2R3ZA 4J6HA 1D8LA 1UEAB 3D6WA 2K33A 2F3VA 2K5VA 5EKKA 3T1YL 2OEOA 1CA5A 5M5WH 3KJOA 4QUCA 1QWYA 4IZ8A 1BBUA 4QMFB 3CMEA 1B70B 5EKIA 3NPPA 4CJ0B 5I4DA 5EQ0A 1KHIA 4DXFA 3SDZA 1ML0D 3BS1A 2N88A 1QVCA 1J5EQ 2OT2A 2GN5A 3OMCA 4H44C 2EOTA 4RWSC 1PRTF 4I7ZC 1F9RA 4DU9A 4DV0L 3Q22A 3DLLA 1WD1A 1ILPA 1PV4A 3NBIA 1I4PA 4TVAB 1SDFA 3OWFA 1PTOB 3CMAA 4RHSA 1KLGD 1W2BA 5IWAL 4C2MH 3GV6A 1I4GA 3TBIB 4R4QA 5FO8B 4DR3Q 2Y0SE 5JJKA 3OW7A 1DCZA 1ASZA 2BE5D 2QF7A 3TP8A 5J3BA 1BVSA 4JI3Q 2ICEC 3PO3H 5LL6S 2AXYA 1JCKB 1MJEA 2MHVA 1FR3A 2IX1A 3EN2A 3TS2A 2WAQE 3MHBA 1VQ4A 1X3FA 4LJZC 3HS0C 3T16A 4X65L 1E24A 5C4XG 1EQRA 3IRBA 4CKCA 3FVQA 4ABNA 1OTCA 4LF4L 3K58A 2RHSB 3GTPB 4ZUIA 2CFMA 2F4VL 1KC8C 1LTBD 1EWHA 2RA4A 3U1KA 1QOHA 5HGQA 5KYLA 2IHFA 5FK9C 5CV8A 1VQ9A 2FMCA 2FHTA 4TKOB 4BBSG 4G7OC 5JVG3 1E1OA 2DUDA 3UDXA 3CRLC 1W3SA 1XPRA 4DR4Q 5C6AA 5ELDA 3OHXC 1TWAH 4O0AA 3G7LA 2PPBC 1LT5D 3UE0A 4WALA 1HFGA 5DEHA 5JOBA 1YHQA 3JAMc 3NUCA 1TIID 1YJNA 3HGBA 3BVZA 1PYBA 4LFBQ 1E2VA 2L55A 3OIQA 2JA7H 1JICA 1NJIC 4DAYA 3QWNA 3N6RA 3PUXA 3M4OH 1ENCA 3I4NB 4A3KB 3V2TA 4C3JB 5FLMG 3NBHA 1SRUA 1STHA 3FDTA 2R93B 4ME3A 1OO9B 1CI3M 1SROA 1A3VA 1CKOA 1E22A 2L5TA 1TWGB 1YNJC 1VIHA 1HNXL 1ENFA 3VYRA 1D7QA 3PO2G 1E2ZA 1HNWQ 4IJHA 4B3RQ 4KHPL 2RHQB 2A73B 2F03A 4WRDA 3OIPA 4XIGS 1IYVA 4Q0FA 3HOYG 5FLXc 3TP6A 2N8NA 1BR9A 1ICWA 2SOBA 5IYDG 3M7NA 2KCNA 1HNZQ 1H9SB 3ER0A 4JI2Q 2VB2X 2IY5B 4O42A 2L0CA 2N55A 3ND8A 1Q1BA 4JI3L 1DXMA 2BL5A 2UUBL 4ZYSA 4MN3A 1PH3A 2UXDQ 5M5YH 3J7AF 4DV1Q 1ZZIA 2KEEA 1TY0A 1H95A 2Q2TA 3FKIB 2NVQH 1N33L 4JI6L 1G6PA 4DAYB 2K04A 4HMJA 4NMZA 2KENA 4OWTB 3J81c 5A2QE 1B53A 1SJHD 4YWKA 3BVMA 2FFKB 3HP3A 1PH8A 1L1OC 2H1EA 4WFN3 1JQYD 2D62A 3S17H 3PCOB 2EY2A 2YU9H 4A3CG 4JI5L 3V69A 3GTJB 3I8ZA 4XXEA 1RTNA 1O80A 2F0HA 2HIXA 5GQOA 4A3BH 1Q90A 2NVQB 5C4XH 4HCEA 2A6HD 4HR7B 1HUMA 1MGSA 3PIPA 4HJAA 4IFDI 5C3EH 2VW9A 4KMUC 5JVH3 4QUFA 1J5KA 1S3OA 1CZWA 1CFMA 2VQFL 1K8GA 3PUZA 2HCCA 4A4IA 4A3MH 1XTCD 2EYOA 1WTXA 1PH9A 4FDBA 4ODGA 1RD9D 2F0SA 5LMNQ 4ME5A 2E8GA 1EOVA 3A55A 2QEXA 3C46A 1S5BD 2J4XA 4GLXA 1KXLA 2SNSA 1BF4A 1UE1A 1IBKQ 1IKLA 2JZXA 1VIGA 2EJMA 3CAMA 2A69D 3BDOA 3QOJA 3S1RB 5K36G 1V9PA 1CHPD 4DV7L 1WVLA 3BZKA 2N3SA 3GTQH 1K83H 2F0FA 3I2ZA 4B3SQ 1B8AA 2R7FA 4IUPA 1X9NA 4P71A 1V1OA 1QZGA 2R7ZB 1I50B 1I6VC 3S16H 2C9OA 5I2XA 2FMMA 3E0JA 3KF8B 3PO2B 4L8JA 4JI2L 1SNPA 3IKJA 4DNRB 1QG7A 3VYSA 2XNAC 2NVTH 2OPUA 4FNFA 2QA4A 1SFOH 1BCPF 1CK1A 3VR3A 3S24A 4A3GG 1N33Q 4A3KG 2RQXA 1WTRA 4LUZA 4HIOA 1NE3A 1STNA 4C3IB 4DAPA 1WCMH 1KAAA 4C3HH 3S1MH 1D5XC 3GQBA 4AYBB 2F0WA 1JB3A 3CW2C 2L15A 3GTOB 5I6YA 2LMCB 1VQPA 5A2QL 2UU9Q 1SYBA 4N9PA 1K3RA 1LTGD 2WB1G 3L3OC 3I3CA 2B2TA 5IE8A 2A74C 3OW2A 4MIUA 1HNWL 3GP7A 5T1IA 1TQOA 4RKBA 4BBSB 5IP9H 2DY7A 1V43A 2EYMA 4LF5Q 2AWOA 4BS9A 4XTCS 1CA6A 3CCEA 2ZM6Q 4EX5A 3PIO3 2BE5C 2MJHA 1I6HB 1HNZL 1XJVA 3HOXH 5D3IB 4HJ8A 1SE3A 2ZTDA 1LACA 2F0GA 2F0UA 4GKJL 3O13A 1TWFH 4GNXB 1XPUA 3A0JA 5D14A 4A3EG 1ZZKA 5M3FB 4UAIA 2HCIA 2XWBB 1B2TA 2QEJC 1Q81C 2YTYA 5DNFA 3M9BA 3LNNA 4JI6Q 1B9MA 1O7ZA 1SAPA 1GUGA 1Z9FA 1U5KA 1K0RA 4YHHQ 2N78A 1EY4A 3P20A 5EBDA 1TWCH 2F4IA 2R6GA 2XRSD 4JVHA 1EY7A 4DF7A 2NB0A 4LFCQ 1CM9A 1CHQD 1VQIA 1BNZA 1YNNC 3NTHA 5TSSA 1FYCA 2KCMA 4IPDA 3R2IA 3KBGA 3GTJH 4BY7H 3MXNA 1WTWA 1QILA 2RF4A 1KNAA 1PDQA 3LWEA 5IP7H 4J8QA 4TQUS 2CWAA 1KQSA 4LW1A 4FO2A 3U9OA 3SK8A 1ZEQX 5KRUA 4Q5VA 1VQCA 4BY7G 4A3FB 4UPAA 1HZAA 3I90A 1X65A 3K7AH 2Q2HA 3W1BA 1JWMD 1GXDC 4DV5Q 1QNKA 2MP1A 1DONA 4A3MB 4OX9L 2NWGA 1EIHA 3HOUH 3G71A 1B4OA 4RGTA 4L6TB 4KKSA 2I0QA 1SMXA 2UUCQ 4RHRA 3TP7A 1RHPA 2R7DA 3G4SA 5E3FA 2Q2UA 1Y1VG 2CCZA 1B9NA 1IBML 5IYBH 3NTIA 2IX3A 4YWLA 4GZYC 4NPSA 3BZDB 2LXJA 5AJ3L 3KUPA 2JSOA 2LSSA 1PZKD 3AFPA 1H9MA 2X69A 4OHJA 3MXNB 1Q86C 5M5WB 4F87A 4HCSA 4HJ7A 2ALYB 2I46A 3K57A 1O7IA 1QUQA 5I6WA 2ZJQA 5IGFA 4MZ9A 1EIYB 5BN4A 4FXDA 1F2MA 3NEMA 5CBEE 1LABA 3TN2A 4KY5A 4GKJQ 3SXHA 1JE5A 3HOZB 2G9DA 4C3JH 4GN3B 1X54A 1GUNA 5BN3A 3HKZB 1TT2A 4K5XA 3CXCA 3S15B 2K32A 1RKNA 1ZKOA 2R93G 4LFAQ 2CTLA 2CTKA 4C3JG 2K5WA 4N9TA 2R61A 4C2MB 3G48A 2PZWA 1Q12A 1Q8IA 2F0VA 4LFCL 4DV2L 4JVYA 5E4XA 3S17B 4C3HB 2BH8A 4BBRB 4L5TA 3EFXD 3I4NH 3IFDA 3GTOH 4RGNA 3VR6A 4H13C 2JA8H 3VA5A 1GUTA 3G6EA 3EA6A 4NXML 1EY0A 1WTQA 5C44G 1VQLA 4PV1C 4RH6A 3B6YA 1Y1WH 4K5VA 1YI2A 4IPHA 1AW7A 2NBFA 3U50C 4A3BG 4FP5D 5ELFA 2RSOA 1YIJA 1STYA 4DR1L 1JJGA 3EJIA 1EEID 1TWCB 3EVQA 3PO3G 1LT4D 3AYHB 5KNBA 1N34Q 3CRKC 2B2UC 4KN4C 4BBRH 4BWGB 4RAUC 1STAA 4RCNA 1EIFA 3CPWA 2YU9B 2WACA 1NMFA 4QCLA 4YCWA 1IZ6A 4LUOA 3CCSA 2PI2A 3GTLH 4YCVA 3FKIH 3A56A 1AE2A 3AQQA 2ATWA 1HRJA 3PF5A 3TRZA 1HHVA 3S1RH 5BR8Q 1NAPA 2NVXB 4OWXB 4G57A 5IT9L 1IL8A 3GTQB 3HOVB 1HNXQ 3C2PA 1M8AA 4DV3Q 1NSNS 2IPKD 4RGOS 4PMBA 3MTSA 4LF6L 2D5DA 1LTAD 1D1IA 2KQ3A 4CBVA 1WE8A 1F2YA 5NUCA 1LUZA 2EPBA 2Z8LA 3S1NH 3OSOA 3K7UC 2B29A 3A7AB 2K05A 1X6OA 3H6MA 1UWVA 1HR0Q 1E1TA 4X66L 1X4MA 3I56A 1L0XB 2HIVA 4WJ4A 3FPUB 1LV9A 4ZRZA 2L9HA 3T13A 3EIVA 2NUCA 1PYSB 4UP8A 1BBXC 3GO5A 3KF6A 5C5LA 2B63B 1B44D 3F2BA 2CTMA 1E0BA 1NTGA 3HOXG 3I4MH 4OX9Q 1A3TA 1WTVA 3V05A 5C4ZA 2CW0D 2PYKA 2KOLA 4DGZA 4B3TL 1YNJD 5CBAE 5C4JH 1LLRD 1EYCA 5LL6X 4AYBE 1TWAB 3DWPA 2K5NA 4ZLTF 3DWAA 2M9VA 4KD3A 2DGYA 4NXNL 3F2DA 4BBSH 1ZYRD 2KA7A 1WTPA 1IW7C 5ELBA 1MBYA 2WB1E 3RD4A 1GUOA 2PW7A 4LF4Q 4IUTA 5CV4A 5J22A 5GAHC 1A63A 5LMNW 1DT4A 1MJCA 3K80C 1Y8NB 1HA6A 1WYDA 3MFYA 3RN5A 5C0XH 2EVBA 3HOWB 2KHSA 1VQJA 1ONLA 3U4ZA 1TXYA 4HIKA 2Y0SG 2FINB 2TSSA 1XNQQ 4KY6A 4LFAL 3RNUA 2BH2A 1QNUA 3R93A 3OPOA 4XT3B 2HUGA 3KK7A 3J80i 1B50A 2B2YA 3MAQA 1PRTB 1DZ1A 1ZYRC 4JK1C 2C35B 4R4TA 5IT9c 2F0TA 1FNUA 1PTOF 3CP0A 1EQVA 5BR8L 3MFGA 1MD2D 3QO2A 4DV6Q 1X3PA 3QG1A 1ET6A 1EYGA 1DJRD 3A74A 1EQQA 1LT3D 3H15A 1PH1A 3X3NA 3OYYA 4A3IB 3J7AV 1C48A 1VMCA 3UI2A 2NTTA 2CWPA 2AMCB 4BY1B 4A3DB 4O2DA 2EDGA 4EGVA 4A93B 2CKZB 3ULJA 4WORA 1L1OA 4RGMA 3DM3A 3HZXA 3CCVA 1KRTA 1M4VA 1ESRA 1VQ8A 2PQAA 1HTPA 1BUVT 3H0GH 4HAEA 2ES2A 4KTAA 1EL0A 4AQYL 1VQMA 3TP5A 1B3AA 1NY4A 1JR0D 3SK5A 1BXTA 3Q23A 3KLSX 1H9JA 1XMQL 3NE5B 4UP7A 2RKSA 2B63H 4K2KA 4RMFA 4GNXA 1QZHA 1PA6A 4NBQA 2ICIA 3C1FA 1TWFB 2F0IA 4JYAQ 5IGGA 2MJ8A 2F1MA 5E1FA 2VQEL 3I72A 2BDOA 4LMQD 5CC4A 5ELCA 3QJYA 1X3EA 2KBNA 2DNCA 4K0KL 3CC7A 4DV4L 1QUQB 3CU7A 1PH6A 3A5UA 1SMYD 2WKDA 2NVYB 4I65A 1YNND 2ZXOA 1FL0A 1VQFA 3NK9A 4K8JA 1TKWB 3M85A 3J7A5 1F9PA 5C3EB 3DXJC 2NVTB 1ZXTA 5FJ8G 3PUWA 4F7XA 1I3QH 1G2TA 4KI0A 1AFPA 4PMWA 1CKNB 4L5RC 1N36L 3PIP3 5LMUL 3GTPH 2K75A 3EBEA 3NWTA 1X3QA 4JBJA 1IBLQ 4C3IH 4B8TA 2KCCA 2OCEA 2X6GA 3PIOA 4BY1G 4A3DG 4X66Q 4CJ1B 2PY9A 4R4IA 3D3RA 2GA4B 4QGUA 4KD4A 4GNXC 4ZKBB 4JV5L 2Q8RE 1LTTD 3SR1A 1DOLA 1KIXA 4S3SA 4FF1A 3H0GG 1ASYA 1XTDA 2ANNA 1TWGH 1X3GA 2E2HH 3MA2B 3L0OA 1R9TH 4FF4A 3G6JB 4LUVA 1HH2P 5IOCA 5D65A 4EQPA 3J80c 2NZHA 1AEXA 3I70A 3RN2A 1OXUA 4JOIA 2VXWA 5T1GA 2E76C 3W3AA 3J7YW 3SHLA 4KV6A 1JOKA 1JWSD 1G91A 4GOPC 1M90C 1IBKL 2TMPA 2OPVA 2IW3A 3NQIA 4H0LC 2B3GA 4NXNQ 4J1MA 4X64Q 1EU4A 2VY3A 4DV0Q 1EFID 5FLMH 2JK8A 2E2IB 1VQNA 1EC6A 3OTOL 1TVXA 4DV3L 4AQYQ 5IYBG 2ID0A 5HURA 4MHEA 1YVCA 1DM0B 1B7YB 4DN4M 3JAMi 5BN5A 4MNOA 2IX0A 2RDGA 4IFDG 4KKUA 4DR3L 4R8IA 3NELA 1IHZA 1PZID 5G3LD 3S2HB 3A7LA 4LAAA 1SN8A 4A3JB 2HH2A 3KF6B 1SEBD 3M4QA 1EZ8A 3RLFA 4R4OA 3S1QH 3CC4A 4R4CA 5EGTA 5GAGC 2FMRA 1X56A 1F77A 4DPGA 1Z7TA 3C1EA 3F2CA 2JA6H 3OOCA 1IL2A 3DM1A 1UEBA 4FXKC 2MNAA 2F0JA 3RR5A 4B9XA 2PZUA 3LX0A 4GKKQ 3U58A 1H9SA 3K0XA 1EU3A 3BU2A 1HQRD 3CQZH 2WP8J 5LMUQ 2LS01 5JEAG 4TRDA 4BXXG 2OXPA 2HQLA 2UU9L 2BCOA 1NMGA 1PZJD 2K7VA 1Y1WB 4ALPA 3T1HQ 1T9HA 1Q3LA 2E2JH 1UE7A 1FGBD 1EWIA 1H9KA 5CGKA 3HOVG 3ZYYX 4OGQC 4HJ5A 1WI5A 5LHY1 2ASBA 5IGEA 4FYDA 4PMCA 3FP9A 4XT1B 3MEFA 3CQZB 2YYZA 4LWCA 2F0QA 2F0LA 5J39A 3TMEA 1TWHH 2L4NA 1HR0W 2VUMG 1GUWA 4DV2Q 3NP8A 2E2DC 2Z6KC 4F88A 1HZCA 5KNDA 2LY7A 1XNQL 5ELOA 3LWUA 3H94A 1PMRA 4IUUA 3HKZE 2B2VC 4NDXA 5COYA 2FJ2A 1LTID 3GD7A 5M3MB 3X3MA 2V4DA 2SEBD 2LFNA 5IP7G 3Q6SA 3P7JA 1L1OB 2E2IH 1OXXK 3ONAB 2F4VQ 2JXMB 3S1NB 4HN7A 5IGCA 2EXZA 2N49A 3PSIA 4L63B 5EAYA 4DR2Q 4YY3Q 3D0FA 3BDLA 3I4MG 4BBRG 5CMDA 4BA1I 1XXGA 1EFWA 1WCMG 4IOCA 4JV5Q 2L11A 1QB5D 3EQLC 2JA8B 1TS3A 1SYGA 3IAYA 1S4ZA 1SMYC 2F3IA 4DR4L 4P2CB 4CGYB 2QNDA 5IODA 1Q1EA 2UUBQ 1G2SA 2EYJA 4HSVA 3S14B 4ZQ3A 1AE3A 3SK4A 5IY0A 2JEAI 1RIPA 4CHTB 2JEBI 1L0WA 5FO9B 1KDAA 1GJXA 2PQAB 1LO5D 2DY8A 2D0OA 3PUVA 5DM73 5GADC 2JA7B 2JA8G 5KEEA 3D4RA 2VQEQ 1WCMB 1LTLA 4CKBA 2XN9C 3TZUA 1PH7A 3CCLA 2I5LX 2RDHA 2B2WA 2JYOA 3CD6A 1ZZJA 2F0PA 3K5MA 1II3A 4JI4Q 2VL6A 3RUZA 4OO1G 4Z9CB 2A1AA 1KHMA 1HA5A 5CV9A 2IWHA 5EKLA 1RL2A 3CCMA 5FO7B 5ELEA 1RF2D 5EBCA 1SNQA 3CC2A 2MO1A 1CZGA 1SNOA 4DFAA 3T53B 1X55A 1O78A 1Q46A 1CSPA 3QB3A 4PNYA 2B8GA 4K5WA 1SNDA 4JI7L 3GTGH 4A75A 1MSHA 2G9HD 3HOWH 4PZ7A 1MSGA 1QVGA 1J4WA 3KOJA 2ZT9C 4OIJA 4IN3A 4R9WA 2KCTA 1DTJA 4PZ6A 4A3MG 1PH5A 3OWEB 2A68C 4LIJA 1VQAA 4DAMA 4OIKA 2F52A 4X62Q 2JA5G 3ULPA 1IW7D 3VDYA 2JA5B 1FGUA 1V1PB 1Y1VH 4G7ZC 5M3MH 4QB4A 1I4RA 2EYHA 1YZ6A 3J81i 2MUYA 4P73A 4A3JG 1D2BA 3A5ZB 3AU7A 2RBMA 4JI1L 5KNCA 4XQJA 1PFBA 1N9WA 2QCPX 1A8VA 1KL9A 1N32L 4NW2A 2JA6G 2KUMA 3UDFA 4DR6L 3NSWA 1Z47A 3STBD 1EZ6A 2ZXPA 1KTKA 1PXUA 3HFZB 4Y7NB 3MVVA 3DEPA 3M3YB 3OTOQ 1A6XA 4DR5Q 1GO3E 2B39A 3E6ZX 1VQKA 3K8AA 4IFDJ 3K5NA 4JC0A 2R7ZH 1Y8PB 4RKLA 3Q8DA 2RDFA 3GTMB 4QY7A 2NN6H 2K50A 2JP1A 1QJOA 1ESFA 4P72A 4IUVA 2EY5A 1Y69U 2B2TC 3J81E 1PFSA 1VQGA 1TUAA 1R4PB 5IGDA 2XGTA 2ENBA 2M2LA 3L7ZC 2A6ED 4X3UA 4HMIA 5FLXL 2EJFC 2XIWA 3N52A 3TS0A 1GD7A 1D1KA 3H91A 4GKKL 5IWAQ 2WB1B 1GKHA 1Y14B 1EY5A 4G7HC 2ZM6L 3GV3A 4BA2I 1CKMA 2WAQG 1S5DD 5I9PA 5E7NA 1Q82C 4PG3A 1HQMC 3T1HL 2I5MX 5IGBA 3S1QB 4A76A 4H7BA 4M8AA 1IBMQ 4A3GB 3T51B 3RLOA 1VMPA 1A62A 5CORA 4EQ5A 1WFQA 1XYIA 1L0YB 1V1QA 3AFQA 1XX8A 1WOCA 1EOTA 3NXWA 3A8KE 2VUMB 1AP0A 1U9RA 1N36Q 1E3PA 1HZBA 4OO1I 3M4PA 1EY8A 4B3TQ 1MI2A 4K6DA 3MWYW 2SDFA 1IBLL 1AN8A 5M5XH 3KBXA 2GVAA 1AZQA 3NHHA 2E5LQ 3GTLB 1PTOD 3K5OA 1S72A 4ULLA 1F2ZA 3A8IE 2HH3A 4DR6Q 5M3MG 1I94Q 1STEA 2O5JC 5EPKA 1SBBB 3MXPA 2RSNA 1Y1WG 2PMZE 3D8GA 3KF8A 4RFBA 1SYCA 1Y1VB 3M3YH 3L2PA 1T5EA 3HOVH 5FLXE 1VQ5A 1EUJA 5KYIA 5ELNA 2F0DA 1J6QA 2Z1CA 5D3DA 3OMGA 2B8FA 2BOSA 4JI8L 1NR2A 3SGIA 2JQOA 2VB3X 2D2CC 2PCFB 3H3VH 3HG9A 1CQFA 1U4LA 1VS0A 3D31A 2ZTEA 4RG1A 2Q8TA 5FOBB 3RLNA 3AMUA 4HIMA 1IYUA 4IUQA 4PZ8A 2CQAA 4DV6L 3URYA 4LF9L 5AJ3Q 1X32A 4KKTA 5HY6A 5C5MA 1SYDA 1UUPA 4KHVA 2K52A 2WAQB 1AZPA 4DXGA 1SLJA 4GLAC 3KLSA 5KGUA 2QGQA 1W6KA 4FF3A 5J1ZA 3ZJYC 3BDCA 1K8AC 5CV6A 4DR7L 2QILA 2I5HA 2A69C 5I9OA 3BG3A 1S40A 2NZ1D 5JJLA 4K14A 1IYJB 4KN7C 1A15A 2EZVA 3Q0AA 1P8LA 4XQQA 1EY6A 4C56C 4DK0A 1BCPC 2O4XA 5C44H 1PLFA 3RZOB 1I4QA 4XYQA 3ICEA 1UE6A 4DUZQ 4P75A 4EQNA 1VF7A 4DV5L 2OTJA 3I4OA 1I50H 3UDIA 5FKAC 1DD2A 2OQKA 4A3IH 2XRQD 4QF4A 3S2HH 3FPPA 1VQEA 4DV4Q 1P16A 3VYTA 4DAVA 4U68A 1E2WA 3U9SA 1F2LA 1U4MA 2A6HC 5JEAJ 5M5XB 3TQYA 3I91A 1HR0L 1A2UA 2R93H 1XNRL 3W5OA 2E5LL 4GN5A 1I4HA 3SK6A 1OXSC 1EYAA 4DA2A 2SNMA 3JAML 1S5CD 4IURA 2VS1A 2ZJPA 2PNRC 4B08A 4U673 4P74A 1I94L 2KHIA 1SSOA 2JA6B 3I7FA 1S5FD 1O7LA 4IUNA 4B9WA 1H9RA 2D0PA 1HCZA 4DR1Q 4UP9A 4A3LG 5G3LF 1TS2A 1N34L 5JPMC 3JC66 2IJ0A 1LYLA 4M1UB 1S5ED 2B2UA 3BVGA 5C3EG 2B2YC 4KY7A 1PTOC 2F0NA 3I55A 5M5YB 4ZK9B 3H0GB 4B3ML 4DR5L 1GHJA 2B2WC 3PMFA 2BDNA 3RMHA 3J7ZC 1C4QA 3CCRA 4QIWB 2PW5A 3J81j 1SNCA 3K7AB 4JI5Q 4L5QA 1YJWA 4C1NK 1PVOA 3DEOA 3IL8A 1U0LA 1AH9A 1I5FA 1EQTA 1WVNA 3CCQA 4CJ2C 5K5PA 3TREA 4IO9A 1FVIA 4AH6A 3F2UA 1DOMA 1PTOH 2F3WA 5C4XB 4Y7NH 1B1ZA 4KJOA 4NB3A 5CYUA 2O2LD 3J81L 1D5MC 3K0YA 3E5SA 3CF5A 2AUKA 5C44B 2CVRA 3D4DA 4ZKCB 2KECA 3R8BA 5DLQE 4IJLA 2NZOA 2IT1A 3A54A 2KHJA 4IPCA 4A3IG 1PRTC 4C3HG 2EY1A 2E74C 2PMZB 3S2DH 2AUJD 2JE6I 2WFWA 4POFA 2WV6D 2NTSA 2E2JB 2UUAL 1SE4A 4J15A 3S9WA 3K6OA 2O5IC 3NENA 4IFDH 1TU2B 5HGTA 4WJ3M 1JE4A 5C4HA 1NUCA 2HDLA 3CCJA 1YNXA 3BYYB 1O7YA 4DV7Q 3KLRA 3TDQA 1VQ6A 2V1CC 2AHOB 3HKZG 4YWMA 3C3LA 1I3QB 2EY6A 4JBKA 4LF6Q 2PZTA 3P1HA 1TWHB 4OWWB 2NN6I 2WIIB 3I4MB 3BZCA 4A93G 4UDUC 1SJED 2K03A 3R3OA 1V8QA 1N8RC 5IIFA 5C0XG 2K14A 5IP9G 5AFWA 5C4JB 5IYCH 1RDPD 3GTKB 3KDFA 4K0KQ 1YBYA 2EYPA 3UE1A 1KDBA 4OXPA 2EJGC 3E9HA 3M4YA 4C1NI 2CHBD 2EYLA 5C0XJ 3DHQA 1BDOA 2XVSA 3NWSA 1G51A 1D5ZC 4TSSA 4GN4B 4JBWA 4QIWE 3HOZG 4IQZA 3GTGB 5H1SE 1YJ9A 2BA1A 4EQOA 3D4WA 3I4LA 1HFNA 4PQXA 4O1NA 2RVLA 4JI0L 3HRZC 3K59A 1OXTA 2AQ1B 1M1KC 5FJ8H 3KFUA 2Z0SA 4LF9Q 2WINB 3W1GA 1A2TA 2HT1A 2P2RA 5JJIA 4F8MA 1IKMA 2I07B 4A3FH 4DUYL 3WWVA 3Q24A 3MEHA 4GLVB 2LXKA 1FNWA 4KJNA 3DUZA 5JPNC 1ET9A 1CSQA 1BQQT 3F8TA 5KIXA 2CTJA 4X6AH 2CTFA 3NTKA 5DM63 5K36H 1FJGQ 1RJTA 2Z4IA 3ULLA 2YTXA 2B63G 2UUAQ 2Z4HA 4X3TA 2IL8A 3T1YQ 2MGSA 3CHBD 3KJPA 4XDXA 1JOQA 4X64L 4R1JA 4E6IA 4YIJA 1WJJA 3HEJA 1G8ZD 1W6JA 1K83B 2J7ZA 3KDFB 3T56B 4LNQA 2PNHA 4K2LA 2K1BA 4JCVE 1PYWD 3SVMA 2M00A 4OL7A 1BOSA 3PO3B 4ID6A 1F9QA 3SEBA 1XMOL 2NYZD 1JJCB 4HIDA 3PO2H 4KLKA 4A3BB 4G4KA 1MKHA 2HHHL 4DK6C 2IHEA 2GVBA 2UXDL 1U4PA 2VZAA 4WJWA 4DV1L 1ENAA 3FMCA 3RZOH 3VKEA 2E2HB 1XMQQ 1VCIA 4IOAA 2NN6G 1KRSA 3K81C 3AEVB 4JYAL 5M3FG 1PFNA 1EY9A 2JA7G 3P75A 5JEAH 1SE8A 1C8CA 4APVA 2UUCL 5CV5A 2A6EC 2MQHA 4DKAC 1UE5A 2VNUD 2MFIA 1IXRA 3EROA 2DGRA 5EJWA 2NVYH 3H09A 4HSPA 3PF4A 3MXUA 3KYHC 1SXTA 1NBWA 4RCOA 1T5XD 4X65Q 3CCUA 5C3XA 2X6LA