3J80W

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
129
structure length
129
Chain Sequence
b'TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
molecule tags Ribosome
source organism Saccharomyces cerevisiae
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
total genus 27
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3j80W01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3j80W02
1HNZH 4DUZH 4B3SH 1N33H 3T1YH 4LFCH 2UUCH 4X65H 5FLXW 2UUBH 4JI4H 4DR6H 4B3RH 4JI8H 4JYAH 4JI0H 3J7AK 4LFBH 4DV5H 2F4VH 4LF6H 1XMQH 1N36H 4B3MH 4DR4H 4LFAH 1IBLH 5A2QW 2ZM6H 4JI2H 1XNRH 4NXMH 4JI5H 4DV2H 4LF7H 1XNQH 1AN7A 4DR3H 3T1HH 4LF9H 4DUYH 2VQEH 4DV7H 4LF5H 4DV4H 4B3TH 5IT9W 4K0KH 4X64H 1S03G 4KHPH 1FJGH 2HHHH 1IBKH 4GKKH 4YY3H 2E5LH 4JI1H 4PDBA 4DR7H 5LMNH 4LF4H 1J5EH 1FKAH 1I6UA 4YHHH 1I94H 2UU9H 4DR2H 5IWAH 1IBMH 4GKJH 3OTOH 1N32H 3J80W 2UUAH 1SEIA 4AQYH 5BR8H 5LL6b 4DR1H 1N34H 3JAMW 2VQFH 5LMUH 4JI7H 4LF8H 3RF2A 4JI6H 3J81W 1HR0H 4X66H 2UXCH 4DV0H 4JV5H 4DR5H 2UXBH 4DV6H 4JI3H 1HNWH 4DV3H 4DV1H 4NXNH 4X62H 2UXDH 1HNXH 1XMOH 4OX9H
chains in the Genus database with same CATH superfamily
1WSCA 4NZTM 3GABA 2MCTA 1ZQ7A 3N43B 4MTEA 1HNZH 2LTMA 1KJQA 3DF7A 4YR3A 3L2PA 4RUCA 5C4XG 2FLNA 4MV1A 3H40A 4NLGA 4MAMA 5D1OA 4LIJA 1RYRA 2W9BA 3T1YH 2JA7G 3PO2G 3JRWA 5DGBA 4LFCH 1TUAA 3I0PA 4HNUA 2Y0SA 3OHAA 3BQ0A 5HV6A 3GQCA 5C44G 3MJFA 4JYAH 2YQRA 4EG0A 1Y1VA 4DL4A 3J7AK 3MFHA 1K83A 4ED0A 5KFPA 2F4VH 4FBUA 4B3MH 1ZTGA 4LFAH 2JEAI 1KJ8A 5JVLA 1CQIB 2CZGA 3N41B 4YP3A 1ULZA 2W6OA 1JDBB 3HBLA 4ECSA 3TINA 4G3IA 2DIKA 4MV9A 1EYZA 4DV2H 2JEIA 2YZGA 4LF7H 4MV4A 4EBDA 1ODHA 4RAYA 4BY1G 2E2IA 3UOEA 2C2EA 3IN5A 2M8WA 3QFFA 1ZZKA 3VPDA 4TQSA 3T1HH 2WAQA 3GV5B 2IA6A 4MA0A 4ED6A 1S68A 1SCUB 4HNTA 2VUGA 5IYDG 2HH3A 5IT9W 4ME6A 4K0KH 1TWHA 3I4NG 1T3NA 3BJYA 5JUMA 4A3FG 4ECZA 1FJGH 5C1PA 3JZIA 1Y1WG 1IBKH 4GKKH 5KFFA 4DL6A 3N6XA 2BR0A 4YY3H 5KFRA 4UCSA 5DGAA 2XGPA 3Q2OA 2Q2TA 2JEBI 2WE6A 2C28A 2V4QA 4HYKA 2XCPA 5T14A 4NBQA 5KFEA 2W57A 1W93A 4QW9A 2R87A 2NUAB 4QMFB 4IR1A 1DV2A 3HOXG 3QZ7A 5BPHA 4DR2H 2ZDGA 3MWDA 5IWAH 3OUZA 4MA5A 4UCOA 5JQWA 3PW4A 3KTMA 2ZQEA 3R5XA 2FP4B 2OLSA 1KHMA 3J80W 1ZZJA 2FPGB 4QW8A 2NU9B 4DL3A 3KHHA 2JA8G 4A2BA 3Q8SB 4E9JA 5KFAA 1GSAA 4ZOLF 4J9KA 2W70A 4AQYH 3VKEA 5KT2A 2YS7A 2FKLA 3FAUA 5LL6b 4O4HF 4Y8VB 4O3OA 3K3PA 5KFVA 1VBGA 2AGQA 4Q0YA 2BA0A 1EZ1A 4EEQA 1PQXA 2FLPA 4UCVA 3GKUA 5KFKA 3HKZA 2A1SA 4JI7H 2WB1E 3GIQA 4IZOA 4RU9A 3GV8B 4LF8H 1GGOA 1RJRA 1Z2NX 2I8CA 2ASJA 2R7ZA 2C35B 5F9NA 3PR4A 2YRWA 1K1GA 4IFDG 1GSHA 4BBSG 5KFSA 2YS6A 5KFGA 4ECQA 1X4MA 5C5JA 1N48A 1W96A 3MFIA 3KHGA 4J0MA 4XYLB 1S97A 3OHBA 3GLKA 1S20A 2V9WA 5CB4F 1ZHQA 4FJSA 2UVWA 2DWCA 2V4RA 3H0GA 4WD3A 4J9OA 3JSLA 3ORQA 5KFYA 4CC5A 5KFCA 2HVSA 5FPOA 5KFWA 3KAKA 2C22A 4JI3H 2FMRA 3PW5A 3N40P 4DV3H 4DV1H 4NXNH 4X62H 2UXDH 2PN1A 2W6MA 2KSWA 1M0WA 2RGVA 4DL7A 1WH2A 3MWEA 4IHJF 4O3QA 2W9BB 1WCMA 1AUVA 4R8UB 5IYCG 2R8IA 4UCUA 4APMA 1S0NA 1ZHSA 2J6UA 5L1IA 1M6VA 2YZMA 5KFDA 2CWHA 2XGQA 4X65H 4JV2A 4DR6H 4ZI7F 2UVRA 2NU8B 4JI0H 3KDKA 2FPPB 4MTDA 3GTKA 3JSNA 2E2HA 4OCHA 4DV5H 4C5AA 1UG8A 5JVDF 2R7ZG 4DR4H 5I47A 2M05A 2JA5A 2YL2A 4HNVA 5LA6F 3U1KA 4F4XA 4TV8F 4NXMH 4BY7G 1V9NA 5BPFA 2DPIA 3GTPA 3OSSD 3PZPA 2OPVA 2MJHA 2X06A 3I12A 3N44B 5D1OB 2FK1A 2X0SA 5EWEA 1AN7A 4U7CA 1X9ZA 4EGJA 1JDEA 5KFBA 3BAAA 3V6KA 5C0XG 1DT4A 1DV1A 1F0XA 3Q8QB 4DUYH 2CKZB 1VKZA 2VQEH 2DLNA 3GTOA 2W7PA 4DL2A 5JH7F 4ED8A 4DV4H 4B3TH 4QWBA 5F9LA 2HVRA 2ZJTA 2V58A 2FJZA 5EDWA 5DLFA 3RGZA 3QZ8A 1JIHA 2CW7A 4KHPH 2CPQA 3GIDA 1T36A 2LF0A 3EYYA 5FLMG 3RAXA 4A93G 4J9NA 4AYBA 2AQ4A 4O3SA 1I7LA 3IG0A 1VS0A 3SB1A 4JV0A 3ETJA 4JI1H 1M7JA 3U9TA 2HH2A 2O4CA 3VPBA 2J9GA 2WAQE 1B6RA 5KT5A 2BQ3A 2FLLA 4PDBA 3HOZG 3BQ2A 3PO3G 4IRKA 1KBLA 4ECXA 3FMAA 5LMNH 3WNZA 4AM3A 5DT9A 2PBZA 4LSXA 1Y1WA 1J5KA 1I6UA 1JXLA 3LMLA 4DL5A 2DZDA 1BJTA 3CVZA 2UU9H 4XZ3B 2HJWA 4WALA 4BWSC 3BA9A 4ECYA 5KG6A 4GKJH 5FD6A 4F4WA 1C30A 2XIGA 4BXXG 1V9PA 4A3JG 3Q8PB 1I50A 3OTOH 4A2AA 1ZETA 5KT7A 5KFOA 1RJQA 4IWYA 3RGXA 3L4JA 2R92G 4A3KG 3K5HA 4ECUA 4ECWA 3RV3A 3EPGA 1V51A 4J9RA 3GR5A 2R7NA 2YRXA 4A3GG 3TIGA 4DR1H 3N8DA 4HQ6A 3GTMA 2BQUA 1SYXB 4TUYF 3JAMW 4Q43A 3RFCA 3RAQA 5LXTF 3V6HA 4BA1I 1UC9A 1UNNC 1FVIA 4A3MG 4ETSA 4B8TA 4XX0B 2W9AA 3RB0A 2CTJA 3T5JA 2IP4A 2W6PA 5KFJA 2AU0A 3KXYT 5CA0F 3G6YA 2R93G 2K1HA 1EC6A 3BABA 4H8AA 2CQYA 4IRDA 3BA8A 3V69A 3G8CA 5KFHA 3RF2A 4JI6H 3RTXA 4UFZA 1E4EB 5L9XA 4F4ZA 3R23A 4QWCA 1DGSA 3F8NA 4BA2I 2V5AA 3PN1A 5CA1F 2VPSA 4X66H 3PVXA 4JV1A 4DV0H 3OUUA 4YAJB 2QK4A 1KJ9A 4RNNA 4AIMA 4ED3A 2B63A 3JRXA 2C00A 2C2RA 2Y0SE 2JEGA 3GV7B 5IYBG 5KG3A 5KG7A 1HNWH 3GIIA 4EYHB 2UVUA 1WHRA 4C5CA 3FKIA 4A3IG 2LTLA 4EEYA 4A3BG 4A3EG 3TIIA 1XMOH 1EHIA 3HB9A 1Z2OX 2NU6B 1N33H 4B3SH 5LP6F 2ATLA 3R5HA 1S0MA 2R8JA 4EC5A 3T5KA 5IP7G 3H4DA 1TAEA 2JA6A 1PK8A 1RJPA 4Q45A 3Q8RB 1VAJA 3PW0A 2RF4A 3KAJA 3U9SA 2JA7A 2VR1A 4JI4H 2VUMG 3L7ZC 4B3RH 2W8KA 4IRCA 5DG8A 4JI8H 4J9QA 1J4WA 5JEAG 1WVNA 1WCMG 1JKJB 1E4EA 4CC6A 4YAKB 1XDNA 1RK5A 1R9TA 1Y1VG 5EWFA 2XC9A 4ED7A 4RZRA 1K1SA 2R6FA 1N36H 1C3OA 1GO3E 4QWAA 1IBLH 5A2QW 4MV6A 3GILA 2ZM6H 4JI2H 3PW2A 2GPSA 2R8GA 5KG2A 4ECVA 2GLTA 4HR7A 2LRRA 2JE6I 2WB1A 4XYMB 3M9OB 2OH2A 1JX4A 2I80A 3SE7A 3KHLA 2NVXA 5IYZF 3GIJA 2IMWP 5H80A 3V4SA 1TWAA 2RDIA 5K36G 4RB0A 2BL5A 5KG0A 1TWFA 1CQJB 4JUZA 2P0AA 3HKZE 2W8LA 3C0FB 5KFLA 2VQDA 1NXUA 2JEJA 2SCUB 2R84A 2R86A 2VPQA 3BG5A 4DV7H 5EOYA 3MR2A 2JVZA 3VMMA 5IP9G 3N42B 3WO0A 4LF5H 5HBRB 4EBCA 3Q1KA 3T5HA 2NN6G 2PMZA 1S03G 1TWCA 3RIZA 3GIPA 5D8DA 4QIWA 1Y14B 4O2AF 4O4IF 1A0IA 4RAZA 4O3PA 4YR2A 5KFMA 2D9IA 2WYOA 2HHHH 3LWBA 2JA6G 1GSOA 4J9PA 4UCTA 1VIGA 2R7KA 4YJ3F 3M4IA 1A9XA 4F50A 3K3VA 2R7LA 4MV3A 5DLGA 5LYJF 1DIKA 4EGQA 1S9FA 2BQRA 3LP8A 2FE3A 3V4ZA 5KT4A 4ECRA 5FD5A 2VA3A 2VUMA 1V8CA 2HVQA 4R7RA 3TQTA 4J9MA 3GTJA 1O75A 4EYIB 4FS2A 2R92A 4ZHQF 3BQ1A 3MWMA 1J5EH 1FKAH 1MSZA 5KG4A 1L2ZA 4F4YA 1WE8A 4R8UA 2VOBA 5DG7A 4AYBE 1EUCB 3NGDA 1N32H 1UC8A 2UUAH 1AUXA 1KJIA 2YW2A 5EZYF 4FU0A 3RBDA 2C2DA 3RJ0A 1P8LA 3FDSA 4MV7A 1I3QA 5L1JA 2WDTA 5KFIA 4IR9A 5BR8H 5KKNB 1T94A 2QNDA 3PR5B 2IBKA 5EWGA 3KALA 5KFTA 5LOVF 4J9LA 1BGWA 3UFXB 1BNCA 4FS1A 3OETA 2JA9A 3VPCA 2PY9A 3G6VA 4FM9A 2YCHA 3R5FA 2VQFH 2ANNA 2W9CB 1S10A 2J6TA 2DGRA 1Z2PX 2JA5G 4GLXA 2CPMA 2PQUA 3K5IA 3MR3A 2OWOA 4MV8A 5KT3A 1SFOA 2J6SA 3GIKA 2NU7B 5K2MA 4FBTA 2E3UA 1B6SA 1VIHA 2OPUA 1IOVA 4O3RA 5KFUA 1RK6A 4LMYA 4QWEA 3KHRA 4WBNF 4JV5H 4DR5H 3HXLA 4WANA 4I7HA 2UXBH 2G8YA 3H20A 3EZJA 5KFXA 2WTFA 4GC6A 4I4TF 3HOWG 4O3NA 2Y3MA 4EBEA 4M7EA 4ZQIA 2ASLA 4JVHA 2UVVA 1E4FT 2UXCH 2RDJA 2ANRA 3L4KA 5GONF 3RUPA 2CTFA 4DUZH 1WTJA 3HOUG 1X0AA 5C1OA 2FK2A 2CW8A 3H4BA 2W71A 2CWFA 1CS0A 1OWTA 1RYSA 2AXYA 2R8KA 3PW7A 3MR6A 3SI8A 2W9CA 1TA8A 2UUCH 1VBIA 4RNOA 5FLXW 2UUBH 4QJFA 3M9MB 3RBEA 3I4MG 4PWQA 2Z0SA 4UCRA 4ED1A 4I50F 2RGRA 4LFBH 2AGPA 1I7NA 3V6JA 3H3VH 4LF6H 1XMQH 3RB4A 5FPRA 4NZRM 2FB9A 3AYHB 2DPJA 2CTEA 1XNRH 5J2TF 1X4NA 4I55F 2FMAA 3OSNA 1KEEA 3HOVG 4JI5H 4JVYA 1CE8A 3AEVB 3ORRA 4C2MA 1M0TA 1XNQH 1TWGA 1KJJA 5DQGA 4YR0A 2YU9A 1MZBA 4LH7A 5D1PA 4YBZB 5FJ8G 4C5BA 4DR3H 1B33N 3NCVA 5L1LA 5KG1A 4EFBA 1DTJA 4LF9H 1K1QA 1GLVA 4QIWE 5DG9A 2VA2A 5KX5F 2NVYA 4LSAA 2CTKA 3UQ8A 5KT6A 1EUDB 4Q8EA 2AGOA 4X64H 4RB2C 3OSPA 3ETHA 3KDGA 2W6ZA 2XCAA 2B63G 2YYAA 2O03A 4A3CG 2FK3A 5DQIA 3H0GG 1B04A 2V59A 2E5LH 2W7OA 1ZZIA 3HOYG 2CTMA 1BXRA 4G08A 2HGSA 5C8YF 3GTLA 5DQHA 4DR7H 3GTQA 5CAEB 5BMVF 3M9NB 3E5NA 4O2BF 4BBRG 4LF4H 2R85A 5L1KA 3RV4A 3T5LA 4YHHH 3TQ1A 1I94H 1V4YA 3FKIG 5KG5A 1IBMH 4TQRA 1KC7A 4A3LG 4FJUA 2PVPA 3RB3A 1S0OA 2PT7G 2YZNA 4TV9F 4YQWA 4RNMA 2M6QA 4B8CD 4DLKA 2W6NA 4Q44A 2Q2UA 2R7MA 3GIMA 1SEIA 3GTGA 4YB8B 2R82A 4RB1A 3EPIA 4EFEA 3QD7X 1X9NA 4Q8FA 4A3DG 4OO1G 4IWXA 3MR5A 2GPWA 4OD6A 2ZDHA 4L1KA 4J9SA 1N34H 4ED2A 4IAJA 1GYFA 3WO1A 5LMUH 5J2UF 2R93A 4U6PA 2JEFA 2W6QA 2P2RA 4RUAA 4ECTA 2QYZA 2XD4A 2XCLA 2ZDQA 3J81W 2ASDA 4E4TA 2PMZE 1HR0H 1VBHA 2CTLA 4RB3C 1E4GT 4YJ2F 5KFZA 3RB6A 4O4LF 5KFNA 2ALZA 1PX2A 4M9UA 2JZXA 5KFQA 1JLLB 1N56A 1XRHA 2R8HA 1WR2A 4DV6H 2FPHX 4LH6A 2FPIB 2VKCA 4QWDA 1IOWA 3CQZA 4GC7A 2I87A 2FFMA 1HNXH 5C3EG 4RZQA 3G6XA 1Z2IA 4OX9H
chains in the Genus database with same CATH topology
2MCTA 4NZTM 3GABA 2RGVA 3L4KA 3N43B 1Z2OX 1WH2A 1HNZH 4DUZH 4B3SH 1N33H 3DF7A 4MTEA 3L2PA 4EC5A 2CW8A 1TAEA 4UCUA 4APMA 2HVSA 1ZHSA 5D1OA 3T1YH 3KAJA 4LFCH 1TA8A 2UUCH 4X65H 5FLXW 2UUBH 4JI4H 4DR6H 4B3RH 4JI8H 4JYAH 4JI0H 4UCRA 3KDKA 4CC6A 4MTDA 1XDNA 3J7AK 2RGRA 3JSNA 4OCHA 4LFBH 4DV5H 2F4VH 4LF6H 1XMQH 1N36H 4B3MH 4DR4H 4LFAH 5FPRA 1IBLH 5A2QW 2ZM6H 4JI2H 4NZRM 3N41B 1XNRH 4NXMH 4MV9A 4JI5H 4DV2H 1M0TA 3OSSD 4LF7H 1XNQH 1E4FT 1ODHA 1MZBA 4RAYA 4LH7A 3N44B 5D1PA 5D1OB 4RB0A 1AN7A 4DR3H 1X9ZA 3BAAA 3NCVA 3T1HH 4EFBA 3C0FB 4LF9H 1S68A 1F0XA 4DUYH 2VQEH 2VUGA 4DV7H 5EOYA 3UQ8A 3N42B 4LF5H 4DV4H 4B3TH 5IT9W 4K0KH 2HVRA 4X64H 2ZJTA 1S03G 4RB2C 3RIZA 3KDGA 3RGZA 2CW7A 2O03A 4KHPH 1FJGH 1A0IA 2LF0A 3EYYA 4RAZA 2D9IA 2WYOA 2HHHH 1IBKH 4GKKH 1B04A 1VS0A 3SB1A 3IG0A 4YY3H 3N6XA 4UCTA 3M4IA 4UCSA 3K3VA 2E5LH 4JI1H 2O4CA 2Q2TA 2WE6A 4PDBA 2FE3A 4G08A 2HGSA 5FD5A 4DR7H 2HVQA 4R7RA 2W57A 5LMNH 1O75A 3FMAA 5DT9A 4LF4H 3MWMA 4LSXA 1J5EH 1FKAH 1I6UA 4YHHH 3LMLA 3CVZA 1I94H 1BJTA 2UU9H 1L2ZA 4DR2H 4BWSC 4UCOA 5IWAH 1IBMH 2VOBA 4GKJH 3BA9A 5FD6A 2XIGA 2ZQEA 1V9PA 3OTOH 1N32H 1M0WA 2PT7G 4A2AA 3J80W 2UUAH 3L4JA 3RGXA 4A2BA 4B8CD 4E9JA 2Q2UA 3RJ0A 1P8LA 4MV7A 2WDTA 1SEIA 4AQYH 3GR5A 5BR8H 4RB1A 4EFEA 3QD7X 1X9NA 3FAUA 5LL6b 3KALA 4DR1H 1BGWA 4OD6A 4Q0YA 1SYXB 1N34H 3OETA 3JAMW 4EEQA 4UCVA 4FM9A 4IAJA 2YCHA 1GYFA 2VQFH 1FVIA 5LMUH 4JI7H 4ETSA 4LF8H 1Z2PX 1Z2NX 4GLXA 3KXYT 3BABA 2OWOA 3BA8A 3RF2A 4JI6H 3RTXA 4UFZA 3J81W 1HR0H 4RB3C 1DGSA 1E4GT 3F8NA 3PN1A 2VPSA 4J0MA 4X66H 4LMYA 2UXCH 4DV0H 4JV5H 4DR5H 3HXLA 1ZHQA 4I7HA 2UXBH 3JSLA 4CC5A 4DV6H 2FPHX 3EZJA 3H20A 5FPOA 3KAKA 4LH6A 2VKCA 4JI3H 1HNWH 2Y3MA 3N40P 4M7EA 4DV3H 4DV1H 4NXNH 4X62H 2UXDH 1HNXH 4RZQA 2KSWA 1XMOH 4LSAA 4OX9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ H;  4DUZ H;  4B3S H;  1N33 H;  3T1Y H;  4LFC H;  2UUC H;  4X65 H;  5FLX W;  2UUB H;  4JI4 H;  4DR6 H;  4B3R H;  4JI8 H;  4JYA H;  4JI0 H;  3J7A K;  4LFB H;  4DV5 H;  2F4V H;  4LF6 H;  1XMQ H;  1N36 H;  4B3M H;  4DR4 H;  4LFA H;  1IBL H;  5A2Q W;  2ZM6 H;  4JI2 H;  1XNR H;  4NXM H;  4JI5 H;  4DV2 H;  4LF7 H;  1XNQ H;  1AN7 A;  4DR3 H;  3T1H H;  4LF9 H;  4DUY H;  2VQE H;  4DV7 H;  4LF5 H;  4DV4 H;  4B3T H;  5IT9 W;  4K0K H;  4X64 H;  1S03 G;  4KHP H;  1FJG H;  2HHH H;  1IBK H;  4GKK H;  4YY3 H;  2E5L H;  4JI1 H;  4PDB A;  4DR7 H;  5LMN H;  4LF4 H;  1J5E H;  1FKA H;  1I6U A;  4YHH H;  1I94 H;  2UU9 H;  4DR2 H;  5IWA H;  1IBM H;  4GKJ H;  3OTO H;  1N32 H;  3J80 W;  2UUA H;  1SEI A;  4AQY H;  5BR8 H;  5LL6 b;  4DR1 H;  1N34 H;  3JAM W;  2VQF H;  5LMU H;  4JI7 H;  4LF8 H;  3RF2 A;  4JI6 H;  3J81 W;  1HR0 H;  4X66 H;  2UXC H;  4DV0 H;  4JV5 H;  4DR5 H;  2UXB H;  4DV6 H;  4JI3 H;  1HNW H;  4DV3 H;  4DV1 H;  4NXN H;  4X62 H;  2UXD H;  1HNX H;  1XMO H;  4OX9 H; 
#chains in the Genus database with same CATH topology
 1WSC A;  4NZT M;  3GAB A;  2MCT A;  1ZQ7 A;  3N43 B;  4MTE A;  1HNZ H;  2LTM A;  1KJQ A;  3DF7 A;  4YR3 A;  3L2P A;  4RUC A;  5C4X G;  2FLN A;  4MV1 A;  3H40 A;  4NLG A;  4MAM A;  5D1O A;  4LIJ A;  1RYR A;  2W9B A;  3T1Y H;  2JA7 G;  3PO2 G;  3JRW A;  5DGB A;  4LFC H;  1TUA A;  3I0P A;  4HNU A;  2Y0S A;  3OHA A;  3BQ0 A;  5HV6 A;  3GQC A;  5C44 G;  3MJF A;  4JYA H;  2YQR A;  4EG0 A;  1Y1V A;  4DL4 A;  3J7A K;  3MFH A;  1K83 A;  4ED0 A;  5KFP A;  2F4V H;  4FBU A;  4B3M H;  1ZTG A;  4LFA H;  2JEA I;  1KJ8 A;  5JVL A;  1CQI B;  2CZG A;  3N41 B;  4YP3 A;  1ULZ A;  2W6O A;  1JDB B;  3HBL A;  4ECS A;  3TIN A;  4G3I A;  2DIK A;  4MV9 A;  1EYZ A;  4DV2 H;  2JEI A;  2YZG A;  4LF7 H;  4MV4 A;  4EBD A;  1ODH A;  4RAY A;  4BY1 G;  2E2I A;  3UOE A;  2C2E A;  3IN5 A;  2M8W A;  3QFF A;  1ZZK A;  3VPD A;  4TQS A;  3T1H H;  2WAQ A;  3GV5 B;  2IA6 A;  4MA0 A;  4ED6 A;  1S68 A;  1SCU B;  4HNT A;  2VUG A;  5IYD G;  2HH3 A;  5IT9 W;  4ME6 A;  4K0K H;  1TWH A;  3I4N G;  1T3N A;  3BJY A;  5JUM A;  4A3F G;  4ECZ A;  1FJG H;  5C1P A;  3JZI A;  1Y1W G;  1IBK H;  4GKK H;  5KFF A;  4DL6 A;  3N6X A;  2BR0 A;  4YY3 H;  5KFR A;  4UCS A;  5DGA A;  2XGP A;  3Q2O A;  2Q2T A;  2JEB I;  2WE6 A;  2C28 A;  2V4Q A;  4HYK A;  2XCP A;  5T14 A;  4NBQ A;  5KFE A;  2W57 A;  1W93 A;  4QW9 A;  2R87 A;  2NUA B;  4QMF B;  4IR1 A;  1DV2 A;  3HOX G;  3QZ7 A;  5BPH A;  4DR2 H;  2ZDG A;  3MWD A;  5IWA H;  3OUZ A;  4MA5 A;  4UCO A;  5JQW A;  3PW4 A;  3KTM A;  2ZQE A;  3R5X A;  2FP4 B;  2OLS A;  1KHM A;  3J80 W;  1ZZJ A;  2FPG B;  4QW8 A;  2NU9 B;  4DL3 A;  3KHH A;  2JA8 G;  4A2B A;  3Q8S B;  4E9J A;  5KFA A;  1GSA A;  4ZOL F;  4J9K A;  2W70 A;  4AQY H;  3VKE A;  5KT2 A;  2YS7 A;  2FKL A;  3FAU A;  5LL6 b;  4O4H F;  4Y8V B;  4O3O A;  3K3P A;  5KFV A;  1VBG A;  2AGQ A;  4Q0Y A;  2BA0 A;  1EZ1 A;  4EEQ A;  1PQX A;  2FLP A;  4UCV A;  3GKU A;  5KFK A;  3HKZ A;  2A1S A;  4JI7 H;  2WB1 E;  3GIQ A;  4IZO A;  4RU9 A;  3GV8 B;  4LF8 H;  1GGO A;  1RJR A;  1Z2N X;  2I8C A;  2ASJ A;  2R7Z A;  2C35 B;  5F9N A;  3PR4 A;  2YRW A;  1K1G A;  4IFD G;  1GSH A;  4BBS G;  5KFS A;  2YS6 A;  5KFG A;  4ECQ A;  1X4M A;  5C5J A;  1N48 A;  1W96 A;  3MFI A;  3KHG A;  4J0M A;  4XYL B;  1S97 A;  3OHB A;  3GLK A;  1S20 A;  2V9W A;  5CB4 F;  1ZHQ A;  4FJS A;  2UVW A;  2DWC A;  2V4R A;  3H0G A;  4WD3 A;  4J9O A;  3JSL A;  3ORQ A;  5KFY A;  4CC5 A;  5KFC A;  2HVS A;  5FPO A;  5KFW A;  3KAK A;  2C22 A;  4JI3 H;  2FMR A;  3PW5 A;  3N40 P;  4DV3 H;  4DV1 H;  4NXN H;  4X62 H;  2UXD H;  2PN1 A;  2W6M A;  2KSW A;  1M0W A;  2RGV A;  4DL7 A;  1WH2 A;  3MWE A;  4IHJ F;  4O3Q A;  2W9B B;  1WCM A;  1AUV A;  4R8U B;  5IYC G;  2R8I A;  4UCU A;  4APM A;  1S0N A;  1ZHS A;  2J6U A;  5L1I A;  1M6V A;  2YZM A;  5KFD A;  2CWH A;  2XGQ A;  4X65 H;  4JV2 A;  4DR6 H;  4ZI7 F;  2UVR A;  2NU8 B;  4JI0 H;  3KDK A;  2FPP B;  4MTD A;  3GTK A;  3JSN A;  2E2H A;  4OCH A;  4DV5 H;  4C5A A;  1UG8 A;  5JVD F;  2R7Z G;  4DR4 H;  5I47 A;  2M05 A;  2JA5 A;  2YL2 A;  4HNV A;  5LA6 F;  3U1K A;  4F4X A;  4TV8 F;  4NXM H;  4BY7 G;  1V9N A;  5BPF A;  2DPI A;  3GTP A;  3OSS D;  3PZP A;  2OPV A;  2MJH A;  2X06 A;  3I12 A;  3N44 B;  5D1O B;  2FK1 A;  2X0S A;  5EWE A;  1AN7 A;  4U7C A;  1X9Z A;  4EGJ A;  1JDE A;  5KFB A;  3BAA A;  3V6K A;  5C0X G;  1DT4 A;  1DV1 A;  1F0X A;  3Q8Q B;  4DUY H;  2CKZ B;  1VKZ A;  2VQE H;  2DLN A;  3GTO A;  2W7P A;  4DL2 A;  5JH7 F;  4ED8 A;  4DV4 H;  4B3T H;  4QWB A;  5F9L A;  2HVR A;  2ZJT A;  2V58 A;  2FJZ A;  5EDW A;  5DLF A;  3RGZ A;  3QZ8 A;  1JIH A;  2CW7 A;  4KHP H;  2CPQ A;  3GID A;  1T36 A;  2LF0 A;  3EYY A;  5FLM G;  3RAX A;  4A93 G;  4J9N A;  4AYB A;  2AQ4 A;  4O3S A;  1I7L A;  3IG0 A;  1VS0 A;  3SB1 A;  4JV0 A;  3ETJ A;  4JI1 H;  1M7J A;  3U9T A;  2HH2 A;  2O4C A;  3VPB A;  2J9G A;  2WAQ E;  1B6R A;  5KT5 A;  2BQ3 A;  2FLL A;  4PDB A;  3HOZ G;  3BQ2 A;  3PO3 G;  4IRK A;  1KBL A;  4ECX A;  3FMA A;  5LMN H;  3WNZ A;  4AM3 A;  5DT9 A;  2PBZ A;  4LSX A;  1Y1W A;  1J5K A;  1I6U A;  1JXL A;  3LML A;  4DL5 A;  2DZD A;  1BJT A;  3CVZ A;  2UU9 H;  4XZ3 B;  2HJW A;  4WAL A;  4BWS C;  3BA9 A;  4ECY A;  5KG6 A;  4GKJ H;  5FD6 A;  4F4W A;  1C30 A;  2XIG A;  4BXX G;  1V9P A;  4A3J G;  3Q8P B;  1I50 A;  3OTO H;  4A2A A;  1ZET A;  5KT7 A;  5KFO A;  1RJQ A;  4IWY A;  3RGX A;  3L4J A;  2R92 G;  4A3K G;  3K5H A;  4ECU A;  4ECW A;  3RV3 A;  3EPG A;  1V51 A;  4J9R A;  3GR5 A;  2R7N A;  2YRX A;  4A3G G;  3TIG A;  4DR1 H;  3N8D A;  4HQ6 A;  3GTM A;  2BQU A;  1SYX B;  4TUY F;  3JAM W;  4Q43 A;  3RFC A;  3RAQ A;  5LXT F;  3V6H A;  4BA1 I;  1UC9 A;  1UNN C;  1FVI A;  4A3M G;  4ETS A;  4B8T A;  4XX0 B;  2W9A A;  3RB0 A;  2CTJ A;  3T5J A;  2IP4 A;  2W6P A;  5KFJ A;  2AU0 A;  3KXY T;  5CA0 F;  3G6Y A;  2R93 G;  2K1H A;  1EC6 A;  3BAB A;  4H8A A;  2CQY A;  4IRD A;  3BA8 A;  3V69 A;  3G8C A;  5KFH A;  3RF2 A;  4JI6 H;  3RTX A;  4UFZ A;  1E4E B;  5L9X A;  4F4Z A;  3R23 A;  4QWC A;  1DGS A;  3F8N A;  4BA2 I;  2V5A A;  3PN1 A;  5CA1 F;  2VPS A;  4X66 H;  3PVX A;  4JV1 A;  4DV0 H;  3OUU A;  4YAJ B;  2QK4 A;  1KJ9 A;  4RNN A;  4AIM A;  4ED3 A;  2B63 A;  3JRX A;  2C00 A;  2C2R A;  2Y0S E;  2JEG A;  3GV7 B;  5IYB G;  5KG3 A;  5KG7 A;  1HNW H;  3GII A;  4EYH B;  2UVU A;  1WHR A;  4C5C A;  3FKI A;  4A3I G;  2LTL A;  4EEY A;  4A3B G;  4A3E G;  3TII A;  1XMO H;  1EHI A;  3HB9 A;  1Z2O X;  2NU6 B;  1N33 H;  4B3S H;  5LP6 F;  2ATL A;  3R5H A;  1S0M A;  2R8J A;  4EC5 A;  3T5K A;  5IP7 G;  3H4D A;  1TAE A;  2JA6 A;  1PK8 A;  1RJP A;  4Q45 A;  3Q8R B;  1VAJ A;  3PW0 A;  2RF4 A;  3KAJ A;  3U9S A;  2JA7 A;  2VR1 A;  4JI4 H;  2VUM G;  3L7Z C;  4B3R H;  2W8K A;  4IRC A;  5DG8 A;  4JI8 H;  4J9Q A;  1J4W A;  5JEA G;  1WVN A;  1WCM G;  1JKJ B;  1E4E A;  4CC6 A;  4YAK B;  1XDN A;  1RK5 A;  1R9T A;  1Y1V G;  5EWF A;  2XC9 A;  4ED7 A;  4RZR A;  1K1S A;  2R6F A;  1N36 H;  1C3O A;  1GO3 E;  4QWA A;  1IBL H;  5A2Q W;  4MV6 A;  3GIL A;  2ZM6 H;  4JI2 H;  3PW2 A;  2GPS A;  2R8G A;  5KG2 A;  4ECV A;  2GLT A;  4HR7 A;  2LRR A;  2JE6 I;  2WB1 A;  4XYM B;  3M9O B;  2OH2 A;  1JX4 A;  2I80 A;  3SE7 A;  3KHL A;  2NVX A;  5IYZ F;  3GIJ A;  2IMW P;  5H80 A;  3V4S A;  1TWA A;  2RDI A;  5K36 G;  4RB0 A;  2BL5 A;  5KG0 A;  1TWF A;  1CQJ B;  4JUZ A;  2P0A A;  3HKZ E;  2W8L A;  3C0F B;  5KFL A;  2VQD A;  1NXU A;  2JEJ A;  2SCU B;  2R84 A;  2R86 A;  2VPQ A;  3BG5 A;  4DV7 H;  5EOY A;  3MR2 A;  2JVZ A;  3VMM A;  5IP9 G;  3N42 B;  3WO0 A;  4LF5 H;  5HBR B;  4EBC A;  3Q1K A;  3T5H A;  2NN6 G;  2PMZ A;  1S03 G;  1TWC A;  3RIZ A;  3GIP A;  5D8D A;  4QIW A;  1Y14 B;  4O2A F;  4O4I F;  1A0I A;  4RAZ A;  4O3P A;  4YR2 A;  5KFM A;  2D9I A;  2WYO A;  2HHH H;  3LWB A;  2JA6 G;  1GSO A;  4J9P A;  4UCT A;  1VIG A;  2R7K A;  4YJ3 F;  3M4I A;  1A9X A;  4F50 A;  3K3V A;  2R7L A;  4MV3 A;  5DLG A;  5LYJ F;  1DIK A;  4EGQ A;  1S9F A;  2BQR A;  3LP8 A;  2FE3 A;  3V4Z A;  5KT4 A;  4ECR A;  5FD5 A;  2VA3 A;  2VUM A;  1V8C A;  2HVQ A;  4R7R A;  3TQT A;  4J9M A;  3GTJ A;  1O75 A;  4EYI B;  4FS2 A;  2R92 A;  4ZHQ F;  3BQ1 A;  3MWM A;  1J5E H;  1FKA H;  1MSZ A;  5KG4 A;  1L2Z A;  4F4Y A;  1WE8 A;  4R8U A;  2VOB A;  5DG7 A;  4AYB E;  1EUC B;  3NGD A;  1N32 H;  1UC8 A;  2UUA H;  1AUX A;  1KJI A;  2YW2 A;  5EZY F;  4FU0 A;  3RBD A;  2C2D A;  3RJ0 A;  1P8L A;  3FDS A;  4MV7 A;  1I3Q A;  5L1J A;  2WDT A;  5KFI A;  4IR9 A;  5BR8 H;  5KKN B;  1T94 A;  2QND A;  3PR5 B;  2IBK A;  5EWG A;  3KAL A;  5KFT A;  5LOV F;  4J9L A;  1BGW A;  3UFX B;  1BNC A;  4FS1 A;  3OET A;  2JA9 A;  3VPC A;  2PY9 A;  3G6V A;  4FM9 A;  2YCH A;  3R5F A;  2VQF H;  2ANN A;  2W9C B;  1S10 A;  2J6T A;  2DGR A;  1Z2P X;  2JA5 G;  4GLX A;  2CPM A;  2PQU A;  3K5I A;  3MR3 A;  2OWO A;  4MV8 A;  5KT3 A;  1SFO A;  2J6S A;  3GIK A;  2NU7 B;  5K2M A;  4FBT A;  2E3U A;  1B6S A;  1VIH A;  2OPU A;  1IOV A;  4O3R A;  5KFU A;  1RK6 A;  4LMY A;  4QWE A;  3KHR A;  4WBN F;  4JV5 H;  4DR5 H;  3HXL A;  4WAN A;  4I7H A;  2UXB H;  2G8Y A;  3H20 A;  3EZJ A;  5KFX A;  2WTF A;  4GC6 A;  4I4T F;  3HOW G;  4O3N A;  2Y3M A;  4EBE A;  4M7E A;  4ZQI A;  2ASL A;  4JVH A;  2UVV A;  1E4F T;  2UXC H;  2RDJ A;  2ANR A;  3L4K A;  5GON F;  3RUP A;  2CTF A;  4DUZ H;  1WTJ A;  3HOU G;  1X0A A;  5C1O A;  2FK2 A;  2CW8 A;  3H4B A;  2W71 A;  2CWF A;  1CS0 A;  1OWT A;  1RYS A;  2AXY A;  2R8K A;  3PW7 A;  3MR6 A;  3SI8 A;  2W9C A;  1TA8 A;  2UUC H;  1VBI A;  4RNO A;  5FLX W;  2UUB H;  4QJF A;  3M9M B;  3RBE A;  3I4M G;  4PWQ A;  2Z0S A;  4UCR A;  4ED1 A;  4I50 F;  2RGR A;  4LFB H;  2AGP A;  1I7N A;  3V6J A;  3H3V H;  4LF6 H;  1XMQ H;  3RB4 A;  5FPR A;  4NZR M;  2FB9 A;  3AYH B;  2DPJ A;  2CTE A;  1XNR H;  5J2T F;  1X4N A;  4I55 F;  2FMA A;  3OSN A;  1KEE A;  3HOV G;  4JI5 H;  4JVY A;  1CE8 A;  3AEV B;  3ORR A;  4C2M A;  1M0T A;  1XNQ H;  1TWG A;  1KJJ A;  5DQG A;  4YR0 A;  2YU9 A;  1MZB A;  4LH7 A;  5D1P A;  4YBZ B;  5FJ8 G;  4C5B A;  4DR3 H;  1B33 N;  3NCV A;  5L1L A;  5KG1 A;  4EFB A;  1DTJ A;  4LF9 H;  1K1Q A;  1GLV A;  4QIW E;  5DG9 A;  2VA2 A;  5KX5 F;  2NVY A;  4LSA A;  2CTK A;  3UQ8 A;  5KT6 A;  1EUD B;  4Q8E A;  2AGO A;  4X64 H;  4RB2 C;  3OSP A;  3ETH A;  3KDG A;  2W6Z A;  2XCA A;  2B63 G;  2YYA A;  2O03 A;  4A3C G;  2FK3 A;  5DQI A;  3H0G G;  1B04 A;  2V59 A;  2E5L H;  2W7O A;  1ZZI A;  3HOY G;  2CTM A;  1BXR A;  4G08 A;  2HGS A;  5C8Y F;  3GTL A;  5DQH A;  4DR7 H;  3GTQ A;  5CAE B;  5BMV F;  3M9N B;  3E5N A;  4O2B F;  4BBR G;  4LF4 H;  2R85 A;  5L1K A;  3RV4 A;  3T5L A;  4YHH H;  3TQ1 A;  1I94 H;  1V4Y A;  3FKI G;  5KG5 A;  1IBM H;  4TQR A;  1KC7 A;  4A3L G;  4FJU A;  2PVP A;  3RB3 A;  1S0O A;  2PT7 G;  2YZN A;  4TV9 F;  4YQW A;  4RNM A;  2M6Q A;  4B8C D;  4DLK A;  2W6N A;  4Q44 A;  2Q2U A;  2R7M A;  3GIM A;  1SEI A;  3GTG A;  4YB8 B;  2R82 A;  4RB1 A;  3EPI A;  4EFE A;  3QD7 X;  1X9N A;  4Q8F A;  4A3D G;  4OO1 G;  4IWX A;  3MR5 A;  2GPW A;  4OD6 A;  2ZDH A;  4L1K A;  4J9S A;  1N34 H;  4ED2 A;  4IAJ A;  1GYF A;  3WO1 A;  5LMU H;  5J2U F;  2R93 A;  4U6P A;  2JEF A;  2W6Q A;  2P2R A;  4RUA A;  4ECT A;  2QYZ A;  2XD4 A;  2XCL A;  2ZDQ A;  3J81 W;  2ASD A;  4E4T A;  2PMZ E;  1HR0 H;  1VBH A;  2CTL A;  4RB3 C;  1E4G T;  4YJ2 F;  5KFZ A;  3RB6 A;  4O4L F;  5KFN A;  2ALZ A;  1PX2 A;  4M9U A;  2JZX A;  5KFQ A;  1JLL B;  1N56 A;  1XRH A;  2R8H A;  1WR2 A;  4DV6 H;  2FPH X;  4LH6 A;  2FPI B;  2VKC A;  4QWD A;  1IOW A;  3CQZ A;  4GC7 A;  2I87 A;  2FFM A;  1HNX H;  5C3E G;  4RZQ A;  3G6X A;  1Z2I A;  4OX9 H; 
#chains in the Genus database with same CATH homology
 2MCT A;  4NZT M;  3GAB A;  2RGV A;  3L4K A;  3N43 B;  1Z2O X;  1WH2 A;  1HNZ H;  4DUZ H;  4B3S H;  1N33 H;  3DF7 A;  4MTE A;  3L2P A;  4EC5 A;  2CW8 A;  1TAE A;  4UCU A;  4APM A;  2HVS A;  1ZHS A;  5D1O A;  3T1Y H;  3KAJ A;  4LFC H;  1TA8 A;  2UUC H;  4X65 H;  5FLX W;  2UUB H;  4JI4 H;  4DR6 H;  4B3R H;  4JI8 H;  4JYA H;  4JI0 H;  4UCR A;  3KDK A;  4CC6 A;  4MTD A;  1XDN A;  3J7A K;  2RGR A;  3JSN A;  4OCH A;  4LFB H;  4DV5 H;  2F4V H;  4LF6 H;  1XMQ H;  1N36 H;  4B3M H;  4DR4 H;  4LFA H;  5FPR A;  1IBL H;  5A2Q W;  2ZM6 H;  4JI2 H;  4NZR M;  3N41 B;  1XNR H;  4NXM H;  4MV9 A;  4JI5 H;  4DV2 H;  1M0T A;  3OSS D;  4LF7 H;  1XNQ H;  1E4F T;  1ODH A;  1MZB A;  4RAY A;  4LH7 A;  3N44 B;  5D1P A;  5D1O B;  4RB0 A;  1AN7 A;  4DR3 H;  1X9Z A;  3BAA A;  3NCV A;  3T1H H;  4EFB A;  3C0F B;  4LF9 H;  1S68 A;  1F0X A;  4DUY H;  2VQE H;  2VUG A;  4DV7 H;  5EOY A;  3UQ8 A;  3N42 B;  4LF5 H;  4DV4 H;  4B3T H;  5IT9 W;  4K0K H;  2HVR A;  4X64 H;  2ZJT A;  1S03 G;  4RB2 C;  3RIZ A;  3KDG A;  3RGZ A;  2CW7 A;  2O03 A;  4KHP H;  1FJG H;  1A0I A;  2LF0 A;  3EYY A;  4RAZ A;  2D9I A;  2WYO A;  2HHH H;  1IBK H;  4GKK H;  1B04 A;  1VS0 A;  3SB1 A;  3IG0 A;  4YY3 H;  3N6X A;  4UCT A;  3M4I A;  4UCS A;  3K3V A;  2E5L H;  4JI1 H;  2O4C A;  2Q2T A;  2WE6 A;  4PDB A;  2FE3 A;  4G08 A;  2HGS A;  5FD5 A;  4DR7 H;  2HVQ A;  4R7R A;  2W57 A;  5LMN H;  1O75 A;  3FMA A;  5DT9 A;  4LF4 H;  3MWM A;  4LSX A;  1J5E H;  1FKA H;  1I6U A;  4YHH H;  3LML A;  3CVZ A;  1I94 H;  1BJT A;  2UU9 H;  1L2Z A;  4DR2 H;  4BWS C;  4UCO A;  5IWA H;  1IBM H;  2VOB A;  4GKJ H;  3BA9 A;  5FD6 A;  2XIG A;  2ZQE A;  1V9P A;  3OTO H;  1N32 H;  1M0W A;  2PT7 G;  4A2A A;  3J80 W;  2UUA H;  3L4J A;  3RGX A;  4A2B A;  4B8C D;  4E9J A;  2Q2U A;  3RJ0 A;  1P8L A;  4MV7 A;  2WDT A;  1SEI A;  4AQY H;  3GR5 A;  5BR8 H;  4RB1 A;  4EFE A;  3QD7 X;  1X9N A;  3FAU A;  5LL6 b;  3KAL A;  4DR1 H;  1BGW A;  4OD6 A;  4Q0Y A;  1SYX B;  1N34 H;  3OET A;  3JAM W;  4EEQ A;  4UCV A;  4FM9 A;  4IAJ A;  2YCH A;  1GYF A;  2VQF H;  1FVI A;  5LMU H;  4JI7 H;  4ETS A;  4LF8 H;  1Z2P X;  1Z2N X;  4GLX A;  3KXY T;  3BAB A;  2OWO A;  3BA8 A;  3RF2 A;  4JI6 H;  3RTX A;  4UFZ A;  3J81 W;  1HR0 H;  4RB3 C;  1DGS A;  1E4G T;  3F8N A;  3PN1 A;  2VPS A;  4J0M A;  4X66 H;  4LMY A;  2UXC H;  4DV0 H;  4JV5 H;  4DR5 H;  3HXL A;  1ZHQ A;  4I7H A;  2UXB H;  3JSL A;  4CC5 A;  4DV6 H;  2FPH X;  3EZJ A;  3H20 A;  5FPO A;  3KAK A;  4LH6 A;  2VKC A;  4JI3 H;  1HNW H;  2Y3M A;  3N40 P;  4M7E A;  4DV3 H;  4DV1 H;  4NXN H;  4X62 H;  2UXD H;  1HNX H;  4RZQ A;  2KSW A;  1XMO H;  4LSA A;  4OX9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...