3J80W

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
129
structure length
129
Chain Sequence
TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 27
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3j80W01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3j80W02
3J81W 4JI2H 2E5LH 4GKKH 4DUYH 5LL6b 5BR8H 4JI7H 5LMUH 3OTOH 1XNRH 4X65H 4B3MH 3RF2A 4B3SH 1I6UA 1N32H 5LMNH 4PDBA 5A2QW 2UUAH 4JI1H 4OX9H 4LFCH 4JI0H 4JI8H 1N36H 2UUBH 2UUCH 3T1HH 3JAMW 4LFBH 2UXBH 3J7AK 4JI6H 4LF9H 4DV7H 4B3RH 4LF4H 4YY3H 1N34H 2HHHH 4YHHH 4KHPH 2F4VH 4LFAH 4DR2H 1IBLH 1FKAH 4AQYH 2VQFH 4DR3H 4DV4H 4JV5H 4DR4H 1S03G 4X64H 1I94H 1HR0H 4DUZH 1IBMH 1N33H 2UXCH 1AN7A 2ZM6H 4JI3H 4DR7H 1J5EH 4LF7H 2VQEH 4DV5H 4GKJH 1IBKH 1FJGH 1XMOH 1HNXH 1XNQH 4DV0H 2UU9H 4LF8H 3J80W 4DR5H 1XMQH 1HNWH 4DR6H 4DV3H 4DV2H 5IT9W 4DV6H 5IWAH 4NXMH 4DV1H 1HNZH 4NXNH 4B3TH 4LF6H 4DR1H 4K0KH 4LF5H 4JI4H 1SEIA 4X62H 4X66H 2UXDH 4JI5H 4JYAH 5FLXW 3T1YH
chains in the Genus database with same CATH superfamily
4O3RA 4RB0A 3J81W 2FK2A 5FD5A 4JI2H 3K5IA 2FP4B 1KHMA 4WD3A 5C44G 2XIGA 4BBSG 4EC5A 5LL6b 1JIHA 3V6HA 3I12A 5IYDG 2P0AA 2JEFA 4DL6A 2W6MA 3N6XA 3EZJA 5KFIA 3BAAA 4A2BA 4YBZB 1S68A 5KFGA 5KT2A 4Q8FA 4ED3A 2Q2UA 1I6UA 4I7HA 3G6XA 4RB3C 3GIJA 1Z2IA 4A2AA 2QYZA 5KFJA 3RIZA 3MR3A 1A9XA 4UCUA 3GIMA 5KFVA 1Y1WG 2ANRA 1V4YA 3GLKA 5KT6A 4UCTA 4ED0A 2AGPA 2LTLA 2NU7B 1MZBA 4QMFB 2JVZA 1PK8A 4LFCH 4IRCA 1TAEA 3L7ZC 4NZRM 3Q8PB 2HVSA 4QWAA 4GC7A 2JA5G 2M6QA 1B04A 4YP3A 4G3IA 5I47A 3MR6A 1KJ9A 5BPHA 5KFHA 1GYFA 4A3BG 3T1HH 4JV0A 5KFPA 2JA7G 3J7AK 1DV2A 2AU0A 2HH3A 3T5HA 2FB9A 2MJHA 2VUMA 3OSPA 5EOYA 2I80A 3GIQA 2AQ4A 1N34H 2PMZA 4O4HF 3UQ8A 3GQCA 2M05A 3H4DA 4GLXA 1X9NA 3GTMA 2FMAA 4CC6A 4A3CG 5LYJF 4YHHH 1JX4A 3V4SA 4LFAH 4LH6A 4ZQIA 4DR2H 4I50F 4O3PA 2V58A 3N44B 3JRWA 2WYOA 4OD6A 2JEGA 4J9NA 4ECQA 1S0NA 3I0PA 4MV8A 5KFOA 4E9JA 1M0TA 4ECTA 3M4IA 2WTFA 3I4MG 4X64H 2YU9A 4FBTA 1E4FT 1Y14B 2E3UA 2R87A 1C3OA 4FJUA 4DUZH 4OCHA 2VOBA 1WTJA 1N33H 5KFBA 3KHHA 4EBCA 2XCPA 1DV1A 3RBDA 2ZM6H 4LIJA 3OSSD 4JI3H 1Z2NX 4IWXA 4ED6A 2JA6A 4LF7H 2VQEH 4DV5H 4TV8F 1I50A 2W7OA 3GTKA 5F9LA 4AM3A 3BABA 1V8CA 4QW8A 4A93G 2E2IA 2XD4A 4TUYF 2UVRA 3H3VH 1XNQH 2UU9H 5KT4A 1Z2PX 3RGZA 5DT9A 3J80W 1KEEA 2YZNA 1KBLA 4TQRA 3GILA 5EDWA 4AIMA 1V9NA 3QZ8A 1XMQH 1HNWH 2I8CA 4Q45A 4DLKA 2NU6B 3GTPA 2PN1A 1X0AA 1S20A 4DV2H 4DV3H 2FLNA 2R7KA 2OWOA 4UCOA 1S0OA 5EWGA 1OWTA 3OSNA 4ED2A 2CPMA 5IWAH 4LMYA 2VUGA 1JLLB 3JZIA 3G6VA 3R5FA 3U1KA 1ZZJA 3AYHB 1F0XA 4L1KA 4RZRA 3GTJA 4M9UA 3Q8SB 4DR1H 4K0KH 4HYKA 2OLSA 4NZTM 2VUMG 4LF5H 5KG3A 4RNNA 1BXRA 2W71A 1VBGA 3FAUA 5KFZA 4QWBA 2V4RA 2YS7A 1GO3E 4HNVA 4A3MG 3GABA 3WO0A 1BGWA 5IP9G 4ECZA 3R23A 5KFQA 1M7JA 5KG6A 2KSWA 1UNNC 4AYBE 2ATLA 1VAJA 1I7NA 5C1PA 2FLLA 2IA6A 4F50A 2W6OA 3RBEA 3HXLA 4JYAH 2UVUA 4A3EG 1P8LA 3QD7X 2GLTA 2CW8A 3N40P 2O03A 3RFCA 2R8GA 4AYBA 3Q8RB 1KJIA 4RZQA 2VKCA 2D9IA 2R84A 3GIDA 4EFBA 1TUAA 5BR8H 2DWCA 5KFTA 3GTOA 2JA5A 1BJTA 4A3DG 3WO1A 4F4XA 2FJZA 3SI8A 4FJSA 2I87A 2W6QA 4EG0A 4NLGA 5KKNB 2XGQA 1GSHA 4X65H 2X0SA 2JZXA 3U9SA 1ZHQA 5JVLA 1N32H 4B3SH 4C5CA 2P2RA 4PWQA 4EBEA 4A3KG 3M9NB 1X4NA 4O2AF 4QJFA 4YAJB 5KFCA 5KG1A 5C8YF 2ZDHA 2UUAH 1PQXA 3CQZA 5KG5A 4YR2A 3GV8B 3ETHA 4J9QA 4ECRA 1A0IA 1N48A 2WE6A 4IR1A 3H0GA 4YR0A 4J9KA 2FK3A 2XCLA 4O4LF 4EYHB 2J6UA 4MV9A 1DGSA 4IAJA 3K5HA 1N36H 3VPCA 2J6TA 4ED8A 2UUCH 3VPBA 1E4EA 3JAMW 4E4TA 5EWEA 3N42B 4ZHQF 3ORQA 2CTFA 4LF9H 4F4WA 4BA2I 3TQ1A 3H20A 4LF4H 5HV6A 4IFDG 1VBIA 2Z0SA 4ZOLF 3IN5A 1R9TA 1CQIB 2ANNA 4B8TA 2VA2A 4ED7A 2BL5A 1SCUB 2FMRA 5KFDA 4TQSA 1IBLH 2B63G 1EUCB 4BWSC 1ZZKA 4AQYH 4HR7A 4BY1G 1KJJA 1GSOA 3L4JA 3N8DA 3BQ1A 2K1HA 5KFWA 2AGOA 1K1QA 2FPHX 2VQDA 4MTDA 2RGRA 3GIIA 2CTLA 4DR4H 4XX0B 2X06A 1Y1VG 4MV3A 3U9TA 3VMMA 1WR2A 3PW0A 1I94H 3MWEA 3Q8QB 2J6SA 5KFFA 4O3QA 4RUCA 2JEIA 2CTEA 2PMZE 1AN7A 5DQGA 1RJQA 1J5EH 4EGJA 4O3NA 4WALA 1FJGH 2CWFA 5FPOA 2V9WA 1IOWA 4JV2A 2WB1E 5K2MA 2NVXA 4J0MA 1X9ZA 2YRWA 3PN1A 5JH7F 2A1SA 2C28A 2O4CA 3HKZA 5JUMA 3RB0A 2IMWP 4TV9F 4LSAA 2W8KA 2RGVA 2CZGA 3FKIG 4RNMA 2FPGB 4YAKB 2V4QA 3V6JA 2WB1A 3UFXB 3MWMA 3H0GG 2R7NA 5JVDF 1TWGA 4G08A 3OETA 3JRXA 4Y8VB 2CTJA 2W9BB 4DV1H 4ECUA 1HNZH 1VIHA 5L9XA 4YQWA 3ETJA 2C00A 4YB8B 4LF6H 4J9MA 1WVNA 5KG0A 1X4MA 4XYLB 4WBNF 5KT7A 5EWFA 3GV7B 3EPGA 1EZ1A 4DL2A 3BQ2A 4HQ6A 1SEIA 4ZI7F 3HOUG 1JDBB 3LMLA 2W57A 2W9BA 2WAQA 3GR5A 3NCVA 4QWDA 4EBDA 4YJ2F 4RUAA 4BY7G 2YS6A 2VR1A 1V51A 1VKZA 2UXDH 2W9CA 4GC6A 2MCTA 1ZZIA 4MV1A 3AEVB 3HB9A 5T14A 2QK4A 4Q44A 3T1YH 3PR4A 1I7LA 2M8WA 5KT5A 1ZETA 1CQJB 3KAJA 2CTMA 3K3PA 1SFOA 1UC8A 4I55F 2AGQA 1WCMG 2ZJTA 3FDSA 3RUPA 4HNUA 2LF0A 1JDEA 4UCSA 5DG8A 1Z2OX 2OPVA 4I4TF 4MV7A 1L2ZA 1EUDB 2R86A 2SCUB 3EYYA 4M7EA 1J4WA 2CKZB 3DF7A 1AUVA 2GPWA 1XNRH 4UCVA 3BA9A 3RF2A 5C0XG 2IP4A 2JA9A 1RK5A 3Q2OA 3QZ7A 4O4IF 4F4YA 2YZGA 1DT4A 5EZYF 2XCAA 4PDBA 5IYZF 2NU8B 2R8IA 3MJFA 5A2QW 2NVYA 3V69A 2CPQA 3ORRA 4ED1A 1V9PA 3RV3A 3PZPA 2HVRA 4YR3A 2CWHA 4J9PA 4OX9H 2B63A 2Y0SE 3JSLA 3CVZA 4R8UB 2R92A 2E2HA 2PY9A 2R82A 2YQRA 1GGOA 3T5KA 1K1GA 3VKEA 1S10A 3OUUA 4XYMB 5CAEB 2C2DA 1Y1VA 5C5JA 2UXBH 2NN6G 3L2PA 2Y0SA 2YW2A 1ZTGA 2LTMA 4JI6H 2FLPA 3RB6A 1RK6A 3K3VA 3GIKA 4B3RH 5L1KA 1S97A 3N43B 5DGAA 5KFUA 4J9LA 5IYBG 5D8DA 3HOZG 1RJPA 4R8UA 4A3JG 4YY3H 2PVPA 4QW9A 4FBUA 4J9SA 2HHHH 4RNOA 1SYXB 3TIGA 4KHPH 2F4VH 4C5BA 1E4EB 4QIWA 3PO2G 2DZDA 3MFHA 1FKAH 2UVWA 2VQFH 1EYZA 2W70A 5IYCG 3KAKA 5LOVF 4BA1I 3FKIA 4IZOA 1KJ8A 3MWDA 4J9RA 1S0MA 5IP7G 2R7LA 1S03G 2AXYA 1CE8A 2RF4A 2ZQEA 3R5XA 3RTXA 5LP6F 1DTJA 1CS0A 2R7MA 1NXUA 5KX5F 3IG0A 5CA1F 2R8KA 2J9GA 3GTLA 1W93A 2PBZA 3KXYT 5LA6F 2UXCH 2DLNA 4DR7H 4UFZA 2R7ZA 4QWCA 2JA8G 1FVIA 4R7RA 3TIIA 2PQUA 4GKJH 5C3EG 1IBKH 1KJQA 1XMOH 1ZHSA 1HNXH 1W96A 2W6ZA 3V4ZA 2RDJA 4ECXA 2ASJA 5CA0F 3RB4A 4LH7A 3RGXA 4LF8H 2HGSA 5LXTF 2YCHA 4DR5H 5GONF 5D1OB 2W9AA 3SE7A 3KHRA 5DQHA 4DL4A 1MSZA 4LSXA 5IT9W 4U6PA 5FJ8G 2R92G 5C4XG 4HNTA 1M6VA 3PW7A 3E5NA 3KHGA 1VIGA 5KG4A 2BQUA 2C22A 4MV4A 1KC7A 2G8YA 4EEQA 4F4ZA 2C2RA 4NXNH 1TWCA 4IRDA 1M0WA 3KDKA 4DL7A 4B3TH 4EYIB 4NBQA 3H4BA 5D1OA 4JUZA 1DIKA 3G6YA 2BQRA 5DG7A 3HKZE 1WCMA 3OHBA 3BG5A 2FPIB 3GKUA 2CW7A 5DG9A 3F8NA 2DIKA 2HJWA 4DL3A 1BNCA 2V59A 3FMAA 2XGPA 3MFIA 2RDIA 4A3GG 4WANA 4RB1A 2R8HA 1E4GT 4C5AA 4MAMA 3HOXG 4JI5H 4J9OA 2ZDQA 4O3SA 5DLGA 1RJRA 2CQYA 3HBLA 2VA3A 3LWBA 3PO3G 4IRKA 3GIPA 2E5LH 4GKKH 4CC5A 4O2BF 4DUYH 2R93G 5KT3A 1T94A 3KHLA 1EC6A 3JSNA 3T5LA 4H8AA 4JI7H 3PR5B 3Q1KA 2DPIA 2R7ZG 5L1IA 3L4KA 4EFEA 2WAQE 5LMUH 2W9CB 1WH2A 3OTOH 1VS0A 4U7CA 2ZDGA 3TQTA 4FU0A 5KFYA 4RU9A 1IOVA 5H80A 2NUAB 1ULZA 1ZQ7A 4B3MH 2LRRA 3VPDA 5BMVF 2C2EA 4FM9A 5HBRB 3UOEA 4MA5A 5DQIA 1GLVA 5LMNH 1S9FA 2BQ3A 5JEAG 3BQ0A 5DLFA 4FS2A 4A3FG 5KFLA 1B33N 2NU9B 1TWAA 5J2UF 3C0FB 4EGQA 1B6SA 4JI1H 1K1SA 3R5HA 5KFXA 3GTGA 2OPUA 4ECSA 2DPJA 5FLMG 4JI0H 4JV1A 4Q8EA 5KFRA 4JI8H 2ASLA 2Y3MA 1TWFA 1TA8A 1UG8A 1C30A 2V5AA 2FFMA 4QWEA 2UUBH 2CTKA 1J5KA 1PX2A 3SB1A 4LFBH 2VPSA 4B8CD 2W7PA 4EEYA 5C1OA 4APMA 2WDTA 5J2TF 2YYAA 4YJ3F 4ETSA 3PW4A 4DV7H 3H40A 1JKJB 3MR5A 5DGBA 1WHRA 2HH2A 2YZMA 2PT7G 2OH2A 5K36G 3G8CA 2C35B 5D1PA 3EPIA 5KG2A 4UCRA 2Q2TA 1RYRA 1EHIA 1WE8A 3KALA 4DL5A 5KFEA 1I3QA 3RB3A 4A3LG 3N41B 4MTEA 3BA8A 4DR3H 5KFKA 4DV4H 1B6RA 3NGDA 4JV5H 2XC9A 2JEAI 1XDNA 3LP8A 2JEBI 3OUZA 4IWYA 1JXLA 4BBRG 4IR9A 4JVYA 1HR0H 1IBMH 3WNZA 2FKLA 5FPRA 4ECWA 3RV4A 5KFNA 4Q0YA 4RAYA 3KDGA 3PVXA 4ECVA 2GPSA 2QNDA 2R85A 5CB4F 2ALZA 3HOWG 1RYSA 1UC9A 2YRXA 4QIWE 3TINA 4MA0A 5KFAA 4DV0H 5FD6A 1XRHA 2ASDA 2YL2A 3RJ0A 1ODHA 3QFFA 1T36A 1K83A 2HVQA 1O75A 4DR6H 3KTMA 3BJYA 2FPPB 3HOVG 1Y1WA 3V6KA 5F9NA 4FS1A 2W8LA 2VPQA 4DV6H 4NXMH 4OO1G 3T5JA 4ME6A 1N56A 4Q43A 1VBHA 4O3OA 3M9OB 2R6FA 2UVVA 2JA6G 5BPFA 3HOYG 3OHAA 2FK1A 3RAXA 5KFSA 1T3NA 4BXXG 2IBKA 2R93A 1GSAA 3PW2A 2R8JA 4C2MA 4IHJF 3I4NG 4JI4H 4A3IG 3MR2A 4X62H 1WSCA 2JA7A 3PW5A 2JE6I 4RB2C 4MV6A 4JVHA 3M9MB 5KG7A 5JQWA 2W6PA 2DGRA 2FE3A 2BR0A 2JEJA 3GV5B 1TWHA 5KFMA 1AUXA 4X66H 2BA0A 5L1LA 4ECYA 3GTQA 4RAZA 3RAQA 2W6NA 5FLXW 5L1JA 4XZ3B
chains in the Genus database with same CATH topology
4RB0A 3J81W 2O03A 3N40P 5FD5A 4JI2H 2E5LH 4GKKH 3KAJA 4CC5A 4RZQA 2VKCA 2D9IA 4DUYH 4EC5A 5LL6b 2XIGA 4EFBA 2ZJTA 3JSNA 5BR8H 4JI7H 2LF0A 1BJTA 4UCSA 1Z2OX 4EFEA 4MV7A 3L4KA 3N6XA 4A2BA 3EZJA 5LMUH 3BAAA 1WH2A 3OTOH 1VS0A 3EYYA 1S68A 4M7EA 3DF7A 1L2ZA 1XNRH 4UCVA 4X65H 4B3MH 2Q2UA 1ZHQA 3BA9A 3RF2A 4B3SH 1I6UA 1N32H 4I7HA 4RB3C 4FM9A 4A2AA 5LMNH 3RIZA 4PDBA 4UCUA 5A2QW 2UUAH 1V9PA 4UCTA 2HVRA 3C0FB 1A0IA 4JI1H 1MZBA 2WE6A 4OX9H 4LFCH 4JI0H 3JSLA 3CVZA 1TAEA 4NZRM 2HVSA 4JI8H 2Y3MA 1TA8A 4MV9A 1DGSA 4IAJA 1N36H 1B04A 1GYFA 2UUBH 2UUCH 3T1HH 3JAMW 3SB1A 4LFBH 2VPSA 4B8CD 2UXBH 3N42B 3L2PA 3J7AK 2WDTA 4APMA 4ETSA 4JI6H 4LF9H 5FD6A 4DV7H 3K3VA 4B3RH 4LF4H 3H20A 3N43B 5EOYA 4YY3H 1N34H 3UQ8A 2PT7G 1X9NA 2HHHH 4GLXA 2Q2TA 1SYXB 5D1PA 4UCRA 4CC6A 4YHHH 4KHPH 2F4VH 3KALA 4LFAH 4LH6A 4DR2H 1IBLH 3N41B 4MTEA 1FKAH 3N44B 4AQYH 2VQFH 3BA8A 2WYOA 4BWSC 4DR3H 4OD6A 4DV4H 3KAKA 3L4JA 4JV5H 2RGRA 1XDNA 2FPHX 4MTDA 4DR4H 4E9JA 1M0TA 1S03G 3M4IA 4X64H 2ZQEA 1E4FT 3RTXA 1I94H 1HR0H 4DUZH 4OCHA 1IBMH 1N33H 2VOBA 3IG0A 3KXYT 5FPRA 2UXCH 4UFZA 1AN7A 2ZM6H 3OSSD 4JI3H 3KDGA 1J5EH 4DR7H 1FVIA 4LF7H 2VQEH 4DV5H 1Z2NX 4GKJH 4R7RA 3BABA 1IBKH 1FJGH 1XMOH 1ZHSA 1HNXH 5FPOA 1XNQH 4DV0H 1X9ZA 3PN1A 4J0MA 2UU9H 4LH7A 1Z2PX 4LF8H 5DT9A 2O4CA 3J80W 2HGSA 3RGXA 1ODHA 3RGZA 4Q0YA 3RJ0A 2YCHA 4DR5H 1XMQH 1HNWH 5D1OB 4LSAA 2HVQA 2RGVA 1O75A 4DR6H 4RAYA 4DV3H 4DV2H 4LSXA 2OWOA 4UCOA 5IT9W 3MWMA 4DV6H 5IWAH 4NXMH 4LMYA 2VUGA 4G08A 3OETA 4DV1H 4EEQA 1HNZH 4NXNH 1F0XA 1M0WA 3KDKA 4B3TH 4LF6H 5D1OA 4DR1H 4K0KH 4NZTM 4LF5H 4JI4H 1SEIA 4X62H 3FAUA 2CW7A 3F8NA 3LMLA 4RB2C 2W57A 3FMAA 3GABA 3GR5A 3NCVA 1BGWA 2FE3A 2KSWA 4RB1A 1E4GT 4X66H 2UXDH 4JI5H 3HXLA 2MCTA 4JYAH 4RAZA 5FLXW 1P8LA 3QD7X 2CW8A 3T1YH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 W;  4JI2 H;  2E5L H;  4GKK H;  4DUY H;  5LL6 b;  5BR8 H;  4JI7 H;  5LMU H;  3OTO H;  1XNR H;  4X65 H;  4B3M H;  3RF2 A;  4B3S H;  1I6U A;  1N32 H;  5LMN H;  4PDB A;  5A2Q W;  2UUA H;  4JI1 H;  4OX9 H;  4LFC H;  4JI0 H;  4JI8 H;  1N36 H;  2UUB H;  2UUC H;  3T1H H;  3JAM W;  4LFB H;  2UXB H;  3J7A K;  4JI6 H;  4LF9 H;  4DV7 H;  4B3R H;  4LF4 H;  4YY3 H;  1N34 H;  2HHH H;  4YHH H;  4KHP H;  2F4V H;  4LFA H;  4DR2 H;  1IBL H;  1FKA H;  4AQY H;  2VQF H;  4DR3 H;  4DV4 H;  4JV5 H;  4DR4 H;  1S03 G;  4X64 H;  1I94 H;  1HR0 H;  4DUZ H;  1IBM H;  1N33 H;  2UXC H;  1AN7 A;  2ZM6 H;  4JI3 H;  4DR7 H;  1J5E H;  4LF7 H;  2VQE H;  4DV5 H;  4GKJ H;  1IBK H;  1FJG H;  1XMO H;  1HNX H;  1XNQ H;  4DV0 H;  2UU9 H;  4LF8 H;  3J80 W;  4DR5 H;  1XMQ H;  1HNW H;  4DR6 H;  4DV3 H;  4DV2 H;  5IT9 W;  4DV6 H;  5IWA H;  4NXM H;  4DV1 H;  1HNZ H;  4NXN H;  4B3T H;  4LF6 H;  4DR1 H;  4K0K H;  4LF5 H;  4JI4 H;  1SEI A;  4X62 H;  4X66 H;  2UXD H;  4JI5 H;  4JYA H;  5FLX W;  3T1Y H; 
#chains in the Genus database with same CATH topology
 4O3R A;  4RB0 A;  3J81 W;  2FK2 A;  5FD5 A;  4JI2 H;  3K5I A;  2FP4 B;  1KHM A;  4WD3 A;  5C44 G;  2XIG A;  4BBS G;  4EC5 A;  5LL6 b;  1JIH A;  3V6H A;  3I12 A;  5IYD G;  2P0A A;  2JEF A;  4DL6 A;  2W6M A;  3N6X A;  3EZJ A;  5KFI A;  3BAA A;  4A2B A;  4YBZ B;  1S68 A;  5KFG A;  5KT2 A;  4Q8F A;  4ED3 A;  2Q2U A;  1I6U A;  4I7H A;  3G6X A;  4RB3 C;  3GIJ A;  1Z2I A;  4A2A A;  2QYZ A;  5KFJ A;  3RIZ A;  3MR3 A;  1A9X A;  4UCU A;  3GIM A;  5KFV A;  1Y1W G;  2ANR A;  1V4Y A;  3GLK A;  5KT6 A;  4UCT A;  4ED0 A;  2AGP A;  2LTL A;  2NU7 B;  1MZB A;  4QMF B;  2JVZ A;  1PK8 A;  4LFC H;  4IRC A;  1TAE A;  3L7Z C;  4NZR M;  3Q8P B;  2HVS A;  4QWA A;  4GC7 A;  2JA5 G;  2M6Q A;  1B04 A;  4YP3 A;  4G3I A;  5I47 A;  3MR6 A;  1KJ9 A;  5BPH A;  5KFH A;  1GYF A;  4A3B G;  3T1H H;  4JV0 A;  5KFP A;  2JA7 G;  3J7A K;  1DV2 A;  2AU0 A;  2HH3 A;  3T5H A;  2FB9 A;  2MJH A;  2VUM A;  3OSP A;  5EOY A;  2I80 A;  3GIQ A;  2AQ4 A;  1N34 H;  2PMZ A;  4O4H F;  3UQ8 A;  3GQC A;  2M05 A;  3H4D A;  4GLX A;  1X9N A;  3GTM A;  2FMA A;  4CC6 A;  4A3C G;  5LYJ F;  4YHH H;  1JX4 A;  3V4S A;  4LFA H;  4LH6 A;  4ZQI A;  4DR2 H;  4I50 F;  4O3P A;  2V58 A;  3N44 B;  3JRW A;  2WYO A;  4OD6 A;  2JEG A;  4J9N A;  4ECQ A;  1S0N A;  3I0P A;  4MV8 A;  5KFO A;  4E9J A;  1M0T A;  4ECT A;  3M4I A;  2WTF A;  3I4M G;  4X64 H;  2YU9 A;  4FBT A;  1E4F T;  1Y14 B;  2E3U A;  2R87 A;  1C3O A;  4FJU A;  4DUZ H;  4OCH A;  2VOB A;  1WTJ A;  1N33 H;  5KFB A;  3KHH A;  4EBC A;  2XCP A;  1DV1 A;  3RBD A;  2ZM6 H;  4LIJ A;  3OSS D;  4JI3 H;  1Z2N X;  4IWX A;  4ED6 A;  2JA6 A;  4LF7 H;  2VQE H;  4DV5 H;  4TV8 F;  1I50 A;  2W7O A;  3GTK A;  5F9L A;  4AM3 A;  3BAB A;  1V8C A;  4QW8 A;  4A93 G;  2E2I A;  2XD4 A;  4TUY F;  2UVR A;  3H3V H;  1XNQ H;  2UU9 H;  5KT4 A;  1Z2P X;  3RGZ A;  5DT9 A;  3J80 W;  1KEE A;  2YZN A;  1KBL A;  4TQR A;  3GIL A;  5EDW A;  4AIM A;  1V9N A;  3QZ8 A;  1XMQ H;  1HNW H;  2I8C A;  4Q45 A;  4DLK A;  2NU6 B;  3GTP A;  2PN1 A;  1X0A A;  1S20 A;  4DV2 H;  4DV3 H;  2FLN A;  2R7K A;  2OWO A;  4UCO A;  1S0O A;  5EWG A;  1OWT A;  3OSN A;  4ED2 A;  2CPM A;  5IWA H;  4LMY A;  2VUG A;  1JLL B;  3JZI A;  3G6V A;  3R5F A;  3U1K A;  1ZZJ A;  3AYH B;  1F0X A;  4L1K A;  4RZR A;  3GTJ A;  4M9U A;  3Q8S B;  4DR1 H;  4K0K H;  4HYK A;  2OLS A;  4NZT M;  2VUM G;  4LF5 H;  5KG3 A;  4RNN A;  1BXR A;  2W71 A;  1VBG A;  3FAU A;  5KFZ A;  4QWB A;  2V4R A;  2YS7 A;  1GO3 E;  4HNV A;  4A3M G;  3GAB A;  3WO0 A;  1BGW A;  5IP9 G;  4ECZ A;  3R23 A;  5KFQ A;  1M7J A;  5KG6 A;  2KSW A;  1UNN C;  4AYB E;  2ATL A;  1VAJ A;  1I7N A;  5C1P A;  2FLL A;  2IA6 A;  4F50 A;  2W6O A;  3RBE A;  3HXL A;  4JYA H;  2UVU A;  4A3E G;  1P8L A;  3QD7 X;  2GLT A;  2CW8 A;  3N40 P;  2O03 A;  3RFC A;  2R8G A;  4AYB A;  3Q8R B;  1KJI A;  4RZQ A;  2VKC A;  2D9I A;  2R84 A;  3GID A;  4EFB A;  1TUA A;  5BR8 H;  2DWC A;  5KFT A;  3GTO A;  2JA5 A;  1BJT A;  4A3D G;  3WO1 A;  4F4X A;  2FJZ A;  3SI8 A;  4FJS A;  2I87 A;  2W6Q A;  4EG0 A;  4NLG A;  5KKN B;  2XGQ A;  1GSH A;  4X65 H;  2X0S A;  2JZX A;  3U9S A;  1ZHQ A;  5JVL A;  1N32 H;  4B3S H;  4C5C A;  2P2R A;  4PWQ A;  4EBE A;  4A3K G;  3M9N B;  1X4N A;  4O2A F;  4QJF A;  4YAJ B;  5KFC A;  5KG1 A;  5C8Y F;  2ZDH A;  2UUA H;  1PQX A;  3CQZ A;  5KG5 A;  4YR2 A;  3GV8 B;  3ETH A;  4J9Q A;  4ECR A;  1A0I A;  1N48 A;  2WE6 A;  4IR1 A;  3H0G A;  4YR0 A;  4J9K A;  2FK3 A;  2XCL A;  4O4L F;  4EYH B;  2J6U A;  4MV9 A;  1DGS A;  4IAJ A;  3K5H A;  1N36 H;  3VPC A;  2J6T A;  4ED8 A;  2UUC H;  3VPB A;  1E4E A;  3JAM W;  4E4T A;  5EWE A;  3N42 B;  4ZHQ F;  3ORQ A;  2CTF A;  4LF9 H;  4F4W A;  4BA2 I;  3TQ1 A;  3H20 A;  4LF4 H;  5HV6 A;  4IFD G;  1VBI A;  2Z0S A;  4ZOL F;  3IN5 A;  1R9T A;  1CQI B;  2ANN A;  4B8T A;  2VA2 A;  4ED7 A;  2BL5 A;  1SCU B;  2FMR A;  5KFD A;  4TQS A;  1IBL H;  2B63 G;  1EUC B;  4BWS C;  1ZZK A;  4AQY H;  4HR7 A;  4BY1 G;  1KJJ A;  1GSO A;  3L4J A;  3N8D A;  3BQ1 A;  2K1H A;  5KFW A;  2AGO A;  1K1Q A;  2FPH X;  2VQD A;  4MTD A;  2RGR A;  3GII A;  2CTL A;  4DR4 H;  4XX0 B;  2X06 A;  1Y1V G;  4MV3 A;  3U9T A;  3VMM A;  1WR2 A;  3PW0 A;  1I94 H;  3MWE A;  3Q8Q B;  2J6S A;  5KFF A;  4O3Q A;  4RUC A;  2JEI A;  2CTE A;  2PMZ E;  1AN7 A;  5DQG A;  1RJQ A;  1J5E H;  4EGJ A;  4O3N A;  4WAL A;  1FJG H;  2CWF A;  5FPO A;  2V9W A;  1IOW A;  4JV2 A;  2WB1 E;  5K2M A;  2NVX A;  4J0M A;  1X9Z A;  2YRW A;  3PN1 A;  5JH7 F;  2A1S A;  2C28 A;  2O4C A;  3HKZ A;  5JUM A;  3RB0 A;  2IMW P;  4TV9 F;  4LSA A;  2W8K A;  2RGV A;  2CZG A;  3FKI G;  4RNM A;  2FPG B;  4YAK B;  2V4Q A;  3V6J A;  2WB1 A;  3UFX B;  3MWM A;  3H0G G;  2R7N A;  5JVD F;  1TWG A;  4G08 A;  3OET A;  3JRX A;  4Y8V B;  2CTJ A;  2W9B B;  4DV1 H;  4ECU A;  1HNZ H;  1VIH A;  5L9X A;  4YQW A;  3ETJ A;  2C00 A;  4YB8 B;  4LF6 H;  4J9M A;  1WVN A;  5KG0 A;  1X4M A;  4XYL B;  4WBN F;  5KT7 A;  5EWF A;  3GV7 B;  3EPG A;  1EZ1 A;  4DL2 A;  3BQ2 A;  4HQ6 A;  1SEI A;  4ZI7 F;  3HOU G;  1JDB B;  3LML A;  2W57 A;  2W9B A;  2WAQ A;  3GR5 A;  3NCV A;  4QWD A;  4EBD A;  4YJ2 F;  4RUA A;  4BY7 G;  2YS6 A;  2VR1 A;  1V51 A;  1VKZ A;  2UXD H;  2W9C A;  4GC6 A;  2MCT A;  1ZZI A;  4MV1 A;  3AEV B;  3HB9 A;  5T14 A;  2QK4 A;  4Q44 A;  3T1Y H;  3PR4 A;  1I7L A;  2M8W A;  5KT5 A;  1ZET A;  1CQJ B;  3KAJ A;  2CTM A;  3K3P A;  1SFO A;  1UC8 A;  4I55 F;  2AGQ A;  1WCM G;  2ZJT A;  3FDS A;  3RUP A;  4HNU A;  2LF0 A;  1JDE A;  4UCS A;  5DG8 A;  1Z2O X;  2OPV A;  4I4T F;  4MV7 A;  1L2Z A;  1EUD B;  2R86 A;  2SCU B;  3EYY A;  4M7E A;  1J4W A;  2CKZ B;  3DF7 A;  1AUV A;  2GPW A;  1XNR H;  4UCV A;  3BA9 A;  3RF2 A;  5C0X G;  2IP4 A;  2JA9 A;  1RK5 A;  3Q2O A;  3QZ7 A;  4O4I F;  4F4Y A;  2YZG A;  1DT4 A;  5EZY F;  2XCA A;  4PDB A;  5IYZ F;  2NU8 B;  2R8I A;  3MJF A;  5A2Q W;  2NVY A;  3V69 A;  2CPQ A;  3ORR A;  4ED1 A;  1V9P A;  3RV3 A;  3PZP A;  2HVR A;  4YR3 A;  2CWH A;  4J9P A;  4OX9 H;  2B63 A;  2Y0S E;  3JSL A;  3CVZ A;  4R8U B;  2R92 A;  2E2H A;  2PY9 A;  2R82 A;  2YQR A;  1GGO A;  3T5K A;  1K1G A;  3VKE A;  1S10 A;  3OUU A;  4XYM B;  5CAE B;  2C2D A;  1Y1V A;  5C5J A;  2UXB H;  2NN6 G;  3L2P A;  2Y0S A;  2YW2 A;  1ZTG A;  2LTM A;  4JI6 H;  2FLP A;  3RB6 A;  1RK6 A;  3K3V A;  3GIK A;  4B3R H;  5L1K A;  1S97 A;  3N43 B;  5DGA A;  5KFU A;  4J9L A;  5IYB G;  5D8D A;  3HOZ G;  1RJP A;  4R8U A;  4A3J G;  4YY3 H;  2PVP A;  4QW9 A;  4FBU A;  4J9S A;  2HHH H;  4RNO A;  1SYX B;  3TIG A;  4KHP H;  2F4V H;  4C5B A;  1E4E B;  4QIW A;  3PO2 G;  2DZD A;  3MFH A;  1FKA H;  2UVW A;  2VQF H;  1EYZ A;  2W70 A;  5IYC G;  3KAK A;  5LOV F;  4BA1 I;  3FKI A;  4IZO A;  1KJ8 A;  3MWD A;  4J9R A;  1S0M A;  5IP7 G;  2R7L A;  1S03 G;  2AXY A;  1CE8 A;  2RF4 A;  2ZQE A;  3R5X A;  3RTX A;  5LP6 F;  1DTJ A;  1CS0 A;  2R7M A;  1NXU A;  5KX5 F;  3IG0 A;  5CA1 F;  2R8K A;  2J9G A;  3GTL A;  1W93 A;  2PBZ A;  3KXY T;  5LA6 F;  2UXC H;  2DLN A;  4DR7 H;  4UFZ A;  2R7Z A;  4QWC A;  2JA8 G;  1FVI A;  4R7R A;  3TII A;  2PQU A;  4GKJ H;  5C3E G;  1IBK H;  1KJQ A;  1XMO H;  1ZHS A;  1HNX H;  1W96 A;  2W6Z A;  3V4Z A;  2RDJ A;  4ECX A;  2ASJ A;  5CA0 F;  3RB4 A;  4LH7 A;  3RGX A;  4LF8 H;  2HGS A;  5LXT F;  2YCH A;  4DR5 H;  5GON F;  5D1O B;  2W9A A;  3SE7 A;  3KHR A;  5DQH A;  4DL4 A;  1MSZ A;  4LSX A;  5IT9 W;  4U6P A;  5FJ8 G;  2R92 G;  5C4X G;  4HNT A;  1M6V A;  3PW7 A;  3E5N A;  3KHG A;  1VIG A;  5KG4 A;  2BQU A;  2C22 A;  4MV4 A;  1KC7 A;  2G8Y A;  4EEQ A;  4F4Z A;  2C2R A;  4NXN H;  1TWC A;  4IRD A;  1M0W A;  3KDK A;  4DL7 A;  4B3T H;  4EYI B;  4NBQ A;  3H4B A;  5D1O A;  4JUZ A;  1DIK A;  3G6Y A;  2BQR A;  5DG7 A;  3HKZ E;  1WCM A;  3OHB A;  3BG5 A;  2FPI B;  3GKU A;  2CW7 A;  5DG9 A;  3F8N A;  2DIK A;  2HJW A;  4DL3 A;  1BNC A;  2V59 A;  3FMA A;  2XGP A;  3MFI A;  2RDI A;  4A3G G;  4WAN A;  4RB1 A;  2R8H A;  1E4G T;  4C5A A;  4MAM A;  3HOX G;  4JI5 H;  4J9O A;  2ZDQ A;  4O3S A;  5DLG A;  1RJR A;  2CQY A;  3HBL A;  2VA3 A;  3LWB A;  3PO3 G;  4IRK A;  3GIP A;  2E5L H;  4GKK H;  4CC5 A;  4O2B F;  4DUY H;  2R93 G;  5KT3 A;  1T94 A;  3KHL A;  1EC6 A;  3JSN A;  3T5L A;  4H8A A;  4JI7 H;  3PR5 B;  3Q1K A;  2DPI A;  2R7Z G;  5L1I A;  3L4K A;  4EFE A;  2WAQ E;  5LMU H;  2W9C B;  1WH2 A;  3OTO H;  1VS0 A;  4U7C A;  2ZDG A;  3TQT A;  4FU0 A;  5KFY A;  4RU9 A;  1IOV A;  5H80 A;  2NUA B;  1ULZ A;  1ZQ7 A;  4B3M H;  2LRR A;  3VPD A;  5BMV F;  2C2E A;  4FM9 A;  5HBR B;  3UOE A;  4MA5 A;  5DQI A;  1GLV A;  5LMN H;  1S9F A;  2BQ3 A;  5JEA G;  3BQ0 A;  5DLF A;  4FS2 A;  4A3F G;  5KFL A;  1B33 N;  2NU9 B;  1TWA A;  5J2U F;  3C0F B;  4EGQ A;  1B6S A;  4JI1 H;  1K1S A;  3R5H A;  5KFX A;  3GTG A;  2OPU A;  4ECS A;  2DPJ A;  5FLM G;  4JI0 H;  4JV1 A;  4Q8E A;  5KFR A;  4JI8 H;  2ASL A;  2Y3M A;  1TWF A;  1TA8 A;  1UG8 A;  1C30 A;  2V5A A;  2FFM A;  4QWE A;  2UUB H;  2CTK A;  1J5K A;  1PX2 A;  3SB1 A;  4LFB H;  2VPS A;  4B8C D;  2W7P A;  4EEY A;  5C1O A;  4APM A;  2WDT A;  5J2T F;  2YYA A;  4YJ3 F;  4ETS A;  3PW4 A;  4DV7 H;  3H40 A;  1JKJ B;  3MR5 A;  5DGB A;  1WHR A;  2HH2 A;  2YZM A;  2PT7 G;  2OH2 A;  5K36 G;  3G8C A;  2C35 B;  5D1P A;  3EPI A;  5KG2 A;  4UCR A;  2Q2T A;  1RYR A;  1EHI A;  1WE8 A;  3KAL A;  4DL5 A;  5KFE A;  1I3Q A;  3RB3 A;  4A3L G;  3N41 B;  4MTE A;  3BA8 A;  4DR3 H;  5KFK A;  4DV4 H;  1B6R A;  3NGD A;  4JV5 H;  2XC9 A;  2JEA I;  1XDN A;  3LP8 A;  2JEB I;  3OUZ A;  4IWY A;  1JXL A;  4BBR G;  4IR9 A;  4JVY A;  1HR0 H;  1IBM H;  3WNZ A;  2FKL A;  5FPR A;  4ECW A;  3RV4 A;  5KFN A;  4Q0Y A;  4RAY A;  3KDG A;  3PVX A;  4ECV A;  2GPS A;  2QND A;  2R85 A;  5CB4 F;  2ALZ A;  3HOW G;  1RYS A;  1UC9 A;  2YRX A;  4QIW E;  3TIN A;  4MA0 A;  5KFA A;  4DV0 H;  5FD6 A;  1XRH A;  2ASD A;  2YL2 A;  3RJ0 A;  1ODH A;  3QFF A;  1T36 A;  1K83 A;  2HVQ A;  1O75 A;  4DR6 H;  3KTM A;  3BJY A;  2FPP B;  3HOV G;  1Y1W A;  3V6K A;  5F9N A;  4FS1 A;  2W8L A;  2VPQ A;  4DV6 H;  4NXM H;  4OO1 G;  3T5J A;  4ME6 A;  1N56 A;  4Q43 A;  1VBH A;  4O3O A;  3M9O B;  2R6F A;  2UVV A;  2JA6 G;  5BPF A;  3HOY G;  3OHA A;  2FK1 A;  3RAX A;  5KFS A;  1T3N A;  4BXX G;  2IBK A;  2R93 A;  1GSA A;  3PW2 A;  2R8J A;  4C2M A;  4IHJ F;  3I4N G;  4JI4 H;  4A3I G;  3MR2 A;  4X62 H;  1WSC A;  2JA7 A;  3PW5 A;  2JE6 I;  4RB2 C;  4MV6 A;  4JVH A;  3M9M B;  5KG7 A;  5JQW A;  2W6P A;  2DGR A;  2FE3 A;  2BR0 A;  2JEJ A;  3GV5 B;  1TWH A;  5KFM A;  1AUX A;  4X66 H;  2BA0 A;  5L1L A;  4ECY A;  3GTQ A;  4RAZ A;  3RAQ A;  2W6N A;  5FLX W;  5L1J A;  4XZ3 B; 
#chains in the Genus database with same CATH homology
 4RB0 A;  3J81 W;  2O03 A;  3N40 P;  5FD5 A;  4JI2 H;  2E5L H;  4GKK H;  3KAJ A;  4CC5 A;  4RZQ A;  2VKC A;  2D9I A;  4DUY H;  4EC5 A;  5LL6 b;  2XIG A;  4EFB A;  2ZJT A;  3JSN A;  5BR8 H;  4JI7 H;  2LF0 A;  1BJT A;  4UCS A;  1Z2O X;  4EFE A;  4MV7 A;  3L4K A;  3N6X A;  4A2B A;  3EZJ A;  5LMU H;  3BAA A;  1WH2 A;  3OTO H;  1VS0 A;  3EYY A;  1S68 A;  4M7E A;  3DF7 A;  1L2Z A;  1XNR H;  4UCV A;  4X65 H;  4B3M H;  2Q2U A;  1ZHQ A;  3BA9 A;  3RF2 A;  4B3S H;  1I6U A;  1N32 H;  4I7H A;  4RB3 C;  4FM9 A;  4A2A A;  5LMN H;  3RIZ A;  4PDB A;  4UCU A;  5A2Q W;  2UUA H;  1V9P A;  4UCT A;  2HVR A;  3C0F B;  1A0I A;  4JI1 H;  1MZB A;  2WE6 A;  4OX9 H;  4LFC H;  4JI0 H;  3JSL A;  3CVZ A;  1TAE A;  4NZR M;  2HVS A;  4JI8 H;  2Y3M A;  1TA8 A;  4MV9 A;  1DGS A;  4IAJ A;  1N36 H;  1B04 A;  1GYF A;  2UUB H;  2UUC H;  3T1H H;  3JAM W;  3SB1 A;  4LFB H;  2VPS A;  4B8C D;  2UXB H;  3N42 B;  3L2P A;  3J7A K;  2WDT A;  4APM A;  4ETS A;  4JI6 H;  4LF9 H;  5FD6 A;  4DV7 H;  3K3V A;  4B3R H;  4LF4 H;  3H20 A;  3N43 B;  5EOY A;  4YY3 H;  1N34 H;  3UQ8 A;  2PT7 G;  1X9N A;  2HHH H;  4GLX A;  2Q2T A;  1SYX B;  5D1P A;  4UCR A;  4CC6 A;  4YHH H;  4KHP H;  2F4V H;  3KAL A;  4LFA H;  4LH6 A;  4DR2 H;  1IBL H;  3N41 B;  4MTE A;  1FKA H;  3N44 B;  4AQY H;  2VQF H;  3BA8 A;  2WYO A;  4BWS C;  4DR3 H;  4OD6 A;  4DV4 H;  3KAK A;  3L4J A;  4JV5 H;  2RGR A;  1XDN A;  2FPH X;  4MTD A;  4DR4 H;  4E9J A;  1M0T A;  1S03 G;  3M4I A;  4X64 H;  2ZQE A;  1E4F T;  3RTX A;  1I94 H;  1HR0 H;  4DUZ H;  4OCH A;  1IBM H;  1N33 H;  2VOB A;  3IG0 A;  3KXY T;  5FPR A;  2UXC H;  4UFZ A;  1AN7 A;  2ZM6 H;  3OSS D;  4JI3 H;  3KDG A;  1J5E H;  4DR7 H;  1FVI A;  4LF7 H;  2VQE H;  4DV5 H;  1Z2N X;  4GKJ H;  4R7R A;  3BAB A;  1IBK H;  1FJG H;  1XMO H;  1ZHS A;  1HNX H;  5FPO A;  1XNQ H;  4DV0 H;  1X9Z A;  3PN1 A;  4J0M A;  2UU9 H;  4LH7 A;  1Z2P X;  4LF8 H;  5DT9 A;  2O4C A;  3J80 W;  2HGS A;  3RGX A;  1ODH A;  3RGZ A;  4Q0Y A;  3RJ0 A;  2YCH A;  4DR5 H;  1XMQ H;  1HNW H;  5D1O B;  4LSA A;  2HVQ A;  2RGV A;  1O75 A;  4DR6 H;  4RAY A;  4DV3 H;  4DV2 H;  4LSX A;  2OWO A;  4UCO A;  5IT9 W;  3MWM A;  4DV6 H;  5IWA H;  4NXM H;  4LMY A;  2VUG A;  4G08 A;  3OET A;  4DV1 H;  4EEQ A;  1HNZ H;  4NXN H;  1F0X A;  1M0W A;  3KDK A;  4B3T H;  4LF6 H;  5D1O A;  4DR1 H;  4K0K H;  4NZT M;  4LF5 H;  4JI4 H;  1SEI A;  4X62 H;  3FAU A;  2CW7 A;  3F8N A;  3LML A;  4RB2 C;  2W57 A;  3FMA A;  3GAB A;  3GR5 A;  3NCV A;  1BGW A;  2FE3 A;  2KSW A;  4RB1 A;  1E4G T;  4X66 H;  2UXD H;  4JI5 H;  3HXL A;  2MCT A;  4JYA H;  4RAZ A;  5FLX W;  1P8L A;  3QD7 X;  2CW8 A;  3T1Y H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...