3J80W

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
129
structure length
129
Chain Sequence
TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 27
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3j80W01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3j80W02
4DV2H 4DV0H 1FJGH 1SEIA 1XMQH 3J80W 4DV3H 4DR5H 4JI5H 4KHPH 1XNQH 4AQYH 4DV6H 4DV1H 5LL6b 1I94H 4JI6H 4X65H 1XNRH 4DR7H 2E5LH 5IT9W 2UUCH 1IBMH 2UXBH 4X64H 4JI4H 1J5EH 4X62H 4DUZH 5LMNH 4JYAH 2UU9H 2UXCH 4NXNH 5FLXW 1N32H 5BR8H 2VQFH 3J81W 2HHHH 2ZM6H 4LF7H 4B3RH 4JI7H 2UUBH 1N36H 4LF5H 5A2QW 1FKAH 5LMUH 2VQEH 1XMOH 4DV4H 4PDBA 4NXMH 1N34H 4DR4H 4DR6H 4JI8H 1HR0H 4GKJH 4B3SH 4JI2H 4JI0H 4K0KH 2UXDH 4YY3H 1HNWH 3T1YH 4GKKH 4LF9H 4B3MH 1N33H 3OTOH 4LF4H 1IBLH 4LFAH 1HNXH 1S03G 4X66H 4DUYH 3JAMW 4DV7H 2F4VH 4DR1H 4DR2H 2UUAH 4JV5H 1HNZH 4DV5H 3J7AK 4B3TH 4JI3H 5IWAH 4LFBH 4OX9H 4LF6H 4LF8H 3T1HH 1IBKH 4DR3H 4YHHH 4JI1H 1AN7A 1I6UA 3RF2A 4LFCH
chains in the Genus database with same CATH superfamily
2R82A 4DV2H 2YZGA 5LXTF 2BQRA 4O3QA 4RUAA 3BA9A 2V5AA 1SEIA 3KAJA 4XYLB 2D9IA 4YJ3F 5T14A 1BGWA 2C2DA 2CTFA 1IOVA 4O3PA 1KJ8A 1XMQH 4TUYF 2R6FA 1PX2A 2VA3A 4DR5H 4JV1A 4UCRA 1O75A 2WYOA 2YL2A 1WTJA 3MR3A 2FK1A 1VAJA 4JV2A 1V9NA 4DV1H 1UNNC 3V6JA 3GABA 4BXXG 2V4RA 2ASDA 1N48A 2YW2A 2NU9B 2HVQA 1F0XA 3LWBA 2CKZB 1X4NA 3C0FB 4ECUA 3GTJA 2JA5A 5KFMA 4IHJF 4EFBA 1TWCA 2FLLA 4A3BG 2UUCH 3OSSD 5DQIA 5L9XA 5KG6A 4JI4H 5KFWA 2R8JA 4X62H 5FJ8G 2Q2UA 3AEVB 2NU8B 4G08A 4MTDA 3GR5A 2R7ZA 4OCHA 1SFOA 5IYCG 4NXNH 1WCMG 2LTMA 1N32H 5J2UF 4EEQA 2C35B 3J81W 5KFJA 3ETJA 2JEBI 2ZM6H 4IR1A 2X0SA 4RUCA 1IOWA 5BMVF 4UCSA 2CW8A 2DZDA 3BQ2A 4LF5H 2JA6G 2FPGB 4AIMA 4FBUA 5LMUH 2VQEH 3G6VA 2P0AA 4BA1I 4LH6A 2GPSA 2V58A 4NBQA 3OHAA 2W6ZA 5FPOA 3RB6A 5IYDG 2GPWA 4QJFA 4CC6A 4DL2A 4TQSA 4DV4H 5D8DA 3PO3G 2CWHA 5KG5A 3VPCA 4EYHB 2JA8G 1N34H 4C5AA 4O4HF 5D1PA 2HH3A 5KT6A 3PW5A 2JZXA 4DR6H 1JLLB 1RK6A 4A2BA 1AUXA 2R7LA 1KC7A 4A3KG 4GKJH 4JI0H 4O2AF 5KFXA 1GSAA 1GSHA 4QWBA 2MCTA 5L1KA 1J5KA 2UXDH 1OWTA 1DT4A 3V6HA 2BR0A 4YY3H 4BWSC 2VPQA 5C1OA 3RB0A 1RK5A 3KHHA 3Q8RB 2RF4A 3JZIA 1S0MA 2FK2A 4ECTA 1B04A 4GKKH 3U1KA 3F8NA 3RUPA 1N33H 3OTOH 1ODHA 4O4IF 5KFKA 4QWEA 1V4YA 2W9CB 5C0XG 1IBLH 5KKNB 3HOXG 5FD5A 2RGRA 2XCAA 5IYZF 2DPIA 3GV5B 1GSOA 5EWEA 2R86A 2AGPA 1N56A 3H20A 2HJWA 3GIMA 3M9OB 3PR4A 4DUYH 3JAMW 2FJZA 2R92G 1DV2A 3OETA 4FS1A 3Q8QB 4DR1H 1M7JA 2E3UA 4M7EA 2HVSA 2WAQE 2CTEA 2ANNA 3N8DA 1HNZH 4RB1A 4GC7A 3GTQA 4R7RA 4QWCA 1ZZIA 5KG4A 3WNZA 5LP6F 1BJTA 1WSCA 4YAKB 4B3TH 4F4WA 4WD3A 1K83A 5IWAH 3GTOA 1C3OA 4RZRA 3HOWG 3HKZA 2JA7G 2O03A 4QMFB 5GONF 4DR3H 2XD4A 2WTFA 2VR1A 3KHLA 2R85A 1V8CA 1VKZA 2WB1A 3OSPA 4IR9A 2R93A 4JI1H 1AN7A 2R7KA 5K36G 2R7MA 5EOYA 2IMWP 5DQHA 1VBHA 2R84A 2WE6A 3TQ1A 5C8YF 4DV0H 4EEYA 1JXLA 3GTGA 2YU9A 3GIKA 4EBCA 1S68A 5KFEA 3RB4A 1ULZA 3J80W 4DV3H 2YRXA 2JEIA 4ECWA 3HOVG 2Y0SA 1TA8A 4C5CA 5J2TF 4AQYH 2M8WA 4DV6H 2YRWA 4TV9F 2J6UA 5KFDA 4EC5A 2WDTA 5D1OA 3BQ0A 4EG0A 4FU0A 4A3LG 3BAAA 3FKIG 4A3DG 3QZ8A 4O2BF 3ORQA 2DLNA 5EDWA 2DWCA 1UG8A 3BJYA 1KJ9A 2BL5A 1IBMH 2UXBH 4X64H 1CQJB 1WR2A 2FP4B 3K5IA 3BG5A 1J5EH 4XYMB 3VPBA 1RJPA 2DIKA 3PN1A 5KFZA 5KG2A 4ED2A 2UVRA 1TWGA 5JEAG 1P8LA 2QNDA 5LMNH 5JVLA 2ASJA 2UU9H 2C00A 4DL5A 2R8KA 2BQ3A 2YQRA 4YR0A 4L1KA 4I55F 1E4EB 4ECSA 3GTMA 1SCUB 4LF7H 5L1LA 3V4SA 3ORRA 1UC8A 1X9NA 1KJJA 4A3FG 2XCPA 2I8CA 2AU0A 3JRWA 2R7NA 3KAKA 3MFIA 2FLPA 2E2HA 4BY7G 2PT7G 3L2PA 4RB2C 1VIGA 1KHMA 3I0PA 3Q1KA 4U7CA 4UCOA 4HYKA 2PN1A 2Q2TA 3GV7B 4GLXA 3RB3A 1M0TA 2NVYA 3T5JA 1A0IA 3PVXA 1S9FA 3CVZA 1WCMA 2NU6B 4E9JA 1EYZA 1GYFA 1S97A 2NVXA 4OO1G 1K1QA 3EPIA 4IWYA 4XZ3B 2V59A 4E4TA 3GILA 4ECQA 5LYJF 4IWXA 3JSNA 4ED8A 2OLSA 3RIZA 5CA1F 1EHIA 3K3PA 3SB1A 2JA6A 3GIDA 2CTMA 3T1YH 3K3VA 3HOYG 3GIPA 5C3EG 1X4MA 4DLKA 1TWHA 2IA6A 2P2RA 4MV1A 4LF4H 3IG0A 5KFVA 1A9XA 5EWFA 4DL3A 4UCVA 4J9MA 4WANA 3Q8SB 1HNXH 3Q8PB 4RB3C 3EZJA 4MV6A 3N42B 1XDNA 2JA7A 4J9PA 5LA6F 4FS2A 4B8TA 4I50F 2G8YA 4B8CD 5KFLA 3L7ZC 3LP8A 2PY9A 3L4KA 4HNTA 4F4ZA 1Z2IA 1Z2OX 4AYBA 5C44G 1EUDB 4ZOLF 2W9BB 2JEFA 2W6PA 2JE6I 4DL7A 4G3IA 4DV5H 2FPIB 2JEAI 4A3EG 1MZBA 3MR2A 2OH2A 3DF7A 3JRXA 2PMZA 3TIIA 4JI3H 3H4DA 2AQ4A 4LFBH 4JUZA 4OX9H 4IRDA 4LF8H 4R8UB 3OHBA 4A3GG 3GLKA 4J9QA 2W9AA 3PW7A 2FK3A 2Y3MA 2W9CA 4IFDG 1DV1A 5KT5A 4YHHH 2YZMA 1TAEA 4RNMA 4Q8FA 2VOBA 3I12A 4AM3A 5C1PA 2R8IA 3R5HA 4A3IG 3K5HA 3NGDA 5KFQA 2R92A 4RAYA 4FM9A 3GTKA 4Y8VB 4RAZA 4ZQIA 1CS0A 3KDGA 4Q43A 5DGBA 4LH7A 5IP9G 4MA0A 5KG3A 1FJGH 2QYZA 1S0NA 2B63G 1TWFA 3OUZA 5CB4F 5HBRB 3TINA 4O4LF 5KFPA 2CPQA 3H40A 3T5LA 2V4QA 5JQWA 3KXYT 2LF0A 5BPHA 2GLTA 2AGQA 1Z2PX 3MR5A 4IAJA 4QW8A 1V9PA 1B6RA 3PZPA 4A93G 2IP4A 5HV6A 5LL6b 2XIGA 2DPJA 4X65H 1XNRH 4IZOA 3RGXA 4PWQA 1TUAA 1JDEA 1C30A 4JV0A 2K1HA 4NZTM 5DT9A 3GIJA 3G6XA 5KT2A 4HNUA 2HVRA 3WO1A 1B6SA 5KFIA 1B33N 2YS7A 4ME6A 1CE8A 4QIWA 4ED3A 4LSAA 1I7NA 3N43B 3H0GG 4BA2I 4Q45A 5CAEB 4ECVA 1M6VA 4DL4A 1Y1VG 5KFTA 1SYXB 2A1SA 2W57A 3BABA 1L2ZA 2SCUB 1ZHSA 5KT4A 5FLXW 4C2MA 2W70A 3T5HA 3KDKA 2CTKA 1R9TA 3PO2G 2HHHH 4ZHQF 3M4IA 4RNNA 4A3MG 4JI7H 2J9GA 1E4FT 2XGPA 1N36H 5KFOA 5A2QW 2W6NA 5DQGA 3PR5B 4F4XA 2M05A 3FKIA 3I4MG 2LTLA 3T5KA 3V69A 3KHRA 1FVIA 5FLMG 3HKZE 2W8KA 4DL6A 2R8HA 3R5FA 4IRCA 3RAXA 1Y14B 3SI8A 1EZ1A 1MSZA 4PDBA 1WE8A 2PQUA 4APMA 4C5BA 2DGRA 2VA2A 2I87A 2WB1E 1NXUA 3GTLA 4BBRG 2X06A 4MV8A 1WHRA 1Y1WG 3G8CA 1S20A 2Z0SA 4DR4H 2W6MA 4O3NA 4HR7A 5JH7F 3UQ8A 2NUAB 4Q8EA 4JI8H 4YB8B 1HR0H 3LMLA 4ETSA 4B3SH 2ZDHA 4K0KH 2ATLA 4A2AA 5H80A 2XC9A 1VIHA 1ZTGA 1E4EA 3KALA 5F9LA 3M9MB 3AYHB 3Q2OA 1HNWH 1T94A 2W6OA 4LMYA 3KTMA 2PBZA 1JDBB 5FD6A 3HB9A 4GC6A 3QD7X 4RNOA 2XCLA 2C22A 4CC5A 2HH2A 1ZZKA 3UOEA 4B3MH 4LF9H 2FMAA 1JIHA 2BQUA 1K1GA 1ZETA 2NN6G 1EC6A 2MJHA 4JVHA 5EWGA 1ZQ7A 3QFFA 1I7LA 2LRRA 2VUMG 1J4WA 1Z2NX 5KFCA 4ECZA 4A3JG 2I80A 2UVVA 4O3SA 4DV7H 3NCVA 3MWEA 4MV7A 3GV8B 4EGJA 2UUAH 3BQ1A 4H8AA 4F4YA 2J6TA 4JV5H 3EYYA 5C4XG 3J7AK 2VQDA 2W7OA 2AXYA 1EUCB 5JVDF 2ZDGA 2E2IA 3MFHA 3MR6A 3PW2A 3GTPA 3RV4A 3QZ7A 4J9RA 5KFUA 4ED7A 3IN5A 4WALA 1GGOA 4NZRM 5DGAA 5F9NA 4EYIB 4M9UA 4O3RA 1IBKH 3HOUG 1AUVA 4J9LA 4LIJA 1CQIB 1VBGA 5KG7A 1BXRA 3GQCA 2FFMA 4J9SA 3UFXB 4BBSG 2ZJTA 2JA5G 3N41B 1W93A 1I6UA 3MWMA 4FJUA 2KSWA 4HQ6A 1E4GT 1ZHQA 5FPRA 4QWAA 4EBEA 4LSXA 2W8LA 2FLNA 2R7ZG 1K1SA 5EZYF 2FPHX 2OPVA 1VS0A 2ANRA 3TQTA 4EFEA 2W9BA 2CWFA 3RBEA 2C2EA 4FBTA 2BA0A 5KFFA 2CTJA 3TIGA 4JI5H 2PVPA 2VUGA 4KHPH 2VKCA 2QK4A 2R87A 2C28A 3MJFA 1XNQH 2UVUA 4FJSA 2V9WA 4IRKA 1JX4A 1I94H 5C5JA 3CQZA 4JI6H 2FPPB 4DR7H 1GLVA 4R8UA 2OWOA 2E5LH 3N40P 2W71A 4ECXA 2CW7A 5IT9W 1XRHA 1VBIA 4J9OA 3GIQA 5L1JA 3VPDA 3PW4A 1KJQA 4DUZH 3E5NA 3WO0A 3U9SA 3KHGA 3RFCA 1TWAA 2FKLA 4JYAH 5KG1A 3OSNA 2UXCH 2WAQA 2YYAA 5BPFA 4U6PA 4F50A 5DG9A 4UCTA 2O4CA 4UFZA 5BR8H 5DLGA 3VMMA 4YR3A 4AYBE 2VQFH 2YCHA 4J0MA 3H3VH 4TQRA 2W7PA 1RJQA 2HGSA 1S10A 4B3RH 2YZNA 3MWDA 2UUBH 1DGSA 4XX0B 3OUUA 4YP3A 2FE3A 1FKAH 2PMZE 2XGQA 1KEEA 4QWDA 1XMOH 1RYSA 1RJRA 3HXLA 4I4TF 4NLGA 3M9NB 1BNCA 4RZQA 3RV3A 3RBDA 3V6KA 5CA0F 4RU9A 1PK8A 2W6QA 4Q0YA 4OD6A 4HNVA 1V51A 5KX5F 4I7HA 4NXMH 3H0GA 2FMRA 4YBZB 3GIIA 2AGOA 2J6SA 2JEGA 1Y1VA 3RAQA 2CPMA 3N44B 2CTLA 1KJIA 3H4BA 4MV4A 2C2RA 4EGQA 4WBNF 5LOVF 1RYRA 2JA9A 4MV9A 4JI2H 2R8GA 4EBDA 3ETHA 2UVWA 3I4NG 4UCUA 3HOZG 4ZI7F 1I50A 4ED1A 3SE7A 3HBLA 4YAJB 2NU7B 2RGVA 4ED0A 3GKUA 4Q44A 4YJ2F 3EPGA 3FMAA 1T36A 5KFAA 1W96A 5DG7A 2ASLA 4TV8F 3RTXA 1KBLA 4MAMA 1X0AA 3BA8A 4A3CG 2JEJA 1PQXA 5DLFA 4LFAH 3FDSA 4MTEA 2VPSA 1GO3E 5KFRA 5IP7G 5KFNA 4ED6A 4YQWA 1S03G 4QIWE 5L1IA 2ALZA 4J9NA 4O3OA 2R93G 4X66H 4MA5A 1Y1WA 5I47A 1WH2A 1JKJB 4MV3A 2IBKA 5KFGA 4ECRA 2F4VH 5K2MA 3U9TA 4DR2H 3VKEA 3V4ZA 3RJ0A 4RB0A 2CQYA 5KFHA 2M6QA 1WVNA 5KT7A 1T3NA 3FAUA 5KG0A 1DTJA 2FB9A 1I3QA 1S0OA 1M0WA 5KT3A 3JSLA 1ZZJA 5KFSA 2Y0SE 4LF6H 5D1OB 3PW0A 3R23A 4JVYA 2ZQEA 3T1HH 2CZGA 2RDIA 5IYBG 5DG8A 5KFYA 1UC9A 3L4JA 3G6YA 2B63A 2YS6A 2ZDQA 2JVZA 4BY1G 1X9ZA 2OPUA 5KFBA 4ECYA 4J9KA 4QW9A 3RGZA 1DIKA 4YR2A 2RDJA 3RF2A 4LFCH 5JUMA 2VUMA 3R5XA 3N6XA
chains in the Genus database with same CATH topology
5FPRA 4RAZA 4DV2H 3KDGA 2WE6A 4DV0H 4LH7A 4LSXA 1FJGH 2FPHX 3BA9A 1VS0A 1SEIA 3KAJA 1S68A 2D9IA 4EFEA 1BGWA 1XMQH 3J80W 4DV3H 4DR5H 4JI5H 2VUGA 4KHPH 2VKCA 1O75A 2WYOA 2LF0A 3KXYT 3N6XA 1XNQH 1TA8A 1Z2PX 4AQYH 4IAJA 4DV6H 1V9PA 4DV1H 3GABA 5LL6b 1I94H 2XIGA 4JI6H 4X65H 1XNRH 3RGXA 4DR7H 4EC5A 2WDTA 5D1OA 2HVQA 1F0XA 4NZTM 5DT9A 3BAAA 3C0FB 2OWOA 2E5LH 2HVRA 3N40P 4EFBA 2CW7A 5IT9W 2UUCH 3OSSD 1IBMH 2UXBH 4X64H 4JI4H 3N43B 4LSAA 1J5EH 4X62H 2Q2UA 4DUZH 3PN1A 4G08A 1SYXB 3GR5A 4MTDA 1P8LA 4OCHA 2W57A 5LMNH 4JYAH 3BABA 2UU9H 2UXCH 1L2ZA 4NXNH 1ZHSA 5FLXW 2O4CA 1N32H 5BR8H 4UCTA 4UFZA 4EEQA 2VQFH 2YCHA 3KDKA 4J0MA 3J81W 2HHHH 2ZM6H 4LF7H 2HGSA 3M4IA 4B3RH 4JI7H 4UCSA 2UUBH 1DGSA 2CW8A 1X9NA 1E4FT 1N36H 4LF5H 5A2QW 2FE3A 1FKAH 5LMUH 2VQEH 1XMOH 3KAKA 3HXLA 1FVIA 4LH6A 4RZQA 5FPOA 4CC6A 2PT7G 3L2PA 4DV4H 4OD6A 4PDBA 4Q0YA 4APMA 4I7HA 4NXMH 4RB2C 4UCOA 2Q2TA 4GLXA 1N34H 5D1PA 3UQ8A 1M0TA 4DR4H 3N44B 1A0IA 4DR6H 4JI8H 3CVZA 4A2BA 1HR0H 3LMLA 4E9JA 4ETSA 4GKJH 4B3SH 4JI2H 4MV9A 4JI0H 4FM9A 4K0KH 1GYFA 2MCTA 4UCUA 4A2AA 2UXDH 3KALA 3JSNA 4YY3H 4BWSC 2RGVA 3RIZA 1HNWH 4LMYA 3SB1A 3T1YH 3FMAA 5FD6A 3K3VA 3QD7X 1B04A 4GKKH 3RTXA 3F8NA 4LF9H 4B3MH 3BA8A 1N33H 3OTOH 1ODHA 4CC5A 4LF4H 3IG0A 4UCRA 1IBLH 4UCVA 4LFAH 4MTEA 2VPSA 5FD5A 2RGRA 1HNXH 4RB3C 3EZJA 1S03G 3N42B 1XDNA 4X66H 3H20A 1WH2A 1Z2NX 4DUYH 3JAMW 4B8CD 3L4KA 3OETA 4DV7H 3NCVA 2F4VH 4DR1H 4DR2H 1Z2OX 4MV7A 3RJ0A 2UUAH 4M7EA 4RB0A 2HVSA 4JV5H 3EYYA 1HNZH 4RB1A 4DV5H 3J7AK 4R7RA 3FAUA 1MZBA 1BJTA 3DF7A 4B3TH 1M0WA 4JI3H 5IWAH 4LFBH 3JSLA 4OX9H 4LF6H 4NZRM 5D1OB 4LF8H 2ZQEA 3T1HH 1IBKH 2O03A 3L4JA 4DR3H 2Y3MA 1X9ZA 4YHHH 2ZJTA 1TAEA 2VOBA 3N41B 3RGZA 4JI1H 1AN7A 1I6UA 3RF2A 3MWMA 4LFCH 2KSWA 5EOYA 1E4GT 1ZHQA 4RAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 H;  4DV0 H;  1FJG H;  1SEI A;  1XMQ H;  3J80 W;  4DV3 H;  4DR5 H;  4JI5 H;  4KHP H;  1XNQ H;  4AQY H;  4DV6 H;  4DV1 H;  5LL6 b;  1I94 H;  4JI6 H;  4X65 H;  1XNR H;  4DR7 H;  2E5L H;  5IT9 W;  2UUC H;  1IBM H;  2UXB H;  4X64 H;  4JI4 H;  1J5E H;  4X62 H;  4DUZ H;  5LMN H;  4JYA H;  2UU9 H;  2UXC H;  4NXN H;  5FLX W;  1N32 H;  5BR8 H;  2VQF H;  3J81 W;  2HHH H;  2ZM6 H;  4LF7 H;  4B3R H;  4JI7 H;  2UUB H;  1N36 H;  4LF5 H;  5A2Q W;  1FKA H;  5LMU H;  2VQE H;  1XMO H;  4DV4 H;  4PDB A;  4NXM H;  1N34 H;  4DR4 H;  4DR6 H;  4JI8 H;  1HR0 H;  4GKJ H;  4B3S H;  4JI2 H;  4JI0 H;  4K0K H;  2UXD H;  4YY3 H;  1HNW H;  3T1Y H;  4GKK H;  4LF9 H;  4B3M H;  1N33 H;  3OTO H;  4LF4 H;  1IBL H;  4LFA H;  1HNX H;  1S03 G;  4X66 H;  4DUY H;  3JAM W;  4DV7 H;  2F4V H;  4DR1 H;  4DR2 H;  2UUA H;  4JV5 H;  1HNZ H;  4DV5 H;  3J7A K;  4B3T H;  4JI3 H;  5IWA H;  4LFB H;  4OX9 H;  4LF6 H;  4LF8 H;  3T1H H;  1IBK H;  4DR3 H;  4YHH H;  4JI1 H;  1AN7 A;  1I6U A;  3RF2 A;  4LFC H; 
#chains in the Genus database with same CATH topology
 2R82 A;  4DV2 H;  2YZG A;  5LXT F;  2BQR A;  4O3Q A;  4RUA A;  3BA9 A;  2V5A A;  1SEI A;  3KAJ A;  4XYL B;  2D9I A;  4YJ3 F;  5T14 A;  1BGW A;  2C2D A;  2CTF A;  1IOV A;  4O3P A;  1KJ8 A;  1XMQ H;  4TUY F;  2R6F A;  1PX2 A;  2VA3 A;  4DR5 H;  4JV1 A;  4UCR A;  1O75 A;  2WYO A;  2YL2 A;  1WTJ A;  3MR3 A;  2FK1 A;  1VAJ A;  4JV2 A;  1V9N A;  4DV1 H;  1UNN C;  3V6J A;  3GAB A;  4BXX G;  2V4R A;  2ASD A;  1N48 A;  2YW2 A;  2NU9 B;  2HVQ A;  1F0X A;  3LWB A;  2CKZ B;  1X4N A;  3C0F B;  4ECU A;  3GTJ A;  2JA5 A;  5KFM A;  4IHJ F;  4EFB A;  1TWC A;  2FLL A;  4A3B G;  2UUC H;  3OSS D;  5DQI A;  5L9X A;  5KG6 A;  4JI4 H;  5KFW A;  2R8J A;  4X62 H;  5FJ8 G;  2Q2U A;  3AEV B;  2NU8 B;  4G08 A;  4MTD A;  3GR5 A;  2R7Z A;  4OCH A;  1SFO A;  5IYC G;  4NXN H;  1WCM G;  2LTM A;  1N32 H;  5J2U F;  4EEQ A;  2C35 B;  3J81 W;  5KFJ A;  3ETJ A;  2JEB I;  2ZM6 H;  4IR1 A;  2X0S A;  4RUC A;  1IOW A;  5BMV F;  4UCS A;  2CW8 A;  2DZD A;  3BQ2 A;  4LF5 H;  2JA6 G;  2FPG B;  4AIM A;  4FBU A;  5LMU H;  2VQE H;  3G6V A;  2P0A A;  4BA1 I;  4LH6 A;  2GPS A;  2V58 A;  4NBQ A;  3OHA A;  2W6Z A;  5FPO A;  3RB6 A;  5IYD G;  2GPW A;  4QJF A;  4CC6 A;  4DL2 A;  4TQS A;  4DV4 H;  5D8D A;  3PO3 G;  2CWH A;  5KG5 A;  3VPC A;  4EYH B;  2JA8 G;  1N34 H;  4C5A A;  4O4H F;  5D1P A;  2HH3 A;  5KT6 A;  3PW5 A;  2JZX A;  4DR6 H;  1JLL B;  1RK6 A;  4A2B A;  1AUX A;  2R7L A;  1KC7 A;  4A3K G;  4GKJ H;  4JI0 H;  4O2A F;  5KFX A;  1GSA A;  1GSH A;  4QWB A;  2MCT A;  5L1K A;  1J5K A;  2UXD H;  1OWT A;  1DT4 A;  3V6H A;  2BR0 A;  4YY3 H;  4BWS C;  2VPQ A;  5C1O A;  3RB0 A;  1RK5 A;  3KHH A;  3Q8R B;  2RF4 A;  3JZI A;  1S0M A;  2FK2 A;  4ECT A;  1B04 A;  4GKK H;  3U1K A;  3F8N A;  3RUP A;  1N33 H;  3OTO H;  1ODH A;  4O4I F;  5KFK A;  4QWE A;  1V4Y A;  2W9C B;  5C0X G;  1IBL H;  5KKN B;  3HOX G;  5FD5 A;  2RGR A;  2XCA A;  5IYZ F;  2DPI A;  3GV5 B;  1GSO A;  5EWE A;  2R86 A;  2AGP A;  1N56 A;  3H20 A;  2HJW A;  3GIM A;  3M9O B;  3PR4 A;  4DUY H;  3JAM W;  2FJZ A;  2R92 G;  1DV2 A;  3OET A;  4FS1 A;  3Q8Q B;  4DR1 H;  1M7J A;  2E3U A;  4M7E A;  2HVS A;  2WAQ E;  2CTE A;  2ANN A;  3N8D A;  1HNZ H;  4RB1 A;  4GC7 A;  3GTQ A;  4R7R A;  4QWC A;  1ZZI A;  5KG4 A;  3WNZ A;  5LP6 F;  1BJT A;  1WSC A;  4YAK B;  4B3T H;  4F4W A;  4WD3 A;  1K83 A;  5IWA H;  3GTO A;  1C3O A;  4RZR A;  3HOW G;  3HKZ A;  2JA7 G;  2O03 A;  4QMF B;  5GON F;  4DR3 H;  2XD4 A;  2WTF A;  2VR1 A;  3KHL A;  2R85 A;  1V8C A;  1VKZ A;  2WB1 A;  3OSP A;  4IR9 A;  2R93 A;  4JI1 H;  1AN7 A;  2R7K A;  5K36 G;  2R7M A;  5EOY A;  2IMW P;  5DQH A;  1VBH A;  2R84 A;  2WE6 A;  3TQ1 A;  5C8Y F;  4DV0 H;  4EEY A;  1JXL A;  3GTG A;  2YU9 A;  3GIK A;  4EBC A;  1S68 A;  5KFE A;  3RB4 A;  1ULZ A;  3J80 W;  4DV3 H;  2YRX A;  2JEI A;  4ECW A;  3HOV G;  2Y0S A;  1TA8 A;  4C5C A;  5J2T F;  4AQY H;  2M8W A;  4DV6 H;  2YRW A;  4TV9 F;  2J6U A;  5KFD A;  4EC5 A;  2WDT A;  5D1O A;  3BQ0 A;  4EG0 A;  4FU0 A;  4A3L G;  3BAA A;  3FKI G;  4A3D G;  3QZ8 A;  4O2B F;  3ORQ A;  2DLN A;  5EDW A;  2DWC A;  1UG8 A;  3BJY A;  1KJ9 A;  2BL5 A;  1IBM H;  2UXB H;  4X64 H;  1CQJ B;  1WR2 A;  2FP4 B;  3K5I A;  3BG5 A;  1J5E H;  4XYM B;  3VPB A;  1RJP A;  2DIK A;  3PN1 A;  5KFZ A;  5KG2 A;  4ED2 A;  2UVR A;  1TWG A;  5JEA G;  1P8L A;  2QND A;  5LMN H;  5JVL A;  2ASJ A;  2UU9 H;  2C00 A;  4DL5 A;  2R8K A;  2BQ3 A;  2YQR A;  4YR0 A;  4L1K A;  4I55 F;  1E4E B;  4ECS A;  3GTM A;  1SCU B;  4LF7 H;  5L1L A;  3V4S A;  3ORR A;  1UC8 A;  1X9N A;  1KJJ A;  4A3F G;  2XCP A;  2I8C A;  2AU0 A;  3JRW A;  2R7N A;  3KAK A;  3MFI A;  2FLP A;  2E2H A;  4BY7 G;  2PT7 G;  3L2P A;  4RB2 C;  1VIG A;  1KHM A;  3I0P A;  3Q1K A;  4U7C A;  4UCO A;  4HYK A;  2PN1 A;  2Q2T A;  3GV7 B;  4GLX A;  3RB3 A;  1M0T A;  2NVY A;  3T5J A;  1A0I A;  3PVX A;  1S9F A;  3CVZ A;  1WCM A;  2NU6 B;  4E9J A;  1EYZ A;  1GYF A;  1S97 A;  2NVX A;  4OO1 G;  1K1Q A;  3EPI A;  4IWY A;  4XZ3 B;  2V59 A;  4E4T A;  3GIL A;  4ECQ A;  5LYJ F;  4IWX A;  3JSN A;  4ED8 A;  2OLS A;  3RIZ A;  5CA1 F;  1EHI A;  3K3P A;  3SB1 A;  2JA6 A;  3GID A;  2CTM A;  3T1Y H;  3K3V A;  3HOY G;  3GIP A;  5C3E G;  1X4M A;  4DLK A;  1TWH A;  2IA6 A;  2P2R A;  4MV1 A;  4LF4 H;  3IG0 A;  5KFV A;  1A9X A;  5EWF A;  4DL3 A;  4UCV A;  4J9M A;  4WAN A;  3Q8S B;  1HNX H;  3Q8P B;  4RB3 C;  3EZJ A;  4MV6 A;  3N42 B;  1XDN A;  2JA7 A;  4J9P A;  5LA6 F;  4FS2 A;  4B8T A;  4I50 F;  2G8Y A;  4B8C D;  5KFL A;  3L7Z C;  3LP8 A;  2PY9 A;  3L4K A;  4HNT A;  4F4Z A;  1Z2I A;  1Z2O X;  4AYB A;  5C44 G;  1EUD B;  4ZOL F;  2W9B B;  2JEF A;  2W6P A;  2JE6 I;  4DL7 A;  4G3I A;  4DV5 H;  2FPI B;  2JEA I;  4A3E G;  1MZB A;  3MR2 A;  2OH2 A;  3DF7 A;  3JRX A;  2PMZ A;  3TII A;  4JI3 H;  3H4D A;  2AQ4 A;  4LFB H;  4JUZ A;  4OX9 H;  4IRD A;  4LF8 H;  4R8U B;  3OHB A;  4A3G G;  3GLK A;  4J9Q A;  2W9A A;  3PW7 A;  2FK3 A;  2Y3M A;  2W9C A;  4IFD G;  1DV1 A;  5KT5 A;  4YHH H;  2YZM A;  1TAE A;  4RNM A;  4Q8F A;  2VOB A;  3I12 A;  4AM3 A;  5C1P A;  2R8I A;  3R5H A;  4A3I G;  3K5H A;  3NGD A;  5KFQ A;  2R92 A;  4RAY A;  4FM9 A;  3GTK A;  4Y8V B;  4RAZ A;  4ZQI A;  1CS0 A;  3KDG A;  4Q43 A;  5DGB A;  4LH7 A;  5IP9 G;  4MA0 A;  5KG3 A;  1FJG H;  2QYZ A;  1S0N A;  2B63 G;  1TWF A;  3OUZ A;  5CB4 F;  5HBR B;  3TIN A;  4O4L F;  5KFP A;  2CPQ A;  3H40 A;  3T5L A;  2V4Q A;  5JQW A;  3KXY T;  2LF0 A;  5BPH A;  2GLT A;  2AGQ A;  1Z2P X;  3MR5 A;  4IAJ A;  4QW8 A;  1V9P A;  1B6R A;  3PZP A;  4A93 G;  2IP4 A;  5HV6 A;  5LL6 b;  2XIG A;  2DPJ A;  4X65 H;  1XNR H;  4IZO A;  3RGX A;  4PWQ A;  1TUA A;  1JDE A;  1C30 A;  4JV0 A;  2K1H A;  4NZT M;  5DT9 A;  3GIJ A;  3G6X A;  5KT2 A;  4HNU A;  2HVR A;  3WO1 A;  1B6S A;  5KFI A;  1B33 N;  2YS7 A;  4ME6 A;  1CE8 A;  4QIW A;  4ED3 A;  4LSA A;  1I7N A;  3N43 B;  3H0G G;  4BA2 I;  4Q45 A;  5CAE B;  4ECV A;  1M6V A;  4DL4 A;  1Y1V G;  5KFT A;  1SYX B;  2A1S A;  2W57 A;  3BAB A;  1L2Z A;  2SCU B;  1ZHS A;  5KT4 A;  5FLX W;  4C2M A;  2W70 A;  3T5H A;  3KDK A;  2CTK A;  1R9T A;  3PO2 G;  2HHH H;  4ZHQ F;  3M4I A;  4RNN A;  4A3M G;  4JI7 H;  2J9G A;  1E4F T;  2XGP A;  1N36 H;  5KFO A;  5A2Q W;  2W6N A;  5DQG A;  3PR5 B;  4F4X A;  2M05 A;  3FKI A;  3I4M G;  2LTL A;  3T5K A;  3V69 A;  3KHR A;  1FVI A;  5FLM G;  3HKZ E;  2W8K A;  4DL6 A;  2R8H A;  3R5F A;  4IRC A;  3RAX A;  1Y14 B;  3SI8 A;  1EZ1 A;  1MSZ A;  4PDB A;  1WE8 A;  2PQU A;  4APM A;  4C5B A;  2DGR A;  2VA2 A;  2I87 A;  2WB1 E;  1NXU A;  3GTL A;  4BBR G;  2X06 A;  4MV8 A;  1WHR A;  1Y1W G;  3G8C A;  1S20 A;  2Z0S A;  4DR4 H;  2W6M A;  4O3N A;  4HR7 A;  5JH7 F;  3UQ8 A;  2NUA B;  4Q8E A;  4JI8 H;  4YB8 B;  1HR0 H;  3LML A;  4ETS A;  4B3S H;  2ZDH A;  4K0K H;  2ATL A;  4A2A A;  5H80 A;  2XC9 A;  1VIH A;  1ZTG A;  1E4E A;  3KAL A;  5F9L A;  3M9M B;  3AYH B;  3Q2O A;  1HNW H;  1T94 A;  2W6O A;  4LMY A;  3KTM A;  2PBZ A;  1JDB B;  5FD6 A;  3HB9 A;  4GC6 A;  3QD7 X;  4RNO A;  2XCL A;  2C22 A;  4CC5 A;  2HH2 A;  1ZZK A;  3UOE A;  4B3M H;  4LF9 H;  2FMA A;  1JIH A;  2BQU A;  1K1G A;  1ZET A;  2NN6 G;  1EC6 A;  2MJH A;  4JVH A;  5EWG A;  1ZQ7 A;  3QFF A;  1I7L A;  2LRR A;  2VUM G;  1J4W A;  1Z2N X;  5KFC A;  4ECZ A;  4A3J G;  2I80 A;  2UVV A;  4O3S A;  4DV7 H;  3NCV A;  3MWE A;  4MV7 A;  3GV8 B;  4EGJ A;  2UUA H;  3BQ1 A;  4H8A A;  4F4Y A;  2J6T A;  4JV5 H;  3EYY A;  5C4X G;  3J7A K;  2VQD A;  2W7O A;  2AXY A;  1EUC B;  5JVD F;  2ZDG A;  2E2I A;  3MFH A;  3MR6 A;  3PW2 A;  3GTP A;  3RV4 A;  3QZ7 A;  4J9R A;  5KFU A;  4ED7 A;  3IN5 A;  4WAL A;  1GGO A;  4NZR M;  5DGA A;  5F9N A;  4EYI B;  4M9U A;  4O3R A;  1IBK H;  3HOU G;  1AUV A;  4J9L A;  4LIJ A;  1CQI B;  1VBG A;  5KG7 A;  1BXR A;  3GQC A;  2FFM A;  4J9S A;  3UFX B;  4BBS G;  2ZJT A;  2JA5 G;  3N41 B;  1W93 A;  1I6U A;  3MWM A;  4FJU A;  2KSW A;  4HQ6 A;  1E4G T;  1ZHQ A;  5FPR A;  4QWA A;  4EBE A;  4LSX A;  2W8L A;  2FLN A;  2R7Z G;  1K1S A;  5EZY F;  2FPH X;  2OPV A;  1VS0 A;  2ANR A;  3TQT A;  4EFE A;  2W9B A;  2CWF A;  3RBE A;  2C2E A;  4FBT A;  2BA0 A;  5KFF A;  2CTJ A;  3TIG A;  4JI5 H;  2PVP A;  2VUG A;  4KHP H;  2VKC A;  2QK4 A;  2R87 A;  2C28 A;  3MJF A;  1XNQ H;  2UVU A;  4FJS A;  2V9W A;  4IRK A;  1JX4 A;  1I94 H;  5C5J A;  3CQZ A;  4JI6 H;  2FPP B;  4DR7 H;  1GLV A;  4R8U A;  2OWO A;  2E5L H;  3N40 P;  2W71 A;  4ECX A;  2CW7 A;  5IT9 W;  1XRH A;  1VBI A;  4J9O A;  3GIQ A;  5L1J A;  3VPD A;  3PW4 A;  1KJQ A;  4DUZ H;  3E5N A;  3WO0 A;  3U9S A;  3KHG A;  3RFC A;  1TWA A;  2FKL A;  4JYA H;  5KG1 A;  3OSN A;  2UXC H;  2WAQ A;  2YYA A;  5BPF A;  4U6P A;  4F50 A;  5DG9 A;  4UCT A;  2O4C A;  4UFZ A;  5BR8 H;  5DLG A;  3VMM A;  4YR3 A;  4AYB E;  2VQF H;  2YCH A;  4J0M A;  3H3V H;  4TQR A;  2W7P A;  1RJQ A;  2HGS A;  1S10 A;  4B3R H;  2YZN A;  3MWD A;  2UUB H;  1DGS A;  4XX0 B;  3OUU A;  4YP3 A;  2FE3 A;  1FKA H;  2PMZ E;  2XGQ A;  1KEE A;  4QWD A;  1XMO H;  1RYS A;  1RJR A;  3HXL A;  4I4T F;  4NLG A;  3M9N B;  1BNC A;  4RZQ A;  3RV3 A;  3RBD A;  3V6K A;  5CA0 F;  4RU9 A;  1PK8 A;  2W6Q A;  4Q0Y A;  4OD6 A;  4HNV A;  1V51 A;  5KX5 F;  4I7H A;  4NXM H;  3H0G A;  2FMR A;  4YBZ B;  3GII A;  2AGO A;  2J6S A;  2JEG A;  1Y1V A;  3RAQ A;  2CPM A;  3N44 B;  2CTL A;  1KJI A;  3H4B A;  4MV4 A;  2C2R A;  4EGQ A;  4WBN F;  5LOV F;  1RYR A;  2JA9 A;  4MV9 A;  4JI2 H;  2R8G A;  4EBD A;  3ETH A;  2UVW A;  3I4N G;  4UCU A;  3HOZ G;  4ZI7 F;  1I50 A;  4ED1 A;  3SE7 A;  3HBL A;  4YAJ B;  2NU7 B;  2RGV A;  4ED0 A;  3GKU A;  4Q44 A;  4YJ2 F;  3EPG A;  3FMA A;  1T36 A;  5KFA A;  1W96 A;  5DG7 A;  2ASL A;  4TV8 F;  3RTX A;  1KBL A;  4MAM A;  1X0A A;  3BA8 A;  4A3C G;  2JEJ A;  1PQX A;  5DLF A;  4LFA H;  3FDS A;  4MTE A;  2VPS A;  1GO3 E;  5KFR A;  5IP7 G;  5KFN A;  4ED6 A;  4YQW A;  1S03 G;  4QIW E;  5L1I A;  2ALZ A;  4J9N A;  4O3O A;  2R93 G;  4X66 H;  4MA5 A;  1Y1W A;  5I47 A;  1WH2 A;  1JKJ B;  4MV3 A;  2IBK A;  5KFG A;  4ECR A;  2F4V H;  5K2M A;  3U9T A;  4DR2 H;  3VKE A;  3V4Z A;  3RJ0 A;  4RB0 A;  2CQY A;  5KFH A;  2M6Q A;  1WVN A;  5KT7 A;  1T3N A;  3FAU A;  5KG0 A;  1DTJ A;  2FB9 A;  1I3Q A;  1S0O A;  1M0W A;  5KT3 A;  3JSL A;  1ZZJ A;  5KFS A;  2Y0S E;  4LF6 H;  5D1O B;  3PW0 A;  3R23 A;  4JVY A;  2ZQE A;  3T1H H;  2CZG A;  2RDI A;  5IYB G;  5DG8 A;  5KFY A;  1UC9 A;  3L4J A;  3G6Y A;  2B63 A;  2YS6 A;  2ZDQ A;  2JVZ A;  4BY1 G;  1X9Z A;  2OPU A;  5KFB A;  4ECY A;  4J9K A;  4QW9 A;  3RGZ A;  1DIK A;  4YR2 A;  2RDJ A;  3RF2 A;  4LFC H;  5JUM A;  2VUM A;  3R5X A;  3N6X A; 
#chains in the Genus database with same CATH homology
 5FPR A;  4RAZ A;  4DV2 H;  3KDG A;  2WE6 A;  4DV0 H;  4LH7 A;  4LSX A;  1FJG H;  2FPH X;  3BA9 A;  1VS0 A;  1SEI A;  3KAJ A;  1S68 A;  2D9I A;  4EFE A;  1BGW A;  1XMQ H;  3J80 W;  4DV3 H;  4DR5 H;  4JI5 H;  2VUG A;  4KHP H;  2VKC A;  1O75 A;  2WYO A;  2LF0 A;  3KXY T;  3N6X A;  1XNQ H;  1TA8 A;  1Z2P X;  4AQY H;  4IAJ A;  4DV6 H;  1V9P A;  4DV1 H;  3GAB A;  5LL6 b;  1I94 H;  2XIG A;  4JI6 H;  4X65 H;  1XNR H;  3RGX A;  4DR7 H;  4EC5 A;  2WDT A;  5D1O A;  2HVQ A;  1F0X A;  4NZT M;  5DT9 A;  3BAA A;  3C0F B;  2OWO A;  2E5L H;  2HVR A;  3N40 P;  4EFB A;  2CW7 A;  5IT9 W;  2UUC H;  3OSS D;  1IBM H;  2UXB H;  4X64 H;  4JI4 H;  3N43 B;  4LSA A;  1J5E H;  4X62 H;  2Q2U A;  4DUZ H;  3PN1 A;  4G08 A;  1SYX B;  3GR5 A;  4MTD A;  1P8L A;  4OCH A;  2W57 A;  5LMN H;  4JYA H;  3BAB A;  2UU9 H;  2UXC H;  1L2Z A;  4NXN H;  1ZHS A;  5FLX W;  2O4C A;  1N32 H;  5BR8 H;  4UCT A;  4UFZ A;  4EEQ A;  2VQF H;  2YCH A;  3KDK A;  4J0M A;  3J81 W;  2HHH H;  2ZM6 H;  4LF7 H;  2HGS A;  3M4I A;  4B3R H;  4JI7 H;  4UCS A;  2UUB H;  1DGS A;  2CW8 A;  1X9N A;  1E4F T;  1N36 H;  4LF5 H;  5A2Q W;  2FE3 A;  1FKA H;  5LMU H;  2VQE H;  1XMO H;  3KAK A;  3HXL A;  1FVI A;  4LH6 A;  4RZQ A;  5FPO A;  4CC6 A;  2PT7 G;  3L2P A;  4DV4 H;  4OD6 A;  4PDB A;  4Q0Y A;  4APM A;  4I7H A;  4NXM H;  4RB2 C;  4UCO A;  2Q2T A;  4GLX A;  1N34 H;  5D1P A;  3UQ8 A;  1M0T A;  4DR4 H;  3N44 B;  1A0I A;  4DR6 H;  4JI8 H;  3CVZ A;  4A2B A;  1HR0 H;  3LML A;  4E9J A;  4ETS A;  4GKJ H;  4B3S H;  4JI2 H;  4MV9 A;  4JI0 H;  4FM9 A;  4K0K H;  1GYF A;  2MCT A;  4UCU A;  4A2A A;  2UXD H;  3KAL A;  3JSN A;  4YY3 H;  4BWS C;  2RGV A;  3RIZ A;  1HNW H;  4LMY A;  3SB1 A;  3T1Y H;  3FMA A;  5FD6 A;  3K3V A;  3QD7 X;  1B04 A;  4GKK H;  3RTX A;  3F8N A;  4LF9 H;  4B3M H;  3BA8 A;  1N33 H;  3OTO H;  1ODH A;  4CC5 A;  4LF4 H;  3IG0 A;  4UCR A;  1IBL H;  4UCV A;  4LFA H;  4MTE A;  2VPS A;  5FD5 A;  2RGR A;  1HNX H;  4RB3 C;  3EZJ A;  1S03 G;  3N42 B;  1XDN A;  4X66 H;  3H20 A;  1WH2 A;  1Z2N X;  4DUY H;  3JAM W;  4B8C D;  3L4K A;  3OET A;  4DV7 H;  3NCV A;  2F4V H;  4DR1 H;  4DR2 H;  1Z2O X;  4MV7 A;  3RJ0 A;  2UUA H;  4M7E A;  4RB0 A;  2HVS A;  4JV5 H;  3EYY A;  1HNZ H;  4RB1 A;  4DV5 H;  3J7A K;  4R7R A;  3FAU A;  1MZB A;  1BJT A;  3DF7 A;  4B3T H;  1M0W A;  4JI3 H;  5IWA H;  4LFB H;  3JSL A;  4OX9 H;  4LF6 H;  4NZR M;  5D1O B;  4LF8 H;  2ZQE A;  3T1H H;  1IBK H;  2O03 A;  3L4J A;  4DR3 H;  2Y3M A;  1X9Z A;  4YHH H;  2ZJT A;  1TAE A;  2VOB A;  3N41 B;  3RGZ A;  4JI1 H;  1AN7 A;  1I6U A;  3RF2 A;  3MWM A;  4LFC H;  2KSW A;  5EOY A;  1E4G T;  1ZHQ A;  4RAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...