3J80W

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
129
structure length
129
Chain Sequence
TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 27
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3j80W01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3j80W02
2VQEH 5BR8H 4K0KH 2UXDH 4JI6H 4DV6H 4LFBH 4JI2H 4NXMH 1XMOH 2E5LH 2F4VH 3J7AK 4X64H 4LF4H 4DV5H 4LF5H 3JAMW 1J5EH 1I94H 2UU9H 5IT9W 1S03G 4JI5H 4AQYH 4JYAH 4B3MH 2ZM6H 4GKKH 1SEIA 4DR1H 5IWAH 1FKAH 4LF6H 5FLXW 4B3TH 4OX9H 4NXNH 4JI3H 4KHPH 4DV4H 4LF7H 4DR7H 4JI8H 1HNXH 5A2QW 1XNRH 2UXCH 1XMQH 4YY3H 5LMNH 4DR3H 4LFCH 4DR6H 4LFAH 2UUCH 4LF8H 4X66H 1XNQH 4JI0H 4DR4H 2HHHH 1HNWH 4LF9H 4X62H 1IBMH 4JI4H 3RF2A 3T1YH 4B3SH 4DV0H 2VQFH 1IBLH 1N34H 4DUZH 4JI1H 1HNZH 4YHHH 4DV2H 1IBKH 4DV1H 3T1HH 3OTOH 4PDBA 4DR5H 4DR2H 2UUAH 1N32H 1N33H 3J81W 4DV3H 1AN7A 4B3RH 4DUYH 4JV5H 1I6UA 4JI7H 4GKJH 1FJGH 2UXBH 4X65H 5LMUH 1N36H 3J80W 1HR0H 5LL6b 4DV7H 2UUBH
chains in the Genus database with same CATH superfamily
2HVRA 1KJIA 1X4NA 2XD4A 2VQEH 4BXXG 4LH7A 4AIMA 2CPQA 1ZZJA 3CQZA 4MV6A 4C5AA 2VQDA 1I50A 3OHBA 5BR8H 3HOZG 3QZ8A 2Q2UA 1BXRA 4QWCA 3EPGA 2UXDH 4NZTM 3BA9A 2YQRA 4LIJA 4ED3A 2YCHA 2LTLA 5C8YF 3PW5A 4JI2H 4NXMH 3U9SA 3Q8RB 3R5HA 3BG5A 1RYRA 4A3MG 4RNNA 1KJ9A 4DL4A 5CA1F 2V9WA 5IP7G 2A1SA 4ECZA 4YJ3F 3M4IA 1N48A 2I87A 4RAZA 3JAMW 1C30A 3VPBA 5KX5F 4YR0A 1S03G 4O2AF 3MR5A 2BA0A 3N6XA 3GIKA 4FS2A 4RB0A 1E4FT 3T5LA 1K1QA 2O03A 2BQUA 4EYHB 4BA1I 5KG2A 2R8JA 2W6PA 3L7ZC 5KG5A 3G6XA 2CZGA 2CPMA 3H20A 2XGQA 4IAJA 4B8CD 3PO2G 2PMZE 4QJFA 4UCTA 3GV5B 4OX9H 3BAAA 4NXNH 2W9BB 2HVQA 1ODHA 1WHRA 2V5AA 5LP6F 4QIWE 4EGQA 5FPOA 4EBCA 4DL5A 2DIKA 2R6FA 5KT3A 4RNOA 2V59A 1GGOA 2FK2A 2E3UA 5KFLA 3MWMA 1HNXH 1VBHA 4MTEA 3K3VA 1NXUA 2UXCH 2WDTA 3TQ1A 4YY3H 2CW8A 3G8CA 5DQGA 2ASDA 4R8UB 1B6RA 4LF8H 4A3DG 5IP9G 5KKNB 2E2HA 2WAQE 4FJSA 1IOWA 2UVVA 2AGPA 3K5HA 3GIQA 2C22A 4G08A 4MA5A 1IBMH 4EGJA 3TIIA 4J9MA 3RB0A 2IMWP 2HH3A 3T1YH 5C1OA 1ULZA 3RUPA 4ETSA 5KFPA 1KEEA 2XGPA 4I50F 3VPCA 1IBLH 2FKLA 1N34H 4YQWA 1DV2A 4O3PA 2Y3MA 1HNZH 3PN1A 3H4DA 3RBDA 1JKJB 2JA6G 3GTLA 2YS7A 1UG8A 4IWYA 5L1IA 3H0GG 4ECTA 3OETA 3PR4A 5JEAG 4ECYA 2FLNA 3Q8SB 4YB8B 4F4XA 2IP4A 4FU0A 5LOVF 3OTOH 2LF0A 1SCUB 4PDBA 5FJ8G 2XC9A 3H4BA 3U9TA 2MJHA 3JZIA 4UCUA 2K1HA 4Q8FA 2YRXA 4M9UA 4EBDA 2VOBA 2UVRA 3HOYG 1Z2PX 3GILA 2I80A 3TINA 2R7KA 1M0TA 4YAJB 2HH2A 4NBQA 4IHJF 4JV5H 2G8YA 5DG9A 3NGDA 5IYZF 2JEGA 4JI7H 5KFZA 2LTMA 2PBZA 4GKJH 3T5HA 1S20A 3RB3A 2GLTA 3N42B 5D1OA 2VUGA 1N36H 4YR3A 2FPGB 3JRWA 3KTMA 1WVNA 2R7ZA 1ZHQA 5KFOA 2CTEA 1S97A 2DWCA 2V58A 2JEFA 4EFBA 1EHIA 5KFFA 5LL6b 4A2AA 2UUBH 3N40P 4RUCA 2W6NA 3JSLA 4Q8EA 2CTMA 2CQYA 2WAQA 3HB9A 3RTXA 4J9QA 1WCMG 1CQIB 4A2BA 5DGBA 1T3NA 1S0MA 1R9TA 2VA3A 2YU9A 3EZJA 2B63A 5KT6A 3SB1A 3QD7X 2ZDQA 1X4MA 1EC6A 4LFBH 5F9NA 5DG7A 1V51A 2C2DA 2DPIA 4BA2I 4WALA 3EPIA 2X0SA 5KFWA 5KG6A 5GONF 2F4VH 4U7CA 1EUDB 4R8UA 1AUXA 5LYJF 3RIZA 4LF4H 5KFQA 1PK8A 4IRKA 2W9CA 5KFKA 2J6SA 5KFSA 4GLXA 4LF5H 2ZJTA 3KAJA 1UC8A 1A9XA 3L4JA 5D1PA 4PWQA 2BQ3A 1S0OA 3OHAA 1Y1WG 4J9LA 3PW4A 4C5BA 5HBRB 1I94H 2UU9H 2CTKA 4JI5H 3R5XA 2YYAA 4RUAA 2IA6A 4O4HF 4MV8A 3WO1A 2JA7A 5KFXA 1UC9A 4GKKH 4UCSA 2VA2A 4A3JG 1SEIA 5DGAA 2JZXA 2AGQA 3GTMA 3V69A 5IYDG 2ZDHA 3UOEA 2E2IA 4B3TH 1S0NA 4JUZA 2R8KA 3CVZA 4IFDG 1Y1WA 5KFEA 2HGSA 2W8LA 5JVDF 3FKIA 3I4NG 4O4LF 3HXLA 1CQJB 3MWDA 2YS6A 4OCHA 3DF7A 5KG3A 4DV4H 5JH7F 4FBTA 3RAXA 3PW7A 3KHHA 3GABA 4EG0A 2GPSA 4HR7A 3OSSD 4U6PA 5A2QW 1BJTA 4HNTA 1DV1A 1W96A 1XNRH 3LP8A 4I7HA 4MV4A 5FLMG 1AUVA 4HNUA 4F50A 1KJJA 3WO0A 4F4WA 3RAQA 2VPSA 3RFCA 2JA7G 4BWSC 3OSPA 1WCMA 1DGSA 4X66H 1XNQH 5BPFA 5KFAA 2GPWA 2W57A 1RK6A 4A3BG 4JI0H 5K2MA 3M9MB 1HNWH 5C0XG 4RB2C 3N44B 2JEJA 2FP4B 5JVLA 3GIJA 2FK1A 2QNDA 3R23A 1TUAA 5KT7A 5EOYA 4QW8A 3GQCA 4JI4H 4YR2A 3RF2A 2W9CB 2Y0SA 4XZ3B 2R8IA 4ED6A 1S9FA 4B3SH 3VKEA 4ECWA 2R7ZG 4BBSG 2YZNA 2JA8G 4Q43A 4J0MA 3I0PA 2VQFH 4I55F 3MR6A 4DUZH 2FLLA 2W71A 1BGWA 4AM3A 2BQRA 3GV7B 3HOVG 5D1OB 2R85A 4O3RA 2BL5A 4YHHH 4YAKB 2XCAA 3V6HA 3OSNA 4AYBE 2FPHX 4DV2H 3GTGA 1K1SA 4FJUA 4J9NA 4FBUA 1WE8A 3T1HH 1IOVA 1UNNC 4MA0A 2FE3A 4ECXA 4M7EA 5L1JA 2SCUB 3E5NA 4DR5H 3ORQA 4DR2H 5KFUA 1X9ZA 4QMFB 3PO3G 1N32H 2FPPB 3LMLA 2UVWA 2W70A 2P2RA 1N33H 1EYZA 5KFRA 3Q8PB 4RZQA 3FKIG 1Z2IA 5FD6A 1GSOA 3OUZA 1X0AA 3J81W 3KHGA 3TQTA 1VAJA 5KFHA 3M9OB 4IWXA 3PR5B 4B3RH 2CTLA 3H0GA 1CS0A 5C1PA 2JA6A 1KJ8A 1FVIA 1TWGA 2NU6B 4J9SA 1FJGH 1WSCA 4J9PA 4GC6A 3IG0A 3PW2A 3U1KA 5LMUH 4MTDA 2ANRA 1T36A 2FLPA 3LWBA 1V9PA 2NUAB 3TIGA 1VBIA 2FMAA 4EBEA 4DL2A 3RB4A 2NVYA 3EYYA 2DZDA 2DPJA 3Q1KA 5EWGA 3F8NA 3G6VA 2J6TA 4JVHA 1ZHSA 5JQWA 1TA8A 3MFHA 3JRXA 5KFYA 1W93A 3N41B 4APMA 3IN5A 3G6YA 4A93G 3KAKA 2W6QA 4JI6H 4AYBA 2W7PA 1XDNA 2FJZA 3BQ2A 1PQXA 4BY7G 4LSXA 1XMOH 3KHRA 3JSNA 4F4ZA 5KFIA 2B63G 4Q44A 4DV5H 4J9OA 4OD6A 5IYBG 2NN6G 2HVSA 2LRRA 4QWBA 4EYIB 4FM9A 2JA9A 2W8KA 1J5EH 1WTJA 2WB1E 3RB6A 1JDEA 4DL3A 3UFXB 5IT9W 5CB4F 5DT9A 2R82A 2PQUA 2PY9A 2DLNA 1SFOA 4LMYA 1TWAA 1ZZKA 1EUCB 4ECVA 4JYAH 2BR0A 4FS1A 2OWOA 2W6ZA 5K36G 4UCRA 4NZRM 2CKZB 4A3EG 1V4YA 4XYLB 2ZM6H 2ALZA 3I4MG 1M0WA 5BMVF 1X9NA 4EFEA 3N43B 4L1KA 4TV9F 5IWAH 1WH2A 4BBRG 2M8WA 4LF6H 4QW9A 5KT4A 4R7RA 2C00A 4ECSA 4QWDA 2AQ4A 4ZOLF 4RNMA 2M05A 1TWCA 4TUYF 5FPRA 2IBKA 4F4YA 1J5KA 4ED8A 2C28A 4J9KA 4KHPH 3HKZE 2C2EA 4LF7H 2ZQEA 3KALA 4JV2A 5DLFA 2UVUA 1VBGA 1B6SA 3PW0A 4LH6A 1JX4A 4YBZB 1CE8A 5H80A 3FAUA 2WTFA 2J6UA 1DTJA 3KDKA 4XX0B 4DR3H 1JLLB 5KG1A 4DR6H 1B33N 3K3PA 1B04A 3KXYT 4YP3A 5T14A 3M9NB 2X06A 2YW2A 4MV7A 3V4ZA 4I4TF 5KFVA 1OWTA 2YZMA 3L4KA 2AGOA 3GTJA 4DR4H 4MV1A 2HHHH 1VKZA 3V6JA 2YZGA 4LF9H 4X62H 2PVPA 1KC7A 5C44G 5L1KA 1E4EA 4ECQA 3QFFA 3RV3A 3UQ8A 1TWFA 4C5CA 4IR1A 5LXTF 5KFMA 1WR2A 5J2TF 5EDWA 4JI1H 2W9AA 5L1LA 4IRDA 3VMMA 3GR5A 1GYFA 5KG4A 3L2PA 2R84A 5DQIA 2JEIA 2R8HA 2J9GA 4WANA 1I7NA 1KJQA 2D9IA 4RU9A 5CAEB 2R86A 5KFDA 5DLGA 1RK5A 4MAMA 1VS0A 3T5JA 3Q2OA 4MV9A 2VKCA 1Z2NX 2I8CA 1VIGA 4UCVA 3I12A 4NLGA 5I47A 1ZTGA 3GV8B 2FMRA 4EEYA 3GTKA 4CC6A 3MFIA 2RGVA 2OPUA 1XRHA 2PN1A 4MV3A 2VUMG 4A3LG 2FFMA 1I6UA 4O3QA 2JVZA 1K83A 2XCLA 5LA6F 4LSAA 2V4QA 1GLVA 1ZZIA 1ZETA 2CWFA 4ED0A 3ETJA 3N8DA 2C35B 1K1GA 3ORRA 4WD3A 2R7MA 3GIPA 4ME6A 3Q8QB 1HR0H 1GO3E 1F0XA 2W6OA 2JA5G 3NCVA 5DQHA 1N56A 4A3CG 1L2ZA 3K5IA 2ANNA 2R93G 2C2RA 2R7NA 2FB9A 4RZRA 1M7JA 4RB3C 3HOXG 5L9XA 3RGXA 4K0KH 2FK3A 5EWEA 3GTOA 2R92A 2NU8B 1KBLA 4G3IA 1MSZA 4DV6H 1P8LA 2YL2A 2Z0SA 1JIHA 3GTQA 4O2BF 3GIMA 4O3SA 2RDIA 3VPDA 2E5LH 4J9RA 3J7AK 5KFBA 4X64H 5CA0F 5KFJA 4RAYA 4QWAA 4IRCA 5BPHA 2R92G 3BQ1A 2OLSA 1I7LA 2OPVA 1KHMA 2JEBI 4JV0A 3HKZA 1GSAA 5C5JA 3GIIA 3H40A 4JVYA 3RV4A 5KFTA 3PVXA 3KDGA 4UCOA 4HNVA 2QK4A 2NU7B 3V4SA 2W6MA 3C0FB 4C2MA 5HV6A 1JXLA 2OH2A 3HOUG 1JDBB 5KT2A 2AXYA 2ASJA 4AQYH 5KG7A 2CWHA 2XIGA 4B3MH 1Y14B 2MCTA 2RF4A 2VPQA 4TV8F 3HBLA 2ASLA 4Q45A 2HJWA 4ED2A 4DR1H 3HOWG 1FKAH 1O75A 5FLXW 1EZ1A 4QIWA 4DLKA 4ED7A 2WYOA 5F9LA 3H3VH 1E4GT 4YJ2F 2WB1A 2YRWA 3AYHB 4B8TA 2ZDGA 3ETHA 4DL6A 4JI3H 1ZQ7A 2AU0A 2PMZA 3WNZA 5KFNA 4DR7H 4JI8H 1J4WA 4EEQA 4QWEA 2DGRA 1DT4A 4UFZA 3SE7A 4GC7A 4HYKA 1Z2OX 1V9NA 1XMQH 5KT5A 5LMNH 4LFCH 4TQSA 4LFAH 1RJRA 2UUCH 1C3OA 5KG0A 1RYSA 5EWFA 1Y1VG 5C3EG 3RGZA 1A0IA 5FD5A 4WBNF 1S68A 3PZPA 4EC5A 1TWHA 2R93A 2XCPA 3T5KA 3SI8A 3OUUA 3GIDA 2NVXA 2R8GA 3QZ7A 3GKUA 3MR3A 2W9BA 5C4XG 2CW7A 2FPIB 4Q0YA 4TQRA 2VR1A 4DV0H 3MJFA 1VIHA 1Y1VA 3V6KA 5DG8A 2CTJA 4HQ6A 5KFCA 3RJ0A 3FMAA 1GSHA 2R7LA 4O3OA 2O4CA 3BA8A 4ECUA 4ZI7F 2P0AA 2QYZA 1MZBA 1S10A 1IBKH 4DV1H 4XYMB 2VUMA 1RJPA 5KFGA 3BJYA 2M6QA 2Q2TA 2UUAH 2RDJA 4A3IG 1M6VA 4ECRA 3BQ0A 2PT7G 3MWEA 3GTPA 2CTFA 4JV1A 4O3NA 4H8AA 1SYXB 4IZOA 4OO1G 1PX2A 4DV3H 1AN7A 3FDSA 3KHLA 4RB1A 1I3QA 4E4TA 4DUYH 4ZHQF 3BABA 2JA5A 2JEAI 4CC5A 3R5FA 4ZQIA 3MR2A 5D8DA 4A3KG 3AEVB 5EZYF 2UXBH 2WE6A 4X65H 5IYCG 3RBEA 4IR9A 4ED1A 1V8CA 4E9JA 1RJQA 1BNCA 3J80W 2R87A 2V4RA 4A3FG 4DL7A 2ATLA 1DIKA 1T94A 4O4IF 4A3GG 2Y0SE 5JUMA 1TAEA 2KSWA 2RGRA 5J2UF 4BY1G 2JE6I 1E4EB 2W7OA 4DV7H 4Y8VB 2NU9B 3GLKA
chains in the Genus database with same CATH topology
2HVRA 1ZHSA 3JSLA 2VQEH 4LH7A 4RB3C 3RTXA 4A2BA 5BR8H 1TA8A 4K0KH 3RGXA 4APMA 2Q2UA 3EZJA 3N41B 3SB1A 2UXDH 3QD7X 4NZTM 4JI6H 3BA9A 1XDNA 3KAKA 4DV6H 4LFBH 1P8LA 2YCHA 4JI2H 4NXMH 4LSXA 1XMOH 2E5LH 2F4VH 3J7AK 4X64H 3JSNA 4RAYA 3RIZA 4LF4H 4DV5H 4OD6A 3M4IA 4GLXA 4LF5H 2ZJTA 3KAJA 2HVSA 3L4JA 5D1PA 4RAZA 3KDGA 4UCOA 4FM9A 3JAMW 1J5EH 3C0FB 1I94H 2UU9H 5IT9W 5DT9A 1S03G 4JI5H 3N6XA 4AQYH 4LMYA 4RB0A 1E4FT 4JYAH 2O03A 2OWOA 4UCRA 4NZRM 2XIGA 4B3MH 2MCTA 2ZM6H 1M0WA 1X9NA 4EFEA 4GKKH 3N43B 4UCSA 1SEIA 4DR1H 5IWAH 1FKAH 1WH2A 1O75A 4LF6H 4B8CD 3H20A 4IAJA 5FLXW 4B3TH 4R7RA 4UCTA 3CVZA 2WYOA 1E4GT 2HGSA 4OX9H 3BAAA 4NXNH 3HXLA 2HVQA 1ODHA 5FPRA 4OCHA 4JI3H 4KHPH 3DF7A 4DV4H 4LF7H 2ZQEA 3KALA 5FPOA 3GABA 4DR7H 4JI8H 4EEQA 4LH6A 3MWMA 1HNXH 3OSSD 4UFZA 5A2QW 4MTEA 1BJTA 1Z2OX 3FAUA 1XNRH 3K3VA 4I7HA 2UXCH 2WDTA 1XMQH 4YY3H 5LMNH 4DR3H 3KDKA 4LFCH 4LFAH 4DR6H 2UUCH 1B04A 2VPSA 4LF8H 3KXYT 4BWSC 1DGSA 4X66H 1XNQH 4MV7A 3F8NA 3RGZA 1A0IA 3L4KA 2W57A 5FD5A 4JI0H 4DR4H 1S68A 2HHHH 4EC5A 1HNWH 4RB2C 3N44B 4G08A 4LF9H 4X62H 1IBMH 5EOYA 4JI4H 3UQ8A 3RF2A 2CW7A 2CW8A 3T1YH 4Q0YA 4B3SH 4ETSA 4DV0H 4J0MA 2VQFH 1IBLH 3RJ0A 1N34H 4DUZH 4JI1H 2Y3MA 1HNZH 1BGWA 3GR5A 3FMAA 3PN1A 5D1OB 3L2PA 1GYFA 2O4CA 3BA8A 4YHHH 2FPHX 3OETA 4DV2H 1MZBA 1IBKH 4DV1H 2D9IA 3T1HH 2FE3A 4M7EA 3OTOH 2LF0A 4PDBA 4DR5H 2Q2TA 4DR2H 2UUAH 1X9ZA 1N32H 1VS0A 3LMLA 4UCUA 2PT7G 4UCVA 4MV9A 2VKCA 1N33H 1Z2NX 2VOBA 4RZQA 5FD6A 1SYXB 1Z2PX 3J81W 4DV3H 1AN7A 1M0TA 2RGVA 4CC6A 4RB1A 4B3RH 4DUYH 4JV5H 3BABA 4CC5A 1I6UA 4JI7H 4GKJH 1FVIA 4LSAA 1FJGH 2UXBH 2WE6A 4X65H 3IG0A 3N42B 5LMUH 4E9JA 4MTDA 5D1OA 2VUGA 1N36H 3J80W 1V9PA 1HR0H 1ZHQA 1F0XA 3NCVA 1L2ZA 3EYYA 1TAEA 2KSWA 4EFBA 2RGRA 5LL6b 4A2AA 4DV7H 2UUBH 3N40P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE H;  5BR8 H;  4K0K H;  2UXD H;  4JI6 H;  4DV6 H;  4LFB H;  4JI2 H;  4NXM H;  1XMO H;  2E5L H;  2F4V H;  3J7A K;  4X64 H;  4LF4 H;  4DV5 H;  4LF5 H;  3JAM W;  1J5E H;  1I94 H;  2UU9 H;  5IT9 W;  1S03 G;  4JI5 H;  4AQY H;  4JYA H;  4B3M H;  2ZM6 H;  4GKK H;  1SEI A;  4DR1 H;  5IWA H;  1FKA H;  4LF6 H;  5FLX W;  4B3T H;  4OX9 H;  4NXN H;  4JI3 H;  4KHP H;  4DV4 H;  4LF7 H;  4DR7 H;  4JI8 H;  1HNX H;  5A2Q W;  1XNR H;  2UXC H;  1XMQ H;  4YY3 H;  5LMN H;  4DR3 H;  4LFC H;  4DR6 H;  4LFA H;  2UUC H;  4LF8 H;  4X66 H;  1XNQ H;  4JI0 H;  4DR4 H;  2HHH H;  1HNW H;  4LF9 H;  4X62 H;  1IBM H;  4JI4 H;  3RF2 A;  3T1Y H;  4B3S H;  4DV0 H;  2VQF H;  1IBL H;  1N34 H;  4DUZ H;  4JI1 H;  1HNZ H;  4YHH H;  4DV2 H;  1IBK H;  4DV1 H;  3T1H H;  3OTO H;  4PDB A;  4DR5 H;  4DR2 H;  2UUA H;  1N32 H;  1N33 H;  3J81 W;  4DV3 H;  1AN7 A;  4B3R H;  4DUY H;  4JV5 H;  1I6U A;  4JI7 H;  4GKJ H;  1FJG H;  2UXB H;  4X65 H;  5LMU H;  1N36 H;  3J80 W;  1HR0 H;  5LL6 b;  4DV7 H;  2UUB H; 
#chains in the Genus database with same CATH topology
 2HVR A;  1KJI A;  1X4N A;  2XD4 A;  2VQE H;  4BXX G;  4LH7 A;  4AIM A;  2CPQ A;  1ZZJ A;  3CQZ A;  4MV6 A;  4C5A A;  2VQD A;  1I50 A;  3OHB A;  5BR8 H;  3HOZ G;  3QZ8 A;  2Q2U A;  1BXR A;  4QWC A;  3EPG A;  2UXD H;  4NZT M;  3BA9 A;  2YQR A;  4LIJ A;  4ED3 A;  2YCH A;  2LTL A;  5C8Y F;  3PW5 A;  4JI2 H;  4NXM H;  3U9S A;  3Q8R B;  3R5H A;  3BG5 A;  1RYR A;  4A3M G;  4RNN A;  1KJ9 A;  4DL4 A;  5CA1 F;  2V9W A;  5IP7 G;  2A1S A;  4ECZ A;  4YJ3 F;  3M4I A;  1N48 A;  2I87 A;  4RAZ A;  3JAM W;  1C30 A;  3VPB A;  5KX5 F;  4YR0 A;  1S03 G;  4O2A F;  3MR5 A;  2BA0 A;  3N6X A;  3GIK A;  4FS2 A;  4RB0 A;  1E4F T;  3T5L A;  1K1Q A;  2O03 A;  2BQU A;  4EYH B;  4BA1 I;  5KG2 A;  2R8J A;  2W6P A;  3L7Z C;  5KG5 A;  3G6X A;  2CZG A;  2CPM A;  3H20 A;  2XGQ A;  4IAJ A;  4B8C D;  3PO2 G;  2PMZ E;  4QJF A;  4UCT A;  3GV5 B;  4OX9 H;  3BAA A;  4NXN H;  2W9B B;  2HVQ A;  1ODH A;  1WHR A;  2V5A A;  5LP6 F;  4QIW E;  4EGQ A;  5FPO A;  4EBC A;  4DL5 A;  2DIK A;  2R6F A;  5KT3 A;  4RNO A;  2V59 A;  1GGO A;  2FK2 A;  2E3U A;  5KFL A;  3MWM A;  1HNX H;  1VBH A;  4MTE A;  3K3V A;  1NXU A;  2UXC H;  2WDT A;  3TQ1 A;  4YY3 H;  2CW8 A;  3G8C A;  5DQG A;  2ASD A;  4R8U B;  1B6R A;  4LF8 H;  4A3D G;  5IP9 G;  5KKN B;  2E2H A;  2WAQ E;  4FJS A;  1IOW A;  2UVV A;  2AGP A;  3K5H A;  3GIQ A;  2C22 A;  4G08 A;  4MA5 A;  1IBM H;  4EGJ A;  3TII A;  4J9M A;  3RB0 A;  2IMW P;  2HH3 A;  3T1Y H;  5C1O A;  1ULZ A;  3RUP A;  4ETS A;  5KFP A;  1KEE A;  2XGP A;  4I50 F;  3VPC A;  1IBL H;  2FKL A;  1N34 H;  4YQW A;  1DV2 A;  4O3P A;  2Y3M A;  1HNZ H;  3PN1 A;  3H4D A;  3RBD A;  1JKJ B;  2JA6 G;  3GTL A;  2YS7 A;  1UG8 A;  4IWY A;  5L1I A;  3H0G G;  4ECT A;  3OET A;  3PR4 A;  5JEA G;  4ECY A;  2FLN A;  3Q8S B;  4YB8 B;  4F4X A;  2IP4 A;  4FU0 A;  5LOV F;  3OTO H;  2LF0 A;  1SCU B;  4PDB A;  5FJ8 G;  2XC9 A;  3H4B A;  3U9T A;  2MJH A;  3JZI A;  4UCU A;  2K1H A;  4Q8F A;  2YRX A;  4M9U A;  4EBD A;  2VOB A;  2UVR A;  3HOY G;  1Z2P X;  3GIL A;  2I80 A;  3TIN A;  2R7K A;  1M0T A;  4YAJ B;  2HH2 A;  4NBQ A;  4IHJ F;  4JV5 H;  2G8Y A;  5DG9 A;  3NGD A;  5IYZ F;  2JEG A;  4JI7 H;  5KFZ A;  2LTM A;  2PBZ A;  4GKJ H;  3T5H A;  1S20 A;  3RB3 A;  2GLT A;  3N42 B;  5D1O A;  2VUG A;  1N36 H;  4YR3 A;  2FPG B;  3JRW A;  3KTM A;  1WVN A;  2R7Z A;  1ZHQ A;  5KFO A;  2CTE A;  1S97 A;  2DWC A;  2V58 A;  2JEF A;  4EFB A;  1EHI A;  5KFF A;  5LL6 b;  4A2A A;  2UUB H;  3N40 P;  4RUC A;  2W6N A;  3JSL A;  4Q8E A;  2CTM A;  2CQY A;  2WAQ A;  3HB9 A;  3RTX A;  4J9Q A;  1WCM G;  1CQI B;  4A2B A;  5DGB A;  1T3N A;  1S0M A;  1R9T A;  2VA3 A;  2YU9 A;  3EZJ A;  2B63 A;  5KT6 A;  3SB1 A;  3QD7 X;  2ZDQ A;  1X4M A;  1EC6 A;  4LFB H;  5F9N A;  5DG7 A;  1V51 A;  2C2D A;  2DPI A;  4BA2 I;  4WAL A;  3EPI A;  2X0S A;  5KFW A;  5KG6 A;  5GON F;  2F4V H;  4U7C A;  1EUD B;  4R8U A;  1AUX A;  5LYJ F;  3RIZ A;  4LF4 H;  5KFQ A;  1PK8 A;  4IRK A;  2W9C A;  5KFK A;  2J6S A;  5KFS A;  4GLX A;  4LF5 H;  2ZJT A;  3KAJ A;  1UC8 A;  1A9X A;  3L4J A;  5D1P A;  4PWQ A;  2BQ3 A;  1S0O A;  3OHA A;  1Y1W G;  4J9L A;  3PW4 A;  4C5B A;  5HBR B;  1I94 H;  2UU9 H;  2CTK A;  4JI5 H;  3R5X A;  2YYA A;  4RUA A;  2IA6 A;  4O4H F;  4MV8 A;  3WO1 A;  2JA7 A;  5KFX A;  1UC9 A;  4GKK H;  4UCS A;  2VA2 A;  4A3J G;  1SEI A;  5DGA A;  2JZX A;  2AGQ A;  3GTM A;  3V69 A;  5IYD G;  2ZDH A;  3UOE A;  2E2I A;  4B3T H;  1S0N A;  4JUZ A;  2R8K A;  3CVZ A;  4IFD G;  1Y1W A;  5KFE A;  2HGS A;  2W8L A;  5JVD F;  3FKI A;  3I4N G;  4O4L F;  3HXL A;  1CQJ B;  3MWD A;  2YS6 A;  4OCH A;  3DF7 A;  5KG3 A;  4DV4 H;  5JH7 F;  4FBT A;  3RAX A;  3PW7 A;  3KHH A;  3GAB A;  4EG0 A;  2GPS A;  4HR7 A;  3OSS D;  4U6P A;  5A2Q W;  1BJT A;  4HNT A;  1DV1 A;  1W96 A;  1XNR H;  3LP8 A;  4I7H A;  4MV4 A;  5FLM G;  1AUV A;  4HNU A;  4F50 A;  1KJJ A;  3WO0 A;  4F4W A;  3RAQ A;  2VPS A;  3RFC A;  2JA7 G;  4BWS C;  3OSP A;  1WCM A;  1DGS A;  4X66 H;  1XNQ H;  5BPF A;  5KFA A;  2GPW A;  2W57 A;  1RK6 A;  4A3B G;  4JI0 H;  5K2M A;  3M9M B;  1HNW H;  5C0X G;  4RB2 C;  3N44 B;  2JEJ A;  2FP4 B;  5JVL A;  3GIJ A;  2FK1 A;  2QND A;  3R23 A;  1TUA A;  5KT7 A;  5EOY A;  4QW8 A;  3GQC A;  4JI4 H;  4YR2 A;  3RF2 A;  2W9C B;  2Y0S A;  4XZ3 B;  2R8I A;  4ED6 A;  1S9F A;  4B3S H;  3VKE A;  4ECW A;  2R7Z G;  4BBS G;  2YZN A;  2JA8 G;  4Q43 A;  4J0M A;  3I0P A;  2VQF H;  4I55 F;  3MR6 A;  4DUZ H;  2FLL A;  2W71 A;  1BGW A;  4AM3 A;  2BQR A;  3GV7 B;  3HOV G;  5D1O B;  2R85 A;  4O3R A;  2BL5 A;  4YHH H;  4YAK B;  2XCA A;  3V6H A;  3OSN A;  4AYB E;  2FPH X;  4DV2 H;  3GTG A;  1K1S A;  4FJU A;  4J9N A;  4FBU A;  1WE8 A;  3T1H H;  1IOV A;  1UNN C;  4MA0 A;  2FE3 A;  4ECX A;  4M7E A;  5L1J A;  2SCU B;  3E5N A;  4DR5 H;  3ORQ A;  4DR2 H;  5KFU A;  1X9Z A;  4QMF B;  3PO3 G;  1N32 H;  2FPP B;  3LML A;  2UVW A;  2W70 A;  2P2R A;  1N33 H;  1EYZ A;  5KFR A;  3Q8P B;  4RZQ A;  3FKI G;  1Z2I A;  5FD6 A;  1GSO A;  3OUZ A;  1X0A A;  3J81 W;  3KHG A;  3TQT A;  1VAJ A;  5KFH A;  3M9O B;  4IWX A;  3PR5 B;  4B3R H;  2CTL A;  3H0G A;  1CS0 A;  5C1P A;  2JA6 A;  1KJ8 A;  1FVI A;  1TWG A;  2NU6 B;  4J9S A;  1FJG H;  1WSC A;  4J9P A;  4GC6 A;  3IG0 A;  3PW2 A;  3U1K A;  5LMU H;  4MTD A;  2ANR A;  1T36 A;  2FLP A;  3LWB A;  1V9P A;  2NUA B;  3TIG A;  1VBI A;  2FMA A;  4EBE A;  4DL2 A;  3RB4 A;  2NVY A;  3EYY A;  2DZD A;  2DPJ A;  3Q1K A;  5EWG A;  3F8N A;  3G6V A;  2J6T A;  4JVH A;  1ZHS A;  5JQW A;  1TA8 A;  3MFH A;  3JRX A;  5KFY A;  1W93 A;  3N41 B;  4APM A;  3IN5 A;  3G6Y A;  4A93 G;  3KAK A;  2W6Q A;  4JI6 H;  4AYB A;  2W7P A;  1XDN A;  2FJZ A;  3BQ2 A;  1PQX A;  4BY7 G;  4LSX A;  1XMO H;  3KHR A;  3JSN A;  4F4Z A;  5KFI A;  2B63 G;  4Q44 A;  4DV5 H;  4J9O A;  4OD6 A;  5IYB G;  2NN6 G;  2HVS A;  2LRR A;  4QWB A;  4EYI B;  4FM9 A;  2JA9 A;  2W8K A;  1J5E H;  1WTJ A;  2WB1 E;  3RB6 A;  1JDE A;  4DL3 A;  3UFX B;  5IT9 W;  5CB4 F;  5DT9 A;  2R82 A;  2PQU A;  2PY9 A;  2DLN A;  1SFO A;  4LMY A;  1TWA A;  1ZZK A;  1EUC B;  4ECV A;  4JYA H;  2BR0 A;  4FS1 A;  2OWO A;  2W6Z A;  5K36 G;  4UCR A;  4NZR M;  2CKZ B;  4A3E G;  1V4Y A;  4XYL B;  2ZM6 H;  2ALZ A;  3I4M G;  1M0W A;  5BMV F;  1X9N A;  4EFE A;  3N43 B;  4L1K A;  4TV9 F;  5IWA H;  1WH2 A;  4BBR G;  2M8W A;  4LF6 H;  4QW9 A;  5KT4 A;  4R7R A;  2C00 A;  4ECS A;  4QWD A;  2AQ4 A;  4ZOL F;  4RNM A;  2M05 A;  1TWC A;  4TUY F;  5FPR A;  2IBK A;  4F4Y A;  1J5K A;  4ED8 A;  2C28 A;  4J9K A;  4KHP H;  3HKZ E;  2C2E A;  4LF7 H;  2ZQE A;  3KAL A;  4JV2 A;  5DLF A;  2UVU A;  1VBG A;  1B6S A;  3PW0 A;  4LH6 A;  1JX4 A;  4YBZ B;  1CE8 A;  5H80 A;  3FAU A;  2WTF A;  2J6U A;  1DTJ A;  3KDK A;  4XX0 B;  4DR3 H;  1JLL B;  5KG1 A;  4DR6 H;  1B33 N;  3K3P A;  1B04 A;  3KXY T;  4YP3 A;  5T14 A;  3M9N B;  2X06 A;  2YW2 A;  4MV7 A;  3V4Z A;  4I4T F;  5KFV A;  1OWT A;  2YZM A;  3L4K A;  2AGO A;  3GTJ A;  4DR4 H;  4MV1 A;  2HHH H;  1VKZ A;  3V6J A;  2YZG A;  4LF9 H;  4X62 H;  2PVP A;  1KC7 A;  5C44 G;  5L1K A;  1E4E A;  4ECQ A;  3QFF A;  3RV3 A;  3UQ8 A;  1TWF A;  4C5C A;  4IR1 A;  5LXT F;  5KFM A;  1WR2 A;  5J2T F;  5EDW A;  4JI1 H;  2W9A A;  5L1L A;  4IRD A;  3VMM A;  3GR5 A;  1GYF A;  5KG4 A;  3L2P A;  2R84 A;  5DQI A;  2JEI A;  2R8H A;  2J9G A;  4WAN A;  1I7N A;  1KJQ A;  2D9I A;  4RU9 A;  5CAE B;  2R86 A;  5KFD A;  5DLG A;  1RK5 A;  4MAM A;  1VS0 A;  3T5J A;  3Q2O A;  4MV9 A;  2VKC A;  1Z2N X;  2I8C A;  1VIG A;  4UCV A;  3I12 A;  4NLG A;  5I47 A;  1ZTG A;  3GV8 B;  2FMR A;  4EEY A;  3GTK A;  4CC6 A;  3MFI A;  2RGV A;  2OPU A;  1XRH A;  2PN1 A;  4MV3 A;  2VUM G;  4A3L G;  2FFM A;  1I6U A;  4O3Q A;  2JVZ A;  1K83 A;  2XCL A;  5LA6 F;  4LSA A;  2V4Q A;  1GLV A;  1ZZI A;  1ZET A;  2CWF A;  4ED0 A;  3ETJ A;  3N8D A;  2C35 B;  1K1G A;  3ORR A;  4WD3 A;  2R7M A;  3GIP A;  4ME6 A;  3Q8Q B;  1HR0 H;  1GO3 E;  1F0X A;  2W6O A;  2JA5 G;  3NCV A;  5DQH A;  1N56 A;  4A3C G;  1L2Z A;  3K5I A;  2ANN A;  2R93 G;  2C2R A;  2R7N A;  2FB9 A;  4RZR A;  1M7J A;  4RB3 C;  3HOX G;  5L9X A;  3RGX A;  4K0K H;  2FK3 A;  5EWE A;  3GTO A;  2R92 A;  2NU8 B;  1KBL A;  4G3I A;  1MSZ A;  4DV6 H;  1P8L A;  2YL2 A;  2Z0S A;  1JIH A;  3GTQ A;  4O2B F;  3GIM A;  4O3S A;  2RDI A;  3VPD A;  2E5L H;  4J9R A;  3J7A K;  5KFB A;  4X64 H;  5CA0 F;  5KFJ A;  4RAY A;  4QWA A;  4IRC A;  5BPH A;  2R92 G;  3BQ1 A;  2OLS A;  1I7L A;  2OPV A;  1KHM A;  2JEB I;  4JV0 A;  3HKZ A;  1GSA A;  5C5J A;  3GII A;  3H40 A;  4JVY A;  3RV4 A;  5KFT A;  3PVX A;  3KDG A;  4UCO A;  4HNV A;  2QK4 A;  2NU7 B;  3V4S A;  2W6M A;  3C0F B;  4C2M A;  5HV6 A;  1JXL A;  2OH2 A;  3HOU G;  1JDB B;  5KT2 A;  2AXY A;  2ASJ A;  4AQY H;  5KG7 A;  2CWH A;  2XIG A;  4B3M H;  1Y14 B;  2MCT A;  2RF4 A;  2VPQ A;  4TV8 F;  3HBL A;  2ASL A;  4Q45 A;  2HJW A;  4ED2 A;  4DR1 H;  3HOW G;  1FKA H;  1O75 A;  5FLX W;  1EZ1 A;  4QIW A;  4DLK A;  4ED7 A;  2WYO A;  5F9L A;  3H3V H;  1E4G T;  4YJ2 F;  2WB1 A;  2YRW A;  3AYH B;  4B8T A;  2ZDG A;  3ETH A;  4DL6 A;  4JI3 H;  1ZQ7 A;  2AU0 A;  2PMZ A;  3WNZ A;  5KFN A;  4DR7 H;  4JI8 H;  1J4W A;  4EEQ A;  4QWE A;  2DGR A;  1DT4 A;  4UFZ A;  3SE7 A;  4GC7 A;  4HYK A;  1Z2O X;  1V9N A;  1XMQ H;  5KT5 A;  5LMN H;  4LFC H;  4TQS A;  4LFA H;  1RJR A;  2UUC H;  1C3O A;  5KG0 A;  1RYS A;  5EWF A;  1Y1V G;  5C3E G;  3RGZ A;  1A0I A;  5FD5 A;  4WBN F;  1S68 A;  3PZP A;  4EC5 A;  1TWH A;  2R93 A;  2XCP A;  3T5K A;  3SI8 A;  3OUU A;  3GID A;  2NVX A;  2R8G A;  3QZ7 A;  3GKU A;  3MR3 A;  2W9B A;  5C4X G;  2CW7 A;  2FPI B;  4Q0Y A;  4TQR A;  2VR1 A;  4DV0 H;  3MJF A;  1VIH A;  1Y1V A;  3V6K A;  5DG8 A;  2CTJ A;  4HQ6 A;  5KFC A;  3RJ0 A;  3FMA A;  1GSH A;  2R7L A;  4O3O A;  2O4C A;  3BA8 A;  4ECU A;  4ZI7 F;  2P0A A;  2QYZ A;  1MZB A;  1S10 A;  1IBK H;  4DV1 H;  4XYM B;  2VUM A;  1RJP A;  5KFG A;  3BJY A;  2M6Q A;  2Q2T A;  2UUA H;  2RDJ A;  4A3I G;  1M6V A;  4ECR A;  3BQ0 A;  2PT7 G;  3MWE A;  3GTP A;  2CTF A;  4JV1 A;  4O3N A;  4H8A A;  1SYX B;  4IZO A;  4OO1 G;  1PX2 A;  4DV3 H;  1AN7 A;  3FDS A;  3KHL A;  4RB1 A;  1I3Q A;  4E4T A;  4DUY H;  4ZHQ F;  3BAB A;  2JA5 A;  2JEA I;  4CC5 A;  3R5F A;  4ZQI A;  3MR2 A;  5D8D A;  4A3K G;  3AEV B;  5EZY F;  2UXB H;  2WE6 A;  4X65 H;  5IYC G;  3RBE A;  4IR9 A;  4ED1 A;  1V8C A;  4E9J A;  1RJQ A;  1BNC A;  3J80 W;  2R87 A;  2V4R A;  4A3F G;  4DL7 A;  2ATL A;  1DIK A;  1T94 A;  4O4I F;  4A3G G;  2Y0S E;  5JUM A;  1TAE A;  2KSW A;  2RGR A;  5J2U F;  4BY1 G;  2JE6 I;  1E4E B;  2W7O A;  4DV7 H;  4Y8V B;  2NU9 B;  3GLK A; 
#chains in the Genus database with same CATH homology
 2HVR A;  1ZHS A;  3JSL A;  2VQE H;  4LH7 A;  4RB3 C;  3RTX A;  4A2B A;  5BR8 H;  1TA8 A;  4K0K H;  3RGX A;  4APM A;  2Q2U A;  3EZJ A;  3N41 B;  3SB1 A;  2UXD H;  3QD7 X;  4NZT M;  4JI6 H;  3BA9 A;  1XDN A;  3KAK A;  4DV6 H;  4LFB H;  1P8L A;  2YCH A;  4JI2 H;  4NXM H;  4LSX A;  1XMO H;  2E5L H;  2F4V H;  3J7A K;  4X64 H;  3JSN A;  4RAY A;  3RIZ A;  4LF4 H;  4DV5 H;  4OD6 A;  3M4I A;  4GLX A;  4LF5 H;  2ZJT A;  3KAJ A;  2HVS A;  3L4J A;  5D1P A;  4RAZ A;  3KDG A;  4UCO A;  4FM9 A;  3JAM W;  1J5E H;  3C0F B;  1I94 H;  2UU9 H;  5IT9 W;  5DT9 A;  1S03 G;  4JI5 H;  3N6X A;  4AQY H;  4LMY A;  4RB0 A;  1E4F T;  4JYA H;  2O03 A;  2OWO A;  4UCR A;  4NZR M;  2XIG A;  4B3M H;  2MCT A;  2ZM6 H;  1M0W A;  1X9N A;  4EFE A;  4GKK H;  3N43 B;  4UCS A;  1SEI A;  4DR1 H;  5IWA H;  1FKA H;  1WH2 A;  1O75 A;  4LF6 H;  4B8C D;  3H20 A;  4IAJ A;  5FLX W;  4B3T H;  4R7R A;  4UCT A;  3CVZ A;  2WYO A;  1E4G T;  2HGS A;  4OX9 H;  3BAA A;  4NXN H;  3HXL A;  2HVQ A;  1ODH A;  5FPR A;  4OCH A;  4JI3 H;  4KHP H;  3DF7 A;  4DV4 H;  4LF7 H;  2ZQE A;  3KAL A;  5FPO A;  3GAB A;  4DR7 H;  4JI8 H;  4EEQ A;  4LH6 A;  3MWM A;  1HNX H;  3OSS D;  4UFZ A;  5A2Q W;  4MTE A;  1BJT A;  1Z2O X;  3FAU A;  1XNR H;  3K3V A;  4I7H A;  2UXC H;  2WDT A;  1XMQ H;  4YY3 H;  5LMN H;  4DR3 H;  3KDK A;  4LFC H;  4LFA H;  4DR6 H;  2UUC H;  1B04 A;  2VPS A;  4LF8 H;  3KXY T;  4BWS C;  1DGS A;  4X66 H;  1XNQ H;  4MV7 A;  3F8N A;  3RGZ A;  1A0I A;  3L4K A;  2W57 A;  5FD5 A;  4JI0 H;  4DR4 H;  1S68 A;  2HHH H;  4EC5 A;  1HNW H;  4RB2 C;  3N44 B;  4G08 A;  4LF9 H;  4X62 H;  1IBM H;  5EOY A;  4JI4 H;  3UQ8 A;  3RF2 A;  2CW7 A;  2CW8 A;  3T1Y H;  4Q0Y A;  4B3S H;  4ETS A;  4DV0 H;  4J0M A;  2VQF H;  1IBL H;  3RJ0 A;  1N34 H;  4DUZ H;  4JI1 H;  2Y3M A;  1HNZ H;  1BGW A;  3GR5 A;  3FMA A;  3PN1 A;  5D1O B;  3L2P A;  1GYF A;  2O4C A;  3BA8 A;  4YHH H;  2FPH X;  3OET A;  4DV2 H;  1MZB A;  1IBK H;  4DV1 H;  2D9I A;  3T1H H;  2FE3 A;  4M7E A;  3OTO H;  2LF0 A;  4PDB A;  4DR5 H;  2Q2T A;  4DR2 H;  2UUA H;  1X9Z A;  1N32 H;  1VS0 A;  3LML A;  4UCU A;  2PT7 G;  4UCV A;  4MV9 A;  2VKC A;  1N33 H;  1Z2N X;  2VOB A;  4RZQ A;  5FD6 A;  1SYX B;  1Z2P X;  3J81 W;  4DV3 H;  1AN7 A;  1M0T A;  2RGV A;  4CC6 A;  4RB1 A;  4B3R H;  4DUY H;  4JV5 H;  3BAB A;  4CC5 A;  1I6U A;  4JI7 H;  4GKJ H;  1FVI A;  4LSA A;  1FJG H;  2UXB H;  2WE6 A;  4X65 H;  3IG0 A;  3N42 B;  5LMU H;  4E9J A;  4MTD A;  5D1O A;  2VUG A;  1N36 H;  3J80 W;  1V9P A;  1HR0 H;  1ZHQ A;  1F0X A;  3NCV A;  1L2Z A;  3EYY A;  1TAE A;  2KSW A;  4EFB A;  2RGR A;  5LL6 b;  4A2A A;  4DV7 H;  2UUB H;  3N40 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...