3OSSD

The crystal structure of enterotoxigenic escherichia coli gspc-gspd complex from the type ii secretion system
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
175
structure length
157
Chain Sequence
ATFTANFKDTDLKSFIETVGANLNKTIIMGPGVQGKVSIRTMTPLNERQYYQLFLNLLEAQGYAVVPMYIDTNNDGYIEGDELVLKVVKSAGDEMVTKVVPVRNVSVRELAPILRQMIDSAGSGNVVNYDPSNVIMLTGRASVVERLTEVIQRVDHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords TYPE 2 SECRETION SYSTEM, GSPC
publication title Structural and functional studies on the interaction of GspC and GspD in the type II secretion system.
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 157
sequence length 175
ec nomenclature
pdb deposition date 2010-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3ossD00
4EC5A 3OSSD 4E9JA 2Y3MA 3GR5A 4G08A 3EZJA
chains in the Genus database with same CATH superfamily
4OCHA 2LTLA 4DR1H 2UU9H 2AXYA 1I94H 4JI3H 5IWAH 4NXMH 2F4VH 4AIMA 1N36H 4FJSA 4B3TH 5LMNH 4G08A 1J5EH 1HNWH 1V9NA 1FJGH 3T1YH 2UUCH 2ANNA 2NN6G 4IFDG 1WHRA 3OETA 4JI8H 3GABA 4JV5H 1SEIA 1N32H 4OX9H 2FFMA 2BA0A 4EC5A 4JI7H 3JAMW 3I0PA 1ODHA 1J4WA 2PT7G 4YHHH 4DV2H 1KHMA 4WANA 3AEVB 2JA9A 1MSZA 4DUYH 4B3MH 1AN7A 2HH2A 4JI1H 5LMUH 2ANRA 5C0XG 4E9JA 4B3RH 1WE8A 3T1HH 1XNQH 1DTJA 2D9IA 4AQYH 4DR4H 3VKEA 3V69A 4BA1I 2CPQA 1ZZIA 1TUAA 3KDGA 2CTJA 4X66H 4DV3H 4DR3H 2CTEA 1EC6A 4X62H 4WALA 4LFAH 2LF0A 1WVNA 4AM3A 4DR6H 2VKCA 1UG8A 4LF9H 1ZZJA 4DV6H 2VQEH 4JI5H 4BA2I 2HHHH 3KDKA 1PQXA 1IBMH 4JVYA 2FPHX 2JE6I 3OSSD 5JEAG 2MJHA 2CTKA 3GR5A 4OD6A 4OO1G 1N33H 3J81W 3QD7X 5A2QW 2JEBI 4B3SH 1X4MA 4DV4H 4JI4H 2BL5A 4NZRM 4LFCH 4B8TA 5FLXW 4DV5H 1F0XA 1X9ZA 4DV7H 4FJUA 2DGRA 4LF7H 1S20A 4QMFB 2LTMA 2YQRA 2UXBH 2CPMA 1X4NA 4DV1H 2QNDA 4JYAH 1VBIA 1XNRH 1I6UA 3U1KA 2M8WA 2K1HA 2O4CA 4JI2H 3UOEA 3OTOH 2CTLA 1IBKH 1IBLH 4LF5H 1HNZH 2Z0SA 2ZQEA 4K0KH 5K36G 4H8AA 4NXNH 1DT4A 2CTMA 2PY9A 4LF4H 2UXCH 2PQUA 4DR7H 2OPUA 3SB1A 4B8CD 3GKUA 2JVZA 2UXDH 2HH3A 1XMOH 2P2RA 4GKJH 3RF2A 4DR2H 2CTFA 5DT9A 1V8CA 5IT9W 4JI0H 1WTJA 4LIJA 1J5KA 2CWHA 2OPVA 4DR5H 1X0AA 5BR8H 2LRRA 4GKKH 1HR0H 5LL6b 2G8YA 1XMQH 3L7ZC 4LF8H 1S03G 1HNXH 2E5LH 4DUZH 3J80W 4LF6H 4LFBH 2CWFA 2VQFH 4JVHA 2FMRA 3EZJA 1NXUA 1K1GA 1FKAH 3FAUA 2ZM6H 2UUAH 2JZXA 2X06A 1Z2IA 2Y3MA 4PDBA 1ZZKA 1ZTGA 2M6QA 2JEAI 4KHPH 4NZTM 4JI6H 3NCVA 4NBQA 4X65H 2E3UA 4X64H 2A1SA 4YY3H 3J7AK 1VIGA 1XRHA 4DV0H 1VIHA 2UUBH 1N34H
chains in the Genus database with same CATH topology
4OCHA 4DR1H 4JI3H 2UU9H 1I94H 4NXMH 5IWAH 2F4VH 4B3TH 5LMNH 4G08A 1J5EH 1HNWH 1FJGH 3T1YH 2UUCH 3OETA 4JI8H 3GABA 4JV5H 1SEIA 1N32H 4OX9H 4JI7H 4EC5A 3JAMW 1ODHA 2PT7G 4YHHH 4DV2H 4B3MH 4DUYH 1AN7A 4JI1H 5LMUH 4B3RH 4E9JA 3T1HH 1XNQH 2D9IA 4AQYH 4DR4H 3KDGA 4DV3H 4X66H 4DR3H 4X62H 4LFAH 2LF0A 4DR6H 2VKCA 4LF9H 4DV6H 2VQEH 4JI5H 2HHHH 3KDKA 1IBMH 2FPHX 3OSSD 3GR5A 4OD6A 1N33H 3J81W 5A2QW 3QD7X 4B3SH 4JI4H 4DV4H 4LFCH 4NZRM 5FLXW 4DV5H 1F0XA 1X9ZA 4DV7H 4LF7H 2UXBH 4DV1H 1I6UA 4JYAH 1XNRH 2O4CA 3OTOH 4JI2H 1IBKH 1IBLH 4LF5H 1HNZH 2ZQEA 4K0KH 4NXNH 4LF4H 2UXCH 4DR7H 3SB1A 4B8CD 2UXDH 1XMOH 4GKJH 3RF2A 4DR2H 5DT9A 5IT9W 4JI0H 1N34H 4DR5H 5BR8H 4GKKH 1HR0H 5LL6b 1XMQH 4LF8H 1S03G 1HNXH 2E5LH 4DUZH 3J80W 4LF6H 4LFBH 2VQFH 3EZJA 1FKAH 3FAUA 2ZM6H 2UUAH 2Y3MA 4PDBA 4KHPH 4NZTM 4JI6H 3NCVA 4X65H 4X64H 4YY3H 3J7AK 4DV0H 2UUBH 1N36H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EC5 A;  3OSS D;  4E9J A;  2Y3M A;  3GR5 A;  4G08 A;  3EZJ A; 
#chains in the Genus database with same CATH topology
 4OCH A;  2LTL A;  4DR1 H;  2UU9 H;  2AXY A;  1I94 H;  4JI3 H;  5IWA H;  4NXM H;  2F4V H;  4AIM A;  1N36 H;  4FJS A;  4B3T H;  5LMN H;  4G08 A;  1J5E H;  1HNW H;  1V9N A;  1FJG H;  3T1Y H;  2UUC H;  2ANN A;  2NN6 G;  4IFD G;  1WHR A;  3OET A;  4JI8 H;  3GAB A;  4JV5 H;  1SEI A;  1N32 H;  4OX9 H;  2FFM A;  2BA0 A;  4EC5 A;  4JI7 H;  3JAM W;  3I0P A;  1ODH A;  1J4W A;  2PT7 G;  4YHH H;  4DV2 H;  1KHM A;  4WAN A;  3AEV B;  2JA9 A;  1MSZ A;  4DUY H;  4B3M H;  1AN7 A;  2HH2 A;  4JI1 H;  5LMU H;  2ANR A;  5C0X G;  4E9J A;  4B3R H;  1WE8 A;  3T1H H;  1XNQ H;  1DTJ A;  2D9I A;  4AQY H;  4DR4 H;  3VKE A;  3V69 A;  4BA1 I;  2CPQ A;  1ZZI A;  1TUA A;  3KDG A;  2CTJ A;  4X66 H;  4DV3 H;  4DR3 H;  2CTE A;  1EC6 A;  4X62 H;  4WAL A;  4LFA H;  2LF0 A;  1WVN A;  4AM3 A;  4DR6 H;  2VKC A;  1UG8 A;  4LF9 H;  1ZZJ A;  4DV6 H;  2VQE H;  4JI5 H;  4BA2 I;  2HHH H;  3KDK A;  1PQX A;  1IBM H;  4JVY A;  2FPH X;  2JE6 I;  3OSS D;  5JEA G;  2MJH A;  2CTK A;  3GR5 A;  4OD6 A;  4OO1 G;  1N33 H;  3J81 W;  3QD7 X;  5A2Q W;  2JEB I;  4B3S H;  1X4M A;  4DV4 H;  4JI4 H;  2BL5 A;  4NZR M;  4LFC H;  4B8T A;  5FLX W;  4DV5 H;  1F0X A;  1X9Z A;  4DV7 H;  4FJU A;  2DGR A;  4LF7 H;  1S20 A;  4QMF B;  2LTM A;  2YQR A;  2UXB H;  2CPM A;  1X4N A;  4DV1 H;  2QND A;  4JYA H;  1VBI A;  1XNR H;  1I6U A;  3U1K A;  2M8W A;  2K1H A;  2O4C A;  4JI2 H;  3UOE A;  3OTO H;  2CTL A;  1IBK H;  1IBL H;  4LF5 H;  1HNZ H;  2Z0S A;  2ZQE A;  4K0K H;  5K36 G;  4H8A A;  4NXN H;  1DT4 A;  2CTM A;  2PY9 A;  4LF4 H;  2UXC H;  2PQU A;  4DR7 H;  2OPU A;  3SB1 A;  4B8C D;  3GKU A;  2JVZ A;  2UXD H;  2HH3 A;  1XMO H;  2P2R A;  4GKJ H;  3RF2 A;  4DR2 H;  2CTF A;  5DT9 A;  1V8C A;  5IT9 W;  4JI0 H;  1WTJ A;  4LIJ A;  1J5K A;  2CWH A;  2OPV A;  4DR5 H;  1X0A A;  5BR8 H;  2LRR A;  4GKK H;  1HR0 H;  5LL6 b;  2G8Y A;  1XMQ H;  3L7Z C;  4LF8 H;  1S03 G;  1HNX H;  2E5L H;  4DUZ H;  3J80 W;  4LF6 H;  4LFB H;  2CWF A;  2VQF H;  4JVH A;  2FMR A;  3EZJ A;  1NXU A;  1K1G A;  1FKA H;  3FAU A;  2ZM6 H;  2UUA H;  2JZX A;  2X06 A;  1Z2I A;  2Y3M A;  4PDB A;  1ZZK A;  1ZTG A;  2M6Q A;  2JEA I;  4KHP H;  4NZT M;  4JI6 H;  3NCV A;  4NBQ A;  4X65 H;  2E3U A;  4X64 H;  2A1S A;  4YY3 H;  3J7A K;  1VIG A;  1XRH A;  4DV0 H;  1VIH A;  2UUB H;  1N34 H; 
#chains in the Genus database with same CATH homology
 4OCH A;  4DR1 H;  4JI3 H;  2UU9 H;  1I94 H;  4NXM H;  5IWA H;  2F4V H;  4B3T H;  5LMN H;  4G08 A;  1J5E H;  1HNW H;  1FJG H;  3T1Y H;  2UUC H;  3OET A;  4JI8 H;  3GAB A;  4JV5 H;  1SEI A;  1N32 H;  4OX9 H;  4JI7 H;  4EC5 A;  3JAM W;  1ODH A;  2PT7 G;  4YHH H;  4DV2 H;  4B3M H;  4DUY H;  1AN7 A;  4JI1 H;  5LMU H;  4B3R H;  4E9J A;  3T1H H;  1XNQ H;  2D9I A;  4AQY H;  4DR4 H;  3KDG A;  4DV3 H;  4X66 H;  4DR3 H;  4X62 H;  4LFA H;  2LF0 A;  4DR6 H;  2VKC A;  4LF9 H;  4DV6 H;  2VQE H;  4JI5 H;  2HHH H;  3KDK A;  1IBM H;  2FPH X;  3OSS D;  3GR5 A;  4OD6 A;  1N33 H;  3J81 W;  5A2Q W;  3QD7 X;  4B3S H;  4JI4 H;  4DV4 H;  4LFC H;  4NZR M;  5FLX W;  4DV5 H;  1F0X A;  1X9Z A;  4DV7 H;  4LF7 H;  2UXB H;  4DV1 H;  1I6U A;  4JYA H;  1XNR H;  2O4C A;  3OTO H;  4JI2 H;  1IBK H;  1IBL H;  4LF5 H;  1HNZ H;  2ZQE A;  4K0K H;  4NXN H;  4LF4 H;  2UXC H;  4DR7 H;  3SB1 A;  4B8C D;  2UXD H;  1XMO H;  4GKJ H;  3RF2 A;  4DR2 H;  5DT9 A;  5IT9 W;  4JI0 H;  1N34 H;  4DR5 H;  5BR8 H;  4GKK H;  1HR0 H;  5LL6 b;  1XMQ H;  4LF8 H;  1S03 G;  1HNX H;  2E5L H;  4DUZ H;  3J80 W;  4LF6 H;  4LFB H;  2VQF H;  3EZJ A;  1FKA H;  3FAU A;  2ZM6 H;  2UUA H;  2Y3M A;  4PDB A;  4KHP H;  4NZT M;  4JI6 H;  3NCV A;  4X65 H;  4X64 H;  4YY3 H;  3J7A K;  4DV0 H;  2UUB H;  1N36 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...