3OSSD

The crystal structure of enterotoxigenic escherichia coli gspc-gspd complex from the type ii secretion system
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
175
structure length
157
Chain Sequence
b'ATFTANFKDTDLKSFIETVGANLNKTIIMGPGVQGKVSIRTMTPLNERQYYQLFLNLLEAQGYAVVPMYIDTNNDGYIEGDELVLKVVKSAGDEMVTKVVPVRNVSVRELAPILRQMIDSAGSGNVVNYDPSNVIMLTGRASVVERLTEVIQRVDHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE 2 SECRETION SYSTEM, GSPC
molecule tags Protein transport
source organism Escherichia coli
publication title Structural and functional studies on the interaction of GspC and GspD in the type II secretion system.
pubmed doi rcsb
total genus 45
structure length 157
sequence length 175
ec nomenclature
pdb deposition date 2010-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3ossD00
4E9JA 3GR5A 3OSSD 4EC5A 3EZJA 2Y3MA 4G08A
chains in the Genus database with same CATH superfamily
4E9JA 1WHRA 1Z2IA 4DR7H 2BL5A 4X65H 4AQYH 1SEIA 4LF9H 2CTMA 3J80W 1I6UA 2A1SA 3EZJA 2JE6I 2P2RA 1XRHA 2YQRA 4FJSA 1VBIA 3J81W 2MJHA 1PQXA 4FJUA 2HHHH 4JI7H 2PY9A 4DV0H 2ZQEA 5C0XG 4WALA 2CTJA 4GKKH 2G8YA 4JI3H 1NXUA 4B8TA 1VIGA 2UU9H 1K1GA 2CWFA 2OPVA 3GKUA 2O4CA 4LF5H 4X62H 4DV7H 2E3UA 1KHMA 3J7AK 4DUZH 4LF6H 3GABA 1ZTGA 4JI8H 2ANRA 1EC6A 2Y3MA 2DGRA 4JI1H 3I0PA 1S20A 2M6QA 3OETA 3NCVA 1F0XA 4JVYA 1AN7A 1UG8A 4LF4H 1V9NA 2JZXA 4H8AA 2D9IA 4DV3H 1N34H 2Z0SA 4B3RH 4JV5H 1XNQH 2JEBI 3UOEA 3T1HH 2HH2A 4GKJH 1XNRH 3OSSD 2UXDH 2LTLA 2BA0A 1HNZH 1TUAA 2UUBH 1V8CA 4NBQA 2VQEH 3KDKA 1HNXH 4OCHA 3U1KA 2JVZA 2CTLA 4DR6H 5IT9W 4LIJA 2ZM6H 4YHHH 5LMUH 1ZZKA 5JEAG 5FLXW 4DR1H 2X06A 4JI6H 1N32H 4OO1G 1XMOH 1FKAH 2FMRA 4DV5H 2E5LH 4LF8H 4NXNH 4PDBA 4DV4H 4OD6A 4DV1H 4LF7H 3VKEA 4YY3H 2LRRA 3GR5A 3RF2A 2OPUA 2CTKA 4B3MH 5DT9A 2ANNA 2FPHX 3L7ZC 2FFMA 1DTJA 4QMFB 3JAMW 3OTOH 2K1HA 4DR5H 2UUCH 2PQUA 4LFCH 4OX9H 4BA1I 4NZTM 2F4VH 4IFDG 4B8CD 4JI4H 2CTEA 1J5EH 4AM3A 3SB1A 2CPQA 4DUYH 3FAUA 4EC5A 4KHPH 1N33H 4JI5H 1X4NA 4JI0H 4JI2H 2CPMA 4K0KH 4NXMH 4JYAH 3T1YH 3V69A 1WTJA 1X0AA 4NZRM 2NN6G 1VIHA 4LFAH 1ZZIA 1HNWH 2JEAI 3AEVB 2QNDA 1X4MA 4DR2H 1I94H 2M8WA 3QD7X 1IBLH 5BR8H 4DV6H 1ODHA 1FJGH 2CTFA 4BA2I 1IBKH 4DR4H 4B3SH 4WANA 4LFBH 1WVNA 1J5KA 5A2QW 4B3TH 2LTMA 4G08A 4DV2H 2LF0A 2VKCA 2HH3A 4X64H 1HR0H 4DR3H 2UXBH 1XMQH 1N36H 2PT7G 1X9ZA 4AIMA 5LMNH 1IBMH 3KDGA 5K36G 1MSZA 1S03G 1J4WA 5IWAH 4JVHA 1ZZJA 2VQFH 2UUAH 4X66H 2AXYA 2UXCH 1DT4A 2JA9A 5LL6b 2CWHA 1WE8A
chains in the Genus database with same CATH topology
4E9JA 4DR7H 4X65H 4AQYH 1SEIA 4LF9H 3J80W 1I6UA 3EZJA 3J81W 4JI7H 2HHHH 4DV0H 2ZQEA 4GKKH 4JI3H 2UU9H 2O4CA 4LF5H 4X62H 4DV7H 3J7AK 4DUZH 4LF6H 3GABA 4JI8H 2Y3MA 4JI1H 3OETA 3NCVA 1F0XA 1AN7A 4LF4H 2D9IA 4DV3H 1N34H 4B3RH 4JV5H 1XNQH 3T1HH 4GKJH 1XNRH 3OSSD 2UXDH 1HNZH 2UUBH 2VQEH 3KDKA 1HNXH 4OCHA 4DR6H 5IT9W 2ZM6H 4YHHH 5LMUH 4DR1H 5FLXW 4JI6H 1N32H 1XMOH 1FKAH 4DV5H 2E5LH 4NXNH 4LF8H 4PDBA 4DV4H 4DV1H 4OD6A 4LF7H 4YY3H 3GR5A 3RF2A 4B3MH 5DT9A 2FPHX 3JAMW 3OTOH 4DR5H 2UUCH 4LFCH 4OX9H 4NZTM 2F4VH 4B8CD 4JI4H 1J5EH 3SB1A 4DUYH 3FAUA 4EC5A 4KHPH 1N33H 4JI5H 4JI0H 4JI2H 4K0KH 4NXMH 4JYAH 3T1YH 4NZRM 4LFAH 1HNWH 4DR2H 1I94H 3QD7X 1IBLH 5BR8H 4DV6H 1ODHA 1FJGH 4DR4H 1IBKH 4B3SH 4LFBH 5A2QW 4B3TH 4G08A 4DV2H 2LF0A 2VKCA 4X64H 1HR0H 4DR3H 2UXBH 1XMQH 1N36H 2PT7G 1X9ZA 5LMNH 1IBMH 3KDGA 1S03G 5IWAH 2UUAH 2VQFH 4X66H 2UXCH 5LL6b
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E9J A;  3GR5 A;  3OSS D;  4EC5 A;  3EZJ A;  2Y3M A;  4G08 A; 
#chains in the Genus database with same CATH topology
 4E9J A;  1WHR A;  1Z2I A;  4DR7 H;  2BL5 A;  4X65 H;  4AQY H;  1SEI A;  4LF9 H;  2CTM A;  3J80 W;  1I6U A;  2A1S A;  3EZJ A;  2JE6 I;  2P2R A;  1XRH A;  2YQR A;  4FJS A;  1VBI A;  3J81 W;  2MJH A;  1PQX A;  4FJU A;  2HHH H;  4JI7 H;  2PY9 A;  4DV0 H;  2ZQE A;  5C0X G;  4WAL A;  2CTJ A;  4GKK H;  2G8Y A;  4JI3 H;  1NXU A;  4B8T A;  1VIG A;  2UU9 H;  1K1G A;  2CWF A;  2OPV A;  3GKU A;  2O4C A;  4LF5 H;  4X62 H;  4DV7 H;  2E3U A;  1KHM A;  3J7A K;  4DUZ H;  4LF6 H;  3GAB A;  1ZTG A;  4JI8 H;  2ANR A;  1EC6 A;  2Y3M A;  2DGR A;  4JI1 H;  3I0P A;  1S20 A;  2M6Q A;  3OET A;  3NCV A;  1F0X A;  4JVY A;  1AN7 A;  1UG8 A;  4LF4 H;  1V9N A;  2JZX A;  4H8A A;  2D9I A;  4DV3 H;  1N34 H;  2Z0S A;  4B3R H;  4JV5 H;  1XNQ H;  2JEB I;  3UOE A;  3T1H H;  2HH2 A;  4GKJ H;  1XNR H;  3OSS D;  2UXD H;  2LTL A;  2BA0 A;  1HNZ H;  1TUA A;  2UUB H;  1V8C A;  4NBQ A;  2VQE H;  3KDK A;  1HNX H;  4OCH A;  3U1K A;  2JVZ A;  2CTL A;  4DR6 H;  5IT9 W;  4LIJ A;  2ZM6 H;  4YHH H;  5LMU H;  1ZZK A;  5JEA G;  5FLX W;  4DR1 H;  2X06 A;  4JI6 H;  1N32 H;  4OO1 G;  1XMO H;  1FKA H;  2FMR A;  4DV5 H;  2E5L H;  4LF8 H;  4NXN H;  4PDB A;  4DV4 H;  4OD6 A;  4DV1 H;  4LF7 H;  3VKE A;  4YY3 H;  2LRR A;  3GR5 A;  3RF2 A;  2OPU A;  2CTK A;  4B3M H;  5DT9 A;  2ANN A;  2FPH X;  3L7Z C;  2FFM A;  1DTJ A;  4QMF B;  3JAM W;  3OTO H;  2K1H A;  4DR5 H;  2UUC H;  2PQU A;  4LFC H;  4OX9 H;  4BA1 I;  4NZT M;  2F4V H;  4IFD G;  4B8C D;  4JI4 H;  2CTE A;  1J5E H;  4AM3 A;  3SB1 A;  2CPQ A;  4DUY H;  3FAU A;  4EC5 A;  4KHP H;  1N33 H;  4JI5 H;  1X4N A;  4JI0 H;  4JI2 H;  2CPM A;  4K0K H;  4NXM H;  4JYA H;  3T1Y H;  3V69 A;  1WTJ A;  1X0A A;  4NZR M;  2NN6 G;  1VIH A;  4LFA H;  1ZZI A;  1HNW H;  2JEA I;  3AEV B;  2QND A;  1X4M A;  4DR2 H;  1I94 H;  2M8W A;  3QD7 X;  1IBL H;  5BR8 H;  4DV6 H;  1ODH A;  1FJG H;  2CTF A;  4BA2 I;  1IBK H;  4DR4 H;  4B3S H;  4WAN A;  4LFB H;  1WVN A;  1J5K A;  5A2Q W;  4B3T H;  2LTM A;  4G08 A;  4DV2 H;  2LF0 A;  2VKC A;  2HH3 A;  4X64 H;  1HR0 H;  4DR3 H;  2UXB H;  1XMQ H;  1N36 H;  2PT7 G;  1X9Z A;  4AIM A;  5LMN H;  1IBM H;  3KDG A;  5K36 G;  1MSZ A;  1S03 G;  1J4W A;  5IWA H;  4JVH A;  1ZZJ A;  2VQF H;  2UUA H;  4X66 H;  2AXY A;  2UXC H;  1DT4 A;  2JA9 A;  5LL6 b;  2CWH A;  1WE8 A; 
#chains in the Genus database with same CATH homology
 4E9J A;  4DR7 H;  4X65 H;  4AQY H;  1SEI A;  4LF9 H;  3J80 W;  1I6U A;  3EZJ A;  3J81 W;  4JI7 H;  2HHH H;  4DV0 H;  2ZQE A;  4GKK H;  4JI3 H;  2UU9 H;  2O4C A;  4LF5 H;  4X62 H;  4DV7 H;  3J7A K;  4DUZ H;  4LF6 H;  3GAB A;  4JI8 H;  2Y3M A;  4JI1 H;  3OET A;  3NCV A;  1F0X A;  1AN7 A;  4LF4 H;  2D9I A;  4DV3 H;  1N34 H;  4B3R H;  4JV5 H;  1XNQ H;  3T1H H;  4GKJ H;  1XNR H;  3OSS D;  2UXD H;  1HNZ H;  2UUB H;  2VQE H;  3KDK A;  1HNX H;  4OCH A;  4DR6 H;  5IT9 W;  2ZM6 H;  4YHH H;  5LMU H;  4DR1 H;  5FLX W;  4JI6 H;  1N32 H;  1XMO H;  1FKA H;  4DV5 H;  2E5L H;  4NXN H;  4LF8 H;  4PDB A;  4DV4 H;  4DV1 H;  4OD6 A;  4LF7 H;  4YY3 H;  3GR5 A;  3RF2 A;  4B3M H;  5DT9 A;  2FPH X;  3JAM W;  3OTO H;  4DR5 H;  2UUC H;  4LFC H;  4OX9 H;  4NZT M;  2F4V H;  4B8C D;  4JI4 H;  1J5E H;  3SB1 A;  4DUY H;  3FAU A;  4EC5 A;  4KHP H;  1N33 H;  4JI5 H;  4JI0 H;  4JI2 H;  4K0K H;  4NXM H;  4JYA H;  3T1Y H;  4NZR M;  4LFA H;  1HNW H;  4DR2 H;  1I94 H;  3QD7 X;  1IBL H;  5BR8 H;  4DV6 H;  1ODH A;  1FJG H;  4DR4 H;  1IBK H;  4B3S H;  4LFB H;  5A2Q W;  4B3T H;  4G08 A;  4DV2 H;  2LF0 A;  2VKC A;  4X64 H;  1HR0 H;  4DR3 H;  2UXB H;  1XMQ H;  1N36 H;  2PT7 G;  1X9Z A;  5LMN H;  1IBM H;  3KDG A;  1S03 G;  5IWA H;  2UUA H;  2VQF H;  4X66 H;  2UXC H;  5LL6 b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...