3OSSD

The crystal structure of enterotoxigenic escherichia coli gspc-gspd complex from the type ii secretion system
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
175
structure length
157
Chain Sequence
b'ATFTANFKDTDLKSFIETVGANLNKTIIMGPGVQGKVSIRTMTPLNERQYYQLFLNLLEAQGYAVVPMYIDTNNDGYIEGDELVLKVVKSAGDEMVTKVVPVRNVSVRELAPILRQMIDSAGSGNVVNYDPSNVIMLTGRASVVERLTEVIQRVDHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE 2 SECRETION SYSTEM, GSPC
publication title Structural and functional studies on the interaction of GspC and GspD in the type II secretion system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 45
structure length 157
sequence length 175
ec nomenclature
pdb deposition date 2010-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3ossD00
3GR5A 4E9JA 2Y3MA 3EZJA 4EC5A 3OSSD 4G08A
chains in the Genus database with same CATH superfamily
4FJUA 2FPHX 3JAMW 4DR6H 2VQFH 4OO1G 2CTFA 3OTOH 2CTKA 1WE8A 2FMRA 3OETA 4LFAH 3SB1A 4K0KH 2LTLA 4JI6H 2UXBH 4WANA 1ZZIA 1HR0H 2NN6G 4DV2H 4DV3H 1N36H 5IWAH 4DR1H 1I6UA 3NCVA 4BA1I 4G08A 1XMOH 4DR7H 2ANNA 4LF6H 1N33H 4JV5H 4LF9H 4BA2I 4DR4H 4KHPH 1IBLH 1N32H 3GKUA 1IBMH 1Z2IA 5IT9W 2VKCA 4DR3H 2CWFA 4E9JA 1ZTGA 2E5LH 2FFMA 4LFCH 1WVNA 1HNWH 2QNDA 5JEAG 1AN7A 2M8WA 2YQRA 4DR2H 5LMNH 4DR5H 3U1KA 1FJGH 2A1SA 4X64H 4DV5H 1V9NA 2CPQA 2HH2A 2CPMA 2O4CA 3OSSD 2OPVA 5A2QW 4OX9H 4DV1H 4DV0H 4X65H 1VIHA 1VIGA 4NZRM 4AQYH 4JI4H 1MSZA 4DUZH 4DV6H 2CTEA 2UUCH 1PQXA 2K1HA 2OPUA 2ZQEA 3V69A 4LF4H 2UU9H 2Y3MA 2JEBI 3EZJA 1EC6A 4LIJA 1N34H 2LTMA 1X4MA 4B3MH 1DT4A 3GR5A 4LF7H 4JI8H 2LF0A 1HNXH 2MJHA 2E3UA 1X0AA 4JI0H 4JI5H 4GKJH 4QMFB 4OD6A 1V8CA 4B3SH 5FLXW 4DUYH 2ZM6H 4AM3A 4IFDG 2Z0SA 2JA9A 4OCHA 4DV4H 2BL5A 4H8AA 1J5KA 1ZZJA 4JI3H 4JI7H 1VBIA 4B8CD 2PT7G 1F0XA 4NZTM 2JZXA 4JVHA 2PY9A 2X06A 3L7ZC 3RF2A 3VKEA 2LRRA 4LFBH 4AIMA 1I94H 2HH3A 2CTMA 4LF8H 3J7AK 4B3TH 2HHHH 2P2RA 4X62H 1WHRA 1XRHA 2F4VH 1S03G 4B3RH 4YY3H 3FAUA 2G8YA 4DV7H 2JE6I 4X66H 1WTJA 3KDKA 4PDBA 4GKKH 4JVYA 1XNQH 1XNRH 1X4NA 5BR8H 4NXNH 2DGRA 1J5EH 4B8TA 2UXCH 3AEVB 3J81W 2ANRA 5LMUH 5LL6b 1KHMA 1ODHA 4NBQA 1ZZKA 4WALA 4YHHH 3KDGA 2UUBH 2VQEH 4JI1H 1XMQH 2M6QA 1NXUA 1UG8A 2CTJA 4FJSA 2UXDH 1TUAA 1DTJA 2CWHA 2JEAI 3J80W 4LF5H 1X9ZA 1J4WA 2CTLA 3T1YH 2AXYA 3QD7X 2JVZA 4JYAH 3I0PA 4EC5A 2BA0A 3GABA 1SEIA 5DT9A 2D9IA 1HNZH 3UOEA 1K1GA 1IBKH 2UUAH 4JI2H 1FKAH 3T1HH 5K36G 4NXMH 1S20A 5C0XG 2PQUA
chains in the Genus database with same CATH topology
4DR6H 2FPHX 3JAMW 2VQFH 3OTOH 3OETA 4LFAH 3SB1A 4K0KH 2UXBH 4JI6H 1HR0H 4DV2H 4DV3H 1N36H 5IWAH 4DR1H 1I6UA 3NCVA 4G08A 1XMOH 4DR7H 4LF6H 1N33H 4JV5H 4LF9H 4DR4H 1N32H 4KHPH 1IBLH 5IT9W 1IBMH 2VKCA 4DR3H 2E5LH 4E9JA 4LFCH 1HNWH 1AN7A 4DR2H 5LMNH 4DR5H 1FJGH 4X64H 4DV5H 3OSSD 2O4CA 5A2QW 4OX9H 4DV1H 4DV0H 4X65H 4NZRM 4AQYH 4JI4H 4DUZH 4DV6H 2UUCH 2ZQEA 4LF4H 2UU9H 2Y3MA 3EZJA 1N34H 4B3MH 3GR5A 4LF7H 4JI8H 2LF0A 1HNXH 4JI0H 4JI5H 4GKJH 4OD6A 4B3SH 5FLXW 4DUYH 2ZM6H 4OCHA 4DV4H 4JI3H 4JI7H 4B8CD 2PT7G 1F0XA 4NZTM 3RF2A 4LFBH 1I94H 4LF8H 3J7AK 4B3TH 2HHHH 4B3RH 4X62H 2F4VH 1S03G 4YY3H 3FAUA 4DV7H 4X66H 3KDKA 4PDBA 4GKKH 1XNQH 1XNRH 5BR8H 4NXNH 1J5EH 2UXCH 3J81W 5LMUH 5LL6b 1ODHA 4YHHH 3KDGA 2UUBH 2VQEH 4JI1H 1XMQH 2UXDH 3J80W 4LF5H 1X9ZA 3T1YH 3QD7X 4JYAH 4EC5A 3GABA 1SEIA 5DT9A 2D9IA 1HNZH 1IBKH 2UUAH 4JI2H 1FKAH 3T1HH 4NXMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GR5 A;  4E9J A;  2Y3M A;  3EZJ A;  4EC5 A;  3OSS D;  4G08 A; 
#chains in the Genus database with same CATH topology
 4FJU A;  2FPH X;  3JAM W;  4DR6 H;  2VQF H;  4OO1 G;  2CTF A;  3OTO H;  2CTK A;  1WE8 A;  2FMR A;  3OET A;  4LFA H;  3SB1 A;  4K0K H;  2LTL A;  4JI6 H;  2UXB H;  4WAN A;  1ZZI A;  1HR0 H;  2NN6 G;  4DV2 H;  4DV3 H;  1N36 H;  5IWA H;  4DR1 H;  1I6U A;  3NCV A;  4BA1 I;  4G08 A;  1XMO H;  4DR7 H;  2ANN A;  4LF6 H;  1N33 H;  4JV5 H;  4LF9 H;  4BA2 I;  4DR4 H;  4KHP H;  1IBL H;  1N32 H;  3GKU A;  1IBM H;  1Z2I A;  5IT9 W;  2VKC A;  4DR3 H;  2CWF A;  4E9J A;  1ZTG A;  2E5L H;  2FFM A;  4LFC H;  1WVN A;  1HNW H;  2QND A;  5JEA G;  1AN7 A;  2M8W A;  2YQR A;  4DR2 H;  5LMN H;  4DR5 H;  3U1K A;  1FJG H;  2A1S A;  4X64 H;  4DV5 H;  1V9N A;  2CPQ A;  2HH2 A;  2CPM A;  2O4C A;  3OSS D;  2OPV A;  5A2Q W;  4OX9 H;  4DV1 H;  4DV0 H;  4X65 H;  1VIH A;  1VIG A;  4NZR M;  4AQY H;  4JI4 H;  1MSZ A;  4DUZ H;  4DV6 H;  2CTE A;  2UUC H;  1PQX A;  2K1H A;  2OPU A;  2ZQE A;  3V69 A;  4LF4 H;  2UU9 H;  2Y3M A;  2JEB I;  3EZJ A;  1EC6 A;  4LIJ A;  1N34 H;  2LTM A;  1X4M A;  4B3M H;  1DT4 A;  3GR5 A;  4LF7 H;  4JI8 H;  2LF0 A;  1HNX H;  2MJH A;  2E3U A;  1X0A A;  4JI0 H;  4JI5 H;  4GKJ H;  4QMF B;  4OD6 A;  1V8C A;  4B3S H;  5FLX W;  4DUY H;  2ZM6 H;  4AM3 A;  4IFD G;  2Z0S A;  2JA9 A;  4OCH A;  4DV4 H;  2BL5 A;  4H8A A;  1J5K A;  1ZZJ A;  4JI3 H;  4JI7 H;  1VBI A;  4B8C D;  2PT7 G;  1F0X A;  4NZT M;  2JZX A;  4JVH A;  2PY9 A;  2X06 A;  3L7Z C;  3RF2 A;  3VKE A;  2LRR A;  4LFB H;  4AIM A;  1I94 H;  2HH3 A;  2CTM A;  4LF8 H;  3J7A K;  4B3T H;  2HHH H;  2P2R A;  4X62 H;  1WHR A;  1XRH A;  2F4V H;  1S03 G;  4B3R H;  4YY3 H;  3FAU A;  2G8Y A;  4DV7 H;  2JE6 I;  4X66 H;  1WTJ A;  3KDK A;  4PDB A;  4GKK H;  4JVY A;  1XNQ H;  1XNR H;  1X4N A;  5BR8 H;  4NXN H;  2DGR A;  1J5E H;  4B8T A;  2UXC H;  3AEV B;  3J81 W;  2ANR A;  5LMU H;  5LL6 b;  1KHM A;  1ODH A;  4NBQ A;  1ZZK A;  4WAL A;  4YHH H;  3KDG A;  2UUB H;  2VQE H;  4JI1 H;  1XMQ H;  2M6Q A;  1NXU A;  1UG8 A;  2CTJ A;  4FJS A;  2UXD H;  1TUA A;  1DTJ A;  2CWH A;  2JEA I;  3J80 W;  4LF5 H;  1X9Z A;  1J4W A;  2CTL A;  3T1Y H;  2AXY A;  3QD7 X;  2JVZ A;  4JYA H;  3I0P A;  4EC5 A;  2BA0 A;  3GAB A;  1SEI A;  5DT9 A;  2D9I A;  1HNZ H;  3UOE A;  1K1G A;  1IBK H;  2UUA H;  4JI2 H;  1FKA H;  3T1H H;  5K36 G;  4NXM H;  1S20 A;  5C0X G;  2PQU A; 
#chains in the Genus database with same CATH homology
 4DR6 H;  2FPH X;  3JAM W;  2VQF H;  3OTO H;  3OET A;  4LFA H;  3SB1 A;  4K0K H;  2UXB H;  4JI6 H;  1HR0 H;  4DV2 H;  4DV3 H;  1N36 H;  5IWA H;  4DR1 H;  1I6U A;  3NCV A;  4G08 A;  1XMO H;  4DR7 H;  4LF6 H;  1N33 H;  4JV5 H;  4LF9 H;  4DR4 H;  1N32 H;  4KHP H;  1IBL H;  5IT9 W;  1IBM H;  2VKC A;  4DR3 H;  2E5L H;  4E9J A;  4LFC H;  1HNW H;  1AN7 A;  4DR2 H;  5LMN H;  4DR5 H;  1FJG H;  4X64 H;  4DV5 H;  3OSS D;  2O4C A;  5A2Q W;  4OX9 H;  4DV1 H;  4DV0 H;  4X65 H;  4NZR M;  4AQY H;  4JI4 H;  4DUZ H;  4DV6 H;  2UUC H;  2ZQE A;  4LF4 H;  2UU9 H;  2Y3M A;  3EZJ A;  1N34 H;  4B3M H;  3GR5 A;  4LF7 H;  4JI8 H;  2LF0 A;  1HNX H;  4JI0 H;  4JI5 H;  4GKJ H;  4OD6 A;  4B3S H;  5FLX W;  4DUY H;  2ZM6 H;  4OCH A;  4DV4 H;  4JI3 H;  4JI7 H;  4B8C D;  2PT7 G;  1F0X A;  4NZT M;  3RF2 A;  4LFB H;  1I94 H;  4LF8 H;  3J7A K;  4B3T H;  2HHH H;  4B3R H;  4X62 H;  2F4V H;  1S03 G;  4YY3 H;  3FAU A;  4DV7 H;  4X66 H;  3KDK A;  4PDB A;  4GKK H;  1XNQ H;  1XNR H;  5BR8 H;  4NXN H;  1J5E H;  2UXC H;  3J81 W;  5LMU H;  5LL6 b;  1ODH A;  4YHH H;  3KDG A;  2UUB H;  2VQE H;  4JI1 H;  1XMQ H;  2UXD H;  3J80 W;  4LF5 H;  1X9Z A;  3T1Y H;  3QD7 X;  4JYA H;  4EC5 A;  3GAB A;  1SEI A;  5DT9 A;  2D9I A;  1HNZ H;  1IBK H;  2UUA H;  4JI2 H;  1FKA H;  3T1H H;  4NXM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...