3OSSD

The crystal structure of enterotoxigenic escherichia coli gspc-gspd complex from the type ii secretion system
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
175
structure length
157
Chain Sequence
ATFTANFKDTDLKSFIETVGANLNKTIIMGPGVQGKVSIRTMTPLNERQYYQLFLNLLEAQGYAVVPMYIDTNNDGYIEGDELVLKVVKSAGDEMVTKVVPVRNVSVRELAPILRQMIDSAGSGNVVNYDPSNVIMLTGRASVVERLTEVIQRVDHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE 2 SECRETION SYSTEM, GSPC
publication title Structural and functional studies on the interaction of GspC and GspD in the type II secretion system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 45
structure length 157
sequence length 175
ec nomenclature
pdb deposition date 2010-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3ossD00
3OSSD 3GR5A 3EZJA 4G08A 4E9JA 4EC5A 2Y3MA
chains in the Genus database with same CATH superfamily
5BR8H 2JE6I 4DUZH 4BA2I 4AM3A 2JEBI 2ANNA 2UXCH 2E5LH 3NCVA 2UUCH 1SEIA 3GABA 2ZM6H 3KDGA 2JEAI 1EC6A 2LTMA 4DV7H 2PY9A 2M8WA 1N36H 2F4VH 2P2RA 2HH3A 2O4CA 4LF8H 2HH2A 4DV2H 4NXMH 3T1HH 5K36G 1N32H 4OO1G 3AEVB 2JZXA 2UUAH 4DR5H 4LF4H 4B3RH 4DR4H 3UOEA 2YQRA 1DTJA 2CWHA 1J5EH 1HNWH 2D9IA 2OPVA 1IBLH 4JI7H 5IWAH 4AQYH 4JVYA 1I6UA 4WANA 3OTOH 1WHRA 1S03G 4GKKH 1ZZJA 3KDKA 1XRHA 4DV6H 1IBKH 1Z2IA 2PT7G 4QMFB 2CTEA 1HNXH 4DR1H 1X4NA 4JI8H 1X0AA 4LFCH 5JEAG 3VKEA 1MSZA 2OPUA 2UXBH 4PDBA 1VIHA 2BA0A 1J5KA 2A1SA 1J4WA 4LFAH 4NBQA 5IT9W 3FAUA 2Z0SA 4YHHH 4OD6A 2UU9H 4K0KH 4DV1H 4B3TH 1XNRH 1WTJA 4YY3H 4DUYH 1V9NA 3RF2A 1ZTGA 4NZTM 2K1HA 4DR3H 3L7ZC 1F0XA 2UXDH 1DT4A 4DR6H 4B8CD 4OX9H 3JAMW 3SB1A 3OETA 1NXUA 2CTMA 4E9JA 1XMQH 5LMUH 1FKAH 1XNQH 3U1KA 1V8CA 3T1YH 2ANRA 2LF0A 4DR7H 4AIMA 3GKUA 1I94H 4LF9H 4EC5A 1KHMA 2E3UA 3J7AK 4B3SH 4DV4H 4KHPH 4GKJH 3GR5A 3EZJA 2FPHX 4H8AA 2X06A 1VBIA 4JVHA 3I0PA 4FJUA 4OCHA 4DV3H 1N34H 2NN6G 2ZQEA 4DV0H 1PQXA 2UUBH 1K1GA 4G08A 2VQFH 2AXYA 2M6QA 4LIJA 4BA1I 1S20A 1TUAA 3V69A 4IFDG 2FMRA 2CPQA 2DGRA 5A2QW 4X62H 4JI3H 3J80W 2CPMA 4DV5H 1X4MA 1WVNA 5LMNH 1VIGA 4B8TA 4NZRM 2CTLA 2VQEH 4JI1H 4JI5H 1ODHA 2CWFA 1HR0H 2Y3MA 1X9ZA 5DT9A 1N33H 4LF5H 1HNZH 2FFMA 5LL6b 4LFBH 1ZZKA 2QNDA 3QD7X 4LF6H 2CTKA 2MJHA 1XMOH 2G8YA 4X65H 4JV5H 4LF7H 4JI4H 3OSSD 1AN7A 4JI6H 3J81W 4WALA 2JVZA 1ZZIA 2LTLA 2CTFA 1FJGH 2HHHH 4NXNH 4X66H 1WE8A 2LRRA 5FLXW 4JI2H 2BL5A 5C0XG 4FJSA 4DR2H 4X64H 2VKCA 1IBMH 1UG8A 2CTJA 4B3MH 4JYAH 2JA9A 4JI0H 2PQUA
chains in the Genus database with same CATH topology
5BR8H 4DUZH 2UXCH 2E5LH 3NCVA 2UUCH 1SEIA 3GABA 2ZM6H 3KDGA 4DV7H 1N36H 2F4VH 2O4CA 4LF8H 4NXMH 4DV2H 3T1HH 1N32H 2UUAH 4LF4H 4DR5H 4B3RH 4DR4H 1HNWH 1J5EH 2D9IA 1IBLH 4JI7H 5IWAH 4AQYH 1I6UA 3OTOH 1S03G 4GKKH 3KDKA 4DV6H 1IBKH 2PT7G 1HNXH 4DR1H 4JI8H 4LFCH 2UXBH 4PDBA 4LFAH 5IT9W 3FAUA 4YHHH 4OD6A 2UU9H 4K0KH 4DV1H 4B3TH 1XNRH 4YY3H 4DUYH 3RF2A 4NZTM 4DR3H 2UXDH 1F0XA 4DR6H 4B8CD 4OX9H 3JAMW 3SB1A 3OETA 4E9JA 1XMQH 5LMUH 1FKAH 1XNQH 3T1YH 2LF0A 4DR7H 1I94H 4LF9H 4EC5A 3J7AK 4B3SH 4DV4H 4KHPH 4GKJH 3GR5A 3EZJA 2FPHX 4OCHA 4DV3H 1N34H 2ZQEA 4DV0H 2UUBH 4G08A 2VQFH 5A2QW 4X62H 4JI3H 3J80W 4DV5H 5LMNH 4NZRM 2VQEH 4JI1H 4JI5H 1ODHA 1HR0H 2Y3MA 1X9ZA 5DT9A 1N33H 4LF5H 1HNZH 5LL6b 4LFBH 3QD7X 4LF6H 1XMOH 4X65H 4JV5H 4LF7H 4JI4H 3OSSD 1AN7A 4JI6H 3J81W 1FJGH 2HHHH 4NXNH 4X66H 5FLXW 4JI2H 4DR2H 4X64H 2VKCA 1IBMH 4JYAH 4B3MH 4JI0H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSS D;  3GR5 A;  3EZJ A;  4G08 A;  4E9J A;  4EC5 A;  2Y3M A; 
#chains in the Genus database with same CATH topology
 5BR8 H;  2JE6 I;  4DUZ H;  4BA2 I;  4AM3 A;  2JEB I;  2ANN A;  2UXC H;  2E5L H;  3NCV A;  2UUC H;  1SEI A;  3GAB A;  2ZM6 H;  3KDG A;  2JEA I;  1EC6 A;  2LTM A;  4DV7 H;  2PY9 A;  2M8W A;  1N36 H;  2F4V H;  2P2R A;  2HH3 A;  2O4C A;  4LF8 H;  2HH2 A;  4DV2 H;  4NXM H;  3T1H H;  5K36 G;  1N32 H;  4OO1 G;  3AEV B;  2JZX A;  2UUA H;  4DR5 H;  4LF4 H;  4B3R H;  4DR4 H;  3UOE A;  2YQR A;  1DTJ A;  2CWH A;  1J5E H;  1HNW H;  2D9I A;  2OPV A;  1IBL H;  4JI7 H;  5IWA H;  4AQY H;  4JVY A;  1I6U A;  4WAN A;  3OTO H;  1WHR A;  1S03 G;  4GKK H;  1ZZJ A;  3KDK A;  1XRH A;  4DV6 H;  1IBK H;  1Z2I A;  2PT7 G;  4QMF B;  2CTE A;  1HNX H;  4DR1 H;  1X4N A;  4JI8 H;  1X0A A;  4LFC H;  5JEA G;  3VKE A;  1MSZ A;  2OPU A;  2UXB H;  4PDB A;  1VIH A;  2BA0 A;  1J5K A;  2A1S A;  1J4W A;  4LFA H;  4NBQ A;  5IT9 W;  3FAU A;  2Z0S A;  4YHH H;  4OD6 A;  2UU9 H;  4K0K H;  4DV1 H;  4B3T H;  1XNR H;  1WTJ A;  4YY3 H;  4DUY H;  1V9N A;  3RF2 A;  1ZTG A;  4NZT M;  2K1H A;  4DR3 H;  3L7Z C;  1F0X A;  2UXD H;  1DT4 A;  4DR6 H;  4B8C D;  4OX9 H;  3JAM W;  3SB1 A;  3OET A;  1NXU A;  2CTM A;  4E9J A;  1XMQ H;  5LMU H;  1FKA H;  1XNQ H;  3U1K A;  1V8C A;  3T1Y H;  2ANR A;  2LF0 A;  4DR7 H;  4AIM A;  3GKU A;  1I94 H;  4LF9 H;  4EC5 A;  1KHM A;  2E3U A;  3J7A K;  4B3S H;  4DV4 H;  4KHP H;  4GKJ H;  3GR5 A;  3EZJ A;  2FPH X;  4H8A A;  2X06 A;  1VBI A;  4JVH A;  3I0P A;  4FJU A;  4OCH A;  4DV3 H;  1N34 H;  2NN6 G;  2ZQE A;  4DV0 H;  1PQX A;  2UUB H;  1K1G A;  4G08 A;  2VQF H;  2AXY A;  2M6Q A;  4LIJ A;  4BA1 I;  1S20 A;  1TUA A;  3V69 A;  4IFD G;  2FMR A;  2CPQ A;  2DGR A;  5A2Q W;  4X62 H;  4JI3 H;  3J80 W;  2CPM A;  4DV5 H;  1X4M A;  1WVN A;  5LMN H;  1VIG A;  4B8T A;  4NZR M;  2CTL A;  2VQE H;  4JI1 H;  4JI5 H;  1ODH A;  2CWF A;  1HR0 H;  2Y3M A;  1X9Z A;  5DT9 A;  1N33 H;  4LF5 H;  1HNZ H;  2FFM A;  5LL6 b;  4LFB H;  1ZZK A;  2QND A;  3QD7 X;  4LF6 H;  2CTK A;  2MJH A;  1XMO H;  2G8Y A;  4X65 H;  4JV5 H;  4LF7 H;  4JI4 H;  3OSS D;  1AN7 A;  4JI6 H;  3J81 W;  4WAL A;  2JVZ A;  1ZZI A;  2LTL A;  2CTF A;  1FJG H;  2HHH H;  4NXN H;  4X66 H;  1WE8 A;  2LRR A;  5FLX W;  4JI2 H;  2BL5 A;  5C0X G;  4FJS A;  4DR2 H;  4X64 H;  2VKC A;  1IBM H;  1UG8 A;  2CTJ A;  4B3M H;  4JYA H;  2JA9 A;  4JI0 H;  2PQU A; 
#chains in the Genus database with same CATH homology
 5BR8 H;  4DUZ H;  2UXC H;  2E5L H;  3NCV A;  2UUC H;  1SEI A;  3GAB A;  2ZM6 H;  3KDG A;  4DV7 H;  1N36 H;  2F4V H;  2O4C A;  4LF8 H;  4NXM H;  4DV2 H;  3T1H H;  1N32 H;  2UUA H;  4LF4 H;  4DR5 H;  4B3R H;  4DR4 H;  1HNW H;  1J5E H;  2D9I A;  1IBL H;  4JI7 H;  5IWA H;  4AQY H;  1I6U A;  3OTO H;  1S03 G;  4GKK H;  3KDK A;  4DV6 H;  1IBK H;  2PT7 G;  1HNX H;  4DR1 H;  4JI8 H;  4LFC H;  2UXB H;  4PDB A;  4LFA H;  5IT9 W;  3FAU A;  4YHH H;  4OD6 A;  2UU9 H;  4K0K H;  4DV1 H;  4B3T H;  1XNR H;  4YY3 H;  4DUY H;  3RF2 A;  4NZT M;  4DR3 H;  2UXD H;  1F0X A;  4DR6 H;  4B8C D;  4OX9 H;  3JAM W;  3SB1 A;  3OET A;  4E9J A;  1XMQ H;  5LMU H;  1FKA H;  1XNQ H;  3T1Y H;  2LF0 A;  4DR7 H;  1I94 H;  4LF9 H;  4EC5 A;  3J7A K;  4B3S H;  4DV4 H;  4KHP H;  4GKJ H;  3GR5 A;  3EZJ A;  2FPH X;  4OCH A;  4DV3 H;  1N34 H;  2ZQE A;  4DV0 H;  2UUB H;  4G08 A;  2VQF H;  5A2Q W;  4X62 H;  4JI3 H;  3J80 W;  4DV5 H;  5LMN H;  4NZR M;  2VQE H;  4JI1 H;  4JI5 H;  1ODH A;  1HR0 H;  2Y3M A;  1X9Z A;  5DT9 A;  1N33 H;  4LF5 H;  1HNZ H;  5LL6 b;  4LFB H;  3QD7 X;  4LF6 H;  1XMO H;  4X65 H;  4JV5 H;  4LF7 H;  4JI4 H;  3OSS D;  1AN7 A;  4JI6 H;  3J81 W;  1FJG H;  2HHH H;  4NXN H;  4X66 H;  5FLX W;  4JI2 H;  4DR2 H;  4X64 H;  2VKC A;  1IBM H;  4JYA H;  4B3M H;  4JI0 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...