4H8AA

Crystal structure of ureidoglycolate dehydrogenase in binary complex with nadh
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
337
structure length
337
Chain Sequence
b'MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGFIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGVPTTDPFAVHALLPAAGPKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ureidoglycolate dehydrogenase
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Structural and functional insights into (s)-ureidoglycolate dehydrogenase, a metabolic branch point enzyme in nitrogen utilization.
pubmed doi rcsb
total genus 113
structure length 337
sequence length 337
chains with identical sequence B
ec nomenclature ec 1.1.1.350: Ureidoglycolate dehydrogenase (NAD(+)).
pdb deposition date 2012-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 4h8aA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 4h8aA02
1V9NA 4H8AA 1NXUA 1S20A 3I0PA 3UOEA 4FJUA 2CWHA 1XRHA 1Z2IA 2CWFA 2G8YA 4FJSA 2X06A 1VBIA 1WTJA 1X0AA
chains in the Genus database with same CATH superfamily
1X9ZA 1I94H 3I0PA 1HNWH 1DTJA 4X66H 2CTEA 1IBLH 2CTMA 2O4CA 3NCVA 2CTFA 3T1HH 2UUAH 1I6UA 4X62H 4FJSA 5A2QW 4K0KH 2JE6I 3OTOH 2D9IA 2JA9A 2CWHA 2BA0A 2CTLA 1F0XA 4NZTM 1XRHA 5DT9A 4GKKH 1WE8A 3QD7X 4JI1H 2CPMA 4NBQA 4YHHH 4LF9H 1Z2IA 2CWFA 5FLXW 2UUBH 2E5LH 4DR7H 2HH3A 5LMUH 1ZZIA 2VQEH 2FMRA 1HNZH 4LIJA 4LFAH 2DGRA 2UXDH 4DV0H 4JI3H 4GKJH 3J81W 2PT7G 4DR2H 4DR4H 4AIMA 2NN6G 2A1SA 1WHRA 3GABA 4OCHA 4BA1I 4DV5H 1S20A 1IBMH 2JVZA 4LF6H 2UU9H 4YY3H 1J4WA 2CPQA 4JYAH 4OO1G 2ZQEA 1VBIA 4LF7H 4DR1H 4OD6A 3L7ZC 2UXCH 1UG8A 4WANA 5JEAG 3SB1A 4FJUA 1PQXA 1S03G 4AM3A 2UUCH 1N36H 1EC6A 4LFCH 1XNQH 2FFMA 1ZZJA 2LTLA 4LFBH 4AQYH 4G08A 2JZXA 2ZM6H 3FAUA 3U1KA 4DV2H 1SEIA 4DV7H 4JI4H 2JEBI 2QNDA 2P2RA 1N33H 4BA2I 1TUAA 1X4NA 4DUYH 4OX9H 5C0XG 1XMQH 4QMFB 4PDBA 2LRRA 3EZJA 4JI7H 2OPUA 1N34H 3AEVB 4JI6H 4DV3H 1DT4A 1WVNA 2FPHX 1HR0H 4WALA 1HNXH 1V8CA 3OSSD 4E9JA 1MSZA 5IWAH 3JAMW 2ANNA 3V69A 4DV4H 2CTKA 4LF4H 1N32H 3VKEA 2HH2A 4X65H 3J80W 4IFDG 4DR6H 2M8WA 5LMNH 1XMOH 2X06A 1J5KA 1IBKH 2LTMA 2AXYA 1KHMA 2CTJA 3KDGA 2E3UA 4B8TA 4B3TH 4JI5H 4JI8H 5IT9W 1VIHA 4B3SH 1X4MA 1VIGA 4DUZH 4NXMH 4EC5A 5BR8H 2F4VH 2PY9A 3GR5A 3GKUA 5LL6b 2ANRA 4DR5H 4JI2H 2UXBH 1WTJA 1X0AA 2YQRA 2Z0SA 1FJGH 4B3RH 4JV5H 3UOEA 2VQFH 4JVYA 5K36G 3KDKA 2G8YA 3RF2A 4X64H 3T1YH 4NZRM 4DV6H 4LF5H 2M6QA 4KHPH 1V9NA 4H8AA 1ZZKA 2BL5A 2K1HA 4B8CD 3J7AK 4DR3H 2VKCA 4B3MH 2MJHA 1XNRH 1FKAH 2LF0A 1K1GA 4LF8H 3OETA 1ODHA 2Y3MA 4NXNH 1NXUA 4DV1H 2HHHH 1J5EH 1AN7A 1ZTGA 2OPVA 2JEAI 4JI0H 4JVHA 2PQUA
chains in the Genus database with same CATH topology
1V9NA 4H8AA 1NXUA 1S20A 3I0PA 3UOEA 4FJUA 2CWHA 1XRHA 1Z2IA 2CWFA 2G8YA 4FJSA 2X06A 1VBIA 1WTJA 1X0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V9N A;  4H8A A;  1NXU A;  1S20 A;  3I0P A;  3UOE A;  4FJU A;  2CWH A;  1XRH A;  1Z2I A;  2CWF A;  2G8Y A;  4FJS A;  2X06 A;  1VBI A;  1WTJ A;  1X0A A; 
#chains in the Genus database with same CATH topology
 1X9Z A;  1I94 H;  3I0P A;  1HNW H;  1DTJ A;  4X66 H;  2CTE A;  1IBL H;  2CTM A;  2O4C A;  3NCV A;  2CTF A;  3T1H H;  2UUA H;  1I6U A;  4X62 H;  4FJS A;  5A2Q W;  4K0K H;  2JE6 I;  3OTO H;  2D9I A;  2JA9 A;  2CWH A;  2BA0 A;  2CTL A;  1F0X A;  4NZT M;  1XRH A;  5DT9 A;  4GKK H;  1WE8 A;  3QD7 X;  4JI1 H;  2CPM A;  4NBQ A;  4YHH H;  4LF9 H;  1Z2I A;  2CWF A;  5FLX W;  2UUB H;  2E5L H;  4DR7 H;  2HH3 A;  5LMU H;  1ZZI A;  2VQE H;  2FMR A;  1HNZ H;  4LIJ A;  4LFA H;  2DGR A;  2UXD H;  4DV0 H;  4JI3 H;  4GKJ H;  3J81 W;  2PT7 G;  4DR2 H;  4DR4 H;  4AIM A;  2NN6 G;  2A1S A;  1WHR A;  3GAB A;  4OCH A;  4BA1 I;  4DV5 H;  1S20 A;  1IBM H;  2JVZ A;  4LF6 H;  2UU9 H;  4YY3 H;  1J4W A;  2CPQ A;  4JYA H;  4OO1 G;  2ZQE A;  1VBI A;  4LF7 H;  4DR1 H;  4OD6 A;  3L7Z C;  2UXC H;  1UG8 A;  4WAN A;  5JEA G;  3SB1 A;  4FJU A;  1PQX A;  1S03 G;  4AM3 A;  2UUC H;  1N36 H;  1EC6 A;  4LFC H;  1XNQ H;  2FFM A;  1ZZJ A;  2LTL A;  4LFB H;  4AQY H;  4G08 A;  2JZX A;  2ZM6 H;  3FAU A;  3U1K A;  4DV2 H;  1SEI A;  4DV7 H;  4JI4 H;  2JEB I;  2QND A;  2P2R A;  1N33 H;  4BA2 I;  1TUA A;  1X4N A;  4DUY H;  4OX9 H;  5C0X G;  1XMQ H;  4QMF B;  4PDB A;  2LRR A;  3EZJ A;  4JI7 H;  2OPU A;  1N34 H;  3AEV B;  4JI6 H;  4DV3 H;  1DT4 A;  1WVN A;  2FPH X;  1HR0 H;  4WAL A;  1HNX H;  1V8C A;  3OSS D;  4E9J A;  1MSZ A;  5IWA H;  3JAM W;  2ANN A;  3V69 A;  4DV4 H;  2CTK A;  4LF4 H;  1N32 H;  3VKE A;  2HH2 A;  4X65 H;  3J80 W;  4IFD G;  4DR6 H;  2M8W A;  5LMN H;  1XMO H;  2X06 A;  1J5K A;  1IBK H;  2LTM A;  2AXY A;  1KHM A;  2CTJ A;  3KDG A;  2E3U A;  4B8T A;  4B3T H;  4JI5 H;  4JI8 H;  5IT9 W;  1VIH A;  4B3S H;  1X4M A;  1VIG A;  4DUZ H;  4NXM H;  4EC5 A;  5BR8 H;  2F4V H;  2PY9 A;  3GR5 A;  3GKU A;  5LL6 b;  2ANR A;  4DR5 H;  4JI2 H;  2UXB H;  1WTJ A;  1X0A A;  2YQR A;  2Z0S A;  1FJG H;  4B3R H;  4JV5 H;  3UOE A;  2VQF H;  4JVY A;  5K36 G;  3KDK A;  2G8Y A;  3RF2 A;  4X64 H;  3T1Y H;  4NZR M;  4DV6 H;  4LF5 H;  2M6Q A;  4KHP H;  1V9N A;  4H8A A;  1ZZK A;  2BL5 A;  2K1H A;  4B8C D;  3J7A K;  4DR3 H;  2VKC A;  4B3M H;  2MJH A;  1XNR H;  1FKA H;  2LF0 A;  1K1G A;  4LF8 H;  3OET A;  1ODH A;  2Y3M A;  4NXN H;  1NXU A;  4DV1 H;  2HHH H;  1J5E H;  1AN7 A;  1ZTG A;  2OPV A;  2JEA I;  4JI0 H;  4JVH A;  2PQU A; 
#chains in the Genus database with same CATH homology
 1V9N A;  4H8A A;  1NXU A;  1S20 A;  3I0P A;  3UOE A;  4FJU A;  2CWH A;  1XRH A;  1Z2I A;  2CWF A;  2G8Y A;  4FJS A;  2X06 A;  1VBI A;  1WTJ A;  1X0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...