4H8AA

Crystal structure of ureidoglycolate dehydrogenase in binary complex with nadh
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
337
structure length
337
Chain Sequence
MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGFIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGVPTTDPFAVHALLPAAGPKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ureidoglycolate dehydrogenase
publication title Structural and functional insights into (s)-ureidoglycolate dehydrogenase, a metabolic branch point enzyme in nitrogen utilization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 113
structure length 337
sequence length 337
chains with identical sequence B
ec nomenclature ec 1.1.1.350: Ureidoglycolate dehydrogenase (NAD(+)).
pdb deposition date 2012-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 4h8aA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 4h8aA02
2CWFA 1VBIA 2X06A 4H8AA 1X0AA 1XRHA 2CWHA 4FJSA 2G8YA 1Z2IA 1NXUA 1WTJA 3I0PA 1S20A 4FJUA 3UOEA 1V9NA
chains in the Genus database with same CATH superfamily
2UXDH 3KDGA 2VQFH 4X65H 2CTKA 4JI1H 1XNQH 4GKKH 4AIMA 1N36H 2E3UA 3U1KA 5JEAG 5IWAH 1VIHA 2CTJA 1DTJA 4IFDG 4JI7H 4G08A 3QD7X 4LF6H 1AN7A 4DV2H 2DGRA 4DR5H 2FMRA 4OO1G 3RF2A 2M8WA 2ANNA 2UUCH 2CTMA 2CPMA 4DV6H 2CWFA 2MJHA 3J80W 4X64H 4DR3H 1HNZH 1MSZA 1J5KA 3KDKA 4B8CD 2CPQA 4WANA 2LTMA 2JEBI 1NXUA 4EC5A 1WE8A 4FJUA 1IBLH 4GKJH 1VBIA 2Y3MA 3FAUA 4YY3H 2VQEH 2PY9A 4WALA 4NZTM 4E9JA 4DV4H 1N34H 4DV0H 4JVYA 2BA0A 2OPVA 2QNDA 1PQXA 4NZRM 1KHMA 1ZZKA 4B3RH 2X06A 3JAMW 4DR1H 4LF4H 1ZTGA 1X4NA 2P2RA 4B3MH 4JV5H 2AXYA 2LRRA 1Z2IA 2VKCA 3L7ZC 2UUBH 2F4VH 1X9ZA 2LF0A 4YHHH 1TUAA 4FJSA 5A2QW 1I94H 4LF9H 1ODHA 1WTJA 3GR5A 3OTOH 1J5EH 2ZQEA 4AQYH 4DV1H 1V8CA 3OETA 1IBMH 2JZXA 2FFMA 2UXBH 4BA1I 2UXCH 1EC6A 4JI5H 5LMNH 1HNXH 1N33H 4JVHA 1ZZIA 1IBKH 2PQUA 5FLXW 5LL6b 4DR6H 1XRHA 1UG8A 4B3SH 2D9IA 1DT4A 3T1YH 3I0PA 2A1SA 5IT9W 2OPUA 2YQRA 4JI2H 4DV5H 4JI3H 4BA2I 4KHPH 4NXMH 1FKAH 3T1HH 2G8YA 3V69A 4DUYH 3J81W 4X66H 3UOEA 3SB1A 4LF7H 1FJGH 2CWHA 1X0AA 2UUAH 5K36G 2JA9A 2LTLA 4K0KH 4LIJA 1WHRA 4LFCH 2CTFA 4JI0H 2M6QA 4JI6H 1X4MA 3J7AK 3GABA 1K1GA 2UU9H 1N32H 3GKUA 2ANRA 1V9NA 5C0XG 1F0XA 4LFAH 4JYAH 4B3TH 4H8AA 4LFBH 4DR4H 5DT9A 1WVNA 4B8TA 4JI8H 4DUZH 1ZZJA 4OCHA 4LF8H 2HH3A 2FPHX 4DR2H 1HR0H 2PT7G 1HNWH 3AEVB 2NN6G 2K1HA 1J4WA 2BL5A 1S03G 4OD6A 4DV3H 4DV7H 4DR7H 1SEIA 2E5LH 1XMOH 1XNRH 4AM3A 4PDBA 2JEAI 2HHHH 3EZJA 2HH2A 4OX9H 2Z0SA 3NCVA 5LMUH 1I6UA 5BR8H 2JVZA 4NXNH 2JE6I 3OSSD 4LF5H 1S20A 4X62H 4JI4H 2CTEA 2O4CA 4NBQA 2ZM6H 1XMQH 2CTLA 3VKEA 4QMFB 1VIGA
chains in the Genus database with same CATH topology
2CWFA 1VBIA 2X06A 4H8AA 1X0AA 1XRHA 2CWHA 4FJSA 2G8YA 1Z2IA 1NXUA 1WTJA 3I0PA 1S20A 4FJUA 3UOEA 1V9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWF A;  1VBI A;  2X06 A;  4H8A A;  1X0A A;  1XRH A;  2CWH A;  4FJS A;  2G8Y A;  1Z2I A;  1NXU A;  1WTJ A;  3I0P A;  1S20 A;  4FJU A;  3UOE A;  1V9N A; 
#chains in the Genus database with same CATH topology
 2UXD H;  3KDG A;  2VQF H;  4X65 H;  2CTK A;  4JI1 H;  1XNQ H;  4GKK H;  4AIM A;  1N36 H;  2E3U A;  3U1K A;  5JEA G;  5IWA H;  1VIH A;  2CTJ A;  1DTJ A;  4IFD G;  4JI7 H;  4G08 A;  3QD7 X;  4LF6 H;  1AN7 A;  4DV2 H;  2DGR A;  4DR5 H;  2FMR A;  4OO1 G;  3RF2 A;  2M8W A;  2ANN A;  2UUC H;  2CTM A;  2CPM A;  4DV6 H;  2CWF A;  2MJH A;  3J80 W;  4X64 H;  4DR3 H;  1HNZ H;  1MSZ A;  1J5K A;  3KDK A;  4B8C D;  2CPQ A;  4WAN A;  2LTM A;  2JEB I;  1NXU A;  4EC5 A;  1WE8 A;  4FJU A;  1IBL H;  4GKJ H;  1VBI A;  2Y3M A;  3FAU A;  4YY3 H;  2VQE H;  2PY9 A;  4WAL A;  4NZT M;  4E9J A;  4DV4 H;  1N34 H;  4DV0 H;  4JVY A;  2BA0 A;  2OPV A;  2QND A;  1PQX A;  4NZR M;  1KHM A;  1ZZK A;  4B3R H;  2X06 A;  3JAM W;  4DR1 H;  4LF4 H;  1ZTG A;  1X4N A;  2P2R A;  4B3M H;  4JV5 H;  2AXY A;  2LRR A;  1Z2I A;  2VKC A;  3L7Z C;  2UUB H;  2F4V H;  1X9Z A;  2LF0 A;  4YHH H;  1TUA A;  4FJS A;  5A2Q W;  1I94 H;  4LF9 H;  1ODH A;  1WTJ A;  3GR5 A;  3OTO H;  1J5E H;  2ZQE A;  4AQY H;  4DV1 H;  1V8C A;  3OET A;  1IBM H;  2JZX A;  2FFM A;  2UXB H;  4BA1 I;  2UXC H;  1EC6 A;  4JI5 H;  5LMN H;  1HNX H;  1N33 H;  4JVH A;  1ZZI A;  1IBK H;  2PQU A;  5FLX W;  5LL6 b;  4DR6 H;  1XRH A;  1UG8 A;  4B3S H;  2D9I A;  1DT4 A;  3T1Y H;  3I0P A;  2A1S A;  5IT9 W;  2OPU A;  2YQR A;  4JI2 H;  4DV5 H;  4JI3 H;  4BA2 I;  4KHP H;  4NXM H;  1FKA H;  3T1H H;  2G8Y A;  3V69 A;  4DUY H;  3J81 W;  4X66 H;  3UOE A;  3SB1 A;  4LF7 H;  1FJG H;  2CWH A;  1X0A A;  2UUA H;  5K36 G;  2JA9 A;  2LTL A;  4K0K H;  4LIJ A;  1WHR A;  4LFC H;  2CTF A;  4JI0 H;  2M6Q A;  4JI6 H;  1X4M A;  3J7A K;  3GAB A;  1K1G A;  2UU9 H;  1N32 H;  3GKU A;  2ANR A;  1V9N A;  5C0X G;  1F0X A;  4LFA H;  4JYA H;  4B3T H;  4H8A A;  4LFB H;  4DR4 H;  5DT9 A;  1WVN A;  4B8T A;  4JI8 H;  4DUZ H;  1ZZJ A;  4OCH A;  4LF8 H;  2HH3 A;  2FPH X;  4DR2 H;  1HR0 H;  2PT7 G;  1HNW H;  3AEV B;  2NN6 G;  2K1H A;  1J4W A;  2BL5 A;  1S03 G;  4OD6 A;  4DV3 H;  4DV7 H;  4DR7 H;  1SEI A;  2E5L H;  1XMO H;  1XNR H;  4AM3 A;  4PDB A;  2JEA I;  2HHH H;  3EZJ A;  2HH2 A;  4OX9 H;  2Z0S A;  3NCV A;  5LMU H;  1I6U A;  5BR8 H;  2JVZ A;  4NXN H;  2JE6 I;  3OSS D;  4LF5 H;  1S20 A;  4X62 H;  4JI4 H;  2CTE A;  2O4C A;  4NBQ A;  2ZM6 H;  1XMQ H;  2CTL A;  3VKE A;  4QMF B;  1VIG A; 
#chains in the Genus database with same CATH homology
 2CWF A;  1VBI A;  2X06 A;  4H8A A;  1X0A A;  1XRH A;  2CWH A;  4FJS A;  2G8Y A;  1Z2I A;  1NXU A;  1WTJ A;  3I0P A;  1S20 A;  4FJU A;  3UOE A;  1V9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...