4H8AA

Crystal structure of ureidoglycolate dehydrogenase in binary complex with nadh
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
337
structure length
337
Chain Sequence
MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGFIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGVPTTDPFAVHALLPAAGPKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ureidoglycolate dehydrogenase
publication title Structural and functional insights into (s)-ureidoglycolate dehydrogenase, a metabolic branch point enzyme in nitrogen utilization.
pubmed doi rcsb
source organism Escherichia coli
total genus 113
structure length 337
sequence length 337
chains with identical sequence B
ec nomenclature ec 1.1.1.350: Ureidoglycolate dehydrogenase (NAD(+)).
pdb deposition date 2012-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 4h8aA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 4h8aA02
1S20A 4FJUA 1V9NA 3UOEA 4H8AA 2CWFA 2CWHA 3I0PA 1NXUA 1XRHA 4FJSA 1Z2IA 1VBIA 2G8YA 2X06A 1WTJA 1X0AA
chains in the Genus database with same CATH superfamily
4LF7H 1ZZIA 2LTLA 3OSSD 4B8CD 2UUCH 4YHHH 4LF5H 4JV5H 2X06A 3OETA 2UXCH 4LF4H 4EC5A 1XMQH 2E3UA 3RF2A 3EZJA 2ANNA 2P2RA 3U1KA 2VKCA 5IT9W 3GKUA 4X62H 1X0AA 1F0XA 3J7AK 2K1HA 3J81W 4JI7H 4DR7H 4JVYA 4AQYH 2JZXA 1HNWH 4YY3H 4LF8H 1DTJA 1V8CA 4WALA 1DT4A 4LFAH 1ZTGA 4WANA 3GABA 4PDBA 4X64H 5A2QW 4X66H 2UUAH 4GKKH 1XMOH 3SB1A 4OX9H 2UXBH 3V69A 5LMNH 1K1GA 2LTMA 1ZZJA 2HHHH 4LFBH 4B3TH 1N36H 2HH2A 2CPMA 4IFDG 4B3MH 5LL6b 3AEVB 4QMFB 3T1HH 1WE8A 2NN6G 4JI3H 3FAUA 4E9JA 5FLXW 2BL5A 2G8YA 3QD7X 2CTJA 2AXYA 1VIGA 4DR4H 1V9NA 2E5LH 2CWHA 4JI2H 3NCVA 4JI0H 4X65H 2CTKA 4DR1H 1J5KA 2CTEA 1HR0H 4OD6A 4NXMH 2Z0SA 4DUYH 5C0XG 4DV5H 4DUZH 1UG8A 1N34H 1WTJA 1IBKH 2UXDH 1HNZH 1SEIA 4JI8H 4GKJH 1AN7A 1MSZA 4B8TA 4H8AA 2JA9A 2JE6I 3KDKA 3OTOH 2ZQEA 4DV6H 2FPHX 4DV3H 4LF9H 5DT9A 5BR8H 4DV4H 2MJHA 3L7ZC 4G08A 2PQUA 4DR2H 2UU9H 2FMRA 2CTMA 4KHPH 2VQFH 1J5EH 1WVNA 3GR5A 4FJSA 5K36G 4DV7H 1VBIA 1J4WA 2A1SA 2F4VH 1ODHA 1X9ZA 3T1YH 2JVZA 4B3SH 1XNRH 3UOEA 1S03G 2M6QA 4NXNH 1X4NA 1HNXH 1XRHA 4NZTM 1PQXA 4NZRM 5LMUH 2JEBI 4BA1I 4AM3A 4DR3H 2VQEH 2CTLA 2PT7G 3JAMW 4JYAH 1EC6A 1FJGH 4JI1H 4BA2I 2Y3MA 1IBLH 2M8WA 2UUBH 5JEAG 1X4MA 2CPQA 2CWFA 1ZZKA 4OO1G 1NXUA 4AIMA 1KHMA 2D9IA 2YQRA 2OPVA 1IBMH 2LRRA 4DV2H 1XNQH 1N32H 3J80W 2ANRA 4NBQA 1WHRA 4JI4H 2JEAI 4DV1H 2DGRA 1I94H 4JI6H 4LIJA 2ZM6H 1S20A 2OPUA 4LF6H 2CTFA 4DR5H 1TUAA 1N33H 3I0PA 4DV0H 2O4CA 2QNDA 4B3RH 1FKAH 2FFMA 4LFCH 2BA0A 4JVHA 4FJUA 2LF0A 2HH3A 5IWAH 1I6UA 3KDGA 1VIHA 4OCHA 4JI5H 4K0KH 1Z2IA 4DR6H 2PY9A 3VKEA
chains in the Genus database with same CATH topology
1S20A 4FJUA 1V9NA 3UOEA 4H8AA 2CWFA 2CWHA 3I0PA 1NXUA 1XRHA 4FJSA 1Z2IA 1VBIA 2G8YA 2X06A 1WTJA 1X0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S20 A;  4FJU A;  1V9N A;  3UOE A;  4H8A A;  2CWF A;  2CWH A;  3I0P A;  1NXU A;  1XRH A;  4FJS A;  1Z2I A;  1VBI A;  2G8Y A;  2X06 A;  1WTJ A;  1X0A A; 
#chains in the Genus database with same CATH topology
 4LF7 H;  1ZZI A;  2LTL A;  3OSS D;  4B8C D;  2UUC H;  4YHH H;  4LF5 H;  4JV5 H;  2X06 A;  3OET A;  2UXC H;  4LF4 H;  4EC5 A;  1XMQ H;  2E3U A;  3RF2 A;  3EZJ A;  2ANN A;  2P2R A;  3U1K A;  2VKC A;  5IT9 W;  3GKU A;  4X62 H;  1X0A A;  1F0X A;  3J7A K;  2K1H A;  3J81 W;  4JI7 H;  4DR7 H;  4JVY A;  4AQY H;  2JZX A;  1HNW H;  4YY3 H;  4LF8 H;  1DTJ A;  1V8C A;  4WAL A;  1DT4 A;  4LFA H;  1ZTG A;  4WAN A;  3GAB A;  4PDB A;  4X64 H;  5A2Q W;  4X66 H;  2UUA H;  4GKK H;  1XMO H;  3SB1 A;  4OX9 H;  2UXB H;  3V69 A;  5LMN H;  1K1G A;  2LTM A;  1ZZJ A;  2HHH H;  4LFB H;  4B3T H;  1N36 H;  2HH2 A;  2CPM A;  4IFD G;  4B3M H;  5LL6 b;  3AEV B;  4QMF B;  3T1H H;  1WE8 A;  2NN6 G;  4JI3 H;  3FAU A;  4E9J A;  5FLX W;  2BL5 A;  2G8Y A;  3QD7 X;  2CTJ A;  2AXY A;  1VIG A;  4DR4 H;  1V9N A;  2E5L H;  2CWH A;  4JI2 H;  3NCV A;  4JI0 H;  4X65 H;  2CTK A;  4DR1 H;  1J5K A;  2CTE A;  1HR0 H;  4OD6 A;  4NXM H;  2Z0S A;  4DUY H;  5C0X G;  4DV5 H;  4DUZ H;  1UG8 A;  1N34 H;  1WTJ A;  1IBK H;  2UXD H;  1HNZ H;  1SEI A;  4JI8 H;  4GKJ H;  1AN7 A;  1MSZ A;  4B8T A;  4H8A A;  2JA9 A;  2JE6 I;  3KDK A;  3OTO H;  2ZQE A;  4DV6 H;  2FPH X;  4DV3 H;  4LF9 H;  5DT9 A;  5BR8 H;  4DV4 H;  2MJH A;  3L7Z C;  4G08 A;  2PQU A;  4DR2 H;  2UU9 H;  2FMR A;  2CTM A;  4KHP H;  2VQF H;  1J5E H;  1WVN A;  3GR5 A;  4FJS A;  5K36 G;  4DV7 H;  1VBI A;  1J4W A;  2A1S A;  2F4V H;  1ODH A;  1X9Z A;  3T1Y H;  2JVZ A;  4B3S H;  1XNR H;  3UOE A;  1S03 G;  2M6Q A;  4NXN H;  1X4N A;  1HNX H;  1XRH A;  4NZT M;  1PQX A;  4NZR M;  5LMU H;  2JEB I;  4BA1 I;  4AM3 A;  4DR3 H;  2VQE H;  2CTL A;  2PT7 G;  3JAM W;  4JYA H;  1EC6 A;  1FJG H;  4JI1 H;  4BA2 I;  2Y3M A;  1IBL H;  2M8W A;  2UUB H;  5JEA G;  1X4M A;  2CPQ A;  2CWF A;  1ZZK A;  4OO1 G;  1NXU A;  4AIM A;  1KHM A;  2D9I A;  2YQR A;  2OPV A;  1IBM H;  2LRR A;  4DV2 H;  1XNQ H;  1N32 H;  3J80 W;  2ANR A;  4NBQ A;  1WHR A;  4JI4 H;  2JEA I;  4DV1 H;  2DGR A;  1I94 H;  4JI6 H;  4LIJ A;  2ZM6 H;  1S20 A;  2OPU A;  4LF6 H;  2CTF A;  4DR5 H;  1TUA A;  1N33 H;  3I0P A;  4DV0 H;  2O4C A;  2QND A;  4B3R H;  1FKA H;  2FFM A;  4LFC H;  2BA0 A;  4JVH A;  4FJU A;  2LF0 A;  2HH3 A;  5IWA H;  1I6U A;  3KDG A;  1VIH A;  4OCH A;  4JI5 H;  4K0K H;  1Z2I A;  4DR6 H;  2PY9 A;  3VKE A; 
#chains in the Genus database with same CATH homology
 1S20 A;  4FJU A;  1V9N A;  3UOE A;  4H8A A;  2CWF A;  2CWH A;  3I0P A;  1NXU A;  1XRH A;  4FJS A;  1Z2I A;  1VBI A;  2G8Y A;  2X06 A;  1WTJ A;  1X0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...