4H8AA

Crystal structure of ureidoglycolate dehydrogenase in binary complex with nadh
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
337
structure length
337
Chain Sequence
MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGFIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGVPTTDPFAVHALLPAAGPKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ureidoglycolate dehydrogenase
publication title Structural and functional insights into (s)-ureidoglycolate dehydrogenase, a metabolic branch point enzyme in nitrogen utilization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 113
structure length 337
sequence length 337
chains with identical sequence B
ec nomenclature ec 1.1.1.350: Ureidoglycolate dehydrogenase (NAD(+)).
pdb deposition date 2012-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 4h8aA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 4h8aA02
1WTJA 1VBIA 2CWHA 1S20A 4H8AA 2CWFA 1NXUA 1Z2IA 1XRHA 3I0PA 3UOEA 2X06A 4FJUA 2G8YA 1X0AA 1V9NA 4FJSA
chains in the Genus database with same CATH superfamily
5LMUH 4LFCH 2BL5A 4NZTM 4LFAH 1XNRH 4WANA 2CTFA 1J5KA 4GKKH 2ZM6H 4JVHA 4JI1H 1N34H 4AM3A 3OSSD 1J5EH 1WE8A 5FLXW 2X06A 3SB1A 3OETA 4DR3H 2UXCH 4FJSA 1K1GA 2Z0SA 1S20A 4DV3H 4JI0H 2O4CA 4JI8H 4K0KH 2ANNA 2QNDA 1HNWH 1HNXH 2CTEA 1XMQH 2LRRA 4OO1G 2CPQA 2OPVA 2D9IA 2JE6I 2CTLA 4IFDG 3GKUA 1NXUA 3T1YH 3J7AK 2HH2A 4B3RH 4FJUA 3AEVB 1VIHA 1V8CA 4LF6H 4DR2H 3RF2A 2LTMA 2PQUA 1N33H 1PQXA 5K36G 1I94H 3J81W 4DR5H 4DUZH 4LF9H 4DV2H 4LF5H 1WHRA 2FPHX 3KDKA 2VKCA 1AN7A 3QD7X 4OCHA 4DR4H 5DT9A 2JVZA 1XRHA 4DV4H 4DR1H 1X0AA 4JI7H 2MJHA 2LF0A 1N36H 1WTJA 4DV6H 1X9ZA 3NCVA 1VIGA 4NXNH 4B8TA 1IBLH 1X4MA 2JA9A 2UU9H 2F4VH 2FMRA 2PT7G 3GABA 4BA1I 4B3MH 1J4WA 1MSZA 1X4NA 4JI3H 2HH3A 4GKJH 4WALA 3L7ZC 2OPUA 2CTJA 4NXMH 1XNQH 2JEBI 2ZQEA 4JI2H 2HHHH 4JI4H 3UOEA 3I0PA 1DT4A 4B3SH 2A1SA 3VKEA 3T1HH 4JI6H 4LF8H 4QMFB 1I6UA 3GR5A 2UXDH 4X62H 1SEIA 4OD6A 1ZTGA 2CWHA 4PDBA 3J80W 2BA0A 1KHMA 2UUAH 4LF4H 1EC6A 2G8YA 1ZZJA 4B3TH 4NBQA 2LTLA 4DR6H 2E5LH 2UXBH 4LIJA 2NN6G 2E3UA 3JAMW 1HNZH 2JEAI 1FJGH 3U1KA 1S03G 5C0XG 4AIMA 4JV5H 2DGRA 5A2QW 1DTJA 4KHPH 1VBIA 2VQEH 2JZXA 4H8AA 4E9JA 1F0XA 2CWFA 1Z2IA 4B8CD 2K1HA 4X66H 4DV5H 4JI5H 1XMOH 4LF7H 1N32H 4JYAH 1V9NA 1TUAA 1ZZKA 4AQYH 1ZZIA 1WVNA 1FKAH 3KDGA 4DV1H 3V69A 4DR7H 1UG8A 4NZRM 4DV7H 2M6QA 5LL6b 2VQFH 1IBMH 2AXYA 4X64H 5BR8H 1ODHA 4OX9H 4G08A 2M8WA 4EC5A 5LMNH 2FFMA 4DV0H 2UUBH 2CTKA 2Y3MA 5IT9W 2P2RA 4DUYH 4YHHH 2YQRA 5JEAG 5IWAH 2PY9A 4LFBH 2CPMA 4BA2I 2CTMA 4X65H 4JVYA 3EZJA 2UUCH 3FAUA 1HR0H 2ANRA 1IBKH 4YY3H 3OTOH
chains in the Genus database with same CATH topology
1WTJA 1VBIA 2CWHA 1S20A 4H8AA 2CWFA 1NXUA 1Z2IA 1XRHA 3I0PA 3UOEA 2X06A 4FJUA 2G8YA 1X0AA 1V9NA 4FJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTJ A;  1VBI A;  2CWH A;  1S20 A;  4H8A A;  2CWF A;  1NXU A;  1Z2I A;  1XRH A;  3I0P A;  3UOE A;  2X06 A;  4FJU A;  2G8Y A;  1X0A A;  1V9N A;  4FJS A; 
#chains in the Genus database with same CATH topology
 5LMU H;  4LFC H;  2BL5 A;  4NZT M;  4LFA H;  1XNR H;  4WAN A;  2CTF A;  1J5K A;  4GKK H;  2ZM6 H;  4JVH A;  4JI1 H;  1N34 H;  4AM3 A;  3OSS D;  1J5E H;  1WE8 A;  5FLX W;  2X06 A;  3SB1 A;  3OET A;  4DR3 H;  2UXC H;  4FJS A;  1K1G A;  2Z0S A;  1S20 A;  4DV3 H;  4JI0 H;  2O4C A;  4JI8 H;  4K0K H;  2ANN A;  2QND A;  1HNW H;  1HNX H;  2CTE A;  1XMQ H;  2LRR A;  4OO1 G;  2CPQ A;  2OPV A;  2D9I A;  2JE6 I;  2CTL A;  4IFD G;  3GKU A;  1NXU A;  3T1Y H;  3J7A K;  2HH2 A;  4B3R H;  4FJU A;  3AEV B;  1VIH A;  1V8C A;  4LF6 H;  4DR2 H;  3RF2 A;  2LTM A;  2PQU A;  1N33 H;  1PQX A;  5K36 G;  1I94 H;  3J81 W;  4DR5 H;  4DUZ H;  4LF9 H;  4DV2 H;  4LF5 H;  1WHR A;  2FPH X;  3KDK A;  2VKC A;  1AN7 A;  3QD7 X;  4OCH A;  4DR4 H;  5DT9 A;  2JVZ A;  1XRH A;  4DV4 H;  4DR1 H;  1X0A A;  4JI7 H;  2MJH A;  2LF0 A;  1N36 H;  1WTJ A;  4DV6 H;  1X9Z A;  3NCV A;  1VIG A;  4NXN H;  4B8T A;  1IBL H;  1X4M A;  2JA9 A;  2UU9 H;  2F4V H;  2FMR A;  2PT7 G;  3GAB A;  4BA1 I;  4B3M H;  1J4W A;  1MSZ A;  1X4N A;  4JI3 H;  2HH3 A;  4GKJ H;  4WAL A;  3L7Z C;  2OPU A;  2CTJ A;  4NXM H;  1XNQ H;  2JEB I;  2ZQE A;  4JI2 H;  2HHH H;  4JI4 H;  3UOE A;  3I0P A;  1DT4 A;  4B3S H;  2A1S A;  3VKE A;  3T1H H;  4JI6 H;  4LF8 H;  4QMF B;  1I6U A;  3GR5 A;  2UXD H;  4X62 H;  1SEI A;  4OD6 A;  1ZTG A;  2CWH A;  4PDB A;  3J80 W;  2BA0 A;  1KHM A;  2UUA H;  4LF4 H;  1EC6 A;  2G8Y A;  1ZZJ A;  4B3T H;  4NBQ A;  2LTL A;  4DR6 H;  2E5L H;  2UXB H;  4LIJ A;  2NN6 G;  2E3U A;  3JAM W;  1HNZ H;  2JEA I;  1FJG H;  3U1K A;  1S03 G;  5C0X G;  4AIM A;  4JV5 H;  2DGR A;  5A2Q W;  1DTJ A;  4KHP H;  1VBI A;  2VQE H;  2JZX A;  4H8A A;  4E9J A;  1F0X A;  2CWF A;  1Z2I A;  4B8C D;  2K1H A;  4X66 H;  4DV5 H;  4JI5 H;  1XMO H;  4LF7 H;  1N32 H;  4JYA H;  1V9N A;  1TUA A;  1ZZK A;  4AQY H;  1ZZI A;  1WVN A;  1FKA H;  3KDG A;  4DV1 H;  3V69 A;  4DR7 H;  1UG8 A;  4NZR M;  4DV7 H;  2M6Q A;  5LL6 b;  2VQF H;  1IBM H;  2AXY A;  4X64 H;  5BR8 H;  1ODH A;  4OX9 H;  4G08 A;  2M8W A;  4EC5 A;  5LMN H;  2FFM A;  4DV0 H;  2UUB H;  2CTK A;  2Y3M A;  5IT9 W;  2P2R A;  4DUY H;  4YHH H;  2YQR A;  5JEA G;  5IWA H;  2PY9 A;  4LFB H;  2CPM A;  4BA2 I;  2CTM A;  4X65 H;  4JVY A;  3EZJ A;  2UUC H;  3FAU A;  1HR0 H;  2ANR A;  1IBK H;  4YY3 H;  3OTO H; 
#chains in the Genus database with same CATH homology
 1WTJ A;  1VBI A;  2CWH A;  1S20 A;  4H8A A;  2CWF A;  1NXU A;  1Z2I A;  1XRH A;  3I0P A;  3UOE A;  2X06 A;  4FJU A;  2G8Y A;  1X0A A;  1V9N A;  4FJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...