4JVYA

Structure of the star (signal transduction and activation of rna) domain of gld-1 bound to rna
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
191
structure length
191
Chain Sequence
SHEATVEYLADLVKEKKHLTLFPHMFSNVERLLDDEIGRVRVALFQTEFPRVELPEPAGDMISITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTGCKIMVRGKGSMRDKSKESAHRGKANWEHLEDDLHVLVQCEDTENRVHIKLQAALEQVKKLLIPAPEGTDELKRKQLMELAIINGTYRPMKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function studies of STAR family Quaking proteins bound to their in vivo RNA target sites.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Rna binding protein
molecule keywords Female germline-specific tumor suppressor gld-1
total genus 63
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4jvyA00
2JEAI 4IFDG 1ZZKA 1J5KA 2CTJA 2DGRA 2YQRA 3VKEA 1J4WA 2MJHA 2PY9A 1X4NA 4WANA 2JA9A 4AM3A 1ZZJA 2CPQA 1WVNA 2CTKA 1DTJA 1VIHA 1X4MA 2CTEA 2JVZA 4B8TA 2ANNA 1WE8A 2OPUA 5C0XG 2BA0A 4LIJA 4NBQA 2PQUA 2JEBI 2CTLA 2JZXA 4JVYA 4BA1I 2HH3A 1ZTGA 3U1KA 3AEVB 2OPVA 1ZZIA 2QNDA 2AXYA 1VIGA 2CTFA 4QMFB 2BL5A 1TUAA 4OO1G 5K36G 1KHMA 2P2RA 4BA2I 2NN6G 1EC6A 4WALA 2E3UA 2HH2A 2FMRA 2Z0SA 2JE6I 1K1GA 4JVHA 2CTMA 4AIMA 5JEAG 2ANRA 3V69A 3L7ZC 1DT4A
chains in the Genus database with same CATH superfamily
3GR5A 4DV6H 1ZZKA 4B3RH 1J5KA 3T1YH 1J4WA 2FFMA 1V8CA 2MJHA 1X4NA 2PY9A 4AM3A 1HR0H 4LF7H 1WVNA 1DTJA 4DV0H 2UU9H 4DV7H 2ANNA 2OPUA 5LMUH 2LTMA 5IWAH 2PQUA 3GKUA 3OSSD 4DR4H 2CTLA 3FAUA 3UOEA 3GABA 4FJSA 4X65H 4LF9H 2M6QA 1VBIA 2OPVA 1ZZIA 4NXMH 3JAMW 4DV2H 1VIGA 2A1SA 4LF5H 1TUAA 3KDKA 5K36G 4YY3H 1N36H 2Z0SA 3QD7X 4LF6H 4DV3H 4DR1H 1K1GA 1HNWH 4JV5H 4JVHA 4JI5H 2CWHA 3SB1A 1F0XA 3J7AK 4IFDG 4YHHH 2M8WA 2DGRA 2YQRA 2K1HA 4X64H 2CPQA 2O4CA 3T1HH 2CTKA 5IT9W 4EC5A 5C0XG 4KHPH 2VKCA 3J81W 4G08A 5LMNH 4LFBH 2JEBI 2JZXA 4X66H 1V9NA 1MSZA 4LF4H 4DV1H 4DV4H 4LFCH 2ZQEA 1X0AA 2F4VH 1KHMA 2P2RA 4DR3H 1HNZH 1Z2IA 2HH2A 1SEIA 2FMRA 3KDGA 4DR5H 4JI7H 4JI8H 2CTMA 4FJUA 2VQFH 4NZTM 1IBKH 3V69A 3L7ZC 2UUAH 1DT4A 5FLXW 4DR7H 1XMOH 2JEAI 2G8YA 4OCHA 1XNRH 2CTJA 2X06A 5A2QW 4NZRM 2JA9A 1IBMH 2UXCH 4K0KH 5BR8H 1ODHA 2CTEA 2CWFA 2JVZA 4E9JA 4DUYH 2UXDH 2BA0A 2CPMA 4LIJA 5LL6b 4PDBA 4OD6A 1HNXH 4AQYH 2UXBH 4BA1I 4DR2H 1XNQH 4JI4H 2FPHX 3U1KA 2QNDA 3NCVA 1S20A 4DV5H 2CTFA 2E5LH 1FKAH 4LFAH 4GKKH 4B3TH 4OO1G 4B3SH 4BA2I 2E3UA 2JE6I 1J5EH 5DT9A 1N34H 4B3MH 2D9IA 2UUBH 1I6UA 4GKJH 1UG8A 4JI0H 3VKEA 4WANA 4JI3H 2LRRA 2LF0A 1ZZJA 4H8AA 4JI1H 1VIHA 1WTJA 1X4MA 1AN7A 2PT7G 4B8TA 1WE8A 2HHHH 1N32H 4LF8H 1FJGH 4JI6H 2LTLA 4NBQA 4JI2H 4JVYA 1IBLH 2UUCH 2HH3A 1ZTGA 3EZJA 3J80W 3AEVB 1N33H 2AXYA 4OX9H 4B8CD 3OTOH 4QMFB 2BL5A 1X9ZA 3RF2A 4DUZH 1S03G 2ZM6H 4DR6H 1EC6A 2NN6G 1PQXA 1XRHA 4WALA 4JYAH 3OETA 1WHRA 4X62H 3I0PA 1XMQH 1I94H 4NXNH 4AIMA 5JEAG 2ANRA 1NXUA 2VQEH 2Y3MA
chains in the Genus database with same CATH topology
2JEAI 4IFDG 1ZZKA 1J5KA 2CTJA 2DGRA 2YQRA 3VKEA 1J4WA 2MJHA 2PY9A 1X4NA 4WANA 2JA9A 4AM3A 1ZZJA 2CPQA 1WVNA 2CTKA 1DTJA 1VIHA 1X4MA 2CTEA 2JVZA 4B8TA 2ANNA 1WE8A 2OPUA 5C0XG 2BA0A 4LIJA 4NBQA 2PQUA 2JEBI 2CTLA 2JZXA 4JVYA 4BA1I 2HH3A 1ZTGA 3U1KA 3AEVB 2OPVA 1ZZIA 2QNDA 2AXYA 1VIGA 2CTFA 4QMFB 2BL5A 1TUAA 4OO1G 5K36G 1KHMA 2P2RA 4BA2I 2NN6G 1EC6A 4WALA 2E3UA 2HH2A 2FMRA 2Z0SA 2JE6I 1K1GA 4JVHA 2CTMA 4AIMA 5JEAG 2ANRA 3V69A 3L7ZC 1DT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEA I;  4IFD G;  1ZZK A;  1J5K A;  2CTJ A;  2DGR A;  2YQR A;  3VKE A;  1J4W A;  2MJH A;  2PY9 A;  1X4N A;  4WAN A;  2JA9 A;  4AM3 A;  1ZZJ A;  2CPQ A;  1WVN A;  2CTK A;  1DTJ A;  1VIH A;  1X4M A;  2CTE A;  2JVZ A;  4B8T A;  2ANN A;  1WE8 A;  2OPU A;  5C0X G;  2BA0 A;  4LIJ A;  4NBQ A;  2PQU A;  2JEB I;  2CTL A;  2JZX A;  4JVY A;  4BA1 I;  2HH3 A;  1ZTG A;  3U1K A;  3AEV B;  2OPV A;  1ZZI A;  2QND A;  2AXY A;  1VIG A;  2CTF A;  4QMF B;  2BL5 A;  1TUA A;  4OO1 G;  5K36 G;  1KHM A;  2P2R A;  4BA2 I;  2NN6 G;  1EC6 A;  4WAL A;  2E3U A;  2HH2 A;  2FMR A;  2Z0S A;  2JE6 I;  1K1G A;  4JVH A;  2CTM A;  4AIM A;  5JEA G;  2ANR A;  3V69 A;  3L7Z C;  1DT4 A; 
#chains in the Genus database with same CATH topology
 3GR5 A;  4DV6 H;  1ZZK A;  4B3R H;  1J5K A;  3T1Y H;  1J4W A;  2FFM A;  1V8C A;  2MJH A;  1X4N A;  2PY9 A;  4AM3 A;  1HR0 H;  4LF7 H;  1WVN A;  1DTJ A;  4DV0 H;  2UU9 H;  4DV7 H;  2ANN A;  2OPU A;  5LMU H;  2LTM A;  5IWA H;  2PQU A;  3GKU A;  3OSS D;  4DR4 H;  2CTL A;  3FAU A;  3UOE A;  3GAB A;  4FJS A;  4X65 H;  4LF9 H;  2M6Q A;  1VBI A;  2OPV A;  1ZZI A;  4NXM H;  3JAM W;  4DV2 H;  1VIG A;  2A1S A;  4LF5 H;  1TUA A;  3KDK A;  5K36 G;  4YY3 H;  1N36 H;  2Z0S A;  3QD7 X;  4LF6 H;  4DV3 H;  4DR1 H;  1K1G A;  1HNW H;  4JV5 H;  4JVH A;  4JI5 H;  2CWH A;  3SB1 A;  1F0X A;  3J7A K;  4IFD G;  4YHH H;  2M8W A;  2DGR A;  2YQR A;  2K1H A;  4X64 H;  2CPQ A;  2O4C A;  3T1H H;  2CTK A;  5IT9 W;  4EC5 A;  5C0X G;  4KHP H;  2VKC A;  3J81 W;  4G08 A;  5LMN H;  4LFB H;  2JEB I;  2JZX A;  4X66 H;  1V9N A;  1MSZ A;  4LF4 H;  4DV1 H;  4DV4 H;  4LFC H;  2ZQE A;  1X0A A;  2F4V H;  1KHM A;  2P2R A;  4DR3 H;  1HNZ H;  1Z2I A;  2HH2 A;  1SEI A;  2FMR A;  3KDG A;  4DR5 H;  4JI7 H;  4JI8 H;  2CTM A;  4FJU A;  2VQF H;  4NZT M;  1IBK H;  3V69 A;  3L7Z C;  2UUA H;  1DT4 A;  5FLX W;  4DR7 H;  1XMO H;  2JEA I;  2G8Y A;  4OCH A;  1XNR H;  2CTJ A;  2X06 A;  5A2Q W;  4NZR M;  2JA9 A;  1IBM H;  2UXC H;  4K0K H;  5BR8 H;  1ODH A;  2CTE A;  2CWF A;  2JVZ A;  4E9J A;  4DUY H;  2UXD H;  2BA0 A;  2CPM A;  4LIJ A;  5LL6 b;  4PDB A;  4OD6 A;  1HNX H;  4AQY H;  2UXB H;  4BA1 I;  4DR2 H;  1XNQ H;  4JI4 H;  2FPH X;  3U1K A;  2QND A;  3NCV A;  1S20 A;  4DV5 H;  2CTF A;  2E5L H;  1FKA H;  4LFA H;  4GKK H;  4B3T H;  4OO1 G;  4B3S H;  4BA2 I;  2E3U A;  2JE6 I;  1J5E H;  5DT9 A;  1N34 H;  4B3M H;  2D9I A;  2UUB H;  1I6U A;  4GKJ H;  1UG8 A;  4JI0 H;  3VKE A;  4WAN A;  4JI3 H;  2LRR A;  2LF0 A;  1ZZJ A;  4H8A A;  4JI1 H;  1VIH A;  1WTJ A;  1X4M A;  1AN7 A;  2PT7 G;  4B8T A;  1WE8 A;  2HHH H;  1N32 H;  4LF8 H;  1FJG H;  4JI6 H;  2LTL A;  4NBQ A;  4JI2 H;  4JVY A;  1IBL H;  2UUC H;  2HH3 A;  1ZTG A;  3EZJ A;  3J80 W;  3AEV B;  1N33 H;  2AXY A;  4OX9 H;  4B8C D;  3OTO H;  4QMF B;  2BL5 A;  1X9Z A;  3RF2 A;  4DUZ H;  1S03 G;  2ZM6 H;  4DR6 H;  1EC6 A;  2NN6 G;  1PQX A;  1XRH A;  4WAL A;  4JYA H;  3OET A;  1WHR A;  4X62 H;  3I0P A;  1XMQ H;  1I94 H;  4NXN H;  4AIM A;  5JEA G;  2ANR A;  1NXU A;  2VQE H;  2Y3M A; 
#chains in the Genus database with same CATH homology
 2JEA I;  4IFD G;  1ZZK A;  1J5K A;  2CTJ A;  2DGR A;  2YQR A;  3VKE A;  1J4W A;  2MJH A;  2PY9 A;  1X4N A;  4WAN A;  2JA9 A;  4AM3 A;  1ZZJ A;  2CPQ A;  1WVN A;  2CTK A;  1DTJ A;  1VIH A;  1X4M A;  2CTE A;  2JVZ A;  4B8T A;  2ANN A;  1WE8 A;  2OPU A;  5C0X G;  2BA0 A;  4LIJ A;  4NBQ A;  2PQU A;  2JEB I;  2CTL A;  2JZX A;  4JVY A;  4BA1 I;  2HH3 A;  1ZTG A;  3U1K A;  3AEV B;  2OPV A;  1ZZI A;  2QND A;  2AXY A;  1VIG A;  2CTF A;  4QMF B;  2BL5 A;  1TUA A;  4OO1 G;  5K36 G;  1KHM A;  2P2R A;  4BA2 I;  2NN6 G;  1EC6 A;  4WAL A;  2E3U A;  2HH2 A;  2FMR A;  2Z0S A;  2JE6 I;  1K1G A;  4JVH A;  2CTM A;  4AIM A;  5JEA G;  2ANR A;  3V69 A;  3L7Z C;  1DT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...