4JVYA

Structure of the star (signal transduction and activation of rna) domain of gld-1 bound to rna
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
191
structure length
191
Chain Sequence
b'SHEATVEYLADLVKEKKHLTLFPHMFSNVERLLDDEIGRVRVALFQTEFPRVELPEPAGDMISITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTGCKIMVRGKGSMRDKSKESAHRGKANWEHLEDDLHVLVQCEDTENRVHIKLQAALEQVKKLLIPAPEGTDELKRKQLMELAIINGTYRPMKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Female germline-specific tumor suppressor gld-1
publication title Structure-function studies of STAR family Quaking proteins bound to their in vivo RNA target sites.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Rna binding protein
total genus 63
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4jvyA00
3U1KA 1ZZIA 2DGRA 2P2RA 4NBQA 2JEAI 2QNDA 5JEAG 4JVHA 4JVYA 4WANA 4BA2I 2CTJA 1WVNA 2HH2A 2JA9A 2OPVA 2AXYA 4BA1I 1ZZKA 2E3UA 2Z0SA 1WE8A 2CTLA 2JE6I 4LIJA 2PQUA 2CTEA 4OO1G 1X4NA 2JVZA 4AIMA 1EC6A 5K36G 2FMRA 2BA0A 2CPQA 1J4WA 4IFDG 2JEBI 1X4MA 1ZTGA 2MJHA 4QMFB 1VIHA 2BL5A 1ZZJA 3VKEA 1K1GA 1VIGA 2ANNA 2PY9A 1KHMA 5C0XG 1DT4A 2CTKA 2OPUA 2YQRA 3V69A 4B8TA 1J5KA 2HH3A 2ANRA 1DTJA 4WALA 3AEVB 2CTMA 4AM3A 2JZXA 2CTFA 1TUAA 3L7ZC 2NN6G
chains in the Genus database with same CATH superfamily
4YY3H 4DR3H 1NXUA 1XNQH 2G8YA 1ODHA 2F4VH 1XRHA 2FFMA 1X0AA 4DV4H 2UXBH 2JA9A 4DR2H 2ZQEA 3NCVA 3SB1A 2CTEA 4LF5H 4AIMA 2FMRA 2O4CA 4OD6A 3GKUA 4IFDG 4JI0H 1Z2IA 2Y3MA 1SEIA 2M8WA 1X4MA 2UUBH 1VIHA 4DV1H 2FPHX 4OCHA 1VIGA 1N34H 2PY9A 4YHHH 5LMUH 2VQFH 4NZTM 3JAMW 5LL6b 2PT7G 1S20A 2HH3A 4WALA 2UXDH 5IT9W 4X64H 1I94H 1S03G 1TUAA 3T1YH 4GKJH 4JV5H 4JI1H 1I6UA 4EC5A 1N36H 3U1KA 4AQYH 4JI5H 2LF0A 3UOEA 4DR5H 4NBQA 4JI8H 4JYAH 2JEAI 5JEAG 2D9IA 4OX9H 4JVYA 2CTJA 4LF9H 4LF8H 2E3UA 4B8CD 1WE8A 4JI7H 2JE6I 1WTJA 4OO1G 3T1HH 1UG8A 1X4NA 4GKKH 1V8CA 4DV7H 2UUAH 4G08A 1J4WA 2UU9H 1HR0H 4LFBH 3FAUA 4NXNH 1N33H 2E5LH 4QMFB 2CWHA 2ANNA 4DUYH 3OTOH 4LFCH 4X65H 5C0XG 4K0KH 1N32H 2CTKA 2M6QA 3EZJA 2LTLA 1AN7A 3V69A 1J5KA 3KDGA 3AEVB 1DTJA 1FJGH 2CTMA 4JI3H 3J81W 3L7ZC 4DR6H 3J7AK 2LTMA 2ZM6H 3GABA 1FKAH 4KHPH 2DGRA 4DV6H 2P2RA 1XMQH 1PQXA 2QNDA 3KDKA 4BA2I 3OETA 2HH2A 2AXYA 2OPVA 4DUZH 4BA1I 1ZZKA 2Z0SA 1HNZH 3GR5A 2CTLA 4JI4H 2UXCH 2PQUA 4PDBA 4FJSA 5IWAH 1IBMH 2BA0A 1HNXH 4FJUA 2CPQA 4X66H 4B3TH 4JI6H 5FLXW 1ZTGA 4E9JA 2MJHA 2VQEH 4DR7H 2BL5A 1K1GA 3VKEA 3J80W 1KHMA 4B3MH 1MSZA 4X62H 4DV3H 1F0XA 2OPUA 4LF4H 2YQRA 4LFAH 4B8TA 1HNWH 1XMOH 1X9ZA 4AM3A 2X06A 2NN6G 1VBIA 1ZZIA 1J5EH 4H8AA 2K1HA 2LRRA 5DT9A 4JVHA 4WANA 4B3RH 1WVNA 2VKCA 4JI2H 2HHHH 2CPMA 4LIJA 4DV0H 4DV2H 2JVZA 1EC6A 2UUCH 2CWFA 1XNRH 4DR4H 4LF6H 4B3SH 5K36G 1IBKH 1WHRA 4NZRM 4LF7H 2JEBI 4DV5H 4NXMH 1ZZJA 5BR8H 3QD7X 1V9NA 5A2QW 2A1SA 4DR1H 1DT4A 3OSSD 2ANRA 5LMNH 1IBLH 3RF2A 2JZXA 2CTFA 3I0PA
chains in the Genus database with same CATH topology
3U1KA 1ZZIA 2DGRA 2P2RA 4NBQA 2JEAI 2QNDA 5JEAG 4JVHA 4JVYA 4WANA 4BA2I 2CTJA 1WVNA 2HH2A 2JA9A 2OPVA 2AXYA 4BA1I 1ZZKA 2E3UA 2Z0SA 1WE8A 2CTLA 2JE6I 4LIJA 2PQUA 2CTEA 4OO1G 1X4NA 2JVZA 4AIMA 1EC6A 5K36G 2FMRA 2BA0A 2CPQA 1J4WA 4IFDG 2JEBI 1X4MA 1ZTGA 2MJHA 4QMFB 1VIHA 2BL5A 1ZZJA 3VKEA 1K1GA 1VIGA 2ANNA 2PY9A 1KHMA 5C0XG 1DT4A 2CTKA 2OPUA 2YQRA 3V69A 4B8TA 1J5KA 2HH3A 2ANRA 1DTJA 4WALA 3AEVB 2CTMA 4AM3A 2JZXA 2CTFA 1TUAA 3L7ZC 2NN6G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1K A;  1ZZI A;  2DGR A;  2P2R A;  4NBQ A;  2JEA I;  2QND A;  5JEA G;  4JVH A;  4JVY A;  4WAN A;  4BA2 I;  2CTJ A;  1WVN A;  2HH2 A;  2JA9 A;  2OPV A;  2AXY A;  4BA1 I;  1ZZK A;  2E3U A;  2Z0S A;  1WE8 A;  2CTL A;  2JE6 I;  4LIJ A;  2PQU A;  2CTE A;  4OO1 G;  1X4N A;  2JVZ A;  4AIM A;  1EC6 A;  5K36 G;  2FMR A;  2BA0 A;  2CPQ A;  1J4W A;  4IFD G;  2JEB I;  1X4M A;  1ZTG A;  2MJH A;  4QMF B;  1VIH A;  2BL5 A;  1ZZJ A;  3VKE A;  1K1G A;  1VIG A;  2ANN A;  2PY9 A;  1KHM A;  5C0X G;  1DT4 A;  2CTK A;  2OPU A;  2YQR A;  3V69 A;  4B8T A;  1J5K A;  2HH3 A;  2ANR A;  1DTJ A;  4WAL A;  3AEV B;  2CTM A;  4AM3 A;  2JZX A;  2CTF A;  1TUA A;  3L7Z C;  2NN6 G; 
#chains in the Genus database with same CATH topology
 4YY3 H;  4DR3 H;  1NXU A;  1XNQ H;  2G8Y A;  1ODH A;  2F4V H;  1XRH A;  2FFM A;  1X0A A;  4DV4 H;  2UXB H;  2JA9 A;  4DR2 H;  2ZQE A;  3NCV A;  3SB1 A;  2CTE A;  4LF5 H;  4AIM A;  2FMR A;  2O4C A;  4OD6 A;  3GKU A;  4IFD G;  4JI0 H;  1Z2I A;  2Y3M A;  1SEI A;  2M8W A;  1X4M A;  2UUB H;  1VIH A;  4DV1 H;  2FPH X;  4OCH A;  1VIG A;  1N34 H;  2PY9 A;  4YHH H;  5LMU H;  2VQF H;  4NZT M;  3JAM W;  5LL6 b;  2PT7 G;  1S20 A;  2HH3 A;  4WAL A;  2UXD H;  5IT9 W;  4X64 H;  1I94 H;  1S03 G;  1TUA A;  3T1Y H;  4GKJ H;  4JV5 H;  4JI1 H;  1I6U A;  4EC5 A;  1N36 H;  3U1K A;  4AQY H;  4JI5 H;  2LF0 A;  3UOE A;  4DR5 H;  4NBQ A;  4JI8 H;  4JYA H;  2JEA I;  5JEA G;  2D9I A;  4OX9 H;  4JVY A;  2CTJ A;  4LF9 H;  4LF8 H;  2E3U A;  4B8C D;  1WE8 A;  4JI7 H;  2JE6 I;  1WTJ A;  4OO1 G;  3T1H H;  1UG8 A;  1X4N A;  4GKK H;  1V8C A;  4DV7 H;  2UUA H;  4G08 A;  1J4W A;  2UU9 H;  1HR0 H;  4LFB H;  3FAU A;  4NXN H;  1N33 H;  2E5L H;  4QMF B;  2CWH A;  2ANN A;  4DUY H;  3OTO H;  4LFC H;  4X65 H;  5C0X G;  4K0K H;  1N32 H;  2CTK A;  2M6Q A;  3EZJ A;  2LTL A;  1AN7 A;  3V69 A;  1J5K A;  3KDG A;  3AEV B;  1DTJ A;  1FJG H;  2CTM A;  4JI3 H;  3J81 W;  3L7Z C;  4DR6 H;  3J7A K;  2LTM A;  2ZM6 H;  3GAB A;  1FKA H;  4KHP H;  2DGR A;  4DV6 H;  2P2R A;  1XMQ H;  1PQX A;  2QND A;  3KDK A;  4BA2 I;  3OET A;  2HH2 A;  2AXY A;  2OPV A;  4DUZ H;  4BA1 I;  1ZZK A;  2Z0S A;  1HNZ H;  3GR5 A;  2CTL A;  4JI4 H;  2UXC H;  2PQU A;  4PDB A;  4FJS A;  5IWA H;  1IBM H;  2BA0 A;  1HNX H;  4FJU A;  2CPQ A;  4X66 H;  4B3T H;  4JI6 H;  5FLX W;  1ZTG A;  4E9J A;  2MJH A;  2VQE H;  4DR7 H;  2BL5 A;  1K1G A;  3VKE A;  3J80 W;  1KHM A;  4B3M H;  1MSZ A;  4X62 H;  4DV3 H;  1F0X A;  2OPU A;  4LF4 H;  2YQR A;  4LFA H;  4B8T A;  1HNW H;  1XMO H;  1X9Z A;  4AM3 A;  2X06 A;  2NN6 G;  1VBI A;  1ZZI A;  1J5E H;  4H8A A;  2K1H A;  2LRR A;  5DT9 A;  4JVH A;  4WAN A;  4B3R H;  1WVN A;  2VKC A;  4JI2 H;  2HHH H;  2CPM A;  4LIJ A;  4DV0 H;  4DV2 H;  2JVZ A;  1EC6 A;  2UUC H;  2CWF A;  1XNR H;  4DR4 H;  4LF6 H;  4B3S H;  5K36 G;  1IBK H;  1WHR A;  4NZR M;  4LF7 H;  2JEB I;  4DV5 H;  4NXM H;  1ZZJ A;  5BR8 H;  3QD7 X;  1V9N A;  5A2Q W;  2A1S A;  4DR1 H;  1DT4 A;  3OSS D;  2ANR A;  5LMN H;  1IBL H;  3RF2 A;  2JZX A;  2CTF A;  3I0P A; 
#chains in the Genus database with same CATH homology
 3U1K A;  1ZZI A;  2DGR A;  2P2R A;  4NBQ A;  2JEA I;  2QND A;  5JEA G;  4JVH A;  4JVY A;  4WAN A;  4BA2 I;  2CTJ A;  1WVN A;  2HH2 A;  2JA9 A;  2OPV A;  2AXY A;  4BA1 I;  1ZZK A;  2E3U A;  2Z0S A;  1WE8 A;  2CTL A;  2JE6 I;  4LIJ A;  2PQU A;  2CTE A;  4OO1 G;  1X4N A;  2JVZ A;  4AIM A;  1EC6 A;  5K36 G;  2FMR A;  2BA0 A;  2CPQ A;  1J4W A;  4IFD G;  2JEB I;  1X4M A;  1ZTG A;  2MJH A;  4QMF B;  1VIH A;  2BL5 A;  1ZZJ A;  3VKE A;  1K1G A;  1VIG A;  2ANN A;  2PY9 A;  1KHM A;  5C0X G;  1DT4 A;  2CTK A;  2OPU A;  2YQR A;  3V69 A;  4B8T A;  1J5K A;  2HH3 A;  2ANR A;  1DTJ A;  4WAL A;  3AEV B;  2CTM A;  4AM3 A;  2JZX A;  2CTF A;  1TUA A;  3L7Z C;  2NN6 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...