4JVYA

Structure of the star (signal transduction and activation of rna) domain of gld-1 bound to rna
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
191
structure length
191
Chain Sequence
SHEATVEYLADLVKEKKHLTLFPHMFSNVERLLDDEIGRVRVALFQTEFPRVELPEPAGDMISITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTGCKIMVRGKGSMRDKSKESAHRGKANWEHLEDDLHVLVQCEDTENRVHIKLQAALEQVKKLLIPAPEGTDELKRKQLMELAIINGTYRPMKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Female germline-specific tumor suppressor gld-1
publication title Structure-function studies of STAR family Quaking proteins bound to their in vivo RNA target sites.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Rna binding protein
total genus 63
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4jvyA00
5K36G 1ZZJA 1ZZKA 4LIJA 2AXYA 2CTKA 2JVZA 2ANRA 2JE6I 1VIHA 4AIMA 4BA2I 2JA9A 2OPVA 1K1GA 1WE8A 1DTJA 2JEAI 2OPUA 4JVHA 1VIGA 2HH2A 1J5KA 1TUAA 4IFDG 2HH3A 4B8TA 1ZTGA 4WANA 2CTJA 1X4MA 2CTMA 1J4WA 2CTEA 4NBQA 4QMFB 2ANNA 2BA0A 4WALA 1ZZIA 5JEAG 2P2RA 4OO1G 3V69A 3U1KA 2JEBI 2PY9A 1X4NA 5C0XG 1KHMA 2QNDA 3L7ZC 2Z0SA 2PQUA 1DT4A 1WVNA 2NN6G 4BA1I 2MJHA 2FMRA 1EC6A 3VKEA 2CPQA 2JZXA 2CTLA 2E3UA 3AEVB 4AM3A 4JVYA 2YQRA 2CTFA 2DGRA 2BL5A
chains in the Genus database with same CATH superfamily
1ZZJA 3T1YH 2LTLA 4FJSA 4EC5A 1VBIA 4DR6H 1XNRH 2HHHH 2X06A 4DV6H 4BA2I 1S20A 2JA9A 2VKCA 1DTJA 2JEAI 2OPUA 4JVHA 5FLXW 2UU9H 4GKKH 2CPMA 5LMNH 4K0KH 3GABA 1N33H 4YY3H 4B8TA 1FJGH 4WANA 2K1HA 4X65H 1Z2IA 2CTEA 2FPHX 4WALA 1ZZIA 4AQYH 2ZM6H 4OO1G 4NZRM 3U1KA 3QD7X 3V69A 1N36H 5A2QW 1FKAH 3SB1A 1KHMA 4OX9H 4G08A 4OD6A 1SEIA 2NN6G 3FAUA 3KDKA 1XRHA 2VQFH 4DR4H 2F4VH 2FMRA 1I94H 2UUAH 4B8CD 4DV7H 4DV2H 1XMQH 4AM3A 4B3RH 4JV5H 4X64H 1PQXA 2PT7G 2FFMA 1ZZKA 4LIJA 3J81W 5LL6b 2A1SA 4E9JA 4AIMA 4DV1H 1WE8A 1HR0H 4YHHH 1HNXH 1VIGA 2HH2A 4LF6H 2CWHA 1S03G 2ANNA 4QMFB 4JI7H 5JEAG 2E5LH 4H8AA 2G8YA 4LF5H 2JEBI 4LFAH 1X4NA 4DV0H 5C0XG 5LMUH 3L7ZC 4NXNH 3T1HH 3JAMW 2Z0SA 2PQUA 5DT9A 2VQEH 1WTJA 2CWFA 4JI2H 2CPQA 1HNZH 4LF4H 1XNQH 2JZXA 2CTLA 2E3UA 5BR8H 4JVYA 2YQRA 1IBMH 1UG8A 4B3MH 4B3SH 3GKUA 2AXYA 2UUBH 4DV4H 2CTKA 2UUCH 2JE6I 1VIHA 4LF7H 4NXMH 2OPVA 1N32H 4LFBH 4DR3H 4IFDG 1I6UA 4JI4H 1MSZA 1ZTGA 4JI3H 2D9IA 1IBKH 1X4MA 4OCHA 4DR1H 2M8WA 1J4WA 4JI0H 5IT9W 2PY9A 2LTMA 1ODHA 4PDBA 1X0AA 4FJUA 2QNDA 2UXDH 3UOEA 1WVNA 4BA1I 3J80W 2LRRA 2O4CA 4KHPH 2M6QA 1WHRA 4JI8H 3AEVB 1X9ZA 1V9NA 3NCVA 2DGRA 4DR2H 2ZQEA 2BL5A 4JI5H 3J7AK 5K36G 1NXUA 2ANRA 2JVZA 1F0XA 4DV3H 4X66H 4JI1H 1K1GA 3KDGA 3EZJA 4NZTM 4LF8H 4DR5H 1XMOH 1J5KA 4DUYH 1TUAA 2UXCH 4JI6H 2HH3A 3OTOH 2CTJA 2CTMA 4B3TH 4NBQA 2BA0A 3GR5A 3I0PA 2P2RA 4DR7H 1IBLH 2UXBH 1HNWH 1N34H 4GKJH 1AN7A 3RF2A 4LFCH 1DT4A 1J5EH 2MJHA 2LF0A 4DV5H 4X62H 1V8CA 1EC6A 3VKEA 4JYAH 2Y3MA 5IWAH 3OSSD 4LF9H 2CTFA 3OETA 4DUZH
chains in the Genus database with same CATH topology
5K36G 1ZZJA 1ZZKA 4LIJA 2AXYA 2CTKA 2JVZA 2ANRA 2JE6I 1VIHA 4AIMA 4BA2I 2JA9A 2OPVA 1K1GA 1WE8A 1DTJA 2JEAI 2OPUA 4JVHA 1VIGA 2HH2A 1J5KA 1TUAA 4IFDG 2HH3A 4B8TA 1ZTGA 4WANA 2CTJA 1X4MA 2CTMA 1J4WA 2CTEA 4NBQA 4QMFB 2ANNA 2BA0A 4WALA 1ZZIA 5JEAG 2P2RA 4OO1G 3V69A 3U1KA 2JEBI 2PY9A 1X4NA 5C0XG 1KHMA 2QNDA 3L7ZC 2Z0SA 2PQUA 1DT4A 1WVNA 2NN6G 4BA1I 2MJHA 2FMRA 1EC6A 3VKEA 2CPQA 2JZXA 2CTLA 2E3UA 3AEVB 4AM3A 4JVYA 2YQRA 2CTFA 2DGRA 2BL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K36 G;  1ZZJ A;  1ZZK A;  4LIJ A;  2AXY A;  2CTK A;  2JVZ A;  2ANR A;  2JE6 I;  1VIH A;  4AIM A;  4BA2 I;  2JA9 A;  2OPV A;  1K1G A;  1WE8 A;  1DTJ A;  2JEA I;  2OPU A;  4JVH A;  1VIG A;  2HH2 A;  1J5K A;  1TUA A;  4IFD G;  2HH3 A;  4B8T A;  1ZTG A;  4WAN A;  2CTJ A;  1X4M A;  2CTM A;  1J4W A;  2CTE A;  4NBQ A;  4QMF B;  2ANN A;  2BA0 A;  4WAL A;  1ZZI A;  5JEA G;  2P2R A;  4OO1 G;  3V69 A;  3U1K A;  2JEB I;  2PY9 A;  1X4N A;  5C0X G;  1KHM A;  2QND A;  3L7Z C;  2Z0S A;  2PQU A;  1DT4 A;  1WVN A;  2NN6 G;  4BA1 I;  2MJH A;  2FMR A;  1EC6 A;  3VKE A;  2CPQ A;  2JZX A;  2CTL A;  2E3U A;  3AEV B;  4AM3 A;  4JVY A;  2YQR A;  2CTF A;  2DGR A;  2BL5 A; 
#chains in the Genus database with same CATH topology
 1ZZJ A;  3T1Y H;  2LTL A;  4FJS A;  4EC5 A;  1VBI A;  4DR6 H;  1XNR H;  2HHH H;  2X06 A;  4DV6 H;  4BA2 I;  1S20 A;  2JA9 A;  2VKC A;  1DTJ A;  2JEA I;  2OPU A;  4JVH A;  5FLX W;  2UU9 H;  4GKK H;  2CPM A;  5LMN H;  4K0K H;  3GAB A;  1N33 H;  4YY3 H;  4B8T A;  1FJG H;  4WAN A;  2K1H A;  4X65 H;  1Z2I A;  2CTE A;  2FPH X;  4WAL A;  1ZZI A;  4AQY H;  2ZM6 H;  4OO1 G;  4NZR M;  3U1K A;  3QD7 X;  3V69 A;  1N36 H;  5A2Q W;  1FKA H;  3SB1 A;  1KHM A;  4OX9 H;  4G08 A;  4OD6 A;  1SEI A;  2NN6 G;  3FAU A;  3KDK A;  1XRH A;  2VQF H;  4DR4 H;  2F4V H;  2FMR A;  1I94 H;  2UUA H;  4B8C D;  4DV7 H;  4DV2 H;  1XMQ H;  4AM3 A;  4B3R H;  4JV5 H;  4X64 H;  1PQX A;  2PT7 G;  2FFM A;  1ZZK A;  4LIJ A;  3J81 W;  5LL6 b;  2A1S A;  4E9J A;  4AIM A;  4DV1 H;  1WE8 A;  1HR0 H;  4YHH H;  1HNX H;  1VIG A;  2HH2 A;  4LF6 H;  2CWH A;  1S03 G;  2ANN A;  4QMF B;  4JI7 H;  5JEA G;  2E5L H;  4H8A A;  2G8Y A;  4LF5 H;  2JEB I;  4LFA H;  1X4N A;  4DV0 H;  5C0X G;  5LMU H;  3L7Z C;  4NXN H;  3T1H H;  3JAM W;  2Z0S A;  2PQU A;  5DT9 A;  2VQE H;  1WTJ A;  2CWF A;  4JI2 H;  2CPQ A;  1HNZ H;  4LF4 H;  1XNQ H;  2JZX A;  2CTL A;  2E3U A;  5BR8 H;  4JVY A;  2YQR A;  1IBM H;  1UG8 A;  4B3M H;  4B3S H;  3GKU A;  2AXY A;  2UUB H;  4DV4 H;  2CTK A;  2UUC H;  2JE6 I;  1VIH A;  4LF7 H;  4NXM H;  2OPV A;  1N32 H;  4LFB H;  4DR3 H;  4IFD G;  1I6U A;  4JI4 H;  1MSZ A;  1ZTG A;  4JI3 H;  2D9I A;  1IBK H;  1X4M A;  4OCH A;  4DR1 H;  2M8W A;  1J4W A;  4JI0 H;  5IT9 W;  2PY9 A;  2LTM A;  1ODH A;  4PDB A;  1X0A A;  4FJU A;  2QND A;  2UXD H;  3UOE A;  1WVN A;  4BA1 I;  3J80 W;  2LRR A;  2O4C A;  4KHP H;  2M6Q A;  1WHR A;  4JI8 H;  3AEV B;  1X9Z A;  1V9N A;  3NCV A;  2DGR A;  4DR2 H;  2ZQE A;  2BL5 A;  4JI5 H;  3J7A K;  5K36 G;  1NXU A;  2ANR A;  2JVZ A;  1F0X A;  4DV3 H;  4X66 H;  4JI1 H;  1K1G A;  3KDG A;  3EZJ A;  4NZT M;  4LF8 H;  4DR5 H;  1XMO H;  1J5K A;  4DUY H;  1TUA A;  2UXC H;  4JI6 H;  2HH3 A;  3OTO H;  2CTJ A;  2CTM A;  4B3T H;  4NBQ A;  2BA0 A;  3GR5 A;  3I0P A;  2P2R A;  4DR7 H;  1IBL H;  2UXB H;  1HNW H;  1N34 H;  4GKJ H;  1AN7 A;  3RF2 A;  4LFC H;  1DT4 A;  1J5E H;  2MJH A;  2LF0 A;  4DV5 H;  4X62 H;  1V8C A;  1EC6 A;  3VKE A;  4JYA H;  2Y3M A;  5IWA H;  3OSS D;  4LF9 H;  2CTF A;  3OET A;  4DUZ H; 
#chains in the Genus database with same CATH homology
 5K36 G;  1ZZJ A;  1ZZK A;  4LIJ A;  2AXY A;  2CTK A;  2JVZ A;  2ANR A;  2JE6 I;  1VIH A;  4AIM A;  4BA2 I;  2JA9 A;  2OPV A;  1K1G A;  1WE8 A;  1DTJ A;  2JEA I;  2OPU A;  4JVH A;  1VIG A;  2HH2 A;  1J5K A;  1TUA A;  4IFD G;  2HH3 A;  4B8T A;  1ZTG A;  4WAN A;  2CTJ A;  1X4M A;  2CTM A;  1J4W A;  2CTE A;  4NBQ A;  4QMF B;  2ANN A;  2BA0 A;  4WAL A;  1ZZI A;  5JEA G;  2P2R A;  4OO1 G;  3V69 A;  3U1K A;  2JEB I;  2PY9 A;  1X4N A;  5C0X G;  1KHM A;  2QND A;  3L7Z C;  2Z0S A;  2PQU A;  1DT4 A;  1WVN A;  2NN6 G;  4BA1 I;  2MJH A;  2FMR A;  1EC6 A;  3VKE A;  2CPQ A;  2JZX A;  2CTL A;  2E3U A;  3AEV B;  4AM3 A;  4JVY A;  2YQR A;  2CTF A;  2DGR A;  2BL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...