4JVYA

Structure of the star (signal transduction and activation of rna) domain of gld-1 bound to rna
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
191
structure length
191
Chain Sequence
SHEATVEYLADLVKEKKHLTLFPHMFSNVERLLDDEIGRVRVALFQTEFPRVELPEPAGDMISITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTGCKIMVRGKGSMRDKSKESAHRGKANWEHLEDDLHVLVQCEDTENRVHIKLQAALEQVKKLLIPAPEGTDELKRKQLMELAIINGTYRPMKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Female germline-specific tumor suppressor gld-1
publication title Structure-function studies of STAR family Quaking proteins bound to their in vivo RNA target sites.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 63
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4jvyA00
1VIHA 4BA2I 2JEAI 1VIGA 2ANRA 1J5KA 5K36G 2JZXA 1X4NA 4WALA 2ANNA 2CPQA 2HH3A 2Z0SA 4QMFB 1ZZKA 4B8TA 3V69A 2CTEA 1DTJA 1ZTGA 1DT4A 2CTMA 2JA9A 4IFDG 5JEAG 2BA0A 2CTFA 2DGRA 2E3UA 2OPUA 4AIMA 5C0XG 1WVNA 2CTJA 2AXYA 2PY9A 4AM3A 4WANA 2CTKA 2BL5A 2YQRA 2FMRA 4NBQA 1EC6A 2CTLA 4OO1G 2HH2A 1ZZJA 1J4WA 2P2RA 1K1GA 4LIJA 1TUAA 2JVZA 4BA1I 2NN6G 4JVHA 1KHMA 2OPVA 2QNDA 2JEBI 2PQUA 1ZZIA 3U1KA 2JE6I 4JVYA 3VKEA 1X4MA 3L7ZC 3AEVB 1WE8A 2MJHA
chains in the Genus database with same CATH superfamily
4X66H 1VIGA 1HNZH 1N34H 4DUYH 2JZXA 5FLXW 1XMQH 4JI4H 4YHHH 4PDBA 1XMOH 3V69A 1ZTGA 1N32H 1S20A 4B3SH 4LF5H 5JEAG 1IBKH 4LF7H 2E3UA 4JV5H 4AIMA 3RF2A 2FFMA 2PY9A 2CTJA 3J81W 3GABA 4NBQA 3OSSD 4DR6H 4JI6H 4OO1G 1X0AA 1ZZJA 1N33H 2P2RA 1K1GA 4KHPH 4B3TH 4BA1I 3KDGA 4OD6A 3SB1A 2NN6G 4X65H 1KHMA 4X62H 2F4VH 4X64H 1F0XA 1ZZIA 1I6UA 1XRHA 4JI7H 4DR5H 5IT9W 1IBMH 2VKCA 1J4WA 1VIHA 2UXBH 4BA2I 2JEAI 4FJUA 1HNWH 1MSZA 2D9IA 4G08A 1HR0H 1V9NA 2Z0SA 4B8TA 4DV1H 2CTEA 1DTJA 1FKAH 2VQEH 2LTLA 4LF4H 1NXUA 2OPUA 5A2QW 2K1HA 5C0XG 1WVNA 4AM3A 3JAMW 4DV6H 1J5EH 4JI8H 1Z2IA 4H8AA 3EZJA 1IBLH 4GKKH 2ZM6H 4DR3H 2HH2A 5IWAH 5LMUH 4LIJA 4DR1H 1TUAA 2JVZA 1V8CA 4B8CD 4YY3H 5BR8H 4AQYH 2ZQEA 4EC5A 2CWFA 2QNDA 2JEBI 2UUBH 2E5LH 1XNRH 4OCHA 5LMNH 3GR5A 4OX9H 4LFBH 4JVYA 1HNXH 3I0PA 3L7ZC 4K0KH 3AEVB 1WE8A 2MJHA 2G8YA 1VBIA 1ODHA 3NCVA 2ANRA 1UG8A 4NZRM 2ANNA 2HH3A 3GKUA 1WHRA 4QMFB 1ZZKA 2PT7G 1WTJA 4DUZH 4E9JA 1N36H 4B3RH 2BA0A 2CTFA 2UU9H 5LL6b 4GKJH 3KDKA 4WANA 4DR2H 1X9ZA 2BL5A 2YQRA 1EC6A 4DR4H 1I94H 2CTLA 4JI2H 3T1HH 1S03G 4JI5H 4NXNH 3UOEA 2O4CA 4B3MH 2CPMA 4JVHA 4DR7H 2LF0A 4DV4H 3OTOH 4DV5H 3U1KA 3J7AK 4DV0H 3OETA 3J80W 1X4MA 2FPHX 4DV2H 5DT9A 1J5KA 4LF9H 2UUAH 1X4NA 4WALA 5K36G 2CPQA 2UUCH 3FAUA 4NZTM 3T1YH 4NXMH 2A1SA 4JI0H 4LFAH 1AN7A 1DT4A 2CTMA 2JA9A 4LF6H 4IFDG 2LTMA 1SEIA 2DGRA 2AXYA 2Y3MA 2CTKA 2FMRA 4DV7H 4LFCH 2CWHA 2M6QA 4JI1H 2HHHH 4JI3H 4DV3H 1FJGH 4JYAH 4FJSA 2OPVA 2PQUA 2LRRA 1XNQH 1PQXA 3QD7X 2JE6I 2X06A 3VKEA 2UXDH 2M8WA 2UXCH 4LF8H 2VQFH
chains in the Genus database with same CATH topology
1VIHA 4BA2I 2JEAI 1VIGA 2ANRA 1J5KA 5K36G 2JZXA 1X4NA 4WALA 2ANNA 2CPQA 2HH3A 2Z0SA 4QMFB 1ZZKA 4B8TA 3V69A 2CTEA 1DTJA 1ZTGA 1DT4A 2CTMA 2JA9A 4IFDG 5JEAG 2BA0A 2CTFA 2DGRA 2E3UA 2OPUA 4AIMA 5C0XG 1WVNA 2CTJA 2AXYA 2PY9A 4AM3A 4WANA 2CTKA 2BL5A 2YQRA 2FMRA 4NBQA 1EC6A 2CTLA 4OO1G 2HH2A 1ZZJA 1J4WA 2P2RA 1K1GA 4LIJA 1TUAA 2JVZA 4BA1I 2NN6G 4JVHA 1KHMA 2OPVA 2QNDA 2JEBI 2PQUA 1ZZIA 3U1KA 2JE6I 4JVYA 3VKEA 1X4MA 3L7ZC 3AEVB 1WE8A 2MJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIH A;  4BA2 I;  2JEA I;  1VIG A;  2ANR A;  1J5K A;  5K36 G;  2JZX A;  1X4N A;  4WAL A;  2ANN A;  2CPQ A;  2HH3 A;  2Z0S A;  4QMF B;  1ZZK A;  4B8T A;  3V69 A;  2CTE A;  1DTJ A;  1ZTG A;  1DT4 A;  2CTM A;  2JA9 A;  4IFD G;  5JEA G;  2BA0 A;  2CTF A;  2DGR A;  2E3U A;  2OPU A;  4AIM A;  5C0X G;  1WVN A;  2CTJ A;  2AXY A;  2PY9 A;  4AM3 A;  4WAN A;  2CTK A;  2BL5 A;  2YQR A;  2FMR A;  4NBQ A;  1EC6 A;  2CTL A;  4OO1 G;  2HH2 A;  1ZZJ A;  1J4W A;  2P2R A;  1K1G A;  4LIJ A;  1TUA A;  2JVZ A;  4BA1 I;  2NN6 G;  4JVH A;  1KHM A;  2OPV A;  2QND A;  2JEB I;  2PQU A;  1ZZI A;  3U1K A;  2JE6 I;  4JVY A;  3VKE A;  1X4M A;  3L7Z C;  3AEV B;  1WE8 A;  2MJH A; 
#chains in the Genus database with same CATH topology
 4X66 H;  1VIG A;  1HNZ H;  1N34 H;  4DUY H;  2JZX A;  5FLX W;  1XMQ H;  4JI4 H;  4YHH H;  4PDB A;  1XMO H;  3V69 A;  1ZTG A;  1N32 H;  1S20 A;  4B3S H;  4LF5 H;  5JEA G;  1IBK H;  4LF7 H;  2E3U A;  4JV5 H;  4AIM A;  3RF2 A;  2FFM A;  2PY9 A;  2CTJ A;  3J81 W;  3GAB A;  4NBQ A;  3OSS D;  4DR6 H;  4JI6 H;  4OO1 G;  1X0A A;  1ZZJ A;  1N33 H;  2P2R A;  1K1G A;  4KHP H;  4B3T H;  4BA1 I;  3KDG A;  4OD6 A;  3SB1 A;  2NN6 G;  4X65 H;  1KHM A;  4X62 H;  2F4V H;  4X64 H;  1F0X A;  1ZZI A;  1I6U A;  1XRH A;  4JI7 H;  4DR5 H;  5IT9 W;  1IBM H;  2VKC A;  1J4W A;  1VIH A;  2UXB H;  4BA2 I;  2JEA I;  4FJU A;  1HNW H;  1MSZ A;  2D9I A;  4G08 A;  1HR0 H;  1V9N A;  2Z0S A;  4B8T A;  4DV1 H;  2CTE A;  1DTJ A;  1FKA H;  2VQE H;  2LTL A;  4LF4 H;  1NXU A;  2OPU A;  5A2Q W;  2K1H A;  5C0X G;  1WVN A;  4AM3 A;  3JAM W;  4DV6 H;  1J5E H;  4JI8 H;  1Z2I A;  4H8A A;  3EZJ A;  1IBL H;  4GKK H;  2ZM6 H;  4DR3 H;  2HH2 A;  5IWA H;  5LMU H;  4LIJ A;  4DR1 H;  1TUA A;  2JVZ A;  1V8C A;  4B8C D;  4YY3 H;  5BR8 H;  4AQY H;  2ZQE A;  4EC5 A;  2CWF A;  2QND A;  2JEB I;  2UUB H;  2E5L H;  1XNR H;  4OCH A;  5LMN H;  3GR5 A;  4OX9 H;  4LFB H;  4JVY A;  1HNX H;  3I0P A;  3L7Z C;  4K0K H;  3AEV B;  1WE8 A;  2MJH A;  2G8Y A;  1VBI A;  1ODH A;  3NCV A;  2ANR A;  1UG8 A;  4NZR M;  2ANN A;  2HH3 A;  3GKU A;  1WHR A;  4QMF B;  1ZZK A;  2PT7 G;  1WTJ A;  4DUZ H;  4E9J A;  1N36 H;  4B3R H;  2BA0 A;  2CTF A;  2UU9 H;  5LL6 b;  4GKJ H;  3KDK A;  4WAN A;  4DR2 H;  1X9Z A;  2BL5 A;  2YQR A;  1EC6 A;  4DR4 H;  1I94 H;  2CTL A;  4JI2 H;  3T1H H;  1S03 G;  4JI5 H;  4NXN H;  3UOE A;  2O4C A;  4B3M H;  2CPM A;  4JVH A;  4DR7 H;  2LF0 A;  4DV4 H;  3OTO H;  4DV5 H;  3U1K A;  3J7A K;  4DV0 H;  3OET A;  3J80 W;  1X4M A;  2FPH X;  4DV2 H;  5DT9 A;  1J5K A;  4LF9 H;  2UUA H;  1X4N A;  4WAL A;  5K36 G;  2CPQ A;  2UUC H;  3FAU A;  4NZT M;  3T1Y H;  4NXM H;  2A1S A;  4JI0 H;  4LFA H;  1AN7 A;  1DT4 A;  2CTM A;  2JA9 A;  4LF6 H;  4IFD G;  2LTM A;  1SEI A;  2DGR A;  2AXY A;  2Y3M A;  2CTK A;  2FMR A;  4DV7 H;  4LFC H;  2CWH A;  2M6Q A;  4JI1 H;  2HHH H;  4JI3 H;  4DV3 H;  1FJG H;  4JYA H;  4FJS A;  2OPV A;  2PQU A;  2LRR A;  1XNQ H;  1PQX A;  3QD7 X;  2JE6 I;  2X06 A;  3VKE A;  2UXD H;  2M8W A;  2UXC H;  4LF8 H;  2VQF H; 
#chains in the Genus database with same CATH homology
 1VIH A;  4BA2 I;  2JEA I;  1VIG A;  2ANR A;  1J5K A;  5K36 G;  2JZX A;  1X4N A;  4WAL A;  2ANN A;  2CPQ A;  2HH3 A;  2Z0S A;  4QMF B;  1ZZK A;  4B8T A;  3V69 A;  2CTE A;  1DTJ A;  1ZTG A;  1DT4 A;  2CTM A;  2JA9 A;  4IFD G;  5JEA G;  2BA0 A;  2CTF A;  2DGR A;  2E3U A;  2OPU A;  4AIM A;  5C0X G;  1WVN A;  2CTJ A;  2AXY A;  2PY9 A;  4AM3 A;  4WAN A;  2CTK A;  2BL5 A;  2YQR A;  2FMR A;  4NBQ A;  1EC6 A;  2CTL A;  4OO1 G;  2HH2 A;  1ZZJ A;  1J4W A;  2P2R A;  1K1G A;  4LIJ A;  1TUA A;  2JVZ A;  4BA1 I;  2NN6 G;  4JVH A;  1KHM A;  2OPV A;  2QND A;  2JEB I;  2PQU A;  1ZZI A;  3U1K A;  2JE6 I;  4JVY A;  3VKE A;  1X4M A;  3L7Z C;  3AEV B;  1WE8 A;  2MJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...