1J5KA

Complex of the kh3 domain of hnrnp k with a single_stranded 10mer dna oligonucleotide
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
b'GGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*AP*T*TP*CP*CP*CP*TP*C)-3'
molecule tags Transcription/dna
source organism Homo sapiens
publication title Molecular basis of sequence-specific single-stranded DNA recognition by KH domains: solution structure of a complex between hnRNP K KH3 and single-stranded DNA.
pubmed doi rcsb
total genus 17
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2002-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1j5kA00
2BL5A 2JEAI 2PY9A 5C0XG 2MJHA 1DT4A 2YQRA 4QMFB 2AXYA 2QNDA 1J5KA 2FMRA 4BA1I 1K1GA 2CTKA 1WE8A 4WALA 4LIJA 2CTFA 1ZZIA 4BA2I 4WANA 1KHMA 5JEAG 1X4NA 1VIHA 2OPVA 4AIMA 2NN6G 4B8TA 3AEVB 2Z0SA 2ANNA 2CPQA 2HH2A 2JE6I 2CTMA 3VKEA 2CTLA 2ANRA 2CTJA 4IFDG 2BA0A 2DGRA 2JA9A 2JVZA 2E3UA 3U1KA 1TUAA 4JVYA 2P2RA 4OO1G 2CTEA 1ZZKA 5K36G 1J4WA 4NBQA 4AM3A 1VIGA 1WVNA 2JEBI 2PQUA 1EC6A 1ZZJA 3V69A 2JZXA 1ZTGA 3L7ZC 2OPUA 2HH3A 1DTJA 4JVHA 1X4MA
chains in the Genus database with same CATH superfamily
4K0KH 2E5LH 2M6QA 4QMFB 4DR7H 2AXYA 1MSZA 4DR1H 2F4VH 2UU9H 4H8AA 4LIJA 1N34H 2UUCH 4GKKH 4NXMH 5DT9A 1AN7A 3NCVA 1SEIA 1IBLH 2JE6I 2VQEH 4JYAH 2CTMA 4X64H 2BA0A 2ZM6H 1IBKH 2CPMA 2O4CA 4JVYA 2LRRA 4E9JA 2Y3MA 4OO1G 2UUBH 5A2QW 1J4WA 4AM3A 1WHRA 1V9NA 1WVNA 4OX9H 4X62H 5IWAH 1XNQH 3GABA 2LF0A 1N33H 4LF6H 3T1HH 3I0PA 4KHPH 1X4MA 2BL5A 3KDKA 2MJHA 1DT4A 1S20A 1X0AA 2YQRA 3J81W 4DR2H 1XNRH 1UG8A 4DR4H 1KHMA 4WANA 1VBIA 5JEAG 1X4NA 2OPVA 1Z2IA 5LMUH 4B8TA 2Z0SA 4B3TH 2K1HA 2CPQA 4FJSA 3VKEA 4LF9H 2UXBH 1X9ZA 2CTJA 2JA9A 4JI1H 3OETA 4DV4H 3JAMW 3SB1A 4JI6H 2FFMA 4X66H 2X06A 2ZQEA 2HHHH 3RF2A 4NBQA 4B3SH 1VIGA 3FAUA 2JEBI 4DV0H 1ODHA 1ZZJA 2CWHA 4NZTM 4DR3H 2OPUA 4JI0H 4JI2H 1WTJA 4AQYH 5C0XG 1XMQH 2LTMA 4EC5A 2QNDA 2FMRA 4BA1I 1K1GA 4WALA 1HR0H 4JI5H 4DUZH 4FJUA 2CTFA 3OTOH 4JI4H 1I94H 2UUAH 4AIMA 4DV1H 2NN6G 4YY3H 4LF7H 3AEVB 4DUYH 4LFCH 3J7AK 4G08A 1IBMH 2A1SA 4LF4H 2FPHX 2CTLA 4DV2H 1I6UA 1V8CA 4B3RH 4IFDG 2DGRA 2JVZA 3GKUA 4B8CD 1N36H 4JI3H 1TUAA 4NZRM 1XRHA 3EZJA 4X65H 3J80W 4DR5H 2UXDH 5IT9W 2UXCH 1S03G 5K36G 4LF8H 1EC6A 1FKAH 3GR5A 3T1YH 3V69A 2JZXA 1ZTGA 3L7ZC 5LMNH 1ZZIA 5LL6b 1DTJA 2CWFA 3OSSD 2VKCA 3QD7X 4PDBA 4DV6H 1HNWH 2JEAI 2PY9A 2LTLA 4DV5H 1NXUA 1J5KA 4LFAH 2CTKA 1WE8A 1HNXH 4LF5H 4LFBH 4OD6A 5BR8H 4BA2I 1XMOH 3KDGA 1VIHA 4JV5H 1F0XA 2ANNA 2HH2A 4DV3H 4DR6H 2ANRA 3UOEA 3U1KA 1FJGH 2E3UA 1HNZH 2P2RA 4JI8H 2CTEA 1ZZKA 2G8YA 4B3MH 4DV7H 1N32H 1J5EH 4NXNH 2M8WA 1PQXA 2PQUA 5FLXW 4OCHA 2VQFH 2D9IA 4GKJH 2HH3A 4YHHH 4JI7H 4JVHA 2PT7G
chains in the Genus database with same CATH topology
2BL5A 2JEAI 2PY9A 5C0XG 2MJHA 1DT4A 2YQRA 4QMFB 2AXYA 2QNDA 1J5KA 2FMRA 4BA1I 1K1GA 2CTKA 1WE8A 4WALA 4LIJA 2CTFA 1ZZIA 4BA2I 4WANA 1KHMA 5JEAG 1X4NA 1VIHA 2OPVA 4AIMA 2NN6G 4B8TA 3AEVB 2Z0SA 2ANNA 2CPQA 2HH2A 2JE6I 2CTMA 3VKEA 2CTLA 2ANRA 2CTJA 4IFDG 2BA0A 2DGRA 2JA9A 2JVZA 2E3UA 3U1KA 1TUAA 4JVYA 2P2RA 4OO1G 2CTEA 1ZZKA 5K36G 1J4WA 4NBQA 4AM3A 1VIGA 1WVNA 2JEBI 2PQUA 1EC6A 1ZZJA 3V69A 2JZXA 1ZTGA 3L7ZC 2OPUA 2HH3A 1DTJA 4JVHA 1X4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BL5 A;  2JEA I;  2PY9 A;  5C0X G;  2MJH A;  1DT4 A;  2YQR A;  4QMF B;  2AXY A;  2QND A;  1J5K A;  2FMR A;  4BA1 I;  1K1G A;  2CTK A;  1WE8 A;  4WAL A;  4LIJ A;  2CTF A;  1ZZI A;  4BA2 I;  4WAN A;  1KHM A;  5JEA G;  1X4N A;  1VIH A;  2OPV A;  4AIM A;  2NN6 G;  4B8T A;  3AEV B;  2Z0S A;  2ANN A;  2CPQ A;  2HH2 A;  2JE6 I;  2CTM A;  3VKE A;  2CTL A;  2ANR A;  2CTJ A;  4IFD G;  2BA0 A;  2DGR A;  2JA9 A;  2JVZ A;  2E3U A;  3U1K A;  1TUA A;  4JVY A;  2P2R A;  4OO1 G;  2CTE A;  1ZZK A;  5K36 G;  1J4W A;  4NBQ A;  4AM3 A;  1VIG A;  1WVN A;  2JEB I;  2PQU A;  1EC6 A;  1ZZJ A;  3V69 A;  2JZX A;  1ZTG A;  3L7Z C;  2OPU A;  2HH3 A;  1DTJ A;  4JVH A;  1X4M A; 
#chains in the Genus database with same CATH topology
 4K0K H;  2E5L H;  2M6Q A;  4QMF B;  4DR7 H;  2AXY A;  1MSZ A;  4DR1 H;  2F4V H;  2UU9 H;  4H8A A;  4LIJ A;  1N34 H;  2UUC H;  4GKK H;  4NXM H;  5DT9 A;  1AN7 A;  3NCV A;  1SEI A;  1IBL H;  2JE6 I;  2VQE H;  4JYA H;  2CTM A;  4X64 H;  2BA0 A;  2ZM6 H;  1IBK H;  2CPM A;  2O4C A;  4JVY A;  2LRR A;  4E9J A;  2Y3M A;  4OO1 G;  2UUB H;  5A2Q W;  1J4W A;  4AM3 A;  1WHR A;  1V9N A;  1WVN A;  4OX9 H;  4X62 H;  5IWA H;  1XNQ H;  3GAB A;  2LF0 A;  1N33 H;  4LF6 H;  3T1H H;  3I0P A;  4KHP H;  1X4M A;  2BL5 A;  3KDK A;  2MJH A;  1DT4 A;  1S20 A;  1X0A A;  2YQR A;  3J81 W;  4DR2 H;  1XNR H;  1UG8 A;  4DR4 H;  1KHM A;  4WAN A;  1VBI A;  5JEA G;  1X4N A;  2OPV A;  1Z2I A;  5LMU H;  4B8T A;  2Z0S A;  4B3T H;  2K1H A;  2CPQ A;  4FJS A;  3VKE A;  4LF9 H;  2UXB H;  1X9Z A;  2CTJ A;  2JA9 A;  4JI1 H;  3OET A;  4DV4 H;  3JAM W;  3SB1 A;  4JI6 H;  2FFM A;  4X66 H;  2X06 A;  2ZQE A;  2HHH H;  3RF2 A;  4NBQ A;  4B3S H;  1VIG A;  3FAU A;  2JEB I;  4DV0 H;  1ODH A;  1ZZJ A;  2CWH A;  4NZT M;  4DR3 H;  2OPU A;  4JI0 H;  4JI2 H;  1WTJ A;  4AQY H;  5C0X G;  1XMQ H;  2LTM A;  4EC5 A;  2QND A;  2FMR A;  4BA1 I;  1K1G A;  4WAL A;  1HR0 H;  4JI5 H;  4DUZ H;  4FJU A;  2CTF A;  3OTO H;  4JI4 H;  1I94 H;  2UUA H;  4AIM A;  4DV1 H;  2NN6 G;  4YY3 H;  4LF7 H;  3AEV B;  4DUY H;  4LFC H;  3J7A K;  4G08 A;  1IBM H;  2A1S A;  4LF4 H;  2FPH X;  2CTL A;  4DV2 H;  1I6U A;  1V8C A;  4B3R H;  4IFD G;  2DGR A;  2JVZ A;  3GKU A;  4B8C D;  1N36 H;  4JI3 H;  1TUA A;  4NZR M;  1XRH A;  3EZJ A;  4X65 H;  3J80 W;  4DR5 H;  2UXD H;  5IT9 W;  2UXC H;  1S03 G;  5K36 G;  4LF8 H;  1EC6 A;  1FKA H;  3GR5 A;  3T1Y H;  3V69 A;  2JZX A;  1ZTG A;  3L7Z C;  5LMN H;  1ZZI A;  5LL6 b;  1DTJ A;  2CWF A;  3OSS D;  2VKC A;  3QD7 X;  4PDB A;  4DV6 H;  1HNW H;  2JEA I;  2PY9 A;  2LTL A;  4DV5 H;  1NXU A;  1J5K A;  4LFA H;  2CTK A;  1WE8 A;  1HNX H;  4LF5 H;  4LFB H;  4OD6 A;  5BR8 H;  4BA2 I;  1XMO H;  3KDG A;  1VIH A;  4JV5 H;  1F0X A;  2ANN A;  2HH2 A;  4DV3 H;  4DR6 H;  2ANR A;  3UOE A;  3U1K A;  1FJG H;  2E3U A;  1HNZ H;  2P2R A;  4JI8 H;  2CTE A;  1ZZK A;  2G8Y A;  4B3M H;  4DV7 H;  1N32 H;  1J5E H;  4NXN H;  2M8W A;  1PQX A;  2PQU A;  5FLX W;  4OCH A;  2VQF H;  2D9I A;  4GKJ H;  2HH3 A;  4YHH H;  4JI7 H;  4JVH A;  2PT7 G; 
#chains in the Genus database with same CATH homology
 2BL5 A;  2JEA I;  2PY9 A;  5C0X G;  2MJH A;  1DT4 A;  2YQR A;  4QMF B;  2AXY A;  2QND A;  1J5K A;  2FMR A;  4BA1 I;  1K1G A;  2CTK A;  1WE8 A;  4WAL A;  4LIJ A;  2CTF A;  1ZZI A;  4BA2 I;  4WAN A;  1KHM A;  5JEA G;  1X4N A;  1VIH A;  2OPV A;  4AIM A;  2NN6 G;  4B8T A;  3AEV B;  2Z0S A;  2ANN A;  2CPQ A;  2HH2 A;  2JE6 I;  2CTM A;  3VKE A;  2CTL A;  2ANR A;  2CTJ A;  4IFD G;  2BA0 A;  2DGR A;  2JA9 A;  2JVZ A;  2E3U A;  3U1K A;  1TUA A;  4JVY A;  2P2R A;  4OO1 G;  2CTE A;  1ZZK A;  5K36 G;  1J4W A;  4NBQ A;  4AM3 A;  1VIG A;  1WVN A;  2JEB I;  2PQU A;  1EC6 A;  1ZZJ A;  3V69 A;  2JZX A;  1ZTG A;  3L7Z C;  2OPU A;  2HH3 A;  1DTJ A;  4JVH A;  1X4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...