1J5KA

Complex of the kh3 domain of hnrnp k with a single_stranded 10mer dna oligonucleotide
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
GGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*AP*T*TP*CP*CP*CP*TP*C)-3'
publication title Molecular basis of sequence-specific single-stranded DNA recognition by KH domains: solution structure of a complex between hnRNP K KH3 and single-stranded DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 17
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2002-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1j5kA00
4NBQA 2ANNA 2OPVA 2BL5A 2BA0A 4LIJA 4QMFB 5JEAG 2MJHA 2PY9A 2JA9A 4AM3A 2HH2A 2CTFA 4BA1I 2JE6I 2OPUA 1X4MA 3VKEA 1K1GA 2DGRA 2FMRA 5C0XG 1J5KA 2CTMA 2YQRA 2NN6G 1ZZJA 2AXYA 1J4WA 1TUAA 2Z0SA 2PQUA 1EC6A 1ZZKA 4AIMA 4WALA 1VIGA 2HH3A 4JVYA 2E3UA 1DT4A 2CTKA 1WVNA 1DTJA 4B8TA 2P2RA 2CTLA 4BA2I 3U1KA 1X4NA 2JZXA 2JEAI 4JVHA 1WE8A 3L7ZC 4WANA 2QNDA 2JEBI 2CTEA 4IFDG 1KHMA 1VIHA 4OO1G 2JVZA 2CPQA 1ZZIA 3AEVB 2ANRA 5K36G 2CTJA 3V69A 1ZTGA
chains in the Genus database with same CATH superfamily
1S20A 2X06A 1NXUA 4DV5H 2MJHA 4LIJA 5LMUH 2PY9A 4AM3A 3OSSD 4BA1I 2LRRA 2F4VH 3VKEA 3KDGA 5DT9A 2DGRA 2A1SA 3SB1A 3T1HH 2CTMA 1N34H 2NN6G 1WHRA 3UOEA 2Y3MA 1J5KA 2Z0SA 1EC6A 4LF4H 2UXDH 4AIMA 3OTOH 3OETA 4DV6H 4LFAH 4JI0H 3I0PA 4DV3H 4OX9H 3NCVA 1DT4A 2CPMA 4DUZH 4DR6H 1Z2IA 4AQYH 1FJGH 1XNQH 2JEAI 4JVHA 4KHPH 1WE8A 4DV0H 2QNDA 3JAMW 2VQFH 5IWAH 1VIHA 4OO1G 3GKUA 4LF6H 1SEIA 4DR1H 1HNXH 2FPHX 4WANA 1X0AA 1F0XA 5JEAG 4DV1H 3QD7X 1XMOH 1HNZH 4K0KH 4E9JA 2JE6I 4LFBH 4GKKH 4LFCH 2YQRA 3RF2A 4DV4H 2PQUA 1TUAA 2UUCH 4G08A 1V8CA 4WALA 2K1HA 1N32H 3GABA 3FAUA 4DR3H 1HR0H 4NZRM 2G8YA 2HH3A 4B8CD 4GKJH 4JVYA 1N33H 2CTKA 1WVNA 4BA2I 4X66H 5LMNH 3U1KA 4B3TH 4JI3H 3EZJA 4EC5A 1FKAH 3J7AK 2UXCH 4LF8H 4JI2H 5IT9W 1XRHA 4X65H 3V69A 2PT7G 1ZTGA 5LL6b 2ANNA 2OPVA 2BL5A 2BA0A 2JA9A 4JI6H 1UG8A 2HH2A 5FLXW 3J81W 1HNWH 2M6QA 2OPUA 4NZTM 4DR2H 2E5LH 4JYAH 4JI7H 1J4WA 2M8WA 4OD6A 5BR8H 1ZZKA 4DR4H 3J80W 4JI5H 4JI8H 4PDBA 4OCHA 4B3MH 1I6UA 4B8TA 2O4CA 2P2RA 2CTLA 1X4NA 4YY3H 4DV2H 4X62H 4LF7H 3L7ZC 2LTLA 2LF0A 2JEBI 4DR5H 1XMQH 2CTEA 4B3RH 4B3SH 4DUYH 1I94H 2CPQA 5K36G 2ANRA 4FJUA 4LF9H 1K1GA 5A2QW 4NBQA 4NXMH 4LF5H 4JV5H 4QMFB 3GR5A 1VBIA 2LTMA 2VKCA 2CTFA 4X64H 1IBLH 4YHHH 1X4MA 3T1YH 2UUAH 3KDKA 2FMRA 5C0XG 1S03G 1ZZJA 2AXYA 1X9ZA 2ZQEA 1VIGA 4FJSA 2ZM6H 1XNRH 4DR7H 2CWHA 2E3UA 1V9NA 1DTJA 1ODHA 1J5EH 1PQXA 2UUBH 1MSZA 4DV7H 4JI4H 2JZXA 2FFMA 1N36H 1AN7A 1WTJA 4H8AA 1KHMA 4IFDG 1IBKH 2JVZA 4JI1H 2CWFA 2VQEH 1ZZIA 2HHHH 2D9IA 3AEVB 2CTJA 1IBMH 2UXBH 4NXNH 2UU9H
chains in the Genus database with same CATH topology
4NBQA 2ANNA 2OPVA 2BL5A 2BA0A 4LIJA 4QMFB 5JEAG 2MJHA 2PY9A 2JA9A 4AM3A 2HH2A 2CTFA 4BA1I 2JE6I 2OPUA 1X4MA 3VKEA 1K1GA 2DGRA 2FMRA 5C0XG 1J5KA 2CTMA 2YQRA 2NN6G 1ZZJA 2AXYA 1J4WA 1TUAA 2Z0SA 2PQUA 1EC6A 1ZZKA 4AIMA 4WALA 1VIGA 2HH3A 4JVYA 2E3UA 1DT4A 2CTKA 1WVNA 1DTJA 4B8TA 2P2RA 2CTLA 4BA2I 3U1KA 1X4NA 2JZXA 2JEAI 4JVHA 1WE8A 3L7ZC 4WANA 2QNDA 2JEBI 2CTEA 4IFDG 1KHMA 1VIHA 4OO1G 2JVZA 2CPQA 1ZZIA 3AEVB 2ANRA 5K36G 2CTJA 3V69A 1ZTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBQ A;  2ANN A;  2OPV A;  2BL5 A;  2BA0 A;  4LIJ A;  4QMF B;  5JEA G;  2MJH A;  2PY9 A;  2JA9 A;  4AM3 A;  2HH2 A;  2CTF A;  4BA1 I;  2JE6 I;  2OPU A;  1X4M A;  3VKE A;  1K1G A;  2DGR A;  2FMR A;  5C0X G;  1J5K A;  2CTM A;  2YQR A;  2NN6 G;  1ZZJ A;  2AXY A;  1J4W A;  1TUA A;  2Z0S A;  2PQU A;  1EC6 A;  1ZZK A;  4AIM A;  4WAL A;  1VIG A;  2HH3 A;  4JVY A;  2E3U A;  1DT4 A;  2CTK A;  1WVN A;  1DTJ A;  4B8T A;  2P2R A;  2CTL A;  4BA2 I;  3U1K A;  1X4N A;  2JZX A;  2JEA I;  4JVH A;  1WE8 A;  3L7Z C;  4WAN A;  2QND A;  2JEB I;  2CTE A;  4IFD G;  1KHM A;  1VIH A;  4OO1 G;  2JVZ A;  2CPQ A;  1ZZI A;  3AEV B;  2ANR A;  5K36 G;  2CTJ A;  3V69 A;  1ZTG A; 
#chains in the Genus database with same CATH topology
 1S20 A;  2X06 A;  1NXU A;  4DV5 H;  2MJH A;  4LIJ A;  5LMU H;  2PY9 A;  4AM3 A;  3OSS D;  4BA1 I;  2LRR A;  2F4V H;  3VKE A;  3KDG A;  5DT9 A;  2DGR A;  2A1S A;  3SB1 A;  3T1H H;  2CTM A;  1N34 H;  2NN6 G;  1WHR A;  3UOE A;  2Y3M A;  1J5K A;  2Z0S A;  1EC6 A;  4LF4 H;  2UXD H;  4AIM A;  3OTO H;  3OET A;  4DV6 H;  4LFA H;  4JI0 H;  3I0P A;  4DV3 H;  4OX9 H;  3NCV A;  1DT4 A;  2CPM A;  4DUZ H;  4DR6 H;  1Z2I A;  4AQY H;  1FJG H;  1XNQ H;  2JEA I;  4JVH A;  4KHP H;  1WE8 A;  4DV0 H;  2QND A;  3JAM W;  2VQF H;  5IWA H;  1VIH A;  4OO1 G;  3GKU A;  4LF6 H;  1SEI A;  4DR1 H;  1HNX H;  2FPH X;  4WAN A;  1X0A A;  1F0X A;  5JEA G;  4DV1 H;  3QD7 X;  1XMO H;  1HNZ H;  4K0K H;  4E9J A;  2JE6 I;  4LFB H;  4GKK H;  4LFC H;  2YQR A;  3RF2 A;  4DV4 H;  2PQU A;  1TUA A;  2UUC H;  4G08 A;  1V8C A;  4WAL A;  2K1H A;  1N32 H;  3GAB A;  3FAU A;  4DR3 H;  1HR0 H;  4NZR M;  2G8Y A;  2HH3 A;  4B8C D;  4GKJ H;  4JVY A;  1N33 H;  2CTK A;  1WVN A;  4BA2 I;  4X66 H;  5LMN H;  3U1K A;  4B3T H;  4JI3 H;  3EZJ A;  4EC5 A;  1FKA H;  3J7A K;  2UXC H;  4LF8 H;  4JI2 H;  5IT9 W;  1XRH A;  4X65 H;  3V69 A;  2PT7 G;  1ZTG A;  5LL6 b;  2ANN A;  2OPV A;  2BL5 A;  2BA0 A;  2JA9 A;  4JI6 H;  1UG8 A;  2HH2 A;  5FLX W;  3J81 W;  1HNW H;  2M6Q A;  2OPU A;  4NZT M;  4DR2 H;  2E5L H;  4JYA H;  4JI7 H;  1J4W A;  2M8W A;  4OD6 A;  5BR8 H;  1ZZK A;  4DR4 H;  3J80 W;  4JI5 H;  4JI8 H;  4PDB A;  4OCH A;  4B3M H;  1I6U A;  4B8T A;  2O4C A;  2P2R A;  2CTL A;  1X4N A;  4YY3 H;  4DV2 H;  4X62 H;  4LF7 H;  3L7Z C;  2LTL A;  2LF0 A;  2JEB I;  4DR5 H;  1XMQ H;  2CTE A;  4B3R H;  4B3S H;  4DUY H;  1I94 H;  2CPQ A;  5K36 G;  2ANR A;  4FJU A;  4LF9 H;  1K1G A;  5A2Q W;  4NBQ A;  4NXM H;  4LF5 H;  4JV5 H;  4QMF B;  3GR5 A;  1VBI A;  2LTM A;  2VKC A;  2CTF A;  4X64 H;  1IBL H;  4YHH H;  1X4M A;  3T1Y H;  2UUA H;  3KDK A;  2FMR A;  5C0X G;  1S03 G;  1ZZJ A;  2AXY A;  1X9Z A;  2ZQE A;  1VIG A;  4FJS A;  2ZM6 H;  1XNR H;  4DR7 H;  2CWH A;  2E3U A;  1V9N A;  1DTJ A;  1ODH A;  1J5E H;  1PQX A;  2UUB H;  1MSZ A;  4DV7 H;  4JI4 H;  2JZX A;  2FFM A;  1N36 H;  1AN7 A;  1WTJ A;  4H8A A;  1KHM A;  4IFD G;  1IBK H;  2JVZ A;  4JI1 H;  2CWF A;  2VQE H;  1ZZI A;  2HHH H;  2D9I A;  3AEV B;  2CTJ A;  1IBM H;  2UXB H;  4NXN H;  2UU9 H; 
#chains in the Genus database with same CATH homology
 4NBQ A;  2ANN A;  2OPV A;  2BL5 A;  2BA0 A;  4LIJ A;  4QMF B;  5JEA G;  2MJH A;  2PY9 A;  2JA9 A;  4AM3 A;  2HH2 A;  2CTF A;  4BA1 I;  2JE6 I;  2OPU A;  1X4M A;  3VKE A;  1K1G A;  2DGR A;  2FMR A;  5C0X G;  1J5K A;  2CTM A;  2YQR A;  2NN6 G;  1ZZJ A;  2AXY A;  1J4W A;  1TUA A;  2Z0S A;  2PQU A;  1EC6 A;  1ZZK A;  4AIM A;  4WAL A;  1VIG A;  2HH3 A;  4JVY A;  2E3U A;  1DT4 A;  2CTK A;  1WVN A;  1DTJ A;  4B8T A;  2P2R A;  2CTL A;  4BA2 I;  3U1K A;  1X4N A;  2JZX A;  2JEA I;  4JVH A;  1WE8 A;  3L7Z C;  4WAN A;  2QND A;  2JEB I;  2CTE A;  4IFD G;  1KHM A;  1VIH A;  4OO1 G;  2JVZ A;  2CPQ A;  1ZZI A;  3AEV B;  2ANR A;  5K36 G;  2CTJ A;  3V69 A;  1ZTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...