1J5KA

Complex of the kh3 domain of hnrnp k with a single_stranded 10mer dna oligonucleotide
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
GGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*TP*AP*T*TP*CP*CP*CP*TP*C)-3'
publication title Molecular basis of sequence-specific single-stranded DNA recognition by KH domains: solution structure of a complex between hnRNP K KH3 and single-stranded DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2002-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1j5kA00
2YQRA 1ZZKA 2NN6G 1K1GA 2JZXA 2BA0A 2MJHA 2CPQA 1DT4A 1ZTGA 3AEVB 4B8TA 3U1KA 4WANA 1J4WA 4IFDG 2CTLA 2PQUA 2ANNA 2Z0SA 2JA9A 3V69A 1ZZIA 4BA2I 2ANRA 1DTJA 1VIGA 2JEBI 1KHMA 1X4MA 2HH2A 2CTMA 2E3UA 4WALA 1J5KA 1EC6A 4QMFB 5K36G 2AXYA 2DGRA 3VKEA 4AIMA 2P2RA 2JE6I 2CTKA 4NBQA 4BA1I 1X4NA 2BL5A 4OO1G 2OPUA 2JEAI 2JVZA 1WE8A 1TUAA 4LIJA 1WVNA 2QNDA 2HH3A 3L7ZC 2PY9A 5JEAG 4JVHA 4JVYA 2CTJA 2CTEA 2CTFA 1VIHA 5C0XG 2OPVA 4AM3A 1ZZJA 2FMRA
chains in the Genus database with same CATH superfamily
5FLXW 1XRHA 3OSSD 5IT9W 2YQRA 2JZXA 2BA0A 3I0PA 2VQEH 2MJHA 1I6UA 3AEVB 4B8TA 2PT7G 3U1KA 4LFAH 4IFDG 3KDKA 1XMQH 1IBMH 4BA2I 4B8CD 2UU9H 3NCVA 2G8YA 4B3SH 1HNZH 4NXNH 1VBIA 4DR4H 2CTMA 1XNRH 4QMFB 2E5LH 3T1HH 2JE6I 3OETA 4NBQA 1X4NA 2BL5A 3GKUA 2CWHA 2JVZA 4DV2H 1F0XA 4DV1H 2K1HA 1WHRA 4G08A 3JAMW 2PY9A 1SEIA 4JVYA 1AN7A 1N33H 2M8WA 4YY3H 4DV7H 5LMUH 2FPHX 4DR6H 1X9ZA 2HHHH 2CPQA 1ZTGA 1N36H 1PQXA 4H8AA 4WANA 3T1YH 2LTLA 2UXDH 1NXUA 3RF2A 1HNXH 4DUZH 1VIGA 2JEBI 5LMNH 1KHMA 1ODHA 3GR5A 4JI2H 1J5KA 2UUCH 4LF5H 4OX9H 5K36G 2VKCA 1J5EH 4B3MH 1MSZA 4BA1I 4DR1H 4JI0H 4PDBA 4K0KH 1XMOH 4GKKH 4DV0H 2JEAI 3J81W 2UXCH 3L7ZC 2HH3A 4JI5H 5JEAG 4JVHA 1V9NA 2ZM6H 4JYAH 4X62H 5C0XG 2CWFA 4WALA 4EC5A 1S20A 5IWAH 2LRRA 1ZZKA 2NN6G 5DT9A 1FKAH 2A1SA 1DT4A 4LF9H 2LTMA 1J4WA 2ANNA 2PQUA 1HR0H 3UOEA 4JI4H 2JA9A 3OTOH 1ZZIA 4DV4H 2ANRA 4AQYH 2D9IA 2VQFH 4DV5H 1IBKH 2ZQEA 1WTJA 1X4MA 2HH2A 2CPMA 2O4CA 3GABA 4FJSA 4X66H 1FJGH 2DGRA 3VKEA 4AIMA 4DV3H 2CTKA 5BR8H 4OO1G 2X06A 4DR5H 4JV5H 2OPUA 1WE8A 2UUBH 2QNDA 2CTEA 2OPVA 4DUYH 4LF6H 1HNWH 2FMRA 4LIJA 4LF7H 3J7AK 4JI8H 1Z2IA 2M6QA 4KHPH 4GKJH 4DR3H 4NXMH 4LFBH 1K1GA 2FFMA 4B3TH 4OCHA 4LF8H 2LF0A 4DR2H 2UUAH 1X0AA 2F4VH 2UXBH 1V8CA 2CTLA 3SB1A 4E9JA 4LF4H 2Z0SA 3V69A 3KDGA 3FAUA 4JI3H 5LL6b 1DTJA 2Y3MA 5A2QW 4X64H 4X65H 4DV6H 4JI6H 2E3UA 4OD6A 1EC6A 2AXYA 4DR7H 4NZRM 1IBLH 4FJUA 2P2RA 4JI7H 4LFCH 3EZJA 1XNQH 3QD7X 1S03G 1N32H 1UG8A 4JI1H 4YHHH 1TUAA 3J80W 1WVNA 1I94H 2CTJA 4B3RH 2CTFA 1VIHA 4AM3A 1N34H 4NZTM 1ZZJA
chains in the Genus database with same CATH topology
2YQRA 1ZZKA 2NN6G 1K1GA 2JZXA 2BA0A 2MJHA 2CPQA 1DT4A 1ZTGA 3AEVB 4B8TA 3U1KA 4WANA 1J4WA 4IFDG 2CTLA 2PQUA 2ANNA 2Z0SA 2JA9A 3V69A 1ZZIA 4BA2I 2ANRA 1DTJA 1VIGA 2JEBI 1KHMA 1X4MA 2HH2A 2CTMA 2E3UA 4WALA 1J5KA 1EC6A 4QMFB 5K36G 2AXYA 2DGRA 3VKEA 4AIMA 2P2RA 2JE6I 2CTKA 4NBQA 4BA1I 1X4NA 2BL5A 4OO1G 2OPUA 2JEAI 2JVZA 1WE8A 1TUAA 4LIJA 1WVNA 2QNDA 2HH3A 3L7ZC 2PY9A 5JEAG 4JVHA 4JVYA 2CTJA 2CTEA 2CTFA 1VIHA 5C0XG 2OPVA 4AM3A 1ZZJA 2FMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQR A;  1ZZK A;  2NN6 G;  1K1G A;  2JZX A;  2BA0 A;  2MJH A;  2CPQ A;  1DT4 A;  1ZTG A;  3AEV B;  4B8T A;  3U1K A;  4WAN A;  1J4W A;  4IFD G;  2CTL A;  2PQU A;  2ANN A;  2Z0S A;  2JA9 A;  3V69 A;  1ZZI A;  4BA2 I;  2ANR A;  1DTJ A;  1VIG A;  2JEB I;  1KHM A;  1X4M A;  2HH2 A;  2CTM A;  2E3U A;  4WAL A;  1J5K A;  1EC6 A;  4QMF B;  5K36 G;  2AXY A;  2DGR A;  3VKE A;  4AIM A;  2P2R A;  2JE6 I;  2CTK A;  4NBQ A;  4BA1 I;  1X4N A;  2BL5 A;  4OO1 G;  2OPU A;  2JEA I;  2JVZ A;  1WE8 A;  1TUA A;  4LIJ A;  1WVN A;  2QND A;  2HH3 A;  3L7Z C;  2PY9 A;  5JEA G;  4JVH A;  4JVY A;  2CTJ A;  2CTE A;  2CTF A;  1VIH A;  5C0X G;  2OPV A;  4AM3 A;  1ZZJ A;  2FMR A; 
#chains in the Genus database with same CATH topology
 5FLX W;  1XRH A;  3OSS D;  5IT9 W;  2YQR A;  2JZX A;  2BA0 A;  3I0P A;  2VQE H;  2MJH A;  1I6U A;  3AEV B;  4B8T A;  2PT7 G;  3U1K A;  4LFA H;  4IFD G;  3KDK A;  1XMQ H;  1IBM H;  4BA2 I;  4B8C D;  2UU9 H;  3NCV A;  2G8Y A;  4B3S H;  1HNZ H;  4NXN H;  1VBI A;  4DR4 H;  2CTM A;  1XNR H;  4QMF B;  2E5L H;  3T1H H;  2JE6 I;  3OET A;  4NBQ A;  1X4N A;  2BL5 A;  3GKU A;  2CWH A;  2JVZ A;  4DV2 H;  1F0X A;  4DV1 H;  2K1H A;  1WHR A;  4G08 A;  3JAM W;  2PY9 A;  1SEI A;  4JVY A;  1AN7 A;  1N33 H;  2M8W A;  4YY3 H;  4DV7 H;  5LMU H;  2FPH X;  4DR6 H;  1X9Z A;  2HHH H;  2CPQ A;  1ZTG A;  1N36 H;  1PQX A;  4H8A A;  4WAN A;  3T1Y H;  2LTL A;  2UXD H;  1NXU A;  3RF2 A;  1HNX H;  4DUZ H;  1VIG A;  2JEB I;  5LMN H;  1KHM A;  1ODH A;  3GR5 A;  4JI2 H;  1J5K A;  2UUC H;  4LF5 H;  4OX9 H;  5K36 G;  2VKC A;  1J5E H;  4B3M H;  1MSZ A;  4BA1 I;  4DR1 H;  4JI0 H;  4PDB A;  4K0K H;  1XMO H;  4GKK H;  4DV0 H;  2JEA I;  3J81 W;  2UXC H;  3L7Z C;  2HH3 A;  4JI5 H;  5JEA G;  4JVH A;  1V9N A;  2ZM6 H;  4JYA H;  4X62 H;  5C0X G;  2CWF A;  4WAL A;  4EC5 A;  1S20 A;  5IWA H;  2LRR A;  1ZZK A;  2NN6 G;  5DT9 A;  1FKA H;  2A1S A;  1DT4 A;  4LF9 H;  2LTM A;  1J4W A;  2ANN A;  2PQU A;  1HR0 H;  3UOE A;  4JI4 H;  2JA9 A;  3OTO H;  1ZZI A;  4DV4 H;  2ANR A;  4AQY H;  2D9I A;  2VQF H;  4DV5 H;  1IBK H;  2ZQE A;  1WTJ A;  1X4M A;  2HH2 A;  2CPM A;  2O4C A;  3GAB A;  4FJS A;  4X66 H;  1FJG H;  2DGR A;  3VKE A;  4AIM A;  4DV3 H;  2CTK A;  5BR8 H;  4OO1 G;  2X06 A;  4DR5 H;  4JV5 H;  2OPU A;  1WE8 A;  2UUB H;  2QND A;  2CTE A;  2OPV A;  4DUY H;  4LF6 H;  1HNW H;  2FMR A;  4LIJ A;  4LF7 H;  3J7A K;  4JI8 H;  1Z2I A;  2M6Q A;  4KHP H;  4GKJ H;  4DR3 H;  4NXM H;  4LFB H;  1K1G A;  2FFM A;  4B3T H;  4OCH A;  4LF8 H;  2LF0 A;  4DR2 H;  2UUA H;  1X0A A;  2F4V H;  2UXB H;  1V8C A;  2CTL A;  3SB1 A;  4E9J A;  4LF4 H;  2Z0S A;  3V69 A;  3KDG A;  3FAU A;  4JI3 H;  5LL6 b;  1DTJ A;  2Y3M A;  5A2Q W;  4X64 H;  4X65 H;  4DV6 H;  4JI6 H;  2E3U A;  4OD6 A;  1EC6 A;  2AXY A;  4DR7 H;  4NZR M;  1IBL H;  4FJU A;  2P2R A;  4JI7 H;  4LFC H;  3EZJ A;  1XNQ H;  3QD7 X;  1S03 G;  1N32 H;  1UG8 A;  4JI1 H;  4YHH H;  1TUA A;  3J80 W;  1WVN A;  1I94 H;  2CTJ A;  4B3R H;  2CTF A;  1VIH A;  4AM3 A;  1N34 H;  4NZT M;  1ZZJ A; 
#chains in the Genus database with same CATH homology
 2YQR A;  1ZZK A;  2NN6 G;  1K1G A;  2JZX A;  2BA0 A;  2MJH A;  2CPQ A;  1DT4 A;  1ZTG A;  3AEV B;  4B8T A;  3U1K A;  4WAN A;  1J4W A;  4IFD G;  2CTL A;  2PQU A;  2ANN A;  2Z0S A;  2JA9 A;  3V69 A;  1ZZI A;  4BA2 I;  2ANR A;  1DTJ A;  1VIG A;  2JEB I;  1KHM A;  1X4M A;  2HH2 A;  2CTM A;  2E3U A;  4WAL A;  1J5K A;  1EC6 A;  4QMF B;  5K36 G;  2AXY A;  2DGR A;  3VKE A;  4AIM A;  2P2R A;  2JE6 I;  2CTK A;  4NBQ A;  4BA1 I;  1X4N A;  2BL5 A;  4OO1 G;  2OPU A;  2JEA I;  2JVZ A;  1WE8 A;  1TUA A;  4LIJ A;  1WVN A;  2QND A;  2HH3 A;  3L7Z C;  2PY9 A;  5JEA G;  4JVH A;  4JVY A;  2CTJ A;  2CTE A;  2CTF A;  1VIH A;  5C0X G;  2OPV A;  4AM3 A;  1ZZJ A;  2FMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...