2CTMA

Solution structure of the 14th kh type i domain from human vigilin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
b'GSSGSSGRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLADSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vigilin
molecule tags Transport protein, rna binding protein
source organism Homo sapiens
publication title Solution structure of the 14th KH type I domain from human Vigilin
rcsb
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2ctmA00
2JA9A 1DT4A 1ZTGA 5K36G 4AIMA 1VIGA 2HH3A 4BA2I 1X4MA 3L7ZC 4BA1I 2CTKA 1X4NA 2BL5A 4AM3A 2QNDA 4JVHA 1K1GA 3VKEA 2JEAI 4WANA 2ANRA 2BA0A 2CTFA 2JVZA 2CPQA 2DGRA 4OO1G 2JZXA 2JE6I 2OPVA 4WALA 4QMFB 2CTMA 4IFDG 2CTEA 2FMRA 3AEVB 1KHMA 2CTLA 3V69A 2P2RA 1WE8A 2OPUA 2JEBI 5JEAG 2ANNA 2Z0SA 5C0XG 2NN6G 1ZZIA 2HH2A 1WVNA 1EC6A 4LIJA 2PY9A 4JVYA 4NBQA 3U1KA 1J4WA 2MJHA 1ZZJA 1DTJA 2CTJA 2AXYA 1TUAA 1ZZKA 2E3UA 1VIHA 2YQRA 1J5KA 2PQUA 4B8TA
chains in the Genus database with same CATH superfamily
1X0AA 2D9IA 3GKUA 4B3SH 1HNXH 2LTMA 4JI8H 2PT7G 2BL5A 2QNDA 4KHPH 1HR0H 2VKCA 1FJGH 3J81W 1N33H 2CTFA 2JVZA 2UXBH 2JE6I 4EC5A 4DV7H 4LFBH 4IFDG 2CTEA 2F4VH 3OSSD 4OX9H 2FFMA 4DR1H 2P2RA 2OPUA 1V9NA 1IBKH 5C0XG 2FPHX 2NN6G 4K0KH 2LTLA 1WHRA 5LMNH 4JI6H 4OD6A 5A2QW 4X66H 1HNZH 1N36H 4JI2H 2UU9H 1TUAA 1MSZA 4B3RH 1F0XA 2UXDH 4JI3H 2YQRA 1XMOH 2UUBH 1J5KA 3J80W 2JA9A 4B3TH 2UXCH 4YY3H 2HH3A 1X4MA 4YHHH 5BR8H 4DV5H 1X4NA 2CWHA 5IWAH 3T1HH 3VKEA 4DV4H 2LRRA 1PQXA 4WANA 2ANRA 2CPQA 2DGRA 4B3MH 5IT9W 4X62H 1VBIA 4WALA 3T1YH 2CTMA 2HHHH 4DR2H 3SB1A 4LF8H 3GABA 1WE8A 2LF0A 1I94H 2JEBI 4DUYH 1EC6A 4DR7H 2O4CA 1S03G 2A1SA 3U1KA 5DT9A 1J4WA 2MJHA 4FJUA 2AXYA 4JI0H 4PDBA 4X64H 4LF5H 2E3UA 3KDKA 4JI7H 4LF7H 1I6UA 3GR5A 4JVYA 4B8CD 2K1HA 4X65H 2PQUA 1DT4A 3OETA 1NXUA 3NCVA 3RF2A 4AIMA 5K36G 4BA2I 3UOEA 4H8AA 2CTKA 4FJSA 1XNQH 4AM3A 4OCHA 3J7AK 4OO1G 2BA0A 2VQFH 5LMUH 4NZTM 3JAMW 1XMQH 4NXNH 1X9ZA 2OPVA 4QMFB 4LFAH 3AEVB 1KHMA 2CTLA 3V69A 1S20A 2UUAH 1SEIA 1XNRH 5JEAG 4LF4H 2Y3MA 1FKAH 1ZZIA 1WVNA 2M6QA 1IBMH 4JV5H 2UUCH 2G8YA 4LFCH 3QD7X 4NBQA 2PY9A 4JI5H 1V8CA 4DV3H 1ZZJA 2ZQEA 1AN7A 3I0PA 4E9JA 4DV6H 4NXMH 1ZTGA 1IBLH 5LL6b 1VIGA 3FAUA 2CWFA 3L7ZC 4GKJH 4BA1I 1Z2IA 1UG8A 4DR5H 4JVHA 2CPMA 1K1GA 2JEAI 4NZRM 4LF9H 1XRHA 3EZJA 2JZXA 4JI1H 4DV0H 4GKKH 4DR3H 4JYAH 4LF6H 4DV2H 2FMRA 4AQYH 4DR6H 1WTJA 5FLXW 4G08A 3OTOH 1N34H 2ANNA 2Z0SA 4DV1H 4JI4H 4DR4H 2ZM6H 1ODHA 2M8WA 2HH2A 4LIJA 1HNWH 4DUZH 1DTJA 2CTJA 2X06A 1J5EH 1ZZKA 1VIHA 3KDGA 2VQEH 2E5LH 1N32H 4B8TA
chains in the Genus database with same CATH topology
2JA9A 1DT4A 1ZTGA 5K36G 4AIMA 1VIGA 2HH3A 4BA2I 1X4MA 3L7ZC 4BA1I 2CTKA 1X4NA 2BL5A 4AM3A 2QNDA 4JVHA 1K1GA 3VKEA 2JEAI 4WANA 2ANRA 2BA0A 2CTFA 2JVZA 2CPQA 2DGRA 4OO1G 2JZXA 2JE6I 2OPVA 4WALA 4QMFB 2CTMA 4IFDG 2CTEA 2FMRA 3AEVB 1KHMA 2CTLA 3V69A 2P2RA 1WE8A 2OPUA 2JEBI 5JEAG 2ANNA 2Z0SA 5C0XG 2NN6G 1ZZIA 2HH2A 1WVNA 1EC6A 4LIJA 2PY9A 4JVYA 4NBQA 3U1KA 1J4WA 2MJHA 1ZZJA 1DTJA 2CTJA 2AXYA 1TUAA 1ZZKA 2E3UA 1VIHA 2YQRA 1J5KA 2PQUA 4B8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA9 A;  1DT4 A;  1ZTG A;  5K36 G;  4AIM A;  1VIG A;  2HH3 A;  4BA2 I;  1X4M A;  3L7Z C;  4BA1 I;  2CTK A;  1X4N A;  2BL5 A;  4AM3 A;  2QND A;  4JVH A;  1K1G A;  3VKE A;  2JEA I;  4WAN A;  2ANR A;  2BA0 A;  2CTF A;  2JVZ A;  2CPQ A;  2DGR A;  4OO1 G;  2JZX A;  2JE6 I;  2OPV A;  4WAL A;  4QMF B;  2CTM A;  4IFD G;  2CTE A;  2FMR A;  3AEV B;  1KHM A;  2CTL A;  3V69 A;  2P2R A;  1WE8 A;  2OPU A;  2JEB I;  5JEA G;  2ANN A;  2Z0S A;  5C0X G;  2NN6 G;  1ZZI A;  2HH2 A;  1WVN A;  1EC6 A;  4LIJ A;  2PY9 A;  4JVY A;  4NBQ A;  3U1K A;  1J4W A;  2MJH A;  1ZZJ A;  1DTJ A;  2CTJ A;  2AXY A;  1TUA A;  1ZZK A;  2E3U A;  1VIH A;  2YQR A;  1J5K A;  2PQU A;  4B8T A; 
#chains in the Genus database with same CATH topology
 1X0A A;  2D9I A;  3GKU A;  4B3S H;  1HNX H;  2LTM A;  4JI8 H;  2PT7 G;  2BL5 A;  2QND A;  4KHP H;  1HR0 H;  2VKC A;  1FJG H;  3J81 W;  1N33 H;  2CTF A;  2JVZ A;  2UXB H;  2JE6 I;  4EC5 A;  4DV7 H;  4LFB H;  4IFD G;  2CTE A;  2F4V H;  3OSS D;  4OX9 H;  2FFM A;  4DR1 H;  2P2R A;  2OPU A;  1V9N A;  1IBK H;  5C0X G;  2FPH X;  2NN6 G;  4K0K H;  2LTL A;  1WHR A;  5LMN H;  4JI6 H;  4OD6 A;  5A2Q W;  4X66 H;  1HNZ H;  1N36 H;  4JI2 H;  2UU9 H;  1TUA A;  1MSZ A;  4B3R H;  1F0X A;  2UXD H;  4JI3 H;  2YQR A;  1XMO H;  2UUB H;  1J5K A;  3J80 W;  2JA9 A;  4B3T H;  2UXC H;  4YY3 H;  2HH3 A;  1X4M A;  4YHH H;  5BR8 H;  4DV5 H;  1X4N A;  2CWH A;  5IWA H;  3T1H H;  3VKE A;  4DV4 H;  2LRR A;  1PQX A;  4WAN A;  2ANR A;  2CPQ A;  2DGR A;  4B3M H;  5IT9 W;  4X62 H;  1VBI A;  4WAL A;  3T1Y H;  2CTM A;  2HHH H;  4DR2 H;  3SB1 A;  4LF8 H;  3GAB A;  1WE8 A;  2LF0 A;  1I94 H;  2JEB I;  4DUY H;  1EC6 A;  4DR7 H;  2O4C A;  1S03 G;  2A1S A;  3U1K A;  5DT9 A;  1J4W A;  2MJH A;  4FJU A;  2AXY A;  4JI0 H;  4PDB A;  4X64 H;  4LF5 H;  2E3U A;  3KDK A;  4JI7 H;  4LF7 H;  1I6U A;  3GR5 A;  4JVY A;  4B8C D;  2K1H A;  4X65 H;  2PQU A;  1DT4 A;  3OET A;  1NXU A;  3NCV A;  3RF2 A;  4AIM A;  5K36 G;  4BA2 I;  3UOE A;  4H8A A;  2CTK A;  4FJS A;  1XNQ H;  4AM3 A;  4OCH A;  3J7A K;  4OO1 G;  2BA0 A;  2VQF H;  5LMU H;  4NZT M;  3JAM W;  1XMQ H;  4NXN H;  1X9Z A;  2OPV A;  4QMF B;  4LFA H;  3AEV B;  1KHM A;  2CTL A;  3V69 A;  1S20 A;  2UUA H;  1SEI A;  1XNR H;  5JEA G;  4LF4 H;  2Y3M A;  1FKA H;  1ZZI A;  1WVN A;  2M6Q A;  1IBM H;  4JV5 H;  2UUC H;  2G8Y A;  4LFC H;  3QD7 X;  4NBQ A;  2PY9 A;  4JI5 H;  1V8C A;  4DV3 H;  1ZZJ A;  2ZQE A;  1AN7 A;  3I0P A;  4E9J A;  4DV6 H;  4NXM H;  1ZTG A;  1IBL H;  5LL6 b;  1VIG A;  3FAU A;  2CWF A;  3L7Z C;  4GKJ H;  4BA1 I;  1Z2I A;  1UG8 A;  4DR5 H;  4JVH A;  2CPM A;  1K1G A;  2JEA I;  4NZR M;  4LF9 H;  1XRH A;  3EZJ A;  2JZX A;  4JI1 H;  4DV0 H;  4GKK H;  4DR3 H;  4JYA H;  4LF6 H;  4DV2 H;  2FMR A;  4AQY H;  4DR6 H;  1WTJ A;  5FLX W;  4G08 A;  3OTO H;  1N34 H;  2ANN A;  2Z0S A;  4DV1 H;  4JI4 H;  4DR4 H;  2ZM6 H;  1ODH A;  2M8W A;  2HH2 A;  4LIJ A;  1HNW H;  4DUZ H;  1DTJ A;  2CTJ A;  2X06 A;  1J5E H;  1ZZK A;  1VIH A;  3KDG A;  2VQE H;  2E5L H;  1N32 H;  4B8T A; 
#chains in the Genus database with same CATH homology
 2JA9 A;  1DT4 A;  1ZTG A;  5K36 G;  4AIM A;  1VIG A;  2HH3 A;  4BA2 I;  1X4M A;  3L7Z C;  4BA1 I;  2CTK A;  1X4N A;  2BL5 A;  4AM3 A;  2QND A;  4JVH A;  1K1G A;  3VKE A;  2JEA I;  4WAN A;  2ANR A;  2BA0 A;  2CTF A;  2JVZ A;  2CPQ A;  2DGR A;  4OO1 G;  2JZX A;  2JE6 I;  2OPV A;  4WAL A;  4QMF B;  2CTM A;  4IFD G;  2CTE A;  2FMR A;  3AEV B;  1KHM A;  2CTL A;  3V69 A;  2P2R A;  1WE8 A;  2OPU A;  2JEB I;  5JEA G;  2ANN A;  2Z0S A;  5C0X G;  2NN6 G;  1ZZI A;  2HH2 A;  1WVN A;  1EC6 A;  4LIJ A;  2PY9 A;  4JVY A;  4NBQ A;  3U1K A;  1J4W A;  2MJH A;  1ZZJ A;  1DTJ A;  2CTJ A;  2AXY A;  1TUA A;  1ZZK A;  2E3U A;  1VIH A;  2YQR A;  1J5K A;  2PQU A;  4B8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...