2CTMA

Solution structure of the 14th kh type i domain from human vigilin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
b'GSSGSSGRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLADSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vigilin
publication title Solution structure of the 14th KH type I domain from human Vigilin
rcsb
source organism Homo sapiens
molecule tags Transport protein, rna binding protein
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2ctmA00
1WE8A 4JVYA 2JEBI 2CTEA 4WALA 4BA1I 2BL5A 1ZZJA 2CTLA 2CTMA 2DGRA 2OPUA 1ZZIA 2JE6I 1VIGA 2AXYA 1VIHA 2BA0A 2PY9A 1EC6A 1J4WA 4AM3A 1J5KA 3VKEA 2JEAI 2YQRA 5C0XG 1X4NA 2MJHA 2CPQA 1ZTGA 2P2RA 2PQUA 1TUAA 1WVNA 4WANA 2JZXA 1ZZKA 2Z0SA 2HH3A 1X4MA 2JVZA 3L7ZC 3U1KA 1K1GA 2ANRA 2OPVA 1DT4A 2ANNA 4B8TA 2CTFA 2QNDA 4LIJA 4AIMA 2FMRA 4JVHA 2CTJA 3V69A 3AEVB 1DTJA 1KHMA 4BA2I 4NBQA 5K36G 2NN6G 2JA9A 5JEAG 2HH2A 4OO1G 4IFDG 2CTKA 2E3UA 4QMFB
chains in the Genus database with same CATH superfamily
4JVYA 2CTEA 1WHRA 4DV0H 2UXBH 3J81W 3T1YH 4YY3H 2UXCH 3SB1A 2G8YA 2VQFH 2F4VH 4JI3H 1N33H 4AM3A 2UU9H 4X64H 4FJSA 3J7AK 1N36H 1XNQH 4GKJH 1N34H 4LF7H 1Z2IA 1NXUA 5LL6b 2PQUA 1HNWH 4WANA 2JZXA 1AN7A 2HH3A 2JVZA 3U1KA 4NXNH 1IBLH 2A1SA 5IT9W 4JI1H 1HNXH 3UOEA 1DTJA 2LTLA 5BR8H 1HNZH 3J80W 4DR3H 2NN6G 5JEAG 4IFDG 2CWHA 2CTKA 4JI2H 1J4WA 4QMFB 1WE8A 2E5LH 2LRRA 4DR1H 1S03G 4BA2I 4LFBH 4WALA 1XMQH 2CTMA 1X0AA 2DGRA 1IBMH 2UUCH 3FAUA 4B3SH 4JI5H 4YHHH 4LF5H 4KHPH 2UXDH 1VIGA 4DV6H 1VIHA 2CPMA 4G08A 4OX9H 2Y3MA 4EC5A 2FPHX 1I94H 4DV7H 1J5KA 1I6UA 4DR5H 4LFCH 2YQRA 2MJHA 2ZM6H 4DUYH 4B3MH 4FJUA 4DV1H 4K0KH 4X65H 2ANRA 4DV3H 1XMOH 1N32H 1DT4A 2O4CA 2ANNA 2D9IA 4DUZH 2CTFA 4LIJA 4AIMA 4JV5H 2FMRA 3OTOH 3RF2A 3V69A 3AEVB 5FLXW 2PT7G 1VBIA 1V9NA 4DR7H 3GR5A 2QNDA 1S20A 4DR6H 4JI4H 4NZTM 4BA1I 2BL5A 2LTMA 2CTLA 1MSZA 4NZRM 1SEIA 1V8CA 1X9ZA 2AXYA 4B3RH 1EC6A 4H8AA 5LMUH 4DV2H 2UUBH 2M8WA 1ODHA 2M6QA 2JEAI 5C0XG 1ZTGA 2P2RA 5LMNH 1WVNA 4LFAH 2CWFA 1UG8A 3L7ZC 2LF0A 3OETA 4GKKH 1PQXA 3NCVA 4DV5H 4B8TA 4DR2H 4JVHA 2CTJA 1KHMA 4DV4H 2ZQEA 4NBQA 5K36G 1XRHA 4JI6H 1IBKH 2FFMA 4JI0H 2E3UA 5IWAH 4AQYH 4E9JA 2JEBI 2X06A 3QD7X 5A2QW 4JI7H 1XNRH 1ZZJA 4LF8H 1FKAH 2UUAH 1HR0H 2OPUA 1ZZIA 2JE6I 3KDGA 3EZJA 2PY9A 3GKUA 1WTJA 1F0XA 4NXMH 3VKEA 5DT9A 4JI8H 3OSSD 1X4NA 4OCHA 4DR4H 2CPQA 4X62H 1TUAA 4LF4H 3JAMW 1ZZKA 2Z0SA 2VKCA 1X4MA 1K1GA 3T1HH 2OPVA 2K1HA 4LF9H 4X66H 1J5EH 2VQEH 1FJGH 3KDKA 4LF6H 4OD6A 3GABA 4B8CD 4B3TH 4PDBA 4OO1G 2JA9A 2HH2A 4JYAH 2HHHH 2BA0A 3I0PA
chains in the Genus database with same CATH topology
1WE8A 4JVYA 2JEBI 2CTEA 4WALA 4BA1I 2BL5A 1ZZJA 2CTLA 2CTMA 2DGRA 2OPUA 1ZZIA 2JE6I 1VIGA 2AXYA 1VIHA 2BA0A 2PY9A 1EC6A 1J4WA 4AM3A 1J5KA 3VKEA 2JEAI 2YQRA 5C0XG 1X4NA 2MJHA 2CPQA 1ZTGA 2P2RA 2PQUA 1TUAA 1WVNA 4WANA 2JZXA 1ZZKA 2Z0SA 2HH3A 1X4MA 2JVZA 3L7ZC 3U1KA 1K1GA 2ANRA 2OPVA 1DT4A 2ANNA 4B8TA 2CTFA 2QNDA 4LIJA 4AIMA 2FMRA 4JVHA 2CTJA 3V69A 3AEVB 1DTJA 1KHMA 4BA2I 4NBQA 5K36G 2NN6G 2JA9A 5JEAG 2HH2A 4OO1G 4IFDG 2CTKA 2E3UA 4QMFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WE8 A;  4JVY A;  2JEB I;  2CTE A;  4WAL A;  4BA1 I;  2BL5 A;  1ZZJ A;  2CTL A;  2CTM A;  2DGR A;  2OPU A;  1ZZI A;  2JE6 I;  1VIG A;  2AXY A;  1VIH A;  2BA0 A;  2PY9 A;  1EC6 A;  1J4W A;  4AM3 A;  1J5K A;  3VKE A;  2JEA I;  2YQR A;  5C0X G;  1X4N A;  2MJH A;  2CPQ A;  1ZTG A;  2P2R A;  2PQU A;  1TUA A;  1WVN A;  4WAN A;  2JZX A;  1ZZK A;  2Z0S A;  2HH3 A;  1X4M A;  2JVZ A;  3L7Z C;  3U1K A;  1K1G A;  2ANR A;  2OPV A;  1DT4 A;  2ANN A;  4B8T A;  2CTF A;  2QND A;  4LIJ A;  4AIM A;  2FMR A;  4JVH A;  2CTJ A;  3V69 A;  3AEV B;  1DTJ A;  1KHM A;  4BA2 I;  4NBQ A;  5K36 G;  2NN6 G;  2JA9 A;  5JEA G;  2HH2 A;  4OO1 G;  4IFD G;  2CTK A;  2E3U A;  4QMF B; 
#chains in the Genus database with same CATH topology
 4JVY A;  2CTE A;  1WHR A;  4DV0 H;  2UXB H;  3J81 W;  3T1Y H;  4YY3 H;  2UXC H;  3SB1 A;  2G8Y A;  2VQF H;  2F4V H;  4JI3 H;  1N33 H;  4AM3 A;  2UU9 H;  4X64 H;  4FJS A;  3J7A K;  1N36 H;  1XNQ H;  4GKJ H;  1N34 H;  4LF7 H;  1Z2I A;  1NXU A;  5LL6 b;  2PQU A;  1HNW H;  4WAN A;  2JZX A;  1AN7 A;  2HH3 A;  2JVZ A;  3U1K A;  4NXN H;  1IBL H;  2A1S A;  5IT9 W;  4JI1 H;  1HNX H;  3UOE A;  1DTJ A;  2LTL A;  5BR8 H;  1HNZ H;  3J80 W;  4DR3 H;  2NN6 G;  5JEA G;  4IFD G;  2CWH A;  2CTK A;  4JI2 H;  1J4W A;  4QMF B;  1WE8 A;  2E5L H;  2LRR A;  4DR1 H;  1S03 G;  4BA2 I;  4LFB H;  4WAL A;  1XMQ H;  2CTM A;  1X0A A;  2DGR A;  1IBM H;  2UUC H;  3FAU A;  4B3S H;  4JI5 H;  4YHH H;  4LF5 H;  4KHP H;  2UXD H;  1VIG A;  4DV6 H;  1VIH A;  2CPM A;  4G08 A;  4OX9 H;  2Y3M A;  4EC5 A;  2FPH X;  1I94 H;  4DV7 H;  1J5K A;  1I6U A;  4DR5 H;  4LFC H;  2YQR A;  2MJH A;  2ZM6 H;  4DUY H;  4B3M H;  4FJU A;  4DV1 H;  4K0K H;  4X65 H;  2ANR A;  4DV3 H;  1XMO H;  1N32 H;  1DT4 A;  2O4C A;  2ANN A;  2D9I A;  4DUZ H;  2CTF A;  4LIJ A;  4AIM A;  4JV5 H;  2FMR A;  3OTO H;  3RF2 A;  3V69 A;  3AEV B;  5FLX W;  2PT7 G;  1VBI A;  1V9N A;  4DR7 H;  3GR5 A;  2QND A;  1S20 A;  4DR6 H;  4JI4 H;  4NZT M;  4BA1 I;  2BL5 A;  2LTM A;  2CTL A;  1MSZ A;  4NZR M;  1SEI A;  1V8C A;  1X9Z A;  2AXY A;  4B3R H;  1EC6 A;  4H8A A;  5LMU H;  4DV2 H;  2UUB H;  2M8W A;  1ODH A;  2M6Q A;  2JEA I;  5C0X G;  1ZTG A;  2P2R A;  5LMN H;  1WVN A;  4LFA H;  2CWF A;  1UG8 A;  3L7Z C;  2LF0 A;  3OET A;  4GKK H;  1PQX A;  3NCV A;  4DV5 H;  4B8T A;  4DR2 H;  4JVH A;  2CTJ A;  1KHM A;  4DV4 H;  2ZQE A;  4NBQ A;  5K36 G;  1XRH A;  4JI6 H;  1IBK H;  2FFM A;  4JI0 H;  2E3U A;  5IWA H;  4AQY H;  4E9J A;  2JEB I;  2X06 A;  3QD7 X;  5A2Q W;  4JI7 H;  1XNR H;  1ZZJ A;  4LF8 H;  1FKA H;  2UUA H;  1HR0 H;  2OPU A;  1ZZI A;  2JE6 I;  3KDG A;  3EZJ A;  2PY9 A;  3GKU A;  1WTJ A;  1F0X A;  4NXM H;  3VKE A;  5DT9 A;  4JI8 H;  3OSS D;  1X4N A;  4OCH A;  4DR4 H;  2CPQ A;  4X62 H;  1TUA A;  4LF4 H;  3JAM W;  1ZZK A;  2Z0S A;  2VKC A;  1X4M A;  1K1G A;  3T1H H;  2OPV A;  2K1H A;  4LF9 H;  4X66 H;  1J5E H;  2VQE H;  1FJG H;  3KDK A;  4LF6 H;  4OD6 A;  3GAB A;  4B8C D;  4B3T H;  4PDB A;  4OO1 G;  2JA9 A;  2HH2 A;  4JYA H;  2HHH H;  2BA0 A;  3I0P A; 
#chains in the Genus database with same CATH homology
 1WE8 A;  4JVY A;  2JEB I;  2CTE A;  4WAL A;  4BA1 I;  2BL5 A;  1ZZJ A;  2CTL A;  2CTM A;  2DGR A;  2OPU A;  1ZZI A;  2JE6 I;  1VIG A;  2AXY A;  1VIH A;  2BA0 A;  2PY9 A;  1EC6 A;  1J4W A;  4AM3 A;  1J5K A;  3VKE A;  2JEA I;  2YQR A;  5C0X G;  1X4N A;  2MJH A;  2CPQ A;  1ZTG A;  2P2R A;  2PQU A;  1TUA A;  1WVN A;  4WAN A;  2JZX A;  1ZZK A;  2Z0S A;  2HH3 A;  1X4M A;  2JVZ A;  3L7Z C;  3U1K A;  1K1G A;  2ANR A;  2OPV A;  1DT4 A;  2ANN A;  4B8T A;  2CTF A;  2QND A;  4LIJ A;  4AIM A;  2FMR A;  4JVH A;  2CTJ A;  3V69 A;  3AEV B;  1DTJ A;  1KHM A;  4BA2 I;  4NBQ A;  5K36 G;  2NN6 G;  2JA9 A;  5JEA G;  2HH2 A;  4OO1 G;  4IFD G;  2CTK A;  2E3U A;  4QMF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...