2CTMA

Solution structure of the 14th kh type i domain from human vigilin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
GSSGSSGRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLADSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vigilin
publication title Solution structure of the 14th KH type I domain from human Vigilin
rcsb
source organism Homo sapiens
molecule tags Transport protein, rna binding protein
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2ctmA00
2BA0A 1VIHA 1ZTGA 2JEAI 2JA9A 2ANRA 2NN6G 1WE8A 4BA1I 4NBQA 4WALA 4BA2I 2PQUA 2CPQA 4AIMA 2HH3A 4IFDG 1X4MA 3L7ZC 2MJHA 2E3UA 2CTKA 2JEBI 2OPUA 1DT4A 2AXYA 1J4WA 2ANNA 3VKEA 4JVYA 2OPVA 2CTJA 1EC6A 4WANA 2CTEA 1ZZKA 4B8TA 3U1KA 5JEAG 1KHMA 1X4NA 1WVNA 2PY9A 4LIJA 1TUAA 2FMRA 2JE6I 2JVZA 2CTFA 2P2RA 3AEVB 1ZZJA 2HH2A 2YQRA 5C0XG 4JVHA 4QMFB 3V69A 1J5KA 2QNDA 2BL5A 2Z0SA 2JZXA 1DTJA 1ZZIA 5K36G 2DGRA 4OO1G 2CTLA 1VIGA 2CTMA 1K1GA 4AM3A
chains in the Genus database with same CATH superfamily
2BA0A 4B3TH 4JI8H 1VIHA 3UOEA 2D9IA 2JEAI 2CPMA 2PQUA 2UXDH 3L7ZC 2UXCH 2LRRA 5DT9A 4YY3H 1VBIA 3GKUA 4LF5H 4DV2H 1PQXA 3VKEA 4WANA 2CTJA 1WTJA 4B8TA 2CWHA 4DV0H 3OTOH 4LIJA 4OD6A 1J5EH 2ZQEA 1S03G 4LFBH 2CTFA 5C0XG 4JVHA 3V69A 3T1HH 3RF2A 5IT9W 2BL5A 1XNRH 4DV7H 1XNQH 2DGRA 2E5LH 2CTLA 2CTMA 4DR5H 4DV6H 2F4VH 1UG8A 2UUCH 2VQFH 2NN6G 1HNZH 4GKJH 4BA2I 2VKCA 2UXBH 2G8YA 2MJHA 1I6UA 2E3UA 1HNWH 4JI6H 2CTKA 2JEBI 5LMNH 1DT4A 2A1SA 2FFMA 4X65H 2AXYA 1S20A 1J4WA 4DUYH 4DV3H 1EC6A 1ZZKA 4DR4H 4LF8H 4B8CD 1AN7A 1XRHA 3OSSD 4H8AA 2LF0A 5IWAH 3T1YH 2JE6I 2JVZA 4X66H 1ODHA 3GR5A 4PDBA 4X62H 4OX9H 1V8CA 2O4CA 4X64H 4JI5H 4LF9H 3JAMW 1J5KA 1FJGH 1DTJA 1N34H 1IBKH 1MSZA 3KDGA 2M6QA 3EZJA 1IBMH 4NXNH 2CWFA 4JV5H 1ZTGA 1SEIA 5A2QW 1WE8A 4BA1I 4JI2H 4NBQA 4WALA 4DV1H 4DV5H 1V9NA 4JI4H 2CPQA 4EC5A 4IFDG 4YHHH 4DUZH 4JYAH 3QD7X 1XMQH 2OPUA 4G08A 2X06A 2ZM6H 2ANNA 2Y3MA 2CTEA 4LF4H 4GKKH 4LF7H 2UUBH 2K1HA 3U1KA 3OETA 1I94H 4NZTM 1X4NA 2LTLA 4JI3H 4KHPH 1N36H 1TUAA 4DR6H 3GABA 1F0XA 3J80W 3I0PA 2UUAH 1HR0H 4NXMH 4OCHA 4DR3H 2YQRA 4LF6H 3J7AK 4QMFB 1N32H 2QNDA 2Z0SA 3KDKA 2JZXA 1ZZIA 1IBLH 4B3SH 1Z2IA 4JI1H 1HNXH 4JI0H 4B3RH 3J81W 1KHMA 4B3MH 1K1GA 2HHHH 5K36G 3NCVA 4LFCH 2PT7G 4DR2H 2JA9A 2ANRA 2FPHX 4DR1H 1X9ZA 2VQEH 4AIMA 2HH3A 5BR8H 1X4MA 4E9JA 1X0AA 3FAUA 4JVYA 2OPVA 2UU9H 4FJSA 2LTMA 1N33H 5JEAG 4K0KH 1WVNA 3SB1A 5LL6b 2PY9A 2FMRA 4NZRM 2M8WA 3AEVB 2P2RA 5LMUH 1ZZJA 1NXUA 2HH2A 1XMOH 5FLXW 4JI7H 4LFAH 4FJUA 4DR7H 4OO1G 1WHRA 1VIGA 4DV4H 4AQYH 4AM3A 1FKAH
chains in the Genus database with same CATH topology
2BA0A 1VIHA 1ZTGA 2JEAI 2JA9A 2ANRA 2NN6G 1WE8A 4BA1I 4NBQA 4WALA 4BA2I 2PQUA 2CPQA 4AIMA 2HH3A 4IFDG 1X4MA 3L7ZC 2MJHA 2E3UA 2CTKA 2JEBI 2OPUA 1DT4A 2AXYA 1J4WA 2ANNA 3VKEA 4JVYA 2OPVA 2CTJA 1EC6A 4WANA 2CTEA 1ZZKA 4B8TA 3U1KA 5JEAG 1KHMA 1X4NA 1WVNA 2PY9A 4LIJA 1TUAA 2FMRA 2JE6I 2JVZA 2CTFA 2P2RA 3AEVB 1ZZJA 2HH2A 2YQRA 5C0XG 4JVHA 4QMFB 3V69A 1J5KA 2QNDA 2BL5A 2Z0SA 2JZXA 1DTJA 1ZZIA 5K36G 2DGRA 4OO1G 2CTLA 1VIGA 2CTMA 1K1GA 4AM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA0 A;  1VIH A;  1ZTG A;  2JEA I;  2JA9 A;  2ANR A;  2NN6 G;  1WE8 A;  4BA1 I;  4NBQ A;  4WAL A;  4BA2 I;  2PQU A;  2CPQ A;  4AIM A;  2HH3 A;  4IFD G;  1X4M A;  3L7Z C;  2MJH A;  2E3U A;  2CTK A;  2JEB I;  2OPU A;  1DT4 A;  2AXY A;  1J4W A;  2ANN A;  3VKE A;  4JVY A;  2OPV A;  2CTJ A;  1EC6 A;  4WAN A;  2CTE A;  1ZZK A;  4B8T A;  3U1K A;  5JEA G;  1KHM A;  1X4N A;  1WVN A;  2PY9 A;  4LIJ A;  1TUA A;  2FMR A;  2JE6 I;  2JVZ A;  2CTF A;  2P2R A;  3AEV B;  1ZZJ A;  2HH2 A;  2YQR A;  5C0X G;  4JVH A;  4QMF B;  3V69 A;  1J5K A;  2QND A;  2BL5 A;  2Z0S A;  2JZX A;  1DTJ A;  1ZZI A;  5K36 G;  2DGR A;  4OO1 G;  2CTL A;  1VIG A;  2CTM A;  1K1G A;  4AM3 A; 
#chains in the Genus database with same CATH topology
 2BA0 A;  4B3T H;  4JI8 H;  1VIH A;  3UOE A;  2D9I A;  2JEA I;  2CPM A;  2PQU A;  2UXD H;  3L7Z C;  2UXC H;  2LRR A;  5DT9 A;  4YY3 H;  1VBI A;  3GKU A;  4LF5 H;  4DV2 H;  1PQX A;  3VKE A;  4WAN A;  2CTJ A;  1WTJ A;  4B8T A;  2CWH A;  4DV0 H;  3OTO H;  4LIJ A;  4OD6 A;  1J5E H;  2ZQE A;  1S03 G;  4LFB H;  2CTF A;  5C0X G;  4JVH A;  3V69 A;  3T1H H;  3RF2 A;  5IT9 W;  2BL5 A;  1XNR H;  4DV7 H;  1XNQ H;  2DGR A;  2E5L H;  2CTL A;  2CTM A;  4DR5 H;  4DV6 H;  2F4V H;  1UG8 A;  2UUC H;  2VQF H;  2NN6 G;  1HNZ H;  4GKJ H;  4BA2 I;  2VKC A;  2UXB H;  2G8Y A;  2MJH A;  1I6U A;  2E3U A;  1HNW H;  4JI6 H;  2CTK A;  2JEB I;  5LMN H;  1DT4 A;  2A1S A;  2FFM A;  4X65 H;  2AXY A;  1S20 A;  1J4W A;  4DUY H;  4DV3 H;  1EC6 A;  1ZZK A;  4DR4 H;  4LF8 H;  4B8C D;  1AN7 A;  1XRH A;  3OSS D;  4H8A A;  2LF0 A;  5IWA H;  3T1Y H;  2JE6 I;  2JVZ A;  4X66 H;  1ODH A;  3GR5 A;  4PDB A;  4X62 H;  4OX9 H;  1V8C A;  2O4C A;  4X64 H;  4JI5 H;  4LF9 H;  3JAM W;  1J5K A;  1FJG H;  1DTJ A;  1N34 H;  1IBK H;  1MSZ A;  3KDG A;  2M6Q A;  3EZJ A;  1IBM H;  4NXN H;  2CWF A;  4JV5 H;  1ZTG A;  1SEI A;  5A2Q W;  1WE8 A;  4BA1 I;  4JI2 H;  4NBQ A;  4WAL A;  4DV1 H;  4DV5 H;  1V9N A;  4JI4 H;  2CPQ A;  4EC5 A;  4IFD G;  4YHH H;  4DUZ H;  4JYA H;  3QD7 X;  1XMQ H;  2OPU A;  4G08 A;  2X06 A;  2ZM6 H;  2ANN A;  2Y3M A;  2CTE A;  4LF4 H;  4GKK H;  4LF7 H;  2UUB H;  2K1H A;  3U1K A;  3OET A;  1I94 H;  4NZT M;  1X4N A;  2LTL A;  4JI3 H;  4KHP H;  1N36 H;  1TUA A;  4DR6 H;  3GAB A;  1F0X A;  3J80 W;  3I0P A;  2UUA H;  1HR0 H;  4NXM H;  4OCH A;  4DR3 H;  2YQR A;  4LF6 H;  3J7A K;  4QMF B;  1N32 H;  2QND A;  2Z0S A;  3KDK A;  2JZX A;  1ZZI A;  1IBL H;  4B3S H;  1Z2I A;  4JI1 H;  1HNX H;  4JI0 H;  4B3R H;  3J81 W;  1KHM A;  4B3M H;  1K1G A;  2HHH H;  5K36 G;  3NCV A;  4LFC H;  2PT7 G;  4DR2 H;  2JA9 A;  2ANR A;  2FPH X;  4DR1 H;  1X9Z A;  2VQE H;  4AIM A;  2HH3 A;  5BR8 H;  1X4M A;  4E9J A;  1X0A A;  3FAU A;  4JVY A;  2OPV A;  2UU9 H;  4FJS A;  2LTM A;  1N33 H;  5JEA G;  4K0K H;  1WVN A;  3SB1 A;  5LL6 b;  2PY9 A;  2FMR A;  4NZR M;  2M8W A;  3AEV B;  2P2R A;  5LMU H;  1ZZJ A;  1NXU A;  2HH2 A;  1XMO H;  5FLX W;  4JI7 H;  4LFA H;  4FJU A;  4DR7 H;  4OO1 G;  1WHR A;  1VIG A;  4DV4 H;  4AQY H;  4AM3 A;  1FKA H; 
#chains in the Genus database with same CATH homology
 2BA0 A;  1VIH A;  1ZTG A;  2JEA I;  2JA9 A;  2ANR A;  2NN6 G;  1WE8 A;  4BA1 I;  4NBQ A;  4WAL A;  4BA2 I;  2PQU A;  2CPQ A;  4AIM A;  2HH3 A;  4IFD G;  1X4M A;  3L7Z C;  2MJH A;  2E3U A;  2CTK A;  2JEB I;  2OPU A;  1DT4 A;  2AXY A;  1J4W A;  2ANN A;  3VKE A;  4JVY A;  2OPV A;  2CTJ A;  1EC6 A;  4WAN A;  2CTE A;  1ZZK A;  4B8T A;  3U1K A;  5JEA G;  1KHM A;  1X4N A;  1WVN A;  2PY9 A;  4LIJ A;  1TUA A;  2FMR A;  2JE6 I;  2JVZ A;  2CTF A;  2P2R A;  3AEV B;  1ZZJ A;  2HH2 A;  2YQR A;  5C0X G;  4JVH A;  4QMF B;  3V69 A;  1J5K A;  2QND A;  2BL5 A;  2Z0S A;  2JZX A;  1DTJ A;  1ZZI A;  5K36 G;  2DGR A;  4OO1 G;  2CTL A;  1VIG A;  2CTM A;  1K1G A;  4AM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...