2CTMA

Solution structure of the 14th kh type i domain from human vigilin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
GSSGSSGRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLADSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 14th KH type I domain from human Vigilin
rcsb
source organism Homo sapiens
molecule tags Transport protein, rna binding protein
molecule keywords Vigilin
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2ctmA00
2CTLA 2P2RA 2AXYA 1EC6A 5JEAG 2CTEA 1J4WA 2CPQA 2JA9A 2JEBI 2BL5A 5C0XG 4JVYA 2ANNA 4AM3A 2DGRA 2FMRA 4NBQA 1J5KA 2JZXA 4BA2I 1WE8A 4WANA 4AIMA 4WALA 1ZZIA 2HH3A 1DTJA 1X4NA 2CTJA 3V69A 2PQUA 4OO1G 3U1KA 2CTFA 2NN6G 4QMFB 1ZZJA 2JE6I 2MJHA 1VIGA 2PY9A 4LIJA 4B8TA 1K1GA 3L7ZC 2OPVA 2ANRA 3AEVB 2CTMA 1TUAA 2BA0A 4BA1I 2JEAI 2JVZA 1ZZKA 3VKEA 2E3UA 1VIHA 1WVNA 2QNDA 5K36G 4IFDG 2YQRA 1ZTGA 1X4MA 2HH2A 2OPUA 2Z0SA 4JVHA 1KHMA 2CTKA 1DT4A
chains in the Genus database with same CATH superfamily
2CPMA 2P2RA 4DR4H 2CWFA 3RF2A 4NXMH 3OSSD 2CTEA 1J4WA 3GABA 4FJUA 4JVYA 5LL6b 2ANNA 1J5KA 1WE8A 1NXUA 3J80W 4H8AA 2LTMA 3FAUA 1X4NA 2CTJA 3V69A 4OO1G 3EZJA 5LMNH 3OETA 1ZZJA 2VKCA 1MSZA 1UG8A 1XMOH 1J5EH 2MJHA 2UXDH 4LIJA 2M6QA 1K1GA 2OPVA 4E9JA 2VQEH 2ZM6H 3QD7X 2FFMA 2ANRA 4JI0H 2O4CA 1XRHA 4NXNH 2LRRA 4EC5A 3J81W 1WHRA 4JV5H 1ZTGA 3KDKA 1EC6A 2JEBI 2BL5A 1N32H 1F0XA 4LFBH 4BA2I 1X9ZA 2VQFH 5FLXW 4G08A 4B3MH 2UUCH 4JYAH 2PT7G 1I6UA 4DUZH 4AQYH 4GKKH 1VIGA 4OD6A 2UXCH 4LFAH 1N33H 1VBIA 3J7AK 2CWHA 3L7ZC 2F4VH 4PDBA 2CTMA 4B8CD 4DV2H 4DV5H 2LF0A 4KHPH 2E3UA 4JI6H 1WVNA 2QNDA 5K36G 4IFDG 2YQRA 1XMQH 4OCHA 1Z2IA 2Z0SA 4QMFB 5A2QW 2JEAI 2LTLA 4JVHA 2CTKA 1SEIA 4JI1H 5JEAG 3GR5A 2CPQA 2JA9A 5IWAH 1N36H 5C0XG 1IBMH 4DV3H 3NCVA 1N34H 2DGRA 2FMRA 2Y3MA 4NBQA 2UUAH 4DUYH 5IT9W 3KDGA 4JI5H 4WALA 1X0AA 2M8WA 5DT9A 4DV0H 1ZZIA 4LF4H 4LF6H 4DR7H 4GKJH 1DTJA 4X65H 4DV4H 2PQUA 3JAMW 1ODHA 3U1KA 1FKAH 4JI4H 4X66H 1HNWH 1WTJA 1AN7A 2A1SA 5LMUH 2FPHX 3UOEA 4DR2H 3OTOH 3AEVB 1S20A 2X06A 2HHHH 4LF9H 2JVZA 4OX9H 3VKEA 1HR0H 1S03G 2E5LH 3I0PA 1V9NA 1I94H 1V8CA 1KHMA 2CTLA 2AXYA 4DR5H 4DR6H 2UU9H 4JI3H 2K1HA 4AM3A 4X62H 2JZXA 3T1HH 4DR3H 4WANA 5BR8H 1HNXH 4FJSA 4AIMA 4DR1H 1HNZH 2D9IA 2HH3A 4JI2H 2ZQEA 2CTFA 2NN6G 4YHHH 2G8YA 4LFCH 4YY3H 4B3SH 2JE6I 2PY9A 4DV6H 4K0KH 4X64H 4B8TA 3SB1A 4DV7H 3GKUA 1TUAA 2UXBH 1XNQH 2BA0A 4BA1I 1PQXA 1IBLH 4NZTM 1ZZKA 1VIHA 1IBKH 4JI8H 2UUBH 4B3RH 4LF7H 1XNRH 3T1YH 4LF5H 4JI7H 1X4MA 2HH2A 2OPUA 4NZRM 4B3TH 4DV1H 1FJGH 4LF8H 1DT4A
chains in the Genus database with same CATH topology
2CTLA 2P2RA 2AXYA 1EC6A 5JEAG 2CTEA 1J4WA 2CPQA 2JA9A 2JEBI 2BL5A 5C0XG 4JVYA 2ANNA 4AM3A 2DGRA 2FMRA 4NBQA 1J5KA 2JZXA 4BA2I 1WE8A 4WANA 4AIMA 4WALA 1ZZIA 2HH3A 1DTJA 1X4NA 2CTJA 3V69A 2PQUA 4OO1G 3U1KA 2CTFA 2NN6G 4QMFB 1ZZJA 2JE6I 2MJHA 1VIGA 2PY9A 4LIJA 4B8TA 1K1GA 3L7ZC 2OPVA 2ANRA 3AEVB 2CTMA 1TUAA 2BA0A 4BA1I 2JEAI 2JVZA 1ZZKA 3VKEA 2E3UA 1VIHA 1WVNA 2QNDA 5K36G 4IFDG 2YQRA 1ZTGA 1X4MA 2HH2A 2OPUA 2Z0SA 4JVHA 1KHMA 2CTKA 1DT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTL A;  2P2R A;  2AXY A;  1EC6 A;  5JEA G;  2CTE A;  1J4W A;  2CPQ A;  2JA9 A;  2JEB I;  2BL5 A;  5C0X G;  4JVY A;  2ANN A;  4AM3 A;  2DGR A;  2FMR A;  4NBQ A;  1J5K A;  2JZX A;  4BA2 I;  1WE8 A;  4WAN A;  4AIM A;  4WAL A;  1ZZI A;  2HH3 A;  1DTJ A;  1X4N A;  2CTJ A;  3V69 A;  2PQU A;  4OO1 G;  3U1K A;  2CTF A;  2NN6 G;  4QMF B;  1ZZJ A;  2JE6 I;  2MJH A;  1VIG A;  2PY9 A;  4LIJ A;  4B8T A;  1K1G A;  3L7Z C;  2OPV A;  2ANR A;  3AEV B;  2CTM A;  1TUA A;  2BA0 A;  4BA1 I;  2JEA I;  2JVZ A;  1ZZK A;  3VKE A;  2E3U A;  1VIH A;  1WVN A;  2QND A;  5K36 G;  4IFD G;  2YQR A;  1ZTG A;  1X4M A;  2HH2 A;  2OPU A;  2Z0S A;  4JVH A;  1KHM A;  2CTK A;  1DT4 A; 
#chains in the Genus database with same CATH topology
 2CPM A;  2P2R A;  4DR4 H;  2CWF A;  3RF2 A;  4NXM H;  3OSS D;  2CTE A;  1J4W A;  3GAB A;  4FJU A;  4JVY A;  5LL6 b;  2ANN A;  1J5K A;  1WE8 A;  1NXU A;  3J80 W;  4H8A A;  2LTM A;  3FAU A;  1X4N A;  2CTJ A;  3V69 A;  4OO1 G;  3EZJ A;  5LMN H;  3OET A;  1ZZJ A;  2VKC A;  1MSZ A;  1UG8 A;  1XMO H;  1J5E H;  2MJH A;  2UXD H;  4LIJ A;  2M6Q A;  1K1G A;  2OPV A;  4E9J A;  2VQE H;  2ZM6 H;  3QD7 X;  2FFM A;  2ANR A;  4JI0 H;  2O4C A;  1XRH A;  4NXN H;  2LRR A;  4EC5 A;  3J81 W;  1WHR A;  4JV5 H;  1ZTG A;  3KDK A;  1EC6 A;  2JEB I;  2BL5 A;  1N32 H;  1F0X A;  4LFB H;  4BA2 I;  1X9Z A;  2VQF H;  5FLX W;  4G08 A;  4B3M H;  2UUC H;  4JYA H;  2PT7 G;  1I6U A;  4DUZ H;  4AQY H;  4GKK H;  1VIG A;  4OD6 A;  2UXC H;  4LFA H;  1N33 H;  1VBI A;  3J7A K;  2CWH A;  3L7Z C;  2F4V H;  4PDB A;  2CTM A;  4B8C D;  4DV2 H;  4DV5 H;  2LF0 A;  4KHP H;  2E3U A;  4JI6 H;  1WVN A;  2QND A;  5K36 G;  4IFD G;  2YQR A;  1XMQ H;  4OCH A;  1Z2I A;  2Z0S A;  4QMF B;  5A2Q W;  2JEA I;  2LTL A;  4JVH A;  2CTK A;  1SEI A;  4JI1 H;  5JEA G;  3GR5 A;  2CPQ A;  2JA9 A;  5IWA H;  1N36 H;  5C0X G;  1IBM H;  4DV3 H;  3NCV A;  1N34 H;  2DGR A;  2FMR A;  2Y3M A;  4NBQ A;  2UUA H;  4DUY H;  5IT9 W;  3KDG A;  4JI5 H;  4WAL A;  1X0A A;  2M8W A;  5DT9 A;  4DV0 H;  1ZZI A;  4LF4 H;  4LF6 H;  4DR7 H;  4GKJ H;  1DTJ A;  4X65 H;  4DV4 H;  2PQU A;  3JAM W;  1ODH A;  3U1K A;  1FKA H;  4JI4 H;  4X66 H;  1HNW H;  1WTJ A;  1AN7 A;  2A1S A;  5LMU H;  2FPH X;  3UOE A;  4DR2 H;  3OTO H;  3AEV B;  1S20 A;  2X06 A;  2HHH H;  4LF9 H;  2JVZ A;  4OX9 H;  3VKE A;  1HR0 H;  1S03 G;  2E5L H;  3I0P A;  1V9N A;  1I94 H;  1V8C A;  1KHM A;  2CTL A;  2AXY A;  4DR5 H;  4DR6 H;  2UU9 H;  4JI3 H;  2K1H A;  4AM3 A;  4X62 H;  2JZX A;  3T1H H;  4DR3 H;  4WAN A;  5BR8 H;  1HNX H;  4FJS A;  4AIM A;  4DR1 H;  1HNZ H;  2D9I A;  2HH3 A;  4JI2 H;  2ZQE A;  2CTF A;  2NN6 G;  4YHH H;  2G8Y A;  4LFC H;  4YY3 H;  4B3S H;  2JE6 I;  2PY9 A;  4DV6 H;  4K0K H;  4X64 H;  4B8T A;  3SB1 A;  4DV7 H;  3GKU A;  1TUA A;  2UXB H;  1XNQ H;  2BA0 A;  4BA1 I;  1PQX A;  1IBL H;  4NZT M;  1ZZK A;  1VIH A;  1IBK H;  4JI8 H;  2UUB H;  4B3R H;  4LF7 H;  1XNR H;  3T1Y H;  4LF5 H;  4JI7 H;  1X4M A;  2HH2 A;  2OPU A;  4NZR M;  4B3T H;  4DV1 H;  1FJG H;  4LF8 H;  1DT4 A; 
#chains in the Genus database with same CATH homology
 2CTL A;  2P2R A;  2AXY A;  1EC6 A;  5JEA G;  2CTE A;  1J4W A;  2CPQ A;  2JA9 A;  2JEB I;  2BL5 A;  5C0X G;  4JVY A;  2ANN A;  4AM3 A;  2DGR A;  2FMR A;  4NBQ A;  1J5K A;  2JZX A;  4BA2 I;  1WE8 A;  4WAN A;  4AIM A;  4WAL A;  1ZZI A;  2HH3 A;  1DTJ A;  1X4N A;  2CTJ A;  3V69 A;  2PQU A;  4OO1 G;  3U1K A;  2CTF A;  2NN6 G;  4QMF B;  1ZZJ A;  2JE6 I;  2MJH A;  1VIG A;  2PY9 A;  4LIJ A;  4B8T A;  1K1G A;  3L7Z C;  2OPV A;  2ANR A;  3AEV B;  2CTM A;  1TUA A;  2BA0 A;  4BA1 I;  2JEA I;  2JVZ A;  1ZZK A;  3VKE A;  2E3U A;  1VIH A;  1WVN A;  2QND A;  5K36 G;  4IFD G;  2YQR A;  1ZTG A;  1X4M A;  2HH2 A;  2OPU A;  2Z0S A;  4JVH A;  1KHM A;  2CTK A;  1DT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...