1WHRA

Solution structure of the r3h domain from human hypothetical protein baa76846
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
124
structure length
124
Chain Sequence
GSSGSSGTDSTGIDLHEFLVNTLKKNPRDRMMLLKLEQEILEFINDNNNQFKKFPQMTSYHRMLLHRVAAYFGMDHNVDQTGKAVIINKTSNTRIPEQRFSEHIKDEKNTEFQQRFILSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical KIAA1002 protein
publication title Solution structure of the R3H domain from human hypothetical protein BAA76846
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 21
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 1whrA00
2CPMA 3GKUA 1MSZA 2A1SA 2LRRA 1UG8A 1WHRA
chains in the Genus database with same CATH superfamily
5IWAH 3KDKA 4JI3H 2ZQEA 4JI0H 3I0PA 4JI6H 2O4CA 2AXYA 1K1GA 4OD6A 2CWFA 2K1HA 4DV4H 4B8TA 5BR8H 1I94H 1ZZJA 2LRRA 4JI7H 4B8CD 2E5LH 1WVNA 3GR5A 4FJUA 1HNZH 4NZTM 2QNDA 4AIMA 1HNWH 1N32H 2UXBH 4WANA 2JE6I 4LIJA 1XMQH 2CTJA 2OPUA 3U1KA 2YQRA 3OSSD 1XRHA 3GABA 3UOEA 4DR6H 4JV5H 1TUAA 2FFMA 1XMOH 1UG8A 2NN6G 2OPVA 2UUBH 4JVYA 2JEBI 3SB1A 2LTLA 2PT7G 4OCHA 3V69A 2CTMA 4DUYH 2HH3A 1WE8A 2LF0A 3RF2A 2X06A 2CTFA 1V9NA 2G8YA 4YHHH 2D9IA 4JI4H 3AEVB 2Y3MA 4BA1I 4LF9H 4DV3H 1ODHA 4YY3H 4E9JA 2ANNA 1I6UA 1AN7A 2CTKA 4X62H 2JVZA 4H8AA 2BL5A 2VKCA 1DT4A 4JYAH 1J4WA 4JI2H 3T1YH 4BA2I 1KHMA 3NCVA 2ANRA 1N34H 4JI1H 4OO1G 3EZJA 1DTJA 2FPHX 5A2QW 2P2RA 5K36G 4X65H 4KHPH 1X4MA 2ZM6H 1ZTGA 2PQUA 4LFCH 1WTJA 1Z2IA 4GKJH 5DT9A 1XNRH 4LF4H 4GKKH 4JI8H 1X0AA 4K0KH 2UUAH 2F4VH 2PY9A 4B3MH 5JEAG 4DV5H 4DR1H 4DV0H 1NXUA 2CWHA 1HNXH 2BA0A 4QMFB 2Z0SA 1EC6A 1FJGH 4JVHA 4EC5A 4DUZH 1VIHA 4NXMH 2M8WA 4B3TH 1X4NA 3L7ZC 3FAUA 5LMUH 1IBMH 2M6QA 4DV2H 2FMRA 3J81W 4G08A 2JZXA 4DR5H 4DR3H 1VIGA 2HH2A 4LFAH 5LMNH 1N36H 4B3RH 4DV1H 1VBIA 4B3SH 3KDGA 1MSZA 2JA9A 2HHHH 4DR4H 2UXDH 5IT9W 1IBLH 1S20A 5LL6b 4PDBA 2VQEH 3J80W 4WALA 1PQXA 1IBKH 4NZRM 1J5EH 4LF5H 5FLXW 1N33H 3OTOH 2VQFH 1FKAH 4LFBH 4IFDG 4X66H 2CTLA 3T1HH 2UXCH 4DR2H 1HR0H 2CPQA 2LTMA 3QD7X 4NBQA 4DV7H 3J7AK 3OETA 2CPMA 3GKUA 4X64H 4FJSA 1F0XA 1X9ZA 4LF6H 5C0XG 3JAMW 4OX9H 1V8CA 1XNQH 4DR7H 1SEIA 4AQYH 1WHRA 2DGRA 2E3UA 4JI5H 1S03G 1ZZKA 4LF8H 2MJHA 2JEAI 2CTEA 4NXNH 2A1SA 2UU9H 1ZZIA 2UUCH 3VKEA 4LF7H 4AM3A 1J5KA 4DV6H
chains in the Genus database with same CATH topology
2CPMA 3GKUA 1MSZA 2A1SA 2LRRA 1UG8A 1WHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPM A;  3GKU A;  1MSZ A;  2A1S A;  2LRR A;  1UG8 A;  1WHR A; 
#chains in the Genus database with same CATH topology
 5IWA H;  3KDK A;  4JI3 H;  2ZQE A;  4JI0 H;  3I0P A;  4JI6 H;  2O4C A;  2AXY A;  1K1G A;  4OD6 A;  2CWF A;  2K1H A;  4DV4 H;  4B8T A;  5BR8 H;  1I94 H;  1ZZJ A;  2LRR A;  4JI7 H;  4B8C D;  2E5L H;  1WVN A;  3GR5 A;  4FJU A;  1HNZ H;  4NZT M;  2QND A;  4AIM A;  1HNW H;  1N32 H;  2UXB H;  4WAN A;  2JE6 I;  4LIJ A;  1XMQ H;  2CTJ A;  2OPU A;  3U1K A;  2YQR A;  3OSS D;  1XRH A;  3GAB A;  3UOE A;  4DR6 H;  4JV5 H;  1TUA A;  2FFM A;  1XMO H;  1UG8 A;  2NN6 G;  2OPV A;  2UUB H;  4JVY A;  2JEB I;  3SB1 A;  2LTL A;  2PT7 G;  4OCH A;  3V69 A;  2CTM A;  4DUY H;  2HH3 A;  1WE8 A;  2LF0 A;  3RF2 A;  2X06 A;  2CTF A;  1V9N A;  2G8Y A;  4YHH H;  2D9I A;  4JI4 H;  3AEV B;  2Y3M A;  4BA1 I;  4LF9 H;  4DV3 H;  1ODH A;  4YY3 H;  4E9J A;  2ANN A;  1I6U A;  1AN7 A;  2CTK A;  4X62 H;  2JVZ A;  4H8A A;  2BL5 A;  2VKC A;  1DT4 A;  4JYA H;  1J4W A;  4JI2 H;  3T1Y H;  4BA2 I;  1KHM A;  3NCV A;  2ANR A;  1N34 H;  4JI1 H;  4OO1 G;  3EZJ A;  1DTJ A;  2FPH X;  5A2Q W;  2P2R A;  5K36 G;  4X65 H;  4KHP H;  1X4M A;  2ZM6 H;  1ZTG A;  2PQU A;  4LFC H;  1WTJ A;  1Z2I A;  4GKJ H;  5DT9 A;  1XNR H;  4LF4 H;  4GKK H;  4JI8 H;  1X0A A;  4K0K H;  2UUA H;  2F4V H;  2PY9 A;  4B3M H;  5JEA G;  4DV5 H;  4DR1 H;  4DV0 H;  1NXU A;  2CWH A;  1HNX H;  2BA0 A;  4QMF B;  2Z0S A;  1EC6 A;  1FJG H;  4JVH A;  4EC5 A;  4DUZ H;  1VIH A;  4NXM H;  2M8W A;  4B3T H;  1X4N A;  3L7Z C;  3FAU A;  5LMU H;  1IBM H;  2M6Q A;  4DV2 H;  2FMR A;  3J81 W;  4G08 A;  2JZX A;  4DR5 H;  4DR3 H;  1VIG A;  2HH2 A;  4LFA H;  5LMN H;  1N36 H;  4B3R H;  4DV1 H;  1VBI A;  4B3S H;  3KDG A;  1MSZ A;  2JA9 A;  2HHH H;  4DR4 H;  2UXD H;  5IT9 W;  1IBL H;  1S20 A;  5LL6 b;  4PDB A;  2VQE H;  3J80 W;  4WAL A;  1PQX A;  1IBK H;  4NZR M;  1J5E H;  4LF5 H;  5FLX W;  1N33 H;  3OTO H;  2VQF H;  1FKA H;  4LFB H;  4IFD G;  4X66 H;  2CTL A;  3T1H H;  2UXC H;  4DR2 H;  1HR0 H;  2CPQ A;  2LTM A;  3QD7 X;  4NBQ A;  4DV7 H;  3J7A K;  3OET A;  2CPM A;  3GKU A;  4X64 H;  4FJS A;  1F0X A;  1X9Z A;  4LF6 H;  5C0X G;  3JAM W;  4OX9 H;  1V8C A;  1XNQ H;  4DR7 H;  1SEI A;  4AQY H;  1WHR A;  2DGR A;  2E3U A;  4JI5 H;  1S03 G;  1ZZK A;  4LF8 H;  2MJH A;  2JEA I;  2CTE A;  4NXN H;  2A1S A;  2UU9 H;  1ZZI A;  2UUC H;  3VKE A;  4LF7 H;  4AM3 A;  1J5K A;  4DV6 H; 
#chains in the Genus database with same CATH homology
 2CPM A;  3GKU A;  1MSZ A;  2A1S A;  2LRR A;  1UG8 A;  1WHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...