1WHRA

Solution structure of the r3h domain from human hypothetical protein baa76846
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
124
structure length
124
Chain Sequence
b'GSSGSSGTDSTGIDLHEFLVNTLKKNPRDRMMLLKLEQEILEFINDNNNQFKKFPQMTSYHRMLLHRVAAYFGMDHNVDQTGKAVIINKTSNTRIPEQRFSEHIKDEKNTEFQQRFILSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical KIAA1002 protein
molecule tags Structural genomics, unknown function
source organism Homo sapiens
publication title Solution structure of the R3H domain from human hypothetical protein BAA76846
rcsb
total genus 21
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 1whrA00
2A1SA 1WHRA 2CPMA 3GKUA 2LRRA 1MSZA 1UG8A
chains in the Genus database with same CATH superfamily
1N32H 2DGRA 4G08A 1ZZIA 4JI4H 3I0PA 1IBKH 4LF9H 2HH2A 2UXBH 4X66H 3T1HH 2VKCA 2Y3MA 1HNZH 3J7AK 1X9ZA 4B3MH 4DR7H 4X62H 4X65H 2MJHA 4JV5H 2O4CA 4NXMH 2JEBI 1ZTGA 4OCHA 2ANNA 1AN7A 2AXYA 1X4MA 4JI5H 4GKKH 4DUYH 4QMFB 5IWAH 4LFAH 1J5EH 4JI0H 2JA9A 2BL5A 2FMRA 3GR5A 3KDGA 3NCVA 4NBQA 5A2QW 4JI1H 3RF2A 3U1KA 2UUCH 2UUBH 1WVNA 4BA2I 4LFBH 4DR1H 4JI8H 1MSZA 2CTKA 2VQFH 1UG8A 4YHHH 1IBMH 1EC6A 2JE6I 2JEAI 3SB1A 1XNQH 5LL6b 2CPMA 2YQRA 1F0XA 4DV2H 2UUAH 4LF4H 5DT9A 2PY9A 1V9NA 4FJUA 2UU9H 1IBLH 4NZRM 3V69A 1V8CA 3KDKA 1XMOH 1N33H 4H8AA 1ZZKA 4JI6H 4JI7H 2FFMA 4BA1I 2ANRA 4DR2H 2HHHH 4AIMA 4JVYA 1S20A 5BR8H 4DV4H 5K36G 2CTFA 4DV6H 4KHPH 4LF8H 4PDBA 3GABA 4LIJA 1XRHA 3AEVB 1J5KA 2K1HA 1SEIA 2CWHA 4DV1H 4LF7H 4B3SH 3VKEA 1VIGA 4LF6H 1WE8A 2LRRA 1NXUA 4DV3H 2M6QA 1TUAA 4OO1G 1I6UA 2LF0A 4WALA 4NXNH 5FLXW 2NN6G 3JAMW 4DR6H 4IFDG 1J4WA 2D9IA 2P2RA 4FJSA 4DR5H 5LMUH 2UXCH 1XMQH 1ODHA 4AM3A 4DV5H 2PQUA 2G8YA 2Z0SA 1I94H 2HH3A 4B3RH 1FKAH 4B8TA 3L7ZC 4E9JA 4OD6A 4AQYH 3J80W 2ZQEA 2ZM6H 3OTOH 4DV0H 2E5LH 2VQEH 4LFCH 4NZTM 2FPHX 1HNWH 1WTJA 2OPUA 3OETA 1N36H 4K0KH 4EC5A 4DR4H 3GKUA 2UXDH 1DT4A 1X0AA 2CTJA 2E3UA 4B8CD 2CTEA 1S03G 3QD7X 1K1GA 2X06A 4B3TH 4GKJH 2M8WA 1VBIA 1X4NA 1ZZJA 2CWFA 2PT7G 1KHMA 2BA0A 1N34H 4JVHA 1WHRA 3UOEA 1Z2IA 1VIHA 2OPVA 2CTMA 2JZXA 2CPQA 2LTMA 4YY3H 4X64H 4JI2H 3J81W 4DR3H 3OSSD 4DUZH 1XNRH 4WANA 1DTJA 2A1SA 2CTLA 2LTLA 4DV7H 2F4VH 4JI3H 3T1YH 3FAUA 2JVZA 1HR0H 4OX9H 5C0XG 4JYAH 5IT9W 5JEAG 3EZJA 1HNXH 2QNDA 5LMNH 4LF5H 1PQXA 1FJGH
chains in the Genus database with same CATH topology
2A1SA 1WHRA 2CPMA 3GKUA 2LRRA 1MSZA 1UG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A1S A;  1WHR A;  2CPM A;  3GKU A;  2LRR A;  1MSZ A;  1UG8 A; 
#chains in the Genus database with same CATH topology
 1N32 H;  2DGR A;  4G08 A;  1ZZI A;  4JI4 H;  3I0P A;  1IBK H;  4LF9 H;  2HH2 A;  2UXB H;  4X66 H;  3T1H H;  2VKC A;  2Y3M A;  1HNZ H;  3J7A K;  1X9Z A;  4B3M H;  4DR7 H;  4X62 H;  4X65 H;  2MJH A;  4JV5 H;  2O4C A;  4NXM H;  2JEB I;  1ZTG A;  4OCH A;  2ANN A;  1AN7 A;  2AXY A;  1X4M A;  4JI5 H;  4GKK H;  4DUY H;  4QMF B;  5IWA H;  4LFA H;  1J5E H;  4JI0 H;  2JA9 A;  2BL5 A;  2FMR A;  3GR5 A;  3KDG A;  3NCV A;  4NBQ A;  5A2Q W;  4JI1 H;  3RF2 A;  3U1K A;  2UUC H;  2UUB H;  1WVN A;  4BA2 I;  4LFB H;  4DR1 H;  4JI8 H;  1MSZ A;  2CTK A;  2VQF H;  1UG8 A;  4YHH H;  1IBM H;  1EC6 A;  2JE6 I;  2JEA I;  3SB1 A;  1XNQ H;  5LL6 b;  2CPM A;  2YQR A;  1F0X A;  4DV2 H;  2UUA H;  4LF4 H;  5DT9 A;  2PY9 A;  1V9N A;  4FJU A;  2UU9 H;  1IBL H;  4NZR M;  3V69 A;  1V8C A;  3KDK A;  1XMO H;  1N33 H;  4H8A A;  1ZZK A;  4JI6 H;  4JI7 H;  2FFM A;  4BA1 I;  2ANR A;  4DR2 H;  2HHH H;  4AIM A;  4JVY A;  1S20 A;  5BR8 H;  4DV4 H;  5K36 G;  2CTF A;  4DV6 H;  4KHP H;  4LF8 H;  4PDB A;  3GAB A;  4LIJ A;  1XRH A;  3AEV B;  1J5K A;  2K1H A;  1SEI A;  2CWH A;  4DV1 H;  4LF7 H;  4B3S H;  3VKE A;  1VIG A;  4LF6 H;  1WE8 A;  2LRR A;  1NXU A;  4DV3 H;  2M6Q A;  1TUA A;  4OO1 G;  1I6U A;  2LF0 A;  4WAL A;  4NXN H;  5FLX W;  2NN6 G;  3JAM W;  4DR6 H;  4IFD G;  1J4W A;  2D9I A;  2P2R A;  4FJS A;  4DR5 H;  5LMU H;  2UXC H;  1XMQ H;  1ODH A;  4AM3 A;  4DV5 H;  2PQU A;  2G8Y A;  2Z0S A;  1I94 H;  2HH3 A;  4B3R H;  1FKA H;  4B8T A;  3L7Z C;  4E9J A;  4OD6 A;  4AQY H;  3J80 W;  2ZQE A;  2ZM6 H;  3OTO H;  4DV0 H;  2E5L H;  2VQE H;  4LFC H;  4NZT M;  2FPH X;  1HNW H;  1WTJ A;  2OPU A;  3OET A;  1N36 H;  4K0K H;  4EC5 A;  4DR4 H;  3GKU A;  2UXD H;  1DT4 A;  1X0A A;  2CTJ A;  2E3U A;  4B8C D;  2CTE A;  1S03 G;  3QD7 X;  1K1G A;  2X06 A;  4B3T H;  4GKJ H;  2M8W A;  1VBI A;  1X4N A;  1ZZJ A;  2CWF A;  2PT7 G;  1KHM A;  2BA0 A;  1N34 H;  4JVH A;  1WHR A;  3UOE A;  1Z2I A;  1VIH A;  2OPV A;  2CTM A;  2JZX A;  2CPQ A;  2LTM A;  4YY3 H;  4X64 H;  4JI2 H;  3J81 W;  4DR3 H;  3OSS D;  4DUZ H;  1XNR H;  4WAN A;  1DTJ A;  2A1S A;  2CTL A;  2LTL A;  4DV7 H;  2F4V H;  4JI3 H;  3T1Y H;  3FAU A;  2JVZ A;  1HR0 H;  4OX9 H;  5C0X G;  4JYA H;  5IT9 W;  5JEA G;  3EZJ A;  1HNX H;  2QND A;  5LMN H;  4LF5 H;  1PQX A;  1FJG H; 
#chains in the Genus database with same CATH homology
 2A1S A;  1WHR A;  2CPM A;  3GKU A;  2LRR A;  1MSZ A;  1UG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...