1WHRA

Solution structure of the r3h domain from human hypothetical protein baa76846
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
124
structure length
124
Chain Sequence
b'GSSGSSGTDSTGIDLHEFLVNTLKKNPRDRMMLLKLEQEILEFINDNNNQFKKFPQMTSYHRMLLHRVAAYFGMDHNVDQTGKAVIINKTSNTRIPEQRFSEHIKDEKNTEFQQRFILSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical KIAA1002 protein
publication title Solution structure of the R3H domain from human hypothetical protein BAA76846
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 21
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 1whrA00
1MSZA 2CPMA 1UG8A 2LRRA 2A1SA 3GKUA 1WHRA
chains in the Genus database with same CATH superfamily
5JEAG 1J5KA 1S03G 1X0AA 3OETA 2CTJA 3JAMW 1I94H 4OO1G 3RF2A 4X64H 5FLXW 3GKUA 1HNXH 4LF7H 2OPUA 2K1HA 2HHHH 2FMRA 2UXCH 1S20A 1UG8A 3KDGA 4DV3H 4B3MH 4LF9H 1KHMA 2YQRA 4DV5H 4NXNH 4JYAH 1K1GA 1NXUA 4JI6H 4DR2H 1J4WA 1X9ZA 1VIGA 1IBMH 3OTOH 2E5LH 2JEBI 2VQEH 4PDBA 2A1SA 2AXYA 4LF8H 2VQFH 4DV4H 3L7ZC 4LF4H 4QMFB 4OD6A 4IFDG 3NCVA 4JVHA 1XMOH 4JI5H 4EC5A 1XMQH 1N34H 3SB1A 3V69A 1WHRA 4DR5H 4H8AA 4FJSA 2CTLA 2M6QA 4NXMH 4KHPH 1N32H 1HNZH 3VKEA 1WTJA 4X66H 4OX9H 4GKKH 2DGRA 4B8CD 2JE6I 4YY3H 1N36H 2O4CA 4FJUA 3QD7X 4DV0H 2ANNA 2CTMA 4JI1H 4LFBH 4B3SH 1XRHA 2PY9A 3KDKA 1DT4A 5IT9W 5DT9A 4WANA 4JI8H 2FPHX 4LIJA 4E9JA 2BL5A 1SEIA 4G08A 4DUZH 3EZJA 4NZTM 1WE8A 3T1HH 1XNQH 2UXBH 2LF0A 1VBIA 4DR4H 4JI2H 4DUYH 2UUBH 1HNWH 1AN7A 5A2QW 2D9IA 2G8YA 1FJGH 4BA2I 3I0PA 2CTEA 3T1YH 4WALA 4GKJH 4LFCH 2JEAI 3U1KA 4AM3A 4JI3H 1V8CA 2Y3MA 2LTMA 4DR6H 2E3UA 5C0XG 1V9NA 4LFAH 2ANRA 4DV6H 1J5EH 4X65H 4DR7H 1ZTGA 2JVZA 2X06A 4B3TH 1ZZJA 5LMNH 4NBQA 1FKAH 2ZM6H 2F4VH 4JI4H 4K0KH 3J7AK 1TUAA 3OSSD 4NZRM 2BA0A 5K36G 4BA1I 1Z2IA 3GABA 2HH3A 3J81W 4DR1H 1HR0H 5LL6b 1ODHA 1N33H 3FAUA 4B8TA 4AQYH 4LF6H 2LRRA 2LTLA 4B3RH 3UOEA 2UUCH 1XNRH 5LMUH 1MSZA 2CTKA 4JV5H 2VKCA 5BR8H 2PQUA 2CTFA 2UU9H 2PT7G 4JVYA 4YHHH 1VIHA 2CPQA 4DR3H 4DV1H 1ZZIA 4JI0H 1DTJA 2CPMA 2CWFA 2Z0SA 4X62H 3GR5A 4LF5H 1F0XA 4OCHA 2JA9A 4JI7H 2NN6G 1I6UA 2ZQEA 2P2RA 1EC6A 4DV2H 1PQXA 3J80W 1ZZKA 2MJHA 1IBLH 2FFMA 1IBKH 2JZXA 2UUAH 2OPVA 4DV7H 1WVNA 2M8WA 2UXDH 4AIMA 2QNDA 3AEVB 2CWHA 1X4NA 2HH2A 1X4MA 5IWAH
chains in the Genus database with same CATH topology
1MSZA 2CPMA 1UG8A 2LRRA 2A1SA 3GKUA 1WHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSZ A;  2CPM A;  1UG8 A;  2LRR A;  2A1S A;  3GKU A;  1WHR A; 
#chains in the Genus database with same CATH topology
 5JEA G;  1J5K A;  1S03 G;  1X0A A;  3OET A;  2CTJ A;  3JAM W;  1I94 H;  4OO1 G;  3RF2 A;  4X64 H;  5FLX W;  3GKU A;  1HNX H;  4LF7 H;  2OPU A;  2K1H A;  2HHH H;  2FMR A;  2UXC H;  1S20 A;  1UG8 A;  3KDG A;  4DV3 H;  4B3M H;  4LF9 H;  1KHM A;  2YQR A;  4DV5 H;  4NXN H;  4JYA H;  1K1G A;  1NXU A;  4JI6 H;  4DR2 H;  1J4W A;  1X9Z A;  1VIG A;  1IBM H;  3OTO H;  2E5L H;  2JEB I;  2VQE H;  4PDB A;  2A1S A;  2AXY A;  4LF8 H;  2VQF H;  4DV4 H;  3L7Z C;  4LF4 H;  4QMF B;  4OD6 A;  4IFD G;  3NCV A;  4JVH A;  1XMO H;  4JI5 H;  4EC5 A;  1XMQ H;  1N34 H;  3SB1 A;  3V69 A;  1WHR A;  4DR5 H;  4H8A A;  4FJS A;  2CTL A;  2M6Q A;  4NXM H;  4KHP H;  1N32 H;  1HNZ H;  3VKE A;  1WTJ A;  4X66 H;  4OX9 H;  4GKK H;  2DGR A;  4B8C D;  2JE6 I;  4YY3 H;  1N36 H;  2O4C A;  4FJU A;  3QD7 X;  4DV0 H;  2ANN A;  2CTM A;  4JI1 H;  4LFB H;  4B3S H;  1XRH A;  2PY9 A;  3KDK A;  1DT4 A;  5IT9 W;  5DT9 A;  4WAN A;  4JI8 H;  2FPH X;  4LIJ A;  4E9J A;  2BL5 A;  1SEI A;  4G08 A;  4DUZ H;  3EZJ A;  4NZT M;  1WE8 A;  3T1H H;  1XNQ H;  2UXB H;  2LF0 A;  1VBI A;  4DR4 H;  4JI2 H;  4DUY H;  2UUB H;  1HNW H;  1AN7 A;  5A2Q W;  2D9I A;  2G8Y A;  1FJG H;  4BA2 I;  3I0P A;  2CTE A;  3T1Y H;  4WAL A;  4GKJ H;  4LFC H;  2JEA I;  3U1K A;  4AM3 A;  4JI3 H;  1V8C A;  2Y3M A;  2LTM A;  4DR6 H;  2E3U A;  5C0X G;  1V9N A;  4LFA H;  2ANR A;  4DV6 H;  1J5E H;  4X65 H;  4DR7 H;  1ZTG A;  2JVZ A;  2X06 A;  4B3T H;  1ZZJ A;  5LMN H;  4NBQ A;  1FKA H;  2ZM6 H;  2F4V H;  4JI4 H;  4K0K H;  3J7A K;  1TUA A;  3OSS D;  4NZR M;  2BA0 A;  5K36 G;  4BA1 I;  1Z2I A;  3GAB A;  2HH3 A;  3J81 W;  4DR1 H;  1HR0 H;  5LL6 b;  1ODH A;  1N33 H;  3FAU A;  4B8T A;  4AQY H;  4LF6 H;  2LRR A;  2LTL A;  4B3R H;  3UOE A;  2UUC H;  1XNR H;  5LMU H;  1MSZ A;  2CTK A;  4JV5 H;  2VKC A;  5BR8 H;  2PQU A;  2CTF A;  2UU9 H;  2PT7 G;  4JVY A;  4YHH H;  1VIH A;  2CPQ A;  4DR3 H;  4DV1 H;  1ZZI A;  4JI0 H;  1DTJ A;  2CPM A;  2CWF A;  2Z0S A;  4X62 H;  3GR5 A;  4LF5 H;  1F0X A;  4OCH A;  2JA9 A;  4JI7 H;  2NN6 G;  1I6U A;  2ZQE A;  2P2R A;  1EC6 A;  4DV2 H;  1PQX A;  3J80 W;  1ZZK A;  2MJH A;  1IBL H;  2FFM A;  1IBK H;  2JZX A;  2UUA H;  2OPV A;  4DV7 H;  1WVN A;  2M8W A;  2UXD H;  4AIM A;  2QND A;  3AEV B;  2CWH A;  1X4N A;  2HH2 A;  1X4M A;  5IWA H; 
#chains in the Genus database with same CATH homology
 1MSZ A;  2CPM A;  1UG8 A;  2LRR A;  2A1S A;  3GKU A;  1WHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...