1WHRA

Solution structure of the r3h domain from human hypothetical protein baa76846
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
124
structure length
124
Chain Sequence
GSSGSSGTDSTGIDLHEFLVNTLKKNPRDRMMLLKLEQEILEFINDNNNQFKKFPQMTSYHRMLLHRVAAYFGMDHNVDQTGKAVIINKTSNTRIPEQRFSEHIKDEKNTEFQQRFILSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Hypothetical KIAA1002 protein
publication title Solution structure of the R3H domain from human hypothetical protein BAA76846
rcsb
source organism Homo sapiens
total genus 21
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 1whrA00
1MSZA 2LRRA 2A1SA 2CPMA 1WHRA 3GKUA 1UG8A
chains in the Genus database with same CATH superfamily
2JEBI 4AM3A 4LFAH 2BA0A 2CTFA 1Z2IA 1ZTGA 2FMRA 2K1HA 4DV2H 2FPHX 1IBMH 4EC5A 2CPMA 3OSSD 2VQFH 2ZQEA 2ANRA 2PY9A 1ODHA 3OETA 1DTJA 4JI5H 5BR8H 2X06A 2UUCH 3KDKA 4JI3H 1X4NA 4DV3H 4LF6H 1WE8A 4NXNH 5JEAG 4B3TH 3GR5A 5DT9A 1NXUA 3RF2A 4OD6A 4JVHA 4DR6H 1ZZJA 1ZZIA 1J4WA 1FKAH 4LFBH 1EC6A 1MSZA 2UUBH 4LF8H 5LL6b 1X4MA 4FJSA 2CTKA 5FLXW 3VKEA 4LFCH 4LIJA 4QMFB 4DR5H 4LF5H 1IBKH 4YHHH 2E5LH 1S03G 2E3UA 3T1HH 2QNDA 2G8YA 3I0PA 3T1YH 4BA1I 4JI8H 1ZZKA 2NN6G 1J5EH 2CTMA 1HR0H 4K0KH 2ZM6H 4X66H 4B3SH 2M8WA 2P2RA 1N34H 1WTJA 4AIMA 2VQEH 4DR1H 2HH2A 5IT9W 3OTOH 1N36H 2F4VH 4B8TA 1IBLH 1J5KA 3KDGA 5LMNH 1S20A 1XRHA 1TUAA 4DUZH 4DV1H 2A1SA 2FFMA 4NBQA 4E9JA 1WHRA 2AXYA 1XNQH 4DR3H 4JI4H 2LTMA 3V69A 3EZJA 4JI1H 2JE6I 3QD7X 1VIGA 4LF9H 4LF4H 1V8CA 1XMOH 2OPUA 2JA9A 1HNXH 4FJUA 1SEIA 4X64H 3U1KA 1N32H 3FAUA 4DR4H 2JEAI 4KHPH 2CPQA 4DV4H 4DR2H 4LF7H 3GABA 3SB1A 4AQYH 3AEVB 2O4CA 4DR7H 2CWHA 2MJHA 2UXCH 5A2QW 1WVNA 3J7AK 3J80W 4BA2I 2HH3A 5LMUH 1VBIA 2LTLA 1I94H 1XNRH 4WALA 4X62H 1VIHA 2YQRA 1PQXA 4JYAH 2PQUA 2CWFA 2LRRA 2M6QA 4JI6H 3UOEA 2Y3MA 3L7ZC 1V9NA 4GKJH 4WANA 1HNWH 2CTJA 2CTLA 4DV0H 4H8AA 3JAMW 3J81W 4NXMH 4DV6H 3NCVA 2HHHH 4B8CD 4OX9H 4DUYH 2UU9H 3GKUA 2DGRA 1KHMA 2BL5A 2PT7G 2ANNA 2D9IA 4JVYA 5IWAH 5K36G 4OO1G 4GKKH 4JI7H 2VKCA 4B3RH 5C0XG 1UG8A 1K1GA 4NZTM 4JV5H 1DT4A 4X65H 4DV7H 4JI0H 4DV5H 4IFDG 1FJGH 1AN7A 2LF0A 1I6UA 4NZRM 4OCHA 4PDBA 1F0XA 4B3MH 2Z0SA 4JI2H 1N33H 1HNZH 2UXBH 1X9ZA 2CTEA 4G08A 2OPVA 2UUAH 2UXDH 2JVZA 1X0AA 1XMQH 2JZXA 4YY3H
chains in the Genus database with same CATH topology
1MSZA 2LRRA 2A1SA 2CPMA 1WHRA 3GKUA 1UG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSZ A;  2LRR A;  2A1S A;  2CPM A;  1WHR A;  3GKU A;  1UG8 A; 
#chains in the Genus database with same CATH topology
 2JEB I;  4AM3 A;  4LFA H;  2BA0 A;  2CTF A;  1Z2I A;  1ZTG A;  2FMR A;  2K1H A;  4DV2 H;  2FPH X;  1IBM H;  4EC5 A;  2CPM A;  3OSS D;  2VQF H;  2ZQE A;  2ANR A;  2PY9 A;  1ODH A;  3OET A;  1DTJ A;  4JI5 H;  5BR8 H;  2X06 A;  2UUC H;  3KDK A;  4JI3 H;  1X4N A;  4DV3 H;  4LF6 H;  1WE8 A;  4NXN H;  5JEA G;  4B3T H;  3GR5 A;  5DT9 A;  1NXU A;  3RF2 A;  4OD6 A;  4JVH A;  4DR6 H;  1ZZJ A;  1ZZI A;  1J4W A;  1FKA H;  4LFB H;  1EC6 A;  1MSZ A;  2UUB H;  4LF8 H;  5LL6 b;  1X4M A;  4FJS A;  2CTK A;  5FLX W;  3VKE A;  4LFC H;  4LIJ A;  4QMF B;  4DR5 H;  4LF5 H;  1IBK H;  4YHH H;  2E5L H;  1S03 G;  2E3U A;  3T1H H;  2QND A;  2G8Y A;  3I0P A;  3T1Y H;  4BA1 I;  4JI8 H;  1ZZK A;  2NN6 G;  1J5E H;  2CTM A;  1HR0 H;  4K0K H;  2ZM6 H;  4X66 H;  4B3S H;  2M8W A;  2P2R A;  1N34 H;  1WTJ A;  4AIM A;  2VQE H;  4DR1 H;  2HH2 A;  5IT9 W;  3OTO H;  1N36 H;  2F4V H;  4B8T A;  1IBL H;  1J5K A;  3KDG A;  5LMN H;  1S20 A;  1XRH A;  1TUA A;  4DUZ H;  4DV1 H;  2A1S A;  2FFM A;  4NBQ A;  4E9J A;  1WHR A;  2AXY A;  1XNQ H;  4DR3 H;  4JI4 H;  2LTM A;  3V69 A;  3EZJ A;  4JI1 H;  2JE6 I;  3QD7 X;  1VIG A;  4LF9 H;  4LF4 H;  1V8C A;  1XMO H;  2OPU A;  2JA9 A;  1HNX H;  4FJU A;  1SEI A;  4X64 H;  3U1K A;  1N32 H;  3FAU A;  4DR4 H;  2JEA I;  4KHP H;  2CPQ A;  4DV4 H;  4DR2 H;  4LF7 H;  3GAB A;  3SB1 A;  4AQY H;  3AEV B;  2O4C A;  4DR7 H;  2CWH A;  2MJH A;  2UXC H;  5A2Q W;  1WVN A;  3J7A K;  3J80 W;  4BA2 I;  2HH3 A;  5LMU H;  1VBI A;  2LTL A;  1I94 H;  1XNR H;  4WAL A;  4X62 H;  1VIH A;  2YQR A;  1PQX A;  4JYA H;  2PQU A;  2CWF A;  2LRR A;  2M6Q A;  4JI6 H;  3UOE A;  2Y3M A;  3L7Z C;  1V9N A;  4GKJ H;  4WAN A;  1HNW H;  2CTJ A;  2CTL A;  4DV0 H;  4H8A A;  3JAM W;  3J81 W;  4NXM H;  4DV6 H;  3NCV A;  2HHH H;  4B8C D;  4OX9 H;  4DUY H;  2UU9 H;  3GKU A;  2DGR A;  1KHM A;  2BL5 A;  2PT7 G;  2ANN A;  2D9I A;  4JVY A;  5IWA H;  5K36 G;  4OO1 G;  4GKK H;  4JI7 H;  2VKC A;  4B3R H;  5C0X G;  1UG8 A;  1K1G A;  4NZT M;  4JV5 H;  1DT4 A;  4X65 H;  4DV7 H;  4JI0 H;  4DV5 H;  4IFD G;  1FJG H;  1AN7 A;  2LF0 A;  1I6U A;  4NZR M;  4OCH A;  4PDB A;  1F0X A;  4B3M H;  2Z0S A;  4JI2 H;  1N33 H;  1HNZ H;  2UXB H;  1X9Z A;  2CTE A;  4G08 A;  2OPV A;  2UUA H;  2UXD H;  2JVZ A;  1X0A A;  1XMQ H;  2JZX A;  4YY3 H; 
#chains in the Genus database with same CATH homology
 1MSZ A;  2LRR A;  2A1S A;  2CPM A;  1WHR A;  3GKU A;  1UG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...