4B8TA

Rna binding protein solution structure of the third kh domain of ksrp in complex with the g-rich target sequence.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
b'GAMAYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KH-TYPE SPLICING REGULATORY PROTEIN
molecule tags Transcription/rna
source organism Homo sapiens
publication title Noncanonical G Recognition Mediates Ksrp Regulation of Let-7 Biogenesis
pubmed doi rcsb
total genus 21
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4b8tA00
2NN6G 2Z0SA 1ZTGA 3VKEA 5K36G 2PY9A 2CTLA 2CTJA 1DTJA 2JA9A 2DGRA 2OPVA 1VIGA 4WANA 1TUAA 2JEBI 3U1KA 1K1GA 4AM3A 2BA0A 4LIJA 4JVHA 1KHMA 2HH3A 2FMRA 2CPQA 2CTFA 2CTKA 2JZXA 5C0XG 1EC6A 2CTEA 2JVZA 2JE6I 2AXYA 1ZZKA 1WE8A 4BA2I 2CTMA 2PQUA 3AEVB 2HH2A 2MJHA 1X4NA 1ZZIA 3L7ZC 4NBQA 1X4MA 2ANNA 1VIHA 3V69A 4OO1G 5JEAG 4JVYA 2BL5A 1WVNA 2QNDA 1J5KA 2ANRA 2P2RA 4AIMA 1DT4A 4QMFB 4WALA 1J4WA 4BA1I 2YQRA 1ZZJA 2JEAI 2OPUA 4IFDG 4B8TA 2E3UA
chains in the Genus database with same CATH superfamily
1ZTGA 3SB1A 4B3TH 1X0AA 2CTJA 3GKUA 4NZRM 2UUBH 3JAMW 3FAUA 1N36H 1KHMA 2E5LH 2BA0A 4JVHA 4DV1H 1I94H 2HH3A 4WANA 2CTKA 1NXUA 4JI0H 2UXCH 2PT7G 1UG8A 4DV2H 4GKKH 2UXBH 3QD7X 4FJUA 4KHPH 4X64H 2UUCH 1X4NA 1XMOH 4JYAH 1ZZIA 1F0XA 2CPMA 2LRRA 3J80W 4PDBA 4OO1G 2M8WA 1WVNA 4E9JA 2VQFH 1N34H 1FKAH 3GR5A 4DUZH 3KDGA 1WHRA 2CWHA 2M6QA 4LF6H 4EC5A 4QMFB 4WALA 4X66H 4LF5H 2YQRA 4JI6H 3J7AK 1N33H 1N32H 3T1HH 2NN6G 2Z0SA 5LMNH 4FJSA 2X06A 1DTJA 2OPVA 2DGRA 4DR1H 1VIGA 3KDKA 3U1KA 2JEBI 4YHHH 4LFCH 1FJGH 4LIJA 4AM3A 1V8CA 2FPHX 4DR7H 1X9ZA 2JZXA 1V9NA 5C0XG 3NCVA 4B3SH 3OETA 4B3RH 4B3MH 2CTEA 2AXYA 3OSSD 1WE8A 2PQUA 1AN7A 4X62H 2HH2A 1HNZH 2MJHA 4YY3H 2VQEH 1IBMH 5LMUH 1IBLH 1VBIA 4NBQA 4LF4H 1X4MA 2ANNA 4DV7H 5JEAG 1J5EH 2QNDA 4B8CD 1MSZA 2UUAH 4GKJH 2K1HA 4AIMA 1S03G 2UXDH 1XNQH 2Y3MA 1ZZJA 2OPUA 4OD6A 2F4VH 4IFDG 3RF2A 4AQYH 4DV5H 2CTLA 4OCHA 5BR8H 4LF9H 1TUAA 5LL6b 1K1GA 4H8AA 4DR3H 3GABA 2FMRA 3T1YH 1IBKH 4JI5H 4X65H 5A2QW 4DV4H 1HNXH 1ZZKA 2CTMA 1I6UA 3AEVB 2CWFA 4OX9H 4DR6H 1HNWH 2UU9H 2FFMA 4DR5H 1HR0H 4JI3H 1VIHA 4LF8H 4LFAH 4NXNH 4DR4H 4JVYA 2BL5A 4NZTM 4DV6H 2ANRA 4JI7H 4JI2H 4JI8H 2HHHH 1DT4A 4JI1H 2JEAI 4BA1I 3EZJA 1XRHA 1S20A 5IWAH 2ZM6H 4DV3H 2E3UA 4JI4H 3VKEA 5K36G 2PY9A 2JA9A 4DV0H 2A1SA 4NXMH 2VKCA 1ODHA 1WTJA 2CPQA 2CTFA 2O4CA 1EC6A 4K0KH 1PQXA 2JE6I 2JVZA 4LF7H 3UOEA 1Z2IA 2LTMA 1SEIA 3I0PA 3J81W 1XMQH 2D9IA 4JV5H 4LFBH 3L7ZC 3V69A 1XNRH 1J5KA 2P2RA 5DT9A 3OTOH 2LF0A 5FLXW 4DUYH 1J4WA 2LTLA 2ZQEA 4G08A 4DR2H 4BA2I 5IT9W 2G8YA 4B8TA
chains in the Genus database with same CATH topology
2NN6G 2Z0SA 1ZTGA 3VKEA 5K36G 2PY9A 2CTLA 2CTJA 1DTJA 2JA9A 2DGRA 2OPVA 1VIGA 4WANA 1TUAA 2JEBI 3U1KA 1K1GA 4AM3A 2BA0A 4LIJA 4JVHA 1KHMA 2HH3A 2FMRA 2CPQA 2CTFA 2CTKA 2JZXA 5C0XG 1EC6A 2CTEA 2JVZA 2JE6I 2AXYA 1ZZKA 1WE8A 4BA2I 2CTMA 2PQUA 3AEVB 2HH2A 2MJHA 1X4NA 1ZZIA 3L7ZC 4NBQA 1X4MA 2ANNA 1VIHA 3V69A 4OO1G 5JEAG 4JVYA 2BL5A 1WVNA 2QNDA 1J5KA 2ANRA 2P2RA 4AIMA 1DT4A 4QMFB 4WALA 1J4WA 4BA1I 2YQRA 1ZZJA 2JEAI 2OPUA 4IFDG 4B8TA 2E3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 G;  2Z0S A;  1ZTG A;  3VKE A;  5K36 G;  2PY9 A;  2CTL A;  2CTJ A;  1DTJ A;  2JA9 A;  2DGR A;  2OPV A;  1VIG A;  4WAN A;  1TUA A;  2JEB I;  3U1K A;  1K1G A;  4AM3 A;  2BA0 A;  4LIJ A;  4JVH A;  1KHM A;  2HH3 A;  2FMR A;  2CPQ A;  2CTF A;  2CTK A;  2JZX A;  5C0X G;  1EC6 A;  2CTE A;  2JVZ A;  2JE6 I;  2AXY A;  1ZZK A;  1WE8 A;  4BA2 I;  2CTM A;  2PQU A;  3AEV B;  2HH2 A;  2MJH A;  1X4N A;  1ZZI A;  3L7Z C;  4NBQ A;  1X4M A;  2ANN A;  1VIH A;  3V69 A;  4OO1 G;  5JEA G;  4JVY A;  2BL5 A;  1WVN A;  2QND A;  1J5K A;  2ANR A;  2P2R A;  4AIM A;  1DT4 A;  4QMF B;  4WAL A;  1J4W A;  4BA1 I;  2YQR A;  1ZZJ A;  2JEA I;  2OPU A;  4IFD G;  4B8T A;  2E3U A; 
#chains in the Genus database with same CATH topology
 1ZTG A;  3SB1 A;  4B3T H;  1X0A A;  2CTJ A;  3GKU A;  4NZR M;  2UUB H;  3JAM W;  3FAU A;  1N36 H;  1KHM A;  2E5L H;  2BA0 A;  4JVH A;  4DV1 H;  1I94 H;  2HH3 A;  4WAN A;  2CTK A;  1NXU A;  4JI0 H;  2UXC H;  2PT7 G;  1UG8 A;  4DV2 H;  4GKK H;  2UXB H;  3QD7 X;  4FJU A;  4KHP H;  4X64 H;  2UUC H;  1X4N A;  1XMO H;  4JYA H;  1ZZI A;  1F0X A;  2CPM A;  2LRR A;  3J80 W;  4PDB A;  4OO1 G;  2M8W A;  1WVN A;  4E9J A;  2VQF H;  1N34 H;  1FKA H;  3GR5 A;  4DUZ H;  3KDG A;  1WHR A;  2CWH A;  2M6Q A;  4LF6 H;  4EC5 A;  4QMF B;  4WAL A;  4X66 H;  4LF5 H;  2YQR A;  4JI6 H;  3J7A K;  1N33 H;  1N32 H;  3T1H H;  2NN6 G;  2Z0S A;  5LMN H;  4FJS A;  2X06 A;  1DTJ A;  2OPV A;  2DGR A;  4DR1 H;  1VIG A;  3KDK A;  3U1K A;  2JEB I;  4YHH H;  4LFC H;  1FJG H;  4LIJ A;  4AM3 A;  1V8C A;  2FPH X;  4DR7 H;  1X9Z A;  2JZX A;  1V9N A;  5C0X G;  3NCV A;  4B3S H;  3OET A;  4B3R H;  4B3M H;  2CTE A;  2AXY A;  3OSS D;  1WE8 A;  2PQU A;  1AN7 A;  4X62 H;  2HH2 A;  1HNZ H;  2MJH A;  4YY3 H;  2VQE H;  1IBM H;  5LMU H;  1IBL H;  1VBI A;  4NBQ A;  4LF4 H;  1X4M A;  2ANN A;  4DV7 H;  5JEA G;  1J5E H;  2QND A;  4B8C D;  1MSZ A;  2UUA H;  4GKJ H;  2K1H A;  4AIM A;  1S03 G;  2UXD H;  1XNQ H;  2Y3M A;  1ZZJ A;  2OPU A;  4OD6 A;  2F4V H;  4IFD G;  3RF2 A;  4AQY H;  4DV5 H;  2CTL A;  4OCH A;  5BR8 H;  4LF9 H;  1TUA A;  5LL6 b;  1K1G A;  4H8A A;  4DR3 H;  3GAB A;  2FMR A;  3T1Y H;  1IBK H;  4JI5 H;  4X65 H;  5A2Q W;  4DV4 H;  1HNX H;  1ZZK A;  2CTM A;  1I6U A;  3AEV B;  2CWF A;  4OX9 H;  4DR6 H;  1HNW H;  2UU9 H;  2FFM A;  4DR5 H;  1HR0 H;  4JI3 H;  1VIH A;  4LF8 H;  4LFA H;  4NXN H;  4DR4 H;  4JVY A;  2BL5 A;  4NZT M;  4DV6 H;  2ANR A;  4JI7 H;  4JI2 H;  4JI8 H;  2HHH H;  1DT4 A;  4JI1 H;  2JEA I;  4BA1 I;  3EZJ A;  1XRH A;  1S20 A;  5IWA H;  2ZM6 H;  4DV3 H;  2E3U A;  4JI4 H;  3VKE A;  5K36 G;  2PY9 A;  2JA9 A;  4DV0 H;  2A1S A;  4NXM H;  2VKC A;  1ODH A;  1WTJ A;  2CPQ A;  2CTF A;  2O4C A;  1EC6 A;  4K0K H;  1PQX A;  2JE6 I;  2JVZ A;  4LF7 H;  3UOE A;  1Z2I A;  2LTM A;  1SEI A;  3I0P A;  3J81 W;  1XMQ H;  2D9I A;  4JV5 H;  4LFB H;  3L7Z C;  3V69 A;  1XNR H;  1J5K A;  2P2R A;  5DT9 A;  3OTO H;  2LF0 A;  5FLX W;  4DUY H;  1J4W A;  2LTL A;  2ZQE A;  4G08 A;  4DR2 H;  4BA2 I;  5IT9 W;  2G8Y A;  4B8T A; 
#chains in the Genus database with same CATH homology
 2NN6 G;  2Z0S A;  1ZTG A;  3VKE A;  5K36 G;  2PY9 A;  2CTL A;  2CTJ A;  1DTJ A;  2JA9 A;  2DGR A;  2OPV A;  1VIG A;  4WAN A;  1TUA A;  2JEB I;  3U1K A;  1K1G A;  4AM3 A;  2BA0 A;  4LIJ A;  4JVH A;  1KHM A;  2HH3 A;  2FMR A;  2CPQ A;  2CTF A;  2CTK A;  2JZX A;  5C0X G;  1EC6 A;  2CTE A;  2JVZ A;  2JE6 I;  2AXY A;  1ZZK A;  1WE8 A;  4BA2 I;  2CTM A;  2PQU A;  3AEV B;  2HH2 A;  2MJH A;  1X4N A;  1ZZI A;  3L7Z C;  4NBQ A;  1X4M A;  2ANN A;  1VIH A;  3V69 A;  4OO1 G;  5JEA G;  4JVY A;  2BL5 A;  1WVN A;  2QND A;  1J5K A;  2ANR A;  2P2R A;  4AIM A;  1DT4 A;  4QMF B;  4WAL A;  1J4W A;  4BA1 I;  2YQR A;  1ZZJ A;  2JEA I;  2OPU A;  4IFD G;  4B8T A;  2E3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...