4B8TA

Rna binding protein solution structure of the third kh domain of ksrp in complex with the g-rich target sequence.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
GAMAYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Noncanonical G Recognition Mediates Ksrp Regulation of Let-7 Biogenesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/rna
molecule keywords KH-TYPE SPLICING REGULATORY PROTEIN
total genus 21
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4b8tA00
1VIGA 2CTEA 5K36G 4OO1G 2BL5A 2CTFA 2CTJA 4NBQA 2CPQA 4BA2I 2YQRA 2QNDA 2BA0A 1WVNA 1X4MA 2E3UA 2JA9A 2NN6G 1WE8A 2OPVA 1ZZIA 2ANRA 2CTLA 2Z0SA 3AEVB 1ZZKA 4B8TA 2HH2A 2P2RA 2PQUA 2DGRA 2JEBI 3L7ZC 2PY9A 1EC6A 4AM3A 5JEAG 4JVYA 1X4NA 4WALA 3U1KA 4IFDG 4JVHA 2HH3A 2FMRA 1J4WA 3V69A 5C0XG 1VIHA 1ZTGA 1K1GA 4WANA 1TUAA 1DTJA 4QMFB 2CTMA 3VKEA 4LIJA 2JEAI 2CTKA 1ZZJA 1KHMA 2AXYA 1J5KA 2MJHA 4BA1I 2ANNA 2JVZA 2OPUA 2JZXA 1DT4A 2JE6I 4AIMA
chains in the Genus database with same CATH superfamily
1VIGA 4DR4H 5FLXW 5K36G 3GABA 4BA2I 4DR7H 2G8YA 1IBLH 1NXUA 4JI4H 1X4MA 1HNZH 4JI0H 3OETA 2D9IA 5BR8H 1J5EH 1FKAH 5LMUH 4DUZH 4B8TA 3L7ZC 2PY9A 4LF9H 1EC6A 4LF7H 1Z2IA 1ODHA 4IFDG 4JI6H 3RF2A 2FFMA 2HH3A 1S03G 1N36H 2UXBH 4B8CD 4YY3H 3GR5A 4JYAH 1I6UA 5IT9W 3JAMW 3OSSD 4DV2H 1DTJA 4QMFB 1K1GA 4NZTM 4LFCH 1HNWH 1XMOH 4B3SH 2E5LH 2VQEH 2PT7G 2HHHH 1KHMA 2M8WA 1V9NA 2LTMA 1J5KA 4X65H 2LF0A 1N33H 2JVZA 2VQFH 2UXDH 1UG8A 5LL6b 4B3RH 4NBQA 3FAUA 4FJUA 1PQXA 4DV4H 1MSZA 1ZZIA 5IWAH 4NXNH 5A2QW 4B3MH 2Z0SA 2CWFA 1HNXH 3AEVB 4X64H 4DV3H 4DV6H 4JI5H 3J7AK 4OCHA 4GKKH 2DGRA 2JEBI 2UXCH 4DR3H 4LFBH 4AM3A 4JVYA 1X4NA 2F4VH 3U1KA 1N34H 4EC5A 4JI3H 2A1SA 5C0XG 1ZTGA 1VIHA 1VBIA 1X0AA 4DV5H 2CTMA 2CPMA 1HR0H 4YHHH 3VKEA 4JI1H 4GKJH 4LIJA 2LRRA 4FJSA 2JEAI 2K1HA 4KHPH 4DR5H 4DV0H 3KDGA 5LMNH 2ZQEA 2MJHA 3QD7X 3T1YH 2UU9H 1N32H 2OPUA 2JZXA 4OX9H 1DT4A 4AIMA 4OO1G 4JI8H 3J81W 2CTJA 4AQYH 2CPQA 2M6QA 2BA0A 1WVNA 2E3UA 2NN6G 4B3TH 2OPVA 4JI2H 1WHRA 2ANRA 2CTLA 1XNRH 1F0XA 2HH2A 1FJGH 2P2RA 4OD6A 4E9JA 4K0KH 4LF5H 2Y3MA 4JVHA 3SB1A 1S20A 1XRHA 1J4WA 4WANA 3T1HH 4DR6H 1X9ZA 1WTJA 4X66H 4LF4H 2UUBH 1ZZJA 2AXYA 3UOEA 2O4CA 4G08A 4X62H 4BA1I 2ANNA 4DV1H 2FPHX 2CTEA 4LF8H 1XMQH 2BL5A 4DR2H 2CTFA 3OTOH 2YQRA 1V8CA 2QNDA 4LF6H 2JA9A 4NXMH 1WE8A 2ZM6H 2X06A 1ZZKA 2UUCH 4DUYH 2PQUA 3GKUA 4JV5H 5JEAG 2LTLA 4WALA 3NCVA 2FMRA 4DR1H 1IBMH 1IBKH 1AN7A 3V69A 5DT9A 4LFAH 1TUAA 2CWHA 2VKCA 1I94H 3J80W 3KDKA 4H8AA 4JI7H 4DV7H 1SEIA 2UUAH 3I0PA 2CTKA 1XNQH 3EZJA 4NZRM 4PDBA 2JE6I
chains in the Genus database with same CATH topology
1VIGA 2CTEA 5K36G 4OO1G 2BL5A 2CTFA 2CTJA 4NBQA 2CPQA 4BA2I 2YQRA 2QNDA 2BA0A 1WVNA 1X4MA 2E3UA 2JA9A 2NN6G 1WE8A 2OPVA 1ZZIA 2ANRA 2CTLA 2Z0SA 3AEVB 1ZZKA 4B8TA 2HH2A 2P2RA 2PQUA 2DGRA 2JEBI 3L7ZC 2PY9A 1EC6A 4AM3A 5JEAG 4JVYA 1X4NA 4WALA 3U1KA 4IFDG 4JVHA 2HH3A 2FMRA 1J4WA 3V69A 5C0XG 1VIHA 1ZTGA 1K1GA 4WANA 1TUAA 1DTJA 4QMFB 2CTMA 3VKEA 4LIJA 2JEAI 2CTKA 1ZZJA 1KHMA 2AXYA 1J5KA 2MJHA 4BA1I 2ANNA 2JVZA 2OPUA 2JZXA 1DT4A 2JE6I 4AIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIG A;  2CTE A;  5K36 G;  4OO1 G;  2BL5 A;  2CTF A;  2CTJ A;  4NBQ A;  2CPQ A;  4BA2 I;  2YQR A;  2QND A;  2BA0 A;  1WVN A;  1X4M A;  2E3U A;  2JA9 A;  2NN6 G;  1WE8 A;  2OPV A;  1ZZI A;  2ANR A;  2CTL A;  2Z0S A;  3AEV B;  1ZZK A;  4B8T A;  2HH2 A;  2P2R A;  2PQU A;  2DGR A;  2JEB I;  3L7Z C;  2PY9 A;  1EC6 A;  4AM3 A;  5JEA G;  4JVY A;  1X4N A;  4WAL A;  3U1K A;  4IFD G;  4JVH A;  2HH3 A;  2FMR A;  1J4W A;  3V69 A;  5C0X G;  1VIH A;  1ZTG A;  1K1G A;  4WAN A;  1TUA A;  1DTJ A;  4QMF B;  2CTM A;  3VKE A;  4LIJ A;  2JEA I;  2CTK A;  1ZZJ A;  1KHM A;  2AXY A;  1J5K A;  2MJH A;  4BA1 I;  2ANN A;  2JVZ A;  2OPU A;  2JZX A;  1DT4 A;  2JE6 I;  4AIM A; 
#chains in the Genus database with same CATH topology
 1VIG A;  4DR4 H;  5FLX W;  5K36 G;  3GAB A;  4BA2 I;  4DR7 H;  2G8Y A;  1IBL H;  1NXU A;  4JI4 H;  1X4M A;  1HNZ H;  4JI0 H;  3OET A;  2D9I A;  5BR8 H;  1J5E H;  1FKA H;  5LMU H;  4DUZ H;  4B8T A;  3L7Z C;  2PY9 A;  4LF9 H;  1EC6 A;  4LF7 H;  1Z2I A;  1ODH A;  4IFD G;  4JI6 H;  3RF2 A;  2FFM A;  2HH3 A;  1S03 G;  1N36 H;  2UXB H;  4B8C D;  4YY3 H;  3GR5 A;  4JYA H;  1I6U A;  5IT9 W;  3JAM W;  3OSS D;  4DV2 H;  1DTJ A;  4QMF B;  1K1G A;  4NZT M;  4LFC H;  1HNW H;  1XMO H;  4B3S H;  2E5L H;  2VQE H;  2PT7 G;  2HHH H;  1KHM A;  2M8W A;  1V9N A;  2LTM A;  1J5K A;  4X65 H;  2LF0 A;  1N33 H;  2JVZ A;  2VQF H;  2UXD H;  1UG8 A;  5LL6 b;  4B3R H;  4NBQ A;  3FAU A;  4FJU A;  1PQX A;  4DV4 H;  1MSZ A;  1ZZI A;  5IWA H;  4NXN H;  5A2Q W;  4B3M H;  2Z0S A;  2CWF A;  1HNX H;  3AEV B;  4X64 H;  4DV3 H;  4DV6 H;  4JI5 H;  3J7A K;  4OCH A;  4GKK H;  2DGR A;  2JEB I;  2UXC H;  4DR3 H;  4LFB H;  4AM3 A;  4JVY A;  1X4N A;  2F4V H;  3U1K A;  1N34 H;  4EC5 A;  4JI3 H;  2A1S A;  5C0X G;  1ZTG A;  1VIH A;  1VBI A;  1X0A A;  4DV5 H;  2CTM A;  2CPM A;  1HR0 H;  4YHH H;  3VKE A;  4JI1 H;  4GKJ H;  4LIJ A;  2LRR A;  4FJS A;  2JEA I;  2K1H A;  4KHP H;  4DR5 H;  4DV0 H;  3KDG A;  5LMN H;  2ZQE A;  2MJH A;  3QD7 X;  3T1Y H;  2UU9 H;  1N32 H;  2OPU A;  2JZX A;  4OX9 H;  1DT4 A;  4AIM A;  4OO1 G;  4JI8 H;  3J81 W;  2CTJ A;  4AQY H;  2CPQ A;  2M6Q A;  2BA0 A;  1WVN A;  2E3U A;  2NN6 G;  4B3T H;  2OPV A;  4JI2 H;  1WHR A;  2ANR A;  2CTL A;  1XNR H;  1F0X A;  2HH2 A;  1FJG H;  2P2R A;  4OD6 A;  4E9J A;  4K0K H;  4LF5 H;  2Y3M A;  4JVH A;  3SB1 A;  1S20 A;  1XRH A;  1J4W A;  4WAN A;  3T1H H;  4DR6 H;  1X9Z A;  1WTJ A;  4X66 H;  4LF4 H;  2UUB H;  1ZZJ A;  2AXY A;  3UOE A;  2O4C A;  4G08 A;  4X62 H;  4BA1 I;  2ANN A;  4DV1 H;  2FPH X;  2CTE A;  4LF8 H;  1XMQ H;  2BL5 A;  4DR2 H;  2CTF A;  3OTO H;  2YQR A;  1V8C A;  2QND A;  4LF6 H;  2JA9 A;  4NXM H;  1WE8 A;  2ZM6 H;  2X06 A;  1ZZK A;  2UUC H;  4DUY H;  2PQU A;  3GKU A;  4JV5 H;  5JEA G;  2LTL A;  4WAL A;  3NCV A;  2FMR A;  4DR1 H;  1IBM H;  1IBK H;  1AN7 A;  3V69 A;  5DT9 A;  4LFA H;  1TUA A;  2CWH A;  2VKC A;  1I94 H;  3J80 W;  3KDK A;  4H8A A;  4JI7 H;  4DV7 H;  1SEI A;  2UUA H;  3I0P A;  2CTK A;  1XNQ H;  3EZJ A;  4NZR M;  4PDB A;  2JE6 I; 
#chains in the Genus database with same CATH homology
 1VIG A;  2CTE A;  5K36 G;  4OO1 G;  2BL5 A;  2CTF A;  2CTJ A;  4NBQ A;  2CPQ A;  4BA2 I;  2YQR A;  2QND A;  2BA0 A;  1WVN A;  1X4M A;  2E3U A;  2JA9 A;  2NN6 G;  1WE8 A;  2OPV A;  1ZZI A;  2ANR A;  2CTL A;  2Z0S A;  3AEV B;  1ZZK A;  4B8T A;  2HH2 A;  2P2R A;  2PQU A;  2DGR A;  2JEB I;  3L7Z C;  2PY9 A;  1EC6 A;  4AM3 A;  5JEA G;  4JVY A;  1X4N A;  4WAL A;  3U1K A;  4IFD G;  4JVH A;  2HH3 A;  2FMR A;  1J4W A;  3V69 A;  5C0X G;  1VIH A;  1ZTG A;  1K1G A;  4WAN A;  1TUA A;  1DTJ A;  4QMF B;  2CTM A;  3VKE A;  4LIJ A;  2JEA I;  2CTK A;  1ZZJ A;  1KHM A;  2AXY A;  1J5K A;  2MJH A;  4BA1 I;  2ANN A;  2JVZ A;  2OPU A;  2JZX A;  1DT4 A;  2JE6 I;  4AIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...