4B8TA

Rna binding protein solution structure of the third kh domain of ksrp in complex with the g-rich target sequence.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
GAMAYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KH-TYPE SPLICING REGULATORY PROTEIN
publication title Noncanonical G Recognition Mediates Ksrp Regulation of Let-7 Biogenesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/rna
total genus 21
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4b8tA00
2HH2A 2PY9A 2ANNA 5K36G 2CTMA 2CPQA 4WANA 1J5KA 2CTEA 2Z0SA 1VIHA 3U1KA 2P2RA 2JEAI 1KHMA 2JE6I 5C0XG 1ZZIA 1X4MA 1EC6A 4JVYA 2FMRA 2CTJA 4OO1G 2JVZA 1VIGA 2JEBI 2ANRA 2YQRA 1WE8A 2CTLA 2BL5A 2OPUA 1ZTGA 1DTJA 1DT4A 2NN6G 4BA1I 1ZZJA 1ZZKA 4JVHA 4LIJA 4AIMA 4IFDG 4QMFB 3L7ZC 1X4NA 3V69A 3VKEA 1K1GA 2CTKA 2OPVA 2QNDA 1WVNA 2CTFA 2JA9A 1TUAA 2BA0A 2HH3A 2AXYA 4BA2I 2JZXA 2DGRA 4AM3A 5JEAG 4WALA 2MJHA 2PQUA 4B8TA 1J4WA 2E3UA 3AEVB 4NBQA
chains in the Genus database with same CATH superfamily
4DV6H 2ANNA 5K36G 1HNZH 2F4VH 1XRHA 4X65H 2P2RA 4FJSA 2JEAI 1ZZIA 1SEIA 4X66H 1MSZA 4DR1H 3OTOH 4LFAH 2ZM6H 4LFCH 4LF8H 4OO1G 1VIGA 2JEBI 2O4CA 4DV5H 1AN7A 5LMNH 2A1SA 4OCHA 4X62H 1DT4A 4BA1I 4LF7H 5IT9W 3NCVA 2FPHX 4JI1H 3L7ZC 1X4NA 1K1GA 2M8WA 1HNXH 2LF0A 4BA2I 2JZXA 1X0AA 1N32H 2X06A 4WALA 1XMQH 4NXNH 1J4WA 4DR4H 4G08A 2D9IA 3AEVB 4LFBH 2CTMA 2FFMA 4NZRM 1IBLH 4LF4H 4LF6H 1NXUA 2Z0SA 3QD7X 4B8CD 4JVYA 2UXDH 2CTJA 4EC5A 2YQRA 1WE8A 4X64H 2NN6G 4LF5H 1S03G 4JVHA 4AIMA 2E5LH 2CTKA 1XMOH 2HHHH 2JA9A 1HR0H 4DR6H 2G8YA 4E9JA 3T1YH 4AM3A 1Z2IA 1I6UA 1N33H 1V8CA 4B3MH 5JEAG 1F0XA 2MJHA 2PQUA 4B8TA 2UXCH 3J81W 4DV3H 2UXBH 2PY9A 4DR3H 4GKKH 2M6QA 1WHRA 4OD6A 5IWAH 4OX9H 2ZQEA 4DV2H 2CTEA 3SB1A 2VQEH 4FJUA 1J5EH 4KHPH 3J80W 3U1KA 1KHMA 2K1HA 4DV7H 1IBMH 3GABA 5C0XG 2UUCH 4JI4H 4JI6H 2FMRA 4JYAH 2VQFH 1PQXA 2JVZA 4DUYH 2ANRA 4NXMH 4PDBA 4NZTM 2BL5A 3GR5A 1ZTGA 1FJGH 4DR7H 2CWHA 1ZZJA 4DR5H 4GKJH 4QMFB 5A2QW 5BR8H 4AQYH 2UU9H 2CWFA 4B3TH 4JI0H 2QNDA 3OETA 1WVNA 4DV4H 1S20A 2UUAH 1TUAA 2BA0A 2HH3A 5DT9A 2AXYA 1HNWH 4YHHH 3KDKA 4K0KH 1FKAH 2E3UA 3FAUA 4B3RH 4NBQA 1XNQH 2HH2A 3UOEA 2UUBH 3T1HH 2CPQA 4B3SH 1J5KA 4WANA 1X9ZA 1UG8A 1VIHA 2LTLA 5FLXW 3GKUA 1I94H 4JI5H 2JE6I 1ODHA 2CPMA 1X4MA 1EC6A 1IBKH 4LF9H 1N34H 2Y3MA 4H8AA 2PT7G 3EZJA 3JAMW 4DR2H 1N36H 4JI8H 2CTLA 3I0PA 4JI3H 2LRRA 2OPUA 1DTJA 4DV0H 4JI7H 3RF2A 1ZZKA 3OSSD 4YY3H 4LIJA 4JI2H 4DUZH 3J7AK 4DV1H 5LMUH 4IFDG 5LL6b 1WTJA 3V69A 1XNRH 2LTMA 2OPVA 2CTFA 4JV5H 2DGRA 1V9NA 1VBIA 3VKEA 3KDGA 2VKCA
chains in the Genus database with same CATH topology
2HH2A 2PY9A 2ANNA 5K36G 2CTMA 2CPQA 4WANA 1J5KA 2CTEA 2Z0SA 1VIHA 3U1KA 2P2RA 2JEAI 1KHMA 2JE6I 5C0XG 1ZZIA 1X4MA 1EC6A 4JVYA 2FMRA 2CTJA 4OO1G 2JVZA 1VIGA 2JEBI 2ANRA 2YQRA 1WE8A 2CTLA 2BL5A 2OPUA 1ZTGA 1DTJA 1DT4A 2NN6G 4BA1I 1ZZJA 1ZZKA 4JVHA 4LIJA 4AIMA 4IFDG 4QMFB 3L7ZC 1X4NA 3V69A 3VKEA 1K1GA 2CTKA 2OPVA 2QNDA 1WVNA 2CTFA 2JA9A 1TUAA 2BA0A 2HH3A 2AXYA 4BA2I 2JZXA 2DGRA 4AM3A 5JEAG 4WALA 2MJHA 2PQUA 4B8TA 1J4WA 2E3UA 3AEVB 4NBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HH2 A;  2PY9 A;  2ANN A;  5K36 G;  2CTM A;  2CPQ A;  4WAN A;  1J5K A;  2CTE A;  2Z0S A;  1VIH A;  3U1K A;  2P2R A;  2JEA I;  1KHM A;  2JE6 I;  5C0X G;  1ZZI A;  1X4M A;  1EC6 A;  4JVY A;  2FMR A;  2CTJ A;  4OO1 G;  2JVZ A;  1VIG A;  2JEB I;  2ANR A;  2YQR A;  1WE8 A;  2CTL A;  2BL5 A;  2OPU A;  1ZTG A;  1DTJ A;  1DT4 A;  2NN6 G;  4BA1 I;  1ZZJ A;  1ZZK A;  4JVH A;  4LIJ A;  4AIM A;  4IFD G;  4QMF B;  3L7Z C;  1X4N A;  3V69 A;  3VKE A;  1K1G A;  2CTK A;  2OPV A;  2QND A;  1WVN A;  2CTF A;  2JA9 A;  1TUA A;  2BA0 A;  2HH3 A;  2AXY A;  4BA2 I;  2JZX A;  2DGR A;  4AM3 A;  5JEA G;  4WAL A;  2MJH A;  2PQU A;  4B8T A;  1J4W A;  2E3U A;  3AEV B;  4NBQ A; 
#chains in the Genus database with same CATH topology
 4DV6 H;  2ANN A;  5K36 G;  1HNZ H;  2F4V H;  1XRH A;  4X65 H;  2P2R A;  4FJS A;  2JEA I;  1ZZI A;  1SEI A;  4X66 H;  1MSZ A;  4DR1 H;  3OTO H;  4LFA H;  2ZM6 H;  4LFC H;  4LF8 H;  4OO1 G;  1VIG A;  2JEB I;  2O4C A;  4DV5 H;  1AN7 A;  5LMN H;  2A1S A;  4OCH A;  4X62 H;  1DT4 A;  4BA1 I;  4LF7 H;  5IT9 W;  3NCV A;  2FPH X;  4JI1 H;  3L7Z C;  1X4N A;  1K1G A;  2M8W A;  1HNX H;  2LF0 A;  4BA2 I;  2JZX A;  1X0A A;  1N32 H;  2X06 A;  4WAL A;  1XMQ H;  4NXN H;  1J4W A;  4DR4 H;  4G08 A;  2D9I A;  3AEV B;  4LFB H;  2CTM A;  2FFM A;  4NZR M;  1IBL H;  4LF4 H;  4LF6 H;  1NXU A;  2Z0S A;  3QD7 X;  4B8C D;  4JVY A;  2UXD H;  2CTJ A;  4EC5 A;  2YQR A;  1WE8 A;  4X64 H;  2NN6 G;  4LF5 H;  1S03 G;  4JVH A;  4AIM A;  2E5L H;  2CTK A;  1XMO H;  2HHH H;  2JA9 A;  1HR0 H;  4DR6 H;  2G8Y A;  4E9J A;  3T1Y H;  4AM3 A;  1Z2I A;  1I6U A;  1N33 H;  1V8C A;  4B3M H;  5JEA G;  1F0X A;  2MJH A;  2PQU A;  4B8T A;  2UXC H;  3J81 W;  4DV3 H;  2UXB H;  2PY9 A;  4DR3 H;  4GKK H;  2M6Q A;  1WHR A;  4OD6 A;  5IWA H;  4OX9 H;  2ZQE A;  4DV2 H;  2CTE A;  3SB1 A;  2VQE H;  4FJU A;  1J5E H;  4KHP H;  3J80 W;  3U1K A;  1KHM A;  2K1H A;  4DV7 H;  1IBM H;  3GAB A;  5C0X G;  2UUC H;  4JI4 H;  4JI6 H;  2FMR A;  4JYA H;  2VQF H;  1PQX A;  2JVZ A;  4DUY H;  2ANR A;  4NXM H;  4PDB A;  4NZT M;  2BL5 A;  3GR5 A;  1ZTG A;  1FJG H;  4DR7 H;  2CWH A;  1ZZJ A;  4DR5 H;  4GKJ H;  4QMF B;  5A2Q W;  5BR8 H;  4AQY H;  2UU9 H;  2CWF A;  4B3T H;  4JI0 H;  2QND A;  3OET A;  1WVN A;  4DV4 H;  1S20 A;  2UUA H;  1TUA A;  2BA0 A;  2HH3 A;  5DT9 A;  2AXY A;  1HNW H;  4YHH H;  3KDK A;  4K0K H;  1FKA H;  2E3U A;  3FAU A;  4B3R H;  4NBQ A;  1XNQ H;  2HH2 A;  3UOE A;  2UUB H;  3T1H H;  2CPQ A;  4B3S H;  1J5K A;  4WAN A;  1X9Z A;  1UG8 A;  1VIH A;  2LTL A;  5FLX W;  3GKU A;  1I94 H;  4JI5 H;  2JE6 I;  1ODH A;  2CPM A;  1X4M A;  1EC6 A;  1IBK H;  4LF9 H;  1N34 H;  2Y3M A;  4H8A A;  2PT7 G;  3EZJ A;  3JAM W;  4DR2 H;  1N36 H;  4JI8 H;  2CTL A;  3I0P A;  4JI3 H;  2LRR A;  2OPU A;  1DTJ A;  4DV0 H;  4JI7 H;  3RF2 A;  1ZZK A;  3OSS D;  4YY3 H;  4LIJ A;  4JI2 H;  4DUZ H;  3J7A K;  4DV1 H;  5LMU H;  4IFD G;  5LL6 b;  1WTJ A;  3V69 A;  1XNR H;  2LTM A;  2OPV A;  2CTF A;  4JV5 H;  2DGR A;  1V9N A;  1VBI A;  3VKE A;  3KDG A;  2VKC A; 
#chains in the Genus database with same CATH homology
 2HH2 A;  2PY9 A;  2ANN A;  5K36 G;  2CTM A;  2CPQ A;  4WAN A;  1J5K A;  2CTE A;  2Z0S A;  1VIH A;  3U1K A;  2P2R A;  2JEA I;  1KHM A;  2JE6 I;  5C0X G;  1ZZI A;  1X4M A;  1EC6 A;  4JVY A;  2FMR A;  2CTJ A;  4OO1 G;  2JVZ A;  1VIG A;  2JEB I;  2ANR A;  2YQR A;  1WE8 A;  2CTL A;  2BL5 A;  2OPU A;  1ZTG A;  1DTJ A;  1DT4 A;  2NN6 G;  4BA1 I;  1ZZJ A;  1ZZK A;  4JVH A;  4LIJ A;  4AIM A;  4IFD G;  4QMF B;  3L7Z C;  1X4N A;  3V69 A;  3VKE A;  1K1G A;  2CTK A;  2OPV A;  2QND A;  1WVN A;  2CTF A;  2JA9 A;  1TUA A;  2BA0 A;  2HH3 A;  2AXY A;  4BA2 I;  2JZX A;  2DGR A;  4AM3 A;  5JEA G;  4WAL A;  2MJH A;  2PQU A;  4B8T A;  1J4W A;  2E3U A;  3AEV B;  4NBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...