4B8TA

Rna binding protein solution structure of the third kh domain of ksrp in complex with the g-rich target sequence.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
GAMAYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna
molecule keywords KH-TYPE SPLICING REGULATORY PROTEIN
publication title Noncanonical G Recognition Mediates Ksrp Regulation of Let-7 Biogenesis
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4b8tA00
2JE6I 4LIJA 1J5KA 2YQRA 5K36G 1WVNA 4JVYA 2CTFA 4B8TA 2P2RA 2HH2A 4BA2I 1DTJA 3VKEA 1X4MA 1ZZIA 2Z0SA 4QMFB 4WALA 3AEVB 4IFDG 1VIHA 1ZZKA 2CTLA 1EC6A 4JVHA 2NN6G 1VIGA 4AIMA 2AXYA 1ZTGA 2ANNA 2FMRA 2HH3A 1TUAA 1KHMA 1WE8A 2JZXA 1DT4A 1X4NA 5C0XG 2PQUA 4WANA 2DGRA 2JVZA 4OO1G 1K1GA 2CPQA 2MJHA 1J4WA 2BA0A 2CTJA 2ANRA 3L7ZC 4BA1I 2QNDA 2CTMA 2JEBI 5JEAG 2JEAI 2PY9A 4NBQA 2JA9A 2BL5A 4AM3A 3U1KA 1ZZJA 2OPVA 2E3UA 2OPUA 2CTEA 2CTKA 3V69A
chains in the Genus database with same CATH superfamily
3SB1A 2YQRA 4DR2H 1S20A 2CTFA 2Y3MA 1IBKH 2HH2A 3GABA 2CWHA 4QMFB 5LMUH 3AEVB 1ZZKA 4NXNH 2CWFA 4B3RH 4JYAH 2NN6G 2LTLA 3NCVA 1V8CA 2UUCH 2HH3A 1N32H 4E9JA 4X65H 1AN7A 1DT4A 1X4NA 5FLXW 2CPMA 2M8WA 2PQUA 2LRRA 4B3MH 2DGRA 1F0XA 1WHRA 2LF0A 2ZQEA 3OTOH 1K1GA 2CPQA 4DV0H 4DR6H 1J4WA 4OD6A 5IT9W 3OETA 2CTJA 4OCHA 2UUBH 4DR4H 3QD7X 5JEAG 4B3SH 1PQXA 4LF8H 4LFBH 1ZZJA 2OPVA 1VBIA 4DR7H 4DR1H 4LFAH 1XNQH 2X06A 1SEIA 2JE6I 5LL6b 4DV4H 1IBMH 4LF9H 1X9ZA 5K36G 1WVNA 3FAUA 5BR8H 4G08A 4YHHH 3GKUA 2P2RA 1S03G 1I94H 4BA2I 1DTJA 1X4MA 3J80W 1V9NA 4WALA 4IFDG 4DUYH 2UU9H 1MSZA 2AXYA 1J5EH 2FPHX 4AQYH 1XMQH 4WANA 4LF5H 2UXBH 2JVZA 1ODHA 3J7AK 4JI4H 4H8AA 2BA0A 4DV3H 4PDBA 1I6UA 2ANRA 4LF4H 2JEAI 4NBQA 1UG8A 2JA9A 4JV5H 3RF2A 1N36H 4DV2H 4LF7H 2OPUA 4JI7H 2CTEA 1NXUA 2UXDH 4JI8H 4DV5H 1X0AA 4LIJA 4DR5H 4JVYA 2PT7G 4B8TA 1HNZH 1EC6A 1VIHA 4B3TH 2CTLA 4AIMA 5A2QW 1XMOH 2ANNA 4JI0H 2FFMA 2FMRA 1TUAA 1KHMA 1WE8A 2JZXA 3OSSD 4B8CD 4DV7H 2VQEH 4DV1H 3GR5A 4FJUA 4JI1H 4DR3H 4OO1G 3JAMW 4LF6H 1N33H 2O4CA 4JI5H 2MJHA 1FJGH 4DV6H 4NXMH 3L7ZC 4X62H 2QNDA 5LMNH 4LFCH 4GKJH 2BL5A 1FKAH 3U1KA 2E5LH 2E3UA 4KHPH 2VKCA 4YY3H 4JI3H 2CTKA 4EC5A 1Z2IA 3KDGA 2F4VH 3KDKA 3UOEA 1N34H 1J5KA 2K1HA 1IBLH 4DUZH 2G8YA 5IWAH 3VKEA 1ZZIA 2Z0SA 4JI6H 4JVHA 3EZJA 1VIGA 4NZTM 1HNWH 1ZTGA 2UUAH 4OX9H 3J81W 2HHHH 4NZRM 5C0XG 4JI2H 2M6QA 2A1SA 1WTJA 4X66H 2ZM6H 3I0PA 3T1HH 1XRHA 5DT9A 4FJSA 4GKKH 4BA1I 1HR0H 4K0KH 2CTMA 2JEBI 2PY9A 3T1YH 4AM3A 1HNXH 2LTMA 2VQFH 2D9IA 2UXCH 1XNRH 4X64H 3V69A
chains in the Genus database with same CATH topology
2JE6I 4LIJA 1J5KA 2YQRA 5K36G 1WVNA 4JVYA 2CTFA 4B8TA 2P2RA 2HH2A 4BA2I 1DTJA 3VKEA 1X4MA 1ZZIA 2Z0SA 4QMFB 4WALA 3AEVB 4IFDG 1VIHA 1ZZKA 2CTLA 1EC6A 4JVHA 2NN6G 1VIGA 4AIMA 2AXYA 1ZTGA 2ANNA 2FMRA 2HH3A 1TUAA 1KHMA 1WE8A 2JZXA 1DT4A 1X4NA 5C0XG 2PQUA 4WANA 2DGRA 2JVZA 4OO1G 1K1GA 2CPQA 2MJHA 1J4WA 2BA0A 2CTJA 2ANRA 3L7ZC 4BA1I 2QNDA 2CTMA 2JEBI 5JEAG 2JEAI 2PY9A 4NBQA 2JA9A 2BL5A 4AM3A 3U1KA 1ZZJA 2OPVA 2E3UA 2OPUA 2CTEA 2CTKA 3V69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JE6 I;  4LIJ A;  1J5K A;  2YQR A;  5K36 G;  1WVN A;  4JVY A;  2CTF A;  4B8T A;  2P2R A;  2HH2 A;  4BA2 I;  1DTJ A;  3VKE A;  1X4M A;  1ZZI A;  2Z0S A;  4QMF B;  4WAL A;  3AEV B;  4IFD G;  1VIH A;  1ZZK A;  2CTL A;  1EC6 A;  4JVH A;  2NN6 G;  1VIG A;  4AIM A;  2AXY A;  1ZTG A;  2ANN A;  2FMR A;  2HH3 A;  1TUA A;  1KHM A;  1WE8 A;  2JZX A;  1DT4 A;  1X4N A;  5C0X G;  2PQU A;  4WAN A;  2DGR A;  2JVZ A;  4OO1 G;  1K1G A;  2CPQ A;  2MJH A;  1J4W A;  2BA0 A;  2CTJ A;  2ANR A;  3L7Z C;  4BA1 I;  2QND A;  2CTM A;  2JEB I;  5JEA G;  2JEA I;  2PY9 A;  4NBQ A;  2JA9 A;  2BL5 A;  4AM3 A;  3U1K A;  1ZZJ A;  2OPV A;  2E3U A;  2OPU A;  2CTE A;  2CTK A;  3V69 A; 
#chains in the Genus database with same CATH topology
 3SB1 A;  2YQR A;  4DR2 H;  1S20 A;  2CTF A;  2Y3M A;  1IBK H;  2HH2 A;  3GAB A;  2CWH A;  4QMF B;  5LMU H;  3AEV B;  1ZZK A;  4NXN H;  2CWF A;  4B3R H;  4JYA H;  2NN6 G;  2LTL A;  3NCV A;  1V8C A;  2UUC H;  2HH3 A;  1N32 H;  4E9J A;  4X65 H;  1AN7 A;  1DT4 A;  1X4N A;  5FLX W;  2CPM A;  2M8W A;  2PQU A;  2LRR A;  4B3M H;  2DGR A;  1F0X A;  1WHR A;  2LF0 A;  2ZQE A;  3OTO H;  1K1G A;  2CPQ A;  4DV0 H;  4DR6 H;  1J4W A;  4OD6 A;  5IT9 W;  3OET A;  2CTJ A;  4OCH A;  2UUB H;  4DR4 H;  3QD7 X;  5JEA G;  4B3S H;  1PQX A;  4LF8 H;  4LFB H;  1ZZJ A;  2OPV A;  1VBI A;  4DR7 H;  4DR1 H;  4LFA H;  1XNQ H;  2X06 A;  1SEI A;  2JE6 I;  5LL6 b;  4DV4 H;  1IBM H;  4LF9 H;  1X9Z A;  5K36 G;  1WVN A;  3FAU A;  5BR8 H;  4G08 A;  4YHH H;  3GKU A;  2P2R A;  1S03 G;  1I94 H;  4BA2 I;  1DTJ A;  1X4M A;  3J80 W;  1V9N A;  4WAL A;  4IFD G;  4DUY H;  2UU9 H;  1MSZ A;  2AXY A;  1J5E H;  2FPH X;  4AQY H;  1XMQ H;  4WAN A;  4LF5 H;  2UXB H;  2JVZ A;  1ODH A;  3J7A K;  4JI4 H;  4H8A A;  2BA0 A;  4DV3 H;  4PDB A;  1I6U A;  2ANR A;  4LF4 H;  2JEA I;  4NBQ A;  1UG8 A;  2JA9 A;  4JV5 H;  3RF2 A;  1N36 H;  4DV2 H;  4LF7 H;  2OPU A;  4JI7 H;  2CTE A;  1NXU A;  2UXD H;  4JI8 H;  4DV5 H;  1X0A A;  4LIJ A;  4DR5 H;  4JVY A;  2PT7 G;  4B8T A;  1HNZ H;  1EC6 A;  1VIH A;  4B3T H;  2CTL A;  4AIM A;  5A2Q W;  1XMO H;  2ANN A;  4JI0 H;  2FFM A;  2FMR A;  1TUA A;  1KHM A;  1WE8 A;  2JZX A;  3OSS D;  4B8C D;  4DV7 H;  2VQE H;  4DV1 H;  3GR5 A;  4FJU A;  4JI1 H;  4DR3 H;  4OO1 G;  3JAM W;  4LF6 H;  1N33 H;  2O4C A;  4JI5 H;  2MJH A;  1FJG H;  4DV6 H;  4NXM H;  3L7Z C;  4X62 H;  2QND A;  5LMN H;  4LFC H;  4GKJ H;  2BL5 A;  1FKA H;  3U1K A;  2E5L H;  2E3U A;  4KHP H;  2VKC A;  4YY3 H;  4JI3 H;  2CTK A;  4EC5 A;  1Z2I A;  3KDG A;  2F4V H;  3KDK A;  3UOE A;  1N34 H;  1J5K A;  2K1H A;  1IBL H;  4DUZ H;  2G8Y A;  5IWA H;  3VKE A;  1ZZI A;  2Z0S A;  4JI6 H;  4JVH A;  3EZJ A;  1VIG A;  4NZT M;  1HNW H;  1ZTG A;  2UUA H;  4OX9 H;  3J81 W;  2HHH H;  4NZR M;  5C0X G;  4JI2 H;  2M6Q A;  2A1S A;  1WTJ A;  4X66 H;  2ZM6 H;  3I0P A;  3T1H H;  1XRH A;  5DT9 A;  4FJS A;  4GKK H;  4BA1 I;  1HR0 H;  4K0K H;  2CTM A;  2JEB I;  2PY9 A;  3T1Y H;  4AM3 A;  1HNX H;  2LTM A;  2VQF H;  2D9I A;  2UXC H;  1XNR H;  4X64 H;  3V69 A; 
#chains in the Genus database with same CATH homology
 2JE6 I;  4LIJ A;  1J5K A;  2YQR A;  5K36 G;  1WVN A;  4JVY A;  2CTF A;  4B8T A;  2P2R A;  2HH2 A;  4BA2 I;  1DTJ A;  3VKE A;  1X4M A;  1ZZI A;  2Z0S A;  4QMF B;  4WAL A;  3AEV B;  4IFD G;  1VIH A;  1ZZK A;  2CTL A;  1EC6 A;  4JVH A;  2NN6 G;  1VIG A;  4AIM A;  2AXY A;  1ZTG A;  2ANN A;  2FMR A;  2HH3 A;  1TUA A;  1KHM A;  1WE8 A;  2JZX A;  1DT4 A;  1X4N A;  5C0X G;  2PQU A;  4WAN A;  2DGR A;  2JVZ A;  4OO1 G;  1K1G A;  2CPQ A;  2MJH A;  1J4W A;  2BA0 A;  2CTJ A;  2ANR A;  3L7Z C;  4BA1 I;  2QND A;  2CTM A;  2JEB I;  5JEA G;  2JEA I;  2PY9 A;  4NBQ A;  2JA9 A;  2BL5 A;  4AM3 A;  3U1K A;  1ZZJ A;  2OPV A;  2E3U A;  2OPU A;  2CTE A;  2CTK A;  3V69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...