3I0PA

Crystal structure of malate dehydrogenase from entamoeba histolytica
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
361
structure length
361
Chain Sequence
QTKNVSIDTIKEFMYQVLLKVGSDEENARMVRDTLIAADLRGMDTHGIQRFKTVYIDRIKKGMINPTAKPSIIRETSTTCVLDGNNGFGHVNGTIGMKMAIEKAKKYGMGMVVVRNSTHFGIAGYYSLLAAQEGCIGICGTNARSSVAATFGDEPILGTNPLAIGIPSDEAFPYCFDGATSISPTGRFEKYVRMGKTVDKSWASMKGGKPIEDPKELLENYPKGKAYLHPLGGSDEVSGSHKGYCLSEFVEIMSSCLSIANFLNHIEEEKEKSGKFSLGHFFIAINVECFRDLNEFKKNVGDINRTLRNTDKLPGHDRIYTAGEKEYETEQKRRKFGDDLPLVTINEMKELSSFYNVPLPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malate dehydrogenase
publication title Crystal structure of malate dehydrogenase from Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
molecule tags Oxidoreductase
total genus 126
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 3i0pA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 3i0pA02
1NXUA 2G8YA 4FJUA 4FJSA 4H8AA 1Z2IA 1S20A 2X06A 1XRHA 3I0PA 2CWFA 3UOEA 1WTJA 2CWHA 1VBIA 1X0AA 1V9NA
chains in the Genus database with same CATH superfamily
2PT7G 3EZJA 1ZZJA 3OETA 4YY3H 5IWAH 3AEVB 5DT9A 4WALA 4X62H 3J81W 4DV7H 1XMQH 1IBLH 4JVYA 4JI8H 4WANA 5A2QW 5BR8H 5LMNH 4DUYH 1DTJA 3QD7X 4OCHA 1XRHA 1XNRH 4JI3H 1WTJA 4LFBH 4DR3H 1V8CA 2D9IA 2LF0A 4H8AA 2E5LH 4JI4H 4LF6H 3T1YH 3GABA 4AM3A 1EC6A 1HNWH 4FJUA 2E3UA 1VIHA 1KHMA 4OD6A 1ZZIA 3OTOH 3VKEA 4DV5H 5LMUH 1X4MA 4JI5H 1VBIA 5LL6b 2JZXA 4QMFB 3V69A 3J80W 4DR2H 4JI7H 2LRRA 1XMOH 3OSSD 2BA0A 2PQUA 1S20A 2JEBI 1WVNA 2JA9A 4G08A 4DV0H 4DV6H 1MSZA 2JE6I 4X65H 4DR1H 2UUAH 2X06A 1N33H 2VKCA 1NXUA 1ZTGA 2FFMA 4BA2I 1N36H 4JYAH 2MJHA 1FKAH 4DV1H 4DUZH 3RF2A 4EC5A 1HNXH 2JVZA 4JV5H 1S03G 4B3RH 4JI0H 2JEAI 2K1HA 1AN7A 4LF9H 2UXBH 4NBQA 2O4CA 2DGRA 2CWFA 4X66H 4LFCH 2QNDA 2ZQEA 4DR7H 2M6QA 2CTKA 5FLXW 2Y3MA 1I6UA 2FPHX 4LF4H 4KHPH 2P2RA 4NXNH 3SB1A 4DR6H 4GKKH 2M8WA 1Z2IA 2VQFH 4B8TA 1K1GA 4LF8H 4BA1I 5JEAG 2CTMA 2FMRA 4NZRM 2HH2A 4NZTM 4B3MH 2UXCH 3JAMW 2AXYA 2UUBH 2OPVA 2UU9H 1ODHA 4JVHA 2HH3A 4DR4H 1IBMH 2BL5A 1HR0H 5K36G 4K0KH 2HHHH 2G8YA 2Z0SA 4DR5H 4B3SH 1J5EH 4JI6H 4LFAH 2F4VH 1WE8A 2CWHA 4GKJH 4PDBA 1X0AA 2OPUA 4NXMH 4DV4H 3U1KA 3KDGA 4OO1G 3GKUA 4DV2H 1SEIA 4YHHH 2UXDH 2ZM6H 2CTFA 1X9ZA 4LIJA 1N34H 4JI1H 2CPQA 3L7ZC 4AIMA 1J5KA 3UOEA 1PQXA 1FJGH 1XNQH 2VQEH 4IFDG 4B3TH 1V9NA 2CTLA 4DV3H 1ZZKA 2LTMA 3KDKA 3NCVA 4B8CD 4LF5H 2ANRA 2UUCH 5IT9W 2NN6G 4X64H 2CTEA 2YQRA 4AQYH 4LF7H 4FJSA 1HNZH 4OX9H 4JI2H 1VIGA 1WHRA 2CTJA 2A1SA 3I0PA 1TUAA 3FAUA 3T1HH 1UG8A 4E9JA 1X4NA 1I94H 3GR5A 2PY9A 1DT4A 1F0XA 1N32H 2LTLA 1J4WA 2ANNA 1IBKH 5C0XG 2CPMA 3J7AK
chains in the Genus database with same CATH topology
1NXUA 2G8YA 4FJUA 4FJSA 4H8AA 1Z2IA 1S20A 2X06A 1XRHA 3I0PA 2CWFA 3UOEA 1WTJA 2CWHA 1VBIA 1X0AA 1V9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NXU A;  2G8Y A;  4FJU A;  4FJS A;  4H8A A;  1Z2I A;  1S20 A;  2X06 A;  1XRH A;  3I0P A;  2CWF A;  3UOE A;  1WTJ A;  2CWH A;  1VBI A;  1X0A A;  1V9N A; 
#chains in the Genus database with same CATH topology
 2PT7 G;  3EZJ A;  1ZZJ A;  3OET A;  4YY3 H;  5IWA H;  3AEV B;  5DT9 A;  4WAL A;  4X62 H;  3J81 W;  4DV7 H;  1XMQ H;  1IBL H;  4JVY A;  4JI8 H;  4WAN A;  5A2Q W;  5BR8 H;  5LMN H;  4DUY H;  1DTJ A;  3QD7 X;  4OCH A;  1XRH A;  1XNR H;  4JI3 H;  1WTJ A;  4LFB H;  4DR3 H;  1V8C A;  2D9I A;  2LF0 A;  4H8A A;  2E5L H;  4JI4 H;  4LF6 H;  3T1Y H;  3GAB A;  4AM3 A;  1EC6 A;  1HNW H;  4FJU A;  2E3U A;  1VIH A;  1KHM A;  4OD6 A;  1ZZI A;  3OTO H;  3VKE A;  4DV5 H;  5LMU H;  1X4M A;  4JI5 H;  1VBI A;  5LL6 b;  2JZX A;  4QMF B;  3V69 A;  3J80 W;  4DR2 H;  4JI7 H;  2LRR A;  1XMO H;  3OSS D;  2BA0 A;  2PQU A;  1S20 A;  2JEB I;  1WVN A;  2JA9 A;  4G08 A;  4DV0 H;  4DV6 H;  1MSZ A;  2JE6 I;  4X65 H;  4DR1 H;  2UUA H;  2X06 A;  1N33 H;  2VKC A;  1NXU A;  1ZTG A;  2FFM A;  4BA2 I;  1N36 H;  4JYA H;  2MJH A;  1FKA H;  4DV1 H;  4DUZ H;  3RF2 A;  4EC5 A;  1HNX H;  2JVZ A;  4JV5 H;  1S03 G;  4B3R H;  4JI0 H;  2JEA I;  2K1H A;  1AN7 A;  4LF9 H;  2UXB H;  4NBQ A;  2O4C A;  2DGR A;  2CWF A;  4X66 H;  4LFC H;  2QND A;  2ZQE A;  4DR7 H;  2M6Q A;  2CTK A;  5FLX W;  2Y3M A;  1I6U A;  2FPH X;  4LF4 H;  4KHP H;  2P2R A;  4NXN H;  3SB1 A;  4DR6 H;  4GKK H;  2M8W A;  1Z2I A;  2VQF H;  4B8T A;  1K1G A;  4LF8 H;  4BA1 I;  5JEA G;  2CTM A;  2FMR A;  4NZR M;  2HH2 A;  4NZT M;  4B3M H;  2UXC H;  3JAM W;  2AXY A;  2UUB H;  2OPV A;  2UU9 H;  1ODH A;  4JVH A;  2HH3 A;  4DR4 H;  1IBM H;  2BL5 A;  1HR0 H;  5K36 G;  4K0K H;  2HHH H;  2G8Y A;  2Z0S A;  4DR5 H;  4B3S H;  1J5E H;  4JI6 H;  4LFA H;  2F4V H;  1WE8 A;  2CWH A;  4GKJ H;  4PDB A;  1X0A A;  2OPU A;  4NXM H;  4DV4 H;  3U1K A;  3KDG A;  4OO1 G;  3GKU A;  4DV2 H;  1SEI A;  4YHH H;  2UXD H;  2ZM6 H;  2CTF A;  1X9Z A;  4LIJ A;  1N34 H;  4JI1 H;  2CPQ A;  3L7Z C;  4AIM A;  1J5K A;  3UOE A;  1PQX A;  1FJG H;  1XNQ H;  2VQE H;  4IFD G;  4B3T H;  1V9N A;  2CTL A;  4DV3 H;  1ZZK A;  2LTM A;  3KDK A;  3NCV A;  4B8C D;  4LF5 H;  2ANR A;  2UUC H;  5IT9 W;  2NN6 G;  4X64 H;  2CTE A;  2YQR A;  4AQY H;  4LF7 H;  4FJS A;  1HNZ H;  4OX9 H;  4JI2 H;  1VIG A;  1WHR A;  2CTJ A;  2A1S A;  3I0P A;  1TUA A;  3FAU A;  3T1H H;  1UG8 A;  4E9J A;  1X4N A;  1I94 H;  3GR5 A;  2PY9 A;  1DT4 A;  1F0X A;  1N32 H;  2LTL A;  1J4W A;  2ANN A;  1IBK H;  5C0X G;  2CPM A;  3J7A K; 
#chains in the Genus database with same CATH homology
 1NXU A;  2G8Y A;  4FJU A;  4FJS A;  4H8A A;  1Z2I A;  1S20 A;  2X06 A;  1XRH A;  3I0P A;  2CWF A;  3UOE A;  1WTJ A;  2CWH A;  1VBI A;  1X0A A;  1V9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...