3I0PA

Crystal structure of malate dehydrogenase from entamoeba histolytica
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
361
structure length
361
Chain Sequence
QTKNVSIDTIKEFMYQVLLKVGSDEENARMVRDTLIAADLRGMDTHGIQRFKTVYIDRIKKGMINPTAKPSIIRETSTTCVLDGNNGFGHVNGTIGMKMAIEKAKKYGMGMVVVRNSTHFGIAGYYSLLAAQEGCIGICGTNARSSVAATFGDEPILGTNPLAIGIPSDEAFPYCFDGATSISPTGRFEKYVRMGKTVDKSWASMKGGKPIEDPKELLENYPKGKAYLHPLGGSDEVSGSHKGYCLSEFVEIMSSCLSIANFLNHIEEEKEKSGKFSLGHFFIAINVECFRDLNEFKKNVGDINRTLRNTDKLPGHDRIYTAGEKEYETEQKRRKFGDDLPLVTINEMKELSSFYNVPLPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malate dehydrogenase
publication title Crystal structure of malate dehydrogenase from Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
molecule tags Oxidoreductase
total genus 126
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 3i0pA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 3i0pA02
1S20A 2G8YA 2X06A 2CWHA 4FJUA 1X0AA 1XRHA 3I0PA 1WTJA 1VBIA 4H8AA 3UOEA 1V9NA 1Z2IA 2CWFA 4FJSA 1NXUA
chains in the Genus database with same CATH superfamily
5K36G 2ANRA 4FJUA 1F0XA 1V8CA 2JZXA 4DV5H 2BA0A 2CTLA 4OCHA 3T1YH 1J5KA 2CPMA 4LIJA 4OD6A 1N34H 1PQXA 4X64H 3J81W 4DR6H 4JYAH 2CTMA 2JA9A 4JVHA 1AN7A 3AEVB 4NZRM 1N36H 4JI8H 1V9NA 4LFBH 2FFMA 4EC5A 4DR7H 2G8YA 3T1HH 5IT9W 2A1SA 3KDKA 2OPUA 1I94H 4JI4H 2M6QA 1XRHA 2HH2A 2UXDH 1MSZA 4AQYH 5A2QW 4NBQA 4JI3H 1DTJA 1KHMA 2PT7G 2FPHX 3EZJA 1IBKH 1X4NA 5IWAH 1WTJA 4DR3H 1ZTGA 2UUBH 2CWFA 4QMFB 4X66H 2YQRA 2HHHH 4IFDG 2UU9H 4LF7H 1X0AA 1N33H 3I0PA 4WALA 5LMNH 2HH3A 4DUYH 5C0XG 1ZZJA 4DR1H 5BR8H 1SEIA 2LRRA 1IBMH 4GKKH 4G08A 2E5LH 1VBIA 1X9ZA 2D9IA 3GKUA 3SB1A 1XMOH 4FJSA 1VIHA 3OTOH 4LF6H 2P2RA 2ZM6H 4DV0H 4JI7H 4H8AA 2CTFA 4LF4H 2UXCH 2MJHA 4YY3H 2DGRA 1J5EH 1S20A 1N32H 4LFCH 4AIMA 2LTLA 3U1KA 5JEAG 1J4WA 4JI5H 3VKEA 4K0KH 2ZQEA 1FJGH 1HNXH 2OPVA 1UG8A 3L7ZC 2PQUA 1WVNA 4DUZH 4JI2H 2VQEH 4DV3H 1Z2IA 4B8CD 2NN6G 2BL5A 5FLXW 2FMRA 4GKJH 1X4MA 3OETA 3QD7X 4DV7H 2UXBH 4DV2H 4WANA 2CTJA 4B3RH 4OX9H 1NXUA 2CTKA 4JI1H 2X06A 1HNWH 1HR0H 2PY9A 3V69A 1HNZH 1IBLH 4DV4H 4X65H 3FAUA 2VQFH 4LF5H 4B3MH 4LF9H 4DV6H 4NXMH 2K1HA 3KDGA 2AXYA 2ANNA 2CPQA 2JVZA 1XMQH 3RF2A 4DV1H 4X62H 3GR5A 2UUCH 4B8TA 3J80W 2JEAI 1EC6A 2LF0A 1I6UA 3JAMW 4BA1I 1ZZIA 1K1GA 1DT4A 2CTEA 4JV5H 2CWHA 2JEBI 3NCVA 2VKCA 2UUAH 2QNDA 3UOEA 5LL6b 1XNQH 4PDBA 4NZTM 2E3UA 3J7AK 4AM3A 1S03G 4YHHH 4JVYA 4E9JA 1ODHA 4B3SH 1XNRH 1WHRA 2M8WA 4LFAH 5DT9A 4DR4H 1FKAH 2Z0SA 1ZZKA 1WE8A 3OSSD 2F4VH 3GABA 4LF8H 4JI0H 4JI6H 4BA2I 2JE6I 4B3TH 2LTMA 4DR5H 4DR2H 4OO1G 4KHPH 1VIGA 2O4CA 5LMUH 4NXNH 1TUAA 2Y3MA
chains in the Genus database with same CATH topology
1S20A 2G8YA 2X06A 2CWHA 4FJUA 1X0AA 1XRHA 3I0PA 1WTJA 1VBIA 4H8AA 3UOEA 1V9NA 1Z2IA 2CWFA 4FJSA 1NXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S20 A;  2G8Y A;  2X06 A;  2CWH A;  4FJU A;  1X0A A;  1XRH A;  3I0P A;  1WTJ A;  1VBI A;  4H8A A;  3UOE A;  1V9N A;  1Z2I A;  2CWF A;  4FJS A;  1NXU A; 
#chains in the Genus database with same CATH topology
 5K36 G;  2ANR A;  4FJU A;  1F0X A;  1V8C A;  2JZX A;  4DV5 H;  2BA0 A;  2CTL A;  4OCH A;  3T1Y H;  1J5K A;  2CPM A;  4LIJ A;  4OD6 A;  1N34 H;  1PQX A;  4X64 H;  3J81 W;  4DR6 H;  4JYA H;  2CTM A;  2JA9 A;  4JVH A;  1AN7 A;  3AEV B;  4NZR M;  1N36 H;  4JI8 H;  1V9N A;  4LFB H;  2FFM A;  4EC5 A;  4DR7 H;  2G8Y A;  3T1H H;  5IT9 W;  2A1S A;  3KDK A;  2OPU A;  1I94 H;  4JI4 H;  2M6Q A;  1XRH A;  2HH2 A;  2UXD H;  1MSZ A;  4AQY H;  5A2Q W;  4NBQ A;  4JI3 H;  1DTJ A;  1KHM A;  2PT7 G;  2FPH X;  3EZJ A;  1IBK H;  1X4N A;  5IWA H;  1WTJ A;  4DR3 H;  1ZTG A;  2UUB H;  2CWF A;  4QMF B;  4X66 H;  2YQR A;  2HHH H;  4IFD G;  2UU9 H;  4LF7 H;  1X0A A;  1N33 H;  3I0P A;  4WAL A;  5LMN H;  2HH3 A;  4DUY H;  5C0X G;  1ZZJ A;  4DR1 H;  5BR8 H;  1SEI A;  2LRR A;  1IBM H;  4GKK H;  4G08 A;  2E5L H;  1VBI A;  1X9Z A;  2D9I A;  3GKU A;  3SB1 A;  1XMO H;  4FJS A;  1VIH A;  3OTO H;  4LF6 H;  2P2R A;  2ZM6 H;  4DV0 H;  4JI7 H;  4H8A A;  2CTF A;  4LF4 H;  2UXC H;  2MJH A;  4YY3 H;  2DGR A;  1J5E H;  1S20 A;  1N32 H;  4LFC H;  4AIM A;  2LTL A;  3U1K A;  5JEA G;  1J4W A;  4JI5 H;  3VKE A;  4K0K H;  2ZQE A;  1FJG H;  1HNX H;  2OPV A;  1UG8 A;  3L7Z C;  2PQU A;  1WVN A;  4DUZ H;  4JI2 H;  2VQE H;  4DV3 H;  1Z2I A;  4B8C D;  2NN6 G;  2BL5 A;  5FLX W;  2FMR A;  4GKJ H;  1X4M A;  3OET A;  3QD7 X;  4DV7 H;  2UXB H;  4DV2 H;  4WAN A;  2CTJ A;  4B3R H;  4OX9 H;  1NXU A;  2CTK A;  4JI1 H;  2X06 A;  1HNW H;  1HR0 H;  2PY9 A;  3V69 A;  1HNZ H;  1IBL H;  4DV4 H;  4X65 H;  3FAU A;  2VQF H;  4LF5 H;  4B3M H;  4LF9 H;  4DV6 H;  4NXM H;  2K1H A;  3KDG A;  2AXY A;  2ANN A;  2CPQ A;  2JVZ A;  1XMQ H;  3RF2 A;  4DV1 H;  4X62 H;  3GR5 A;  2UUC H;  4B8T A;  3J80 W;  2JEA I;  1EC6 A;  2LF0 A;  1I6U A;  3JAM W;  4BA1 I;  1ZZI A;  1K1G A;  1DT4 A;  2CTE A;  4JV5 H;  2CWH A;  2JEB I;  3NCV A;  2VKC A;  2UUA H;  2QND A;  3UOE A;  5LL6 b;  1XNQ H;  4PDB A;  4NZT M;  2E3U A;  3J7A K;  4AM3 A;  1S03 G;  4YHH H;  4JVY A;  4E9J A;  1ODH A;  4B3S H;  1XNR H;  1WHR A;  2M8W A;  4LFA H;  5DT9 A;  4DR4 H;  1FKA H;  2Z0S A;  1ZZK A;  1WE8 A;  3OSS D;  2F4V H;  3GAB A;  4LF8 H;  4JI0 H;  4JI6 H;  4BA2 I;  2JE6 I;  4B3T H;  2LTM A;  4DR5 H;  4DR2 H;  4OO1 G;  4KHP H;  1VIG A;  2O4C A;  5LMU H;  4NXN H;  1TUA A;  2Y3M A; 
#chains in the Genus database with same CATH homology
 1S20 A;  2G8Y A;  2X06 A;  2CWH A;  4FJU A;  1X0A A;  1XRH A;  3I0P A;  1WTJ A;  1VBI A;  4H8A A;  3UOE A;  1V9N A;  1Z2I A;  2CWF A;  4FJS A;  1NXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...