3I0PA

Crystal structure of malate dehydrogenase from entamoeba histolytica
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
361
structure length
361
Chain Sequence
QTKNVSIDTIKEFMYQVLLKVGSDEENARMVRDTLIAADLRGMDTHGIQRFKTVYIDRIKKGMINPTAKPSIIRETSTTCVLDGNNGFGHVNGTIGMKMAIEKAKKYGMGMVVVRNSTHFGIAGYYSLLAAQEGCIGICGTNARSSVAATFGDEPILGTNPLAIGIPSDEAFPYCFDGATSISPTGRFEKYVRMGKTVDKSWASMKGGKPIEDPKELLENYPKGKAYLHPLGGSDEVSGSHKGYCLSEFVEIMSSCLSIANFLNHIEEEKEKSGKFSLGHFFIAINVECFRDLNEFKKNVGDINRTLRNTDKLPGHDRIYTAGEKEYETEQKRRKFGDDLPLVTINEMKELSSFYNVPLPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Malate dehydrogenase
publication title Crystal structure of malate dehydrogenase from Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
total genus 126
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 3i0pA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 3i0pA02
2G8YA 2X06A 4FJUA 2CWFA 4H8AA 1WTJA 1Z2IA 1X0AA 1XRHA 1S20A 2CWHA 3I0PA 3UOEA 1V9NA 1NXUA 1VBIA 4FJSA
chains in the Genus database with same CATH superfamily
2FFMA 5K36G 2UUBH 3VKEA 4B8TA 2ANRA 4DUZH 1N33H 5JEAG 2A1SA 4AQYH 3UOEA 3U1KA 3T1YH 2LTLA 2LRRA 4JI1H 4JI4H 1XMQH 4LF5H 4WALA 1N34H 1WHRA 3SB1A 2ZM6H 1IBMH 1MSZA 4LF4H 3FAUA 3L7ZC 1I94H 4DR7H 4JYAH 4B3SH 4JI2H 5BR8H 1KHMA 4YHHH 1XNRH 1ZTGA 2Y3MA 2YQRA 4NXMH 4AM3A 2UXDH 1ODHA 2CPQA 4G08A 5IWAH 3J81W 2CTEA 2UUCH 1WVNA 4JI3H 2OPUA 4DV1H 4JVHA 2BA0A 5FLXW 2X06A 1HNXH 4DV7H 4X65H 4X62H 5DT9A 4JI6H 3I0PA 5LMNH 1HR0H 2CWHA 2M8WA 5A2QW 4JI8H 3GR5A 1UG8A 1HNWH 1IBKH 3JAMW 4DUYH 4DR6H 4JV5H 2JVZA 2LF0A 3EZJA 4JI7H 2JEAI 2HH3A 2PY9A 4OD6A 4LF8H 4H8AA 2CPMA 1WTJA 1V8CA 2CTMA 2NN6G 2E3UA 3KDGA 3OSSD 4QMFB 2VQFH 4DV4H 4B3TH 2HH2A 4LF6H 4LIJA 4BA2I 4WANA 2G8YA 4NZRM 1EC6A 1VIGA 1J4WA 4JVYA 4DR2H 1J5EH 2DGRA 2MJHA 4GKJH 1XRHA 1DTJA 3GABA 2Z0SA 4DR5H 2LTMA 1X4MA 1FKAH 4B3MH 4NZTM 2AXYA 1X0AA 3T1HH 4DR1H 2E5LH 2FMRA 2PQUA 2HHHH 4LF9H 1J5KA 4K0KH 3J80W 5LMUH 4FJSA 1ZZKA 2BL5A 4DV3H 2CWFA 1I6UA 1TUAA 1ZZJA 2UXBH 1S20A 3GKUA 2PT7G 1XMOH 2F4VH 4B8CD 5LL6b 4PDBA 1F0XA 4KHPH 2D9IA 3RF2A 4BA1I 2QNDA 4LFBH 3J7AK 4JI0H 5IT9W 4OCHA 1DT4A 1WE8A 2M6QA 2JA9A 3NCVA 4NBQA 1X4NA 4DV5H 4JI5H 1HNZH 4LF7H 4OX9H 1IBLH 4DR4H 4DR3H 1NXUA 2K1HA 1X9ZA 2UUAH 4NXNH 4E9JA 4FJUA 1ZZIA 1FJGH 1XNQH 1N36H 3OETA 4YY3H 4X66H 4DV0H 4B3RH 1VBIA 1VIHA 4X64H 2ANNA 4LFCH 2CTFA 2O4CA 3QD7X 2ZQEA 2JEBI 3OTOH 2P2RA 4OO1G 2UXCH 2CTLA 2VQEH 4IFDG 2CTKA 2UU9H 1AN7A 4AIMA 1N32H 1Z2IA 5C0XG 1V9NA 1PQXA 1S03G 4EC5A 4DV2H 4GKKH 3KDKA 4LFAH 1SEIA 2JZXA 3AEVB 2VKCA 2OPVA 4DV6H 2JE6I 1K1GA 2FPHX 2CTJA 3V69A
chains in the Genus database with same CATH topology
2G8YA 2X06A 4FJUA 2CWFA 4H8AA 1WTJA 1Z2IA 1X0AA 1XRHA 1S20A 2CWHA 3I0PA 3UOEA 1V9NA 1NXUA 1VBIA 4FJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G8Y A;  2X06 A;  4FJU A;  2CWF A;  4H8A A;  1WTJ A;  1Z2I A;  1X0A A;  1XRH A;  1S20 A;  2CWH A;  3I0P A;  3UOE A;  1V9N A;  1NXU A;  1VBI A;  4FJS A; 
#chains in the Genus database with same CATH topology
 2FFM A;  5K36 G;  2UUB H;  3VKE A;  4B8T A;  2ANR A;  4DUZ H;  1N33 H;  5JEA G;  2A1S A;  4AQY H;  3UOE A;  3U1K A;  3T1Y H;  2LTL A;  2LRR A;  4JI1 H;  4JI4 H;  1XMQ H;  4LF5 H;  4WAL A;  1N34 H;  1WHR A;  3SB1 A;  2ZM6 H;  1IBM H;  1MSZ A;  4LF4 H;  3FAU A;  3L7Z C;  1I94 H;  4DR7 H;  4JYA H;  4B3S H;  4JI2 H;  5BR8 H;  1KHM A;  4YHH H;  1XNR H;  1ZTG A;  2Y3M A;  2YQR A;  4NXM H;  4AM3 A;  2UXD H;  1ODH A;  2CPQ A;  4G08 A;  5IWA H;  3J81 W;  2CTE A;  2UUC H;  1WVN A;  4JI3 H;  2OPU A;  4DV1 H;  4JVH A;  2BA0 A;  5FLX W;  2X06 A;  1HNX H;  4DV7 H;  4X65 H;  4X62 H;  5DT9 A;  4JI6 H;  3I0P A;  5LMN H;  1HR0 H;  2CWH A;  2M8W A;  5A2Q W;  4JI8 H;  3GR5 A;  1UG8 A;  1HNW H;  1IBK H;  3JAM W;  4DUY H;  4DR6 H;  4JV5 H;  2JVZ A;  2LF0 A;  3EZJ A;  4JI7 H;  2JEA I;  2HH3 A;  2PY9 A;  4OD6 A;  4LF8 H;  4H8A A;  2CPM A;  1WTJ A;  1V8C A;  2CTM A;  2NN6 G;  2E3U A;  3KDG A;  3OSS D;  4QMF B;  2VQF H;  4DV4 H;  4B3T H;  2HH2 A;  4LF6 H;  4LIJ A;  4BA2 I;  4WAN A;  2G8Y A;  4NZR M;  1EC6 A;  1VIG A;  1J4W A;  4JVY A;  4DR2 H;  1J5E H;  2DGR A;  2MJH A;  4GKJ H;  1XRH A;  1DTJ A;  3GAB A;  2Z0S A;  4DR5 H;  2LTM A;  1X4M A;  1FKA H;  4B3M H;  4NZT M;  2AXY A;  1X0A A;  3T1H H;  4DR1 H;  2E5L H;  2FMR A;  2PQU A;  2HHH H;  4LF9 H;  1J5K A;  4K0K H;  3J80 W;  5LMU H;  4FJS A;  1ZZK A;  2BL5 A;  4DV3 H;  2CWF A;  1I6U A;  1TUA A;  1ZZJ A;  2UXB H;  1S20 A;  3GKU A;  2PT7 G;  1XMO H;  2F4V H;  4B8C D;  5LL6 b;  4PDB A;  1F0X A;  4KHP H;  2D9I A;  3RF2 A;  4BA1 I;  2QND A;  4LFB H;  3J7A K;  4JI0 H;  5IT9 W;  4OCH A;  1DT4 A;  1WE8 A;  2M6Q A;  2JA9 A;  3NCV A;  4NBQ A;  1X4N A;  4DV5 H;  4JI5 H;  1HNZ H;  4LF7 H;  4OX9 H;  1IBL H;  4DR4 H;  4DR3 H;  1NXU A;  2K1H A;  1X9Z A;  2UUA H;  4NXN H;  4E9J A;  4FJU A;  1ZZI A;  1FJG H;  1XNQ H;  1N36 H;  3OET A;  4YY3 H;  4X66 H;  4DV0 H;  4B3R H;  1VBI A;  1VIH A;  4X64 H;  2ANN A;  4LFC H;  2CTF A;  2O4C A;  3QD7 X;  2ZQE A;  2JEB I;  3OTO H;  2P2R A;  4OO1 G;  2UXC H;  2CTL A;  2VQE H;  4IFD G;  2CTK A;  2UU9 H;  1AN7 A;  4AIM A;  1N32 H;  1Z2I A;  5C0X G;  1V9N A;  1PQX A;  1S03 G;  4EC5 A;  4DV2 H;  4GKK H;  3KDK A;  4LFA H;  1SEI A;  2JZX A;  3AEV B;  2VKC A;  2OPV A;  4DV6 H;  2JE6 I;  1K1G A;  2FPH X;  2CTJ A;  3V69 A; 
#chains in the Genus database with same CATH homology
 2G8Y A;  2X06 A;  4FJU A;  2CWF A;  4H8A A;  1WTJ A;  1Z2I A;  1X0A A;  1XRH A;  1S20 A;  2CWH A;  3I0P A;  3UOE A;  1V9N A;  1NXU A;  1VBI A;  4FJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...