3I0PA

Crystal structure of malate dehydrogenase from entamoeba histolytica
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
361
structure length
361
Chain Sequence
QTKNVSIDTIKEFMYQVLLKVGSDEENARMVRDTLIAADLRGMDTHGIQRFKTVYIDRIKKGMINPTAKPSIIRETSTTCVLDGNNGFGHVNGTIGMKMAIEKAKKYGMGMVVVRNSTHFGIAGYYSLLAAQEGCIGICGTNARSSVAATFGDEPILGTNPLAIGIPSDEAFPYCFDGATSISPTGRFEKYVRMGKTVDKSWASMKGGKPIEDPKELLENYPKGKAYLHPLGGSDEVSGSHKGYCLSEFVEIMSSCLSIANFLNHIEEEKEKSGKFSLGHFFIAINVECFRDLNEFKKNVGDINRTLRNTDKLPGHDRIYTAGEKEYETEQKRRKFGDDLPLVTINEMKELSSFYNVPLPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of malate dehydrogenase from Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
molecule tags Oxidoreductase
molecule keywords Malate dehydrogenase
total genus 126
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 3i0pA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 3i0pA02
1S20A 4FJUA 1XRHA 1V9NA 2G8YA 1Z2IA 1X0AA 4FJSA 1WTJA 2CWFA 3UOEA 1VBIA 3I0PA 4H8AA 1NXUA 2CWHA 2X06A
chains in the Genus database with same CATH superfamily
3OETA 1FKAH 4FJUA 2CPQA 2YQRA 2CWFA 4DV6H 2UUBH 4OO1G 1J5EH 4JI6H 1S20A 4EC5A 5BR8H 1XMOH 4FJSA 2FFMA 1Z2IA 2CTJA 2UXBH 2CTLA 4B3MH 1NXUA 4WALA 4OX9H 3RF2A 4JI0H 1VIGA 5IT9W 4JI7H 4JVYA 4NXMH 4DV2H 2ZQEA 2CTEA 4JI2H 4QMFB 1WHRA 4E9JA 4AQYH 1XMQH 1K1GA 1PQXA 2CTMA 2AXYA 5K36G 1EC6A 1I6UA 2A1SA 4NBQA 5FLXW 1N34H 5DT9A 4JI4H 2MJHA 5LMUH 2ZM6H 2JEBI 4X66H 4JVHA 4LFCH 2CWHA 1TUAA 3FAUA 4LF8H 1XNQH 4PDBA 1F0XA 3OSSD 4BA1I 4DUZH 3J80W 4DR2H 4LF4H 2ANRA 4DV7H 1ZZKA 1X4NA 4H8AA 2JZXA 2O4CA 5C0XG 1IBKH 2CTFA 2PY9A 1I94H 4DV5H 2HH2A 3OTOH 1N36H 3KDKA 1S03G 1N33H 3QD7X 1X0AA 4NXNH 4JI3H 2F4VH 3L7ZC 4B3RH 4LIJA 4B8CD 4YHHH 2UUAH 2VKCA 2JE6I 4BA2I 4LF7H 4LF5H 3J81W 3J7AK 1ZZJA 4LFBH 5LMNH 3I0PA 4GKKH 3GABA 2LF0A 1KHMA 4GKJH 4YY3H 1X9ZA 4AIMA 1IBLH 2E3UA 2LTMA 1IBMH 4NZTM 2ANNA 4X62H 1HNWH 4AM3A 2E5LH 2Y3MA 4DV4H 2CPMA 4K0KH 2M6QA 4DUYH 4DV1H 2G8YA 1AN7A 1ZZIA 2NN6G 4OD6A 5LL6b 2D9IA 2JVZA 2QNDA 1SEIA 3JAMW 1N32H 1DT4A 4JYAH 3NCVA 2UXCH 4JI8H 2FPHX 3VKEA 1ODHA 4B8TA 1XRHA 1V9NA 2P2RA 2OPVA 2UUCH 4DR3H 2LRRA 4JI1H 2Z0SA 4X65H 3EZJA 4LF6H 2PQUA 2BA0A 2VQEH 3U1KA 3GKUA 2VQFH 5IWAH 4B3TH 2PT7G 4B3SH 4NZRM 4LFAH 1HNZH 2X06A 3KDGA 2DGRA 1XNRH 4DR6H 1UG8A 4OCHA 2LTLA 1WVNA 2UXDH 1J4WA 2BL5A 1HR0H 5A2QW 1X4MA 2FMRA 3V69A 5JEAG 3T1HH 2JA9A 4LF9H 1VIHA 3AEVB 4DR7H 4WANA 2CTKA 1J5KA 4X64H 2UU9H 4DR1H 2OPUA 4DR4H 1MSZA 4KHPH 1HNXH 4G08A 2HH3A 1FJGH 1VBIA 1WE8A 2HHHH 4JI5H 3GR5A 1V8CA 4DR5H 2M8WA 4IFDG 4JV5H 4DV3H 3T1YH 3UOEA 1WTJA 3SB1A 4DV0H 1ZTGA 2K1HA 2JEAI 1DTJA
chains in the Genus database with same CATH topology
1S20A 4FJUA 1XRHA 1V9NA 2G8YA 1Z2IA 1X0AA 4FJSA 1WTJA 2CWFA 3UOEA 1VBIA 3I0PA 4H8AA 1NXUA 2CWHA 2X06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S20 A;  4FJU A;  1XRH A;  1V9N A;  2G8Y A;  1Z2I A;  1X0A A;  4FJS A;  1WTJ A;  2CWF A;  3UOE A;  1VBI A;  3I0P A;  4H8A A;  1NXU A;  2CWH A;  2X06 A; 
#chains in the Genus database with same CATH topology
 3OET A;  1FKA H;  4FJU A;  2CPQ A;  2YQR A;  2CWF A;  4DV6 H;  2UUB H;  4OO1 G;  1J5E H;  4JI6 H;  1S20 A;  4EC5 A;  5BR8 H;  1XMO H;  4FJS A;  2FFM A;  1Z2I A;  2CTJ A;  2UXB H;  2CTL A;  4B3M H;  1NXU A;  4WAL A;  4OX9 H;  3RF2 A;  4JI0 H;  1VIG A;  5IT9 W;  4JI7 H;  4JVY A;  4NXM H;  4DV2 H;  2ZQE A;  2CTE A;  4JI2 H;  4QMF B;  1WHR A;  4E9J A;  4AQY H;  1XMQ H;  1K1G A;  1PQX A;  2CTM A;  2AXY A;  5K36 G;  1EC6 A;  1I6U A;  2A1S A;  4NBQ A;  5FLX W;  1N34 H;  5DT9 A;  4JI4 H;  2MJH A;  5LMU H;  2ZM6 H;  2JEB I;  4X66 H;  4JVH A;  4LFC H;  2CWH A;  1TUA A;  3FAU A;  4LF8 H;  1XNQ H;  4PDB A;  1F0X A;  3OSS D;  4BA1 I;  4DUZ H;  3J80 W;  4DR2 H;  4LF4 H;  2ANR A;  4DV7 H;  1ZZK A;  1X4N A;  4H8A A;  2JZX A;  2O4C A;  5C0X G;  1IBK H;  2CTF A;  2PY9 A;  1I94 H;  4DV5 H;  2HH2 A;  3OTO H;  1N36 H;  3KDK A;  1S03 G;  1N33 H;  3QD7 X;  1X0A A;  4NXN H;  4JI3 H;  2F4V H;  3L7Z C;  4B3R H;  4LIJ A;  4B8C D;  4YHH H;  2UUA H;  2VKC A;  2JE6 I;  4BA2 I;  4LF7 H;  4LF5 H;  3J81 W;  3J7A K;  1ZZJ A;  4LFB H;  5LMN H;  3I0P A;  4GKK H;  3GAB A;  2LF0 A;  1KHM A;  4GKJ H;  4YY3 H;  1X9Z A;  4AIM A;  1IBL H;  2E3U A;  2LTM A;  1IBM H;  4NZT M;  2ANN A;  4X62 H;  1HNW H;  4AM3 A;  2E5L H;  2Y3M A;  4DV4 H;  2CPM A;  4K0K H;  2M6Q A;  4DUY H;  4DV1 H;  2G8Y A;  1AN7 A;  1ZZI A;  2NN6 G;  4OD6 A;  5LL6 b;  2D9I A;  2JVZ A;  2QND A;  1SEI A;  3JAM W;  1N32 H;  1DT4 A;  4JYA H;  3NCV A;  2UXC H;  4JI8 H;  2FPH X;  3VKE A;  1ODH A;  4B8T A;  1XRH A;  1V9N A;  2P2R A;  2OPV A;  2UUC H;  4DR3 H;  2LRR A;  4JI1 H;  2Z0S A;  4X65 H;  3EZJ A;  4LF6 H;  2PQU A;  2BA0 A;  2VQE H;  3U1K A;  3GKU A;  2VQF H;  5IWA H;  4B3T H;  2PT7 G;  4B3S H;  4NZR M;  4LFA H;  1HNZ H;  2X06 A;  3KDG A;  2DGR A;  1XNR H;  4DR6 H;  1UG8 A;  4OCH A;  2LTL A;  1WVN A;  2UXD H;  1J4W A;  2BL5 A;  1HR0 H;  5A2Q W;  1X4M A;  2FMR A;  3V69 A;  5JEA G;  3T1H H;  2JA9 A;  4LF9 H;  1VIH A;  3AEV B;  4DR7 H;  4WAN A;  2CTK A;  1J5K A;  4X64 H;  2UU9 H;  4DR1 H;  2OPU A;  4DR4 H;  1MSZ A;  4KHP H;  1HNX H;  4G08 A;  2HH3 A;  1FJG H;  1VBI A;  1WE8 A;  2HHH H;  4JI5 H;  3GR5 A;  1V8C A;  4DR5 H;  2M8W A;  4IFD G;  4JV5 H;  4DV3 H;  3T1Y H;  3UOE A;  1WTJ A;  3SB1 A;  4DV0 H;  1ZTG A;  2K1H A;  2JEA I;  1DTJ A; 
#chains in the Genus database with same CATH homology
 1S20 A;  4FJU A;  1XRH A;  1V9N A;  2G8Y A;  1Z2I A;  1X0A A;  4FJS A;  1WTJ A;  2CWF A;  3UOE A;  1VBI A;  3I0P A;  4H8A A;  1NXU A;  2CWH A;  2X06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...