4QMFB

Structure of the krr1 and faf1 complex from saccharomyces cerevisiae
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
175
structure length
175
Chain Sequence
ESSFMTLFPKYRESYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHIKELMIKRELAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords KRR1 small subunit processome component
publication title Interaction between ribosome assembly factors Krr1 and Faf1 is essential for formation of small ribosomal subunit in yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 55
structure length 175
sequence length 175
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17903 KH_8 Krr1 KH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4qmfB01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4qmfB02
4LIJA 2Z0SA 2HH2A 2JE6I 2P2RA 4OO1G 2DGRA 3U1KA 2OPUA 4IFDG 1J4WA 4QMFB 2YQRA 4JVYA 2OPVA 2CTMA 2JVZA 3V69A 5K36G 1TUAA 4WALA 2ANRA 4AIMA 1K1GA 1ZZKA 4B8TA 2BA0A 1X4NA 2CTFA 2CTEA 2JZXA 2CTJA 1VIHA 2NN6G 3AEVB 2JEAI 2BL5A 1ZTGA 1ZZIA 1DTJA 2ANNA 3VKEA 2QNDA 2PY9A 4BA2I 2FMRA 2HH3A 1ZZJA 4AM3A 2AXYA 2CTKA 2JA9A 4JVHA 5JEAG 2PQUA 2MJHA 5C0XG 1WE8A 3L7ZC 1X4MA 2JEBI 4NBQA 1J5KA 1DT4A 1WVNA 1EC6A 1KHMA 1VIGA 2E3UA 2CPQA 4WANA 2CTLA 4BA1I
chains in the Genus database with same CATH superfamily
4B3TH 4DUZH 4LF9H 3U1KA 2O4CA 2E5LH 4OD6A 4NXNH 4K0KH 4QMFB 1NXUA 4LF6H 1WHRA 1N34H 1K1GA 4E9JA 2UUCH 2BA0A 1V8CA 1HNZH 3KDKA 2CTJA 2M6QA 1SEIA 1N36H 1IBLH 2JEAI 1ZZIA 1DTJA 2ANNA 4NZTM 1I94H 2PT7G 1Z2IA 3I0PA 2AXYA 1FKAH 1HNXH 2JA9A 3NCVA 5JEAG 1PQXA 2K1HA 4X65H 2UUAH 4LF5H 1X9ZA 1I6UA 2LF0A 3L7ZC 4JI6H 1X4MA 2JEBI 1J5KA 4JV5H 3J80W 5BR8H 1KHMA 1VIGA 3OSSD 1ZTGA 4WANA 2DGRA 4DV0H 1HNWH 2UXDH 4B3MH 4JYAH 4OO1G 3FAUA 4IFDG 1J4WA 4LF8H 4JI3H 4X66H 3KDGA 2HHHH 4X62H 2VKCA 1ZZKA 2UXCH 2NN6G 5LMNH 2CTEA 3UOEA 4DR7H 2CWHA 4DV4H 2UXBH 4YY3H 4JI0H 1UG8A 2UUBH 4LF7H 1VBIA 4JI5H 1N32H 2PQUA 4LF4H 2FPHX 2F4VH 4LFBH 2MJHA 5DT9A 1S03G 4LFAH 1XRHA 4DV6H 5A2QW 2VQFH 1XNRH 2E3UA 4FJUA 4BA1I 1MSZA 1XNQH 4LIJA 1IBMH 2Z0SA 2HH2A 2JE6I 3GKUA 2A1SA 3J81W 4DR5H 3OETA 4DV5H 4AQYH 2P2RA 2OPUA 4DV2H 4JI8H 5FLXW 2YQRA 3SB1A 2OPVA 2JVZA 4DR2H 1N33H 2Y3MA 4WALA 4AIMA 3QD7X 4B8TA 2JZXA 2UU9H 4G08A 1XMQH 4JI2H 3RF2A 4GKKH 3AEVB 2LRRA 2QNDA 4BA2I 2FMRA 2HH3A 4AM3A 1FJGH 2LTLA 4JI1H 4JVHA 3J7AK 5IWAH 4DUYH 3GABA 1WE8A 4NBQA 2LTMA 1DT4A 4H8AA 4OX9H 4FJSA 4B3RH 5IT9W 3V69A 2CPQA 4EC5A 4DV1H 4NXMH 4DR4H 1J5EH 1V9NA 1F0XA 2ZM6H 2VQEH 3JAMW 4YHHH 4NZRM 4LFCH 4DV3H 2G8YA 4JVYA 3T1YH 2CTMA 1ODHA 4B3SH 5K36G 1WTJA 1TUAA 2CWFA 1S20A 1X0AA 4OCHA 2ANRA 4DR6H 5LMUH 1X4NA 2CTFA 3OTOH 2CPMA 1VIHA 2X06A 4JI4H 4JI7H 1AN7A 2BL5A 2FFMA 3VKEA 4KHPH 1ZZJA 2CTKA 4X64H 3GR5A 4DV7H 1IBKH 2M8WA 1XMOH 3T1HH 5C0XG 4B8CD 4DR3H 4DR1H 5LL6b 4PDBA 1WVNA 1EC6A 1HR0H 2D9IA 2CTLA 2ZQEA 3EZJA 2PY9A 4GKJH
chains in the Genus database with same CATH topology
4LIJA 2Z0SA 2HH2A 2JE6I 2P2RA 4OO1G 2DGRA 3U1KA 2OPUA 4IFDG 1J4WA 4QMFB 2YQRA 4JVYA 2OPVA 2CTMA 2JVZA 3V69A 5K36G 1TUAA 4WALA 2ANRA 4AIMA 1K1GA 1ZZKA 4B8TA 2BA0A 1X4NA 2CTFA 2CTEA 2JZXA 2CTJA 1VIHA 2NN6G 3AEVB 2JEAI 2BL5A 1ZTGA 1ZZIA 1DTJA 2ANNA 3VKEA 2QNDA 2PY9A 4BA2I 2FMRA 2HH3A 1ZZJA 4AM3A 2AXYA 2CTKA 2JA9A 4JVHA 5JEAG 2PQUA 2MJHA 5C0XG 1WE8A 3L7ZC 1X4MA 2JEBI 4NBQA 1J5KA 1DT4A 1WVNA 1EC6A 1KHMA 1VIGA 2E3UA 2CPQA 4WANA 2CTLA 4BA1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LIJ A;  2Z0S A;  2HH2 A;  2JE6 I;  2P2R A;  4OO1 G;  2DGR A;  3U1K A;  2OPU A;  4IFD G;  1J4W A;  4QMF B;  2YQR A;  4JVY A;  2OPV A;  2CTM A;  2JVZ A;  3V69 A;  5K36 G;  1TUA A;  4WAL A;  2ANR A;  4AIM A;  1K1G A;  1ZZK A;  4B8T A;  2BA0 A;  1X4N A;  2CTF A;  2CTE A;  2JZX A;  2CTJ A;  1VIH A;  2NN6 G;  3AEV B;  2JEA I;  2BL5 A;  1ZTG A;  1ZZI A;  1DTJ A;  2ANN A;  3VKE A;  2QND A;  2PY9 A;  4BA2 I;  2FMR A;  2HH3 A;  1ZZJ A;  4AM3 A;  2AXY A;  2CTK A;  2JA9 A;  4JVH A;  5JEA G;  2PQU A;  2MJH A;  5C0X G;  1WE8 A;  3L7Z C;  1X4M A;  2JEB I;  4NBQ A;  1J5K A;  1DT4 A;  1WVN A;  1EC6 A;  1KHM A;  1VIG A;  2E3U A;  2CPQ A;  4WAN A;  2CTL A;  4BA1 I; 
#chains in the Genus database with same CATH topology
 4B3T H;  4DUZ H;  4LF9 H;  3U1K A;  2O4C A;  2E5L H;  4OD6 A;  4NXN H;  4K0K H;  4QMF B;  1NXU A;  4LF6 H;  1WHR A;  1N34 H;  1K1G A;  4E9J A;  2UUC H;  2BA0 A;  1V8C A;  1HNZ H;  3KDK A;  2CTJ A;  2M6Q A;  1SEI A;  1N36 H;  1IBL H;  2JEA I;  1ZZI A;  1DTJ A;  2ANN A;  4NZT M;  1I94 H;  2PT7 G;  1Z2I A;  3I0P A;  2AXY A;  1FKA H;  1HNX H;  2JA9 A;  3NCV A;  5JEA G;  1PQX A;  2K1H A;  4X65 H;  2UUA H;  4LF5 H;  1X9Z A;  1I6U A;  2LF0 A;  3L7Z C;  4JI6 H;  1X4M A;  2JEB I;  1J5K A;  4JV5 H;  3J80 W;  5BR8 H;  1KHM A;  1VIG A;  3OSS D;  1ZTG A;  4WAN A;  2DGR A;  4DV0 H;  1HNW H;  2UXD H;  4B3M H;  4JYA H;  4OO1 G;  3FAU A;  4IFD G;  1J4W A;  4LF8 H;  4JI3 H;  4X66 H;  3KDG A;  2HHH H;  4X62 H;  2VKC A;  1ZZK A;  2UXC H;  2NN6 G;  5LMN H;  2CTE A;  3UOE A;  4DR7 H;  2CWH A;  4DV4 H;  2UXB H;  4YY3 H;  4JI0 H;  1UG8 A;  2UUB H;  4LF7 H;  1VBI A;  4JI5 H;  1N32 H;  2PQU A;  4LF4 H;  2FPH X;  2F4V H;  4LFB H;  2MJH A;  5DT9 A;  1S03 G;  4LFA H;  1XRH A;  4DV6 H;  5A2Q W;  2VQF H;  1XNR H;  2E3U A;  4FJU A;  4BA1 I;  1MSZ A;  1XNQ H;  4LIJ A;  1IBM H;  2Z0S A;  2HH2 A;  2JE6 I;  3GKU A;  2A1S A;  3J81 W;  4DR5 H;  3OET A;  4DV5 H;  4AQY H;  2P2R A;  2OPU A;  4DV2 H;  4JI8 H;  5FLX W;  2YQR A;  3SB1 A;  2OPV A;  2JVZ A;  4DR2 H;  1N33 H;  2Y3M A;  4WAL A;  4AIM A;  3QD7 X;  4B8T A;  2JZX A;  2UU9 H;  4G08 A;  1XMQ H;  4JI2 H;  3RF2 A;  4GKK H;  3AEV B;  2LRR A;  2QND A;  4BA2 I;  2FMR A;  2HH3 A;  4AM3 A;  1FJG H;  2LTL A;  4JI1 H;  4JVH A;  3J7A K;  5IWA H;  4DUY H;  3GAB A;  1WE8 A;  4NBQ A;  2LTM A;  1DT4 A;  4H8A A;  4OX9 H;  4FJS A;  4B3R H;  5IT9 W;  3V69 A;  2CPQ A;  4EC5 A;  4DV1 H;  4NXM H;  4DR4 H;  1J5E H;  1V9N A;  1F0X A;  2ZM6 H;  2VQE H;  3JAM W;  4YHH H;  4NZR M;  4LFC H;  4DV3 H;  2G8Y A;  4JVY A;  3T1Y H;  2CTM A;  1ODH A;  4B3S H;  5K36 G;  1WTJ A;  1TUA A;  2CWF A;  1S20 A;  1X0A A;  4OCH A;  2ANR A;  4DR6 H;  5LMU H;  1X4N A;  2CTF A;  3OTO H;  2CPM A;  1VIH A;  2X06 A;  4JI4 H;  4JI7 H;  1AN7 A;  2BL5 A;  2FFM A;  3VKE A;  4KHP H;  1ZZJ A;  2CTK A;  4X64 H;  3GR5 A;  4DV7 H;  1IBK H;  2M8W A;  1XMO H;  3T1H H;  5C0X G;  4B8C D;  4DR3 H;  4DR1 H;  5LL6 b;  4PDB A;  1WVN A;  1EC6 A;  1HR0 H;  2D9I A;  2CTL A;  2ZQE A;  3EZJ A;  2PY9 A;  4GKJ H; 
#chains in the Genus database with same CATH homology
 4LIJ A;  2Z0S A;  2HH2 A;  2JE6 I;  2P2R A;  4OO1 G;  2DGR A;  3U1K A;  2OPU A;  4IFD G;  1J4W A;  4QMF B;  2YQR A;  4JVY A;  2OPV A;  2CTM A;  2JVZ A;  3V69 A;  5K36 G;  1TUA A;  4WAL A;  2ANR A;  4AIM A;  1K1G A;  1ZZK A;  4B8T A;  2BA0 A;  1X4N A;  2CTF A;  2CTE A;  2JZX A;  2CTJ A;  1VIH A;  2NN6 G;  3AEV B;  2JEA I;  2BL5 A;  1ZTG A;  1ZZI A;  1DTJ A;  2ANN A;  3VKE A;  2QND A;  2PY9 A;  4BA2 I;  2FMR A;  2HH3 A;  1ZZJ A;  4AM3 A;  2AXY A;  2CTK A;  2JA9 A;  4JVH A;  5JEA G;  2PQU A;  2MJH A;  5C0X G;  1WE8 A;  3L7Z C;  1X4M A;  2JEB I;  4NBQ A;  1J5K A;  1DT4 A;  1WVN A;  1EC6 A;  1KHM A;  1VIG A;  2E3U A;  2CPQ A;  4WAN A;  2CTL A;  4BA1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...