4QMFB

Structure of the krr1 and faf1 complex from saccharomyces cerevisiae
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
175
structure length
175
Chain Sequence
ESSFMTLFPKYRESYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHIKELMIKRELAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction between ribosome assembly factors Krr1 and Faf1 is essential for formation of small ribosomal subunit in yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords KRR1 small subunit processome component
total genus 55
structure length 175
sequence length 175
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17903 KH_8 Krr1 KH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4qmfB01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4qmfB02
1KHMA 4B8TA 2CTJA 2P2RA 1X4NA 1ZZKA 4NBQA 4LIJA 2FMRA 2ANRA 2MJHA 1TUAA 1J4WA 2OPVA 2E3UA 2CTKA 2BL5A 2YQRA 2QNDA 4IFDG 4WANA 2BA0A 4WALA 2OPUA 1K1GA 2HH2A 2JEAI 1ZZJA 1X4MA 2CTFA 2JZXA 4BA1I 4AIMA 2CTLA 4AM3A 2CTMA 4JVYA 3VKEA 2PY9A 2CTEA 1VIHA 2Z0SA 4QMFB 2HH3A 4BA2I 2CPQA 3L7ZC 1ZTGA 4JVHA 2AXYA 1J5KA 1WVNA 3U1KA 1VIGA 2JE6I 2JEBI 2NN6G 1DTJA 3V69A 1DT4A 2ANNA 4OO1G 2JA9A 1ZZIA 5C0XG 2JVZA 5K36G 2PQUA 5JEAG 3AEVB 2DGRA 1WE8A 1EC6A
chains in the Genus database with same CATH superfamily
2P2RA 1PQXA 4OX9H 4LIJA 4LFCH 2CPMA 4DUZH 1S03G 4IFDG 4WANA 2LF0A 2QNDA 4X66H 4WALA 1K1GA 2OPUA 2M6QA 5IWAH 1X4MA 2CTFA 4X62H 4LF4H 4LF6H 2FFMA 3GR5A 3OETA 3QD7X 2VQEH 4DV2H 4DR5H 2PY9A 1AN7A 1ODHA 1WHRA 4YY3H 2CPQA 2CWFA 4EC5A 4X65H 1ZTGA 2HHHH 1V8CA 4LFBH 1UG8A 1WVNA 2NN6G 1HR0H 1I94H 2LTLA 5LMNH 4DV3H 4LF5H 1X0AA 2PQUA 4JI5H 1X9ZA 4NXNH 2X06A 3KDKA 4B8TA 4KHPH 1X4NA 4DR6H 1IBLH 4JI3H 4B3TH 2LRRA 4DV5H 2E3UA 3GABA 4NXMH 4DR7H 1N33H 4FJUA 5LMUH 2HH2A 4X64H 4B3SH 2M8WA 3FAUA 4AM3A 2CTLA 4JI0H 4DV1H 2CTMA 4JVYA 4DUYH 1N34H 4OCHA 2CTEA 1VIHA 2K1HA 5BR8H 2HH3A 4BA2I 2UXCH 4DR2H 2PT7G 2UUCH 1J5KA 2UUBH 3U1KA 3UOEA 2JEBI 3KDGA 4DV7H 4OO1G 4JI8H 4DR1H 1ZZIA 5K36G 5JEAG 1XMQH 4LF7H 3AEVB 1WTJA 3J80W 4DV6H 3T1YH 2ZM6H 1KHMA 4JV5H 1SEIA 3GKUA 4NBQA 2ANRA 1XNRH 1J4WA 2CTKA 3RF2A 2VQFH 4G08A 2BA0A 4AQYH 2JEAI 3OSSD 4JYAH 2JZXA 2VKCA 4AIMA 1MSZA 3VKEA 2FPHX 4B3MH 3OTOH 5A2QW 1N32H 4JVHA 2A1SA 4B3RH 2Y3MA 4LFAH 2JE6I 3NCVA 4GKKH 1DTJA 1F0XA 3V69A 4B8CD 3T1HH 1J5EH 2E5LH 4JI7H 3JAMW 1XNQH 2ANNA 5C0XG 4DR3H 4FJSA 4DR4H 4JI4H 4NZTM 3J81W 1WE8A 4DV4H 1VBIA 2O4CA 1FJGH 2F4VH 1EC6A 2CTJA 2UXDH 4PDBA 1ZZKA 4OD6A 1FKAH 2G8YA 2FMRA 4DV0H 2MJHA 2UXBH 1TUAA 2OPVA 2YQRA 1Z2IA 2BL5A 3I0PA 1HNWH 1HNXH 2UUAH 4JI1H 2D9IA 1IBMH 1IBKH 1ZZJA 4BA1I 1N36H 4LF9H 3SB1A 5IT9W 1XRHA 5LL6b 4JI6H 2ZQEA 2Z0SA 4QMFB 3L7ZC 3EZJA 4GKJH 5DT9A 2AXYA 1XMOH 4JI2H 1VIGA 1V9NA 1NXUA 1HNZH 4K0KH 4YHHH 4NZRM 1DT4A 2UU9H 4LF8H 2JA9A 4H8AA 1S20A 1I6UA 2LTMA 2JVZA 5FLXW 3J7AK 4E9JA 2DGRA 2CWHA
chains in the Genus database with same CATH topology
1KHMA 4B8TA 2CTJA 2P2RA 1X4NA 1ZZKA 4NBQA 4LIJA 2FMRA 2ANRA 2MJHA 1TUAA 1J4WA 2OPVA 2E3UA 2CTKA 2BL5A 2YQRA 2QNDA 4IFDG 4WANA 2BA0A 4WALA 2OPUA 1K1GA 2HH2A 2JEAI 1ZZJA 1X4MA 2CTFA 2JZXA 4BA1I 4AIMA 2CTLA 4AM3A 2CTMA 4JVYA 3VKEA 2PY9A 2CTEA 1VIHA 2Z0SA 4QMFB 2HH3A 4BA2I 2CPQA 3L7ZC 1ZTGA 4JVHA 2AXYA 1J5KA 1WVNA 3U1KA 1VIGA 2JE6I 2JEBI 2NN6G 1DTJA 3V69A 1DT4A 2ANNA 4OO1G 2JA9A 1ZZIA 5C0XG 2JVZA 5K36G 2PQUA 5JEAG 3AEVB 2DGRA 1WE8A 1EC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHM A;  4B8T A;  2CTJ A;  2P2R A;  1X4N A;  1ZZK A;  4NBQ A;  4LIJ A;  2FMR A;  2ANR A;  2MJH A;  1TUA A;  1J4W A;  2OPV A;  2E3U A;  2CTK A;  2BL5 A;  2YQR A;  2QND A;  4IFD G;  4WAN A;  2BA0 A;  4WAL A;  2OPU A;  1K1G A;  2HH2 A;  2JEA I;  1ZZJ A;  1X4M A;  2CTF A;  2JZX A;  4BA1 I;  4AIM A;  2CTL A;  4AM3 A;  2CTM A;  4JVY A;  3VKE A;  2PY9 A;  2CTE A;  1VIH A;  2Z0S A;  4QMF B;  2HH3 A;  4BA2 I;  2CPQ A;  3L7Z C;  1ZTG A;  4JVH A;  2AXY A;  1J5K A;  1WVN A;  3U1K A;  1VIG A;  2JE6 I;  2JEB I;  2NN6 G;  1DTJ A;  3V69 A;  1DT4 A;  2ANN A;  4OO1 G;  2JA9 A;  1ZZI A;  5C0X G;  2JVZ A;  5K36 G;  2PQU A;  5JEA G;  3AEV B;  2DGR A;  1WE8 A;  1EC6 A; 
#chains in the Genus database with same CATH topology
 2P2R A;  1PQX A;  4OX9 H;  4LIJ A;  4LFC H;  2CPM A;  4DUZ H;  1S03 G;  4IFD G;  4WAN A;  2LF0 A;  2QND A;  4X66 H;  4WAL A;  1K1G A;  2OPU A;  2M6Q A;  5IWA H;  1X4M A;  2CTF A;  4X62 H;  4LF4 H;  4LF6 H;  2FFM A;  3GR5 A;  3OET A;  3QD7 X;  2VQE H;  4DV2 H;  4DR5 H;  2PY9 A;  1AN7 A;  1ODH A;  1WHR A;  4YY3 H;  2CPQ A;  2CWF A;  4EC5 A;  4X65 H;  1ZTG A;  2HHH H;  1V8C A;  4LFB H;  1UG8 A;  1WVN A;  2NN6 G;  1HR0 H;  1I94 H;  2LTL A;  5LMN H;  4DV3 H;  4LF5 H;  1X0A A;  2PQU A;  4JI5 H;  1X9Z A;  4NXN H;  2X06 A;  3KDK A;  4B8T A;  4KHP H;  1X4N A;  4DR6 H;  1IBL H;  4JI3 H;  4B3T H;  2LRR A;  4DV5 H;  2E3U A;  3GAB A;  4NXM H;  4DR7 H;  1N33 H;  4FJU A;  5LMU H;  2HH2 A;  4X64 H;  4B3S H;  2M8W A;  3FAU A;  4AM3 A;  2CTL A;  4JI0 H;  4DV1 H;  2CTM A;  4JVY A;  4DUY H;  1N34 H;  4OCH A;  2CTE A;  1VIH A;  2K1H A;  5BR8 H;  2HH3 A;  4BA2 I;  2UXC H;  4DR2 H;  2PT7 G;  2UUC H;  1J5K A;  2UUB H;  3U1K A;  3UOE A;  2JEB I;  3KDG A;  4DV7 H;  4OO1 G;  4JI8 H;  4DR1 H;  1ZZI A;  5K36 G;  5JEA G;  1XMQ H;  4LF7 H;  3AEV B;  1WTJ A;  3J80 W;  4DV6 H;  3T1Y H;  2ZM6 H;  1KHM A;  4JV5 H;  1SEI A;  3GKU A;  4NBQ A;  2ANR A;  1XNR H;  1J4W A;  2CTK A;  3RF2 A;  2VQF H;  4G08 A;  2BA0 A;  4AQY H;  2JEA I;  3OSS D;  4JYA H;  2JZX A;  2VKC A;  4AIM A;  1MSZ A;  3VKE A;  2FPH X;  4B3M H;  3OTO H;  5A2Q W;  1N32 H;  4JVH A;  2A1S A;  4B3R H;  2Y3M A;  4LFA H;  2JE6 I;  3NCV A;  4GKK H;  1DTJ A;  1F0X A;  3V69 A;  4B8C D;  3T1H H;  1J5E H;  2E5L H;  4JI7 H;  3JAM W;  1XNQ H;  2ANN A;  5C0X G;  4DR3 H;  4FJS A;  4DR4 H;  4JI4 H;  4NZT M;  3J81 W;  1WE8 A;  4DV4 H;  1VBI A;  2O4C A;  1FJG H;  2F4V H;  1EC6 A;  2CTJ A;  2UXD H;  4PDB A;  1ZZK A;  4OD6 A;  1FKA H;  2G8Y A;  2FMR A;  4DV0 H;  2MJH A;  2UXB H;  1TUA A;  2OPV A;  2YQR A;  1Z2I A;  2BL5 A;  3I0P A;  1HNW H;  1HNX H;  2UUA H;  4JI1 H;  2D9I A;  1IBM H;  1IBK H;  1ZZJ A;  4BA1 I;  1N36 H;  4LF9 H;  3SB1 A;  5IT9 W;  1XRH A;  5LL6 b;  4JI6 H;  2ZQE A;  2Z0S A;  4QMF B;  3L7Z C;  3EZJ A;  4GKJ H;  5DT9 A;  2AXY A;  1XMO H;  4JI2 H;  1VIG A;  1V9N A;  1NXU A;  1HNZ H;  4K0K H;  4YHH H;  4NZR M;  1DT4 A;  2UU9 H;  4LF8 H;  2JA9 A;  4H8A A;  1S20 A;  1I6U A;  2LTM A;  2JVZ A;  5FLX W;  3J7A K;  4E9J A;  2DGR A;  2CWH A; 
#chains in the Genus database with same CATH homology
 1KHM A;  4B8T A;  2CTJ A;  2P2R A;  1X4N A;  1ZZK A;  4NBQ A;  4LIJ A;  2FMR A;  2ANR A;  2MJH A;  1TUA A;  1J4W A;  2OPV A;  2E3U A;  2CTK A;  2BL5 A;  2YQR A;  2QND A;  4IFD G;  4WAN A;  2BA0 A;  4WAL A;  2OPU A;  1K1G A;  2HH2 A;  2JEA I;  1ZZJ A;  1X4M A;  2CTF A;  2JZX A;  4BA1 I;  4AIM A;  2CTL A;  4AM3 A;  2CTM A;  4JVY A;  3VKE A;  2PY9 A;  2CTE A;  1VIH A;  2Z0S A;  4QMF B;  2HH3 A;  4BA2 I;  2CPQ A;  3L7Z C;  1ZTG A;  4JVH A;  2AXY A;  1J5K A;  1WVN A;  3U1K A;  1VIG A;  2JE6 I;  2JEB I;  2NN6 G;  1DTJ A;  3V69 A;  1DT4 A;  2ANN A;  4OO1 G;  2JA9 A;  1ZZI A;  5C0X G;  2JVZ A;  5K36 G;  2PQU A;  5JEA G;  3AEV B;  2DGR A;  1WE8 A;  1EC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...