4QMFB

Structure of the krr1 and faf1 complex from saccharomyces cerevisiae
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
175
structure length
175
Chain Sequence
b'ESSFMTLFPKYRESYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHIKELMIKRELAKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KRR1 small subunit processome component
publication title Interaction between ribosome assembly factors Krr1 and Faf1 is essential for formation of small ribosomal subunit in yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 55
structure length 175
sequence length 175
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17903 KH_8 Krr1 KH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4qmfB01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4qmfB02
2E3UA 4WALA 1J5KA 2P2RA 1X4NA 1TUAA 2YQRA 2AXYA 1ZZIA 5K36G 1WVNA 2HH2A 2CPQA 2CTEA 4BA1I 1VIGA 1ZZKA 2JEBI 3L7ZC 3U1KA 1X4MA 4JVHA 5JEAG 3VKEA 1ZTGA 2BL5A 2JE6I 2ANRA 2MJHA 2PQUA 4WANA 2CTJA 1DT4A 1VIHA 2BA0A 2JVZA 2QNDA 2PY9A 2CTMA 1ZZJA 4JVYA 1KHMA 2FMRA 2HH3A 2JZXA 2ANNA 1EC6A 4NBQA 1WE8A 2JEAI 4IFDG 2CTFA 4AM3A 3AEVB 2DGRA 4QMFB 1J4WA 1K1GA 2NN6G 2OPVA 4BA2I 2JA9A 4OO1G 1DTJA 2CTKA 2OPUA 4LIJA 4AIMA 4B8TA 2Z0SA 5C0XG 3V69A 2CTLA
chains in the Genus database with same CATH superfamily
1V8CA 4LF5H 1V9NA 1TUAA 3GKUA 4LF9H 5K36G 3OTOH 4B3RH 2FFMA 4B3TH 4LFAH 2HH2A 2F4VH 4B8CD 2M6QA 1ZZKA 3L7ZC 4OCHA 1X9ZA 5LL6b 4DV5H 4FJUA 5JEAG 2BL5A 3J81W 2MJHA 2A1SA 1VIHA 2D9IA 2JVZA 4FJSA 4LFCH 4DR4H 3KDGA 3J80W 1FKAH 1N34H 1WE8A 1F0XA 2UUBH 4K0KH 4G08A 4X64H 3UOEA 4QMFB 1K1GA 4OO1G 4B3MH 2CPMA 5IT9W 3V69A 1ZTGA 4JYAH 2YQRA 4OX9H 1ZZIA 1WVNA 2LTLA 1HNWH 2HHHH 2K1HA 4DV1H 2CTEA 1FJGH 1NXUA 3GABA 4JI1H 2JEBI 3U1KA 4JI8H 1X4MA 3OSSD 2PQUA 1DT4A 4NZRM 4AQYH 2BA0A 4B3SH 2QNDA 2PY9A 2UXDH 2CTMA 4JI6H 1KHMA 1Z2IA 4NXNH 2FMRA 3FAUA 2JZXA 5A2QW 4JI7H 2ANNA 1EC6A 2JEAI 2CTFA 4NXMH 4X65H 2VQFH 3SB1A 2NN6G 1XNRH 2CWHA 4AIMA 2E5LH 4DR6H 4X66H 4DV7H 3QD7X 1HR0H 4DUYH 2E3UA 4WALA 1IBLH 2LTMA 1IBKH 1J5KA 1X4NA 1WTJA 2UXBH 1S20A 5DT9A 4DV3H 4PDBA 4EC5A 1HNXH 4KHPH 5FLXW 2Y3MA 1N36H 2UU9H 4LF7H 1S03G 4GKJH 1PQXA 2CWFA 4X62H 5BR8H 3I0PA 4OD6A 1MSZA 1WHRA 3EZJA 4DUZH 3J7AK 2CTJA 4DV6H 2X06A 4E9JA 2O4CA 4LF4H 4DR5H 4JVYA 1IBMH 2FPHX 3JAMW 2HH3A 4YHHH 1SEIA 1VBIA 1I6UA 4DV4H 4DR3H 4AM3A 4GKKH 1ODHA 5IWAH 2OPVA 4JI5H 2JA9A 2ZQEA 1N33H 1DTJA 2OPUA 4LIJA 4B8TA 4JI3H 5C0XG 5LMUH 2CTLA 4JI0H 2VQEH 2P2RA 2UUAH 3GR5A 1XMQH 2AXYA 1I94H 2ZM6H 4JV5H 4DR1H 3KDKA 2LF0A 2CPQA 1XRHA 4BA1I 1VIGA 1XNQH 1UG8A 4JVHA 4DV0H 4LF6H 2UXCH 2ANRA 4DV2H 3VKEA 2JE6I 2M8WA 2PT7G 3OETA 1XMOH 5LMNH 1HNZH 4WANA 2G8YA 4H8AA 1X0AA 4YY3H 1J5EH 2VKCA 1ZZJA 2LRRA 4JI4H 4LFBH 4JI2H 4NBQA 4DR2H 4IFDG 3NCVA 2UUCH 3AEVB 3T1YH 2DGRA 1J4WA 4BA2I 2CTKA 3T1HH 2Z0SA 1AN7A 4NZTM 1N32H 4DR7H 3RF2A 4LF8H
chains in the Genus database with same CATH topology
2E3UA 4WALA 1J5KA 2P2RA 1X4NA 1TUAA 2YQRA 2AXYA 1ZZIA 5K36G 1WVNA 2HH2A 2CPQA 2CTEA 4BA1I 1VIGA 1ZZKA 2JEBI 3L7ZC 3U1KA 1X4MA 4JVHA 5JEAG 3VKEA 1ZTGA 2BL5A 2JE6I 2ANRA 2MJHA 2PQUA 4WANA 2CTJA 1DT4A 1VIHA 2BA0A 2JVZA 2QNDA 2PY9A 2CTMA 1ZZJA 4JVYA 1KHMA 2FMRA 2HH3A 2JZXA 2ANNA 1EC6A 4NBQA 1WE8A 2JEAI 4IFDG 2CTFA 4AM3A 3AEVB 2DGRA 4QMFB 1J4WA 1K1GA 2NN6G 2OPVA 4BA2I 2JA9A 4OO1G 1DTJA 2CTKA 2OPUA 4LIJA 4AIMA 4B8TA 2Z0SA 5C0XG 3V69A 2CTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3U A;  4WAL A;  1J5K A;  2P2R A;  1X4N A;  1TUA A;  2YQR A;  2AXY A;  1ZZI A;  5K36 G;  1WVN A;  2HH2 A;  2CPQ A;  2CTE A;  4BA1 I;  1VIG A;  1ZZK A;  2JEB I;  3L7Z C;  3U1K A;  1X4M A;  4JVH A;  5JEA G;  3VKE A;  1ZTG A;  2BL5 A;  2JE6 I;  2ANR A;  2MJH A;  2PQU A;  4WAN A;  2CTJ A;  1DT4 A;  1VIH A;  2BA0 A;  2JVZ A;  2QND A;  2PY9 A;  2CTM A;  1ZZJ A;  4JVY A;  1KHM A;  2FMR A;  2HH3 A;  2JZX A;  2ANN A;  1EC6 A;  4NBQ A;  1WE8 A;  2JEA I;  4IFD G;  2CTF A;  4AM3 A;  3AEV B;  2DGR A;  4QMF B;  1J4W A;  1K1G A;  2NN6 G;  2OPV A;  4BA2 I;  2JA9 A;  4OO1 G;  1DTJ A;  2CTK A;  2OPU A;  4LIJ A;  4AIM A;  4B8T A;  2Z0S A;  5C0X G;  3V69 A;  2CTL A; 
#chains in the Genus database with same CATH topology
 1V8C A;  4LF5 H;  1V9N A;  1TUA A;  3GKU A;  4LF9 H;  5K36 G;  3OTO H;  4B3R H;  2FFM A;  4B3T H;  4LFA H;  2HH2 A;  2F4V H;  4B8C D;  2M6Q A;  1ZZK A;  3L7Z C;  4OCH A;  1X9Z A;  5LL6 b;  4DV5 H;  4FJU A;  5JEA G;  2BL5 A;  3J81 W;  2MJH A;  2A1S A;  1VIH A;  2D9I A;  2JVZ A;  4FJS A;  4LFC H;  4DR4 H;  3KDG A;  3J80 W;  1FKA H;  1N34 H;  1WE8 A;  1F0X A;  2UUB H;  4K0K H;  4G08 A;  4X64 H;  3UOE A;  4QMF B;  1K1G A;  4OO1 G;  4B3M H;  2CPM A;  5IT9 W;  3V69 A;  1ZTG A;  4JYA H;  2YQR A;  4OX9 H;  1ZZI A;  1WVN A;  2LTL A;  1HNW H;  2HHH H;  2K1H A;  4DV1 H;  2CTE A;  1FJG H;  1NXU A;  3GAB A;  4JI1 H;  2JEB I;  3U1K A;  4JI8 H;  1X4M A;  3OSS D;  2PQU A;  1DT4 A;  4NZR M;  4AQY H;  2BA0 A;  4B3S H;  2QND A;  2PY9 A;  2UXD H;  2CTM A;  4JI6 H;  1KHM A;  1Z2I A;  4NXN H;  2FMR A;  3FAU A;  2JZX A;  5A2Q W;  4JI7 H;  2ANN A;  1EC6 A;  2JEA I;  2CTF A;  4NXM H;  4X65 H;  2VQF H;  3SB1 A;  2NN6 G;  1XNR H;  2CWH A;  4AIM A;  2E5L H;  4DR6 H;  4X66 H;  4DV7 H;  3QD7 X;  1HR0 H;  4DUY H;  2E3U A;  4WAL A;  1IBL H;  2LTM A;  1IBK H;  1J5K A;  1X4N A;  1WTJ A;  2UXB H;  1S20 A;  5DT9 A;  4DV3 H;  4PDB A;  4EC5 A;  1HNX H;  4KHP H;  5FLX W;  2Y3M A;  1N36 H;  2UU9 H;  4LF7 H;  1S03 G;  4GKJ H;  1PQX A;  2CWF A;  4X62 H;  5BR8 H;  3I0P A;  4OD6 A;  1MSZ A;  1WHR A;  3EZJ A;  4DUZ H;  3J7A K;  2CTJ A;  4DV6 H;  2X06 A;  4E9J A;  2O4C A;  4LF4 H;  4DR5 H;  4JVY A;  1IBM H;  2FPH X;  3JAM W;  2HH3 A;  4YHH H;  1SEI A;  1VBI A;  1I6U A;  4DV4 H;  4DR3 H;  4AM3 A;  4GKK H;  1ODH A;  5IWA H;  2OPV A;  4JI5 H;  2JA9 A;  2ZQE A;  1N33 H;  1DTJ A;  2OPU A;  4LIJ A;  4B8T A;  4JI3 H;  5C0X G;  5LMU H;  2CTL A;  4JI0 H;  2VQE H;  2P2R A;  2UUA H;  3GR5 A;  1XMQ H;  2AXY A;  1I94 H;  2ZM6 H;  4JV5 H;  4DR1 H;  3KDK A;  2LF0 A;  2CPQ A;  1XRH A;  4BA1 I;  1VIG A;  1XNQ H;  1UG8 A;  4JVH A;  4DV0 H;  4LF6 H;  2UXC H;  2ANR A;  4DV2 H;  3VKE A;  2JE6 I;  2M8W A;  2PT7 G;  3OET A;  1XMO H;  5LMN H;  1HNZ H;  4WAN A;  2G8Y A;  4H8A A;  1X0A A;  4YY3 H;  1J5E H;  2VKC A;  1ZZJ A;  2LRR A;  4JI4 H;  4LFB H;  4JI2 H;  4NBQ A;  4DR2 H;  4IFD G;  3NCV A;  2UUC H;  3AEV B;  3T1Y H;  2DGR A;  1J4W A;  4BA2 I;  2CTK A;  3T1H H;  2Z0S A;  1AN7 A;  4NZT M;  1N32 H;  4DR7 H;  3RF2 A;  4LF8 H; 
#chains in the Genus database with same CATH homology
 2E3U A;  4WAL A;  1J5K A;  2P2R A;  1X4N A;  1TUA A;  2YQR A;  2AXY A;  1ZZI A;  5K36 G;  1WVN A;  2HH2 A;  2CPQ A;  2CTE A;  4BA1 I;  1VIG A;  1ZZK A;  2JEB I;  3L7Z C;  3U1K A;  1X4M A;  4JVH A;  5JEA G;  3VKE A;  1ZTG A;  2BL5 A;  2JE6 I;  2ANR A;  2MJH A;  2PQU A;  4WAN A;  2CTJ A;  1DT4 A;  1VIH A;  2BA0 A;  2JVZ A;  2QND A;  2PY9 A;  2CTM A;  1ZZJ A;  4JVY A;  1KHM A;  2FMR A;  2HH3 A;  2JZX A;  2ANN A;  1EC6 A;  4NBQ A;  1WE8 A;  2JEA I;  4IFD G;  2CTF A;  4AM3 A;  3AEV B;  2DGR A;  4QMF B;  1J4W A;  1K1G A;  2NN6 G;  2OPV A;  4BA2 I;  2JA9 A;  4OO1 G;  1DTJ A;  2CTK A;  2OPU A;  4LIJ A;  4AIM A;  4B8T A;  2Z0S A;  5C0X G;  3V69 A;  2CTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...