4QMFB

Structure of the krr1 and faf1 complex from saccharomyces cerevisiae
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
175
structure length
175
Chain Sequence
ESSFMTLFPKYRESYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHIKELMIKRELAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KRR1 small subunit processome component
publication title Interaction between ribosome assembly factors Krr1 and Faf1 is essential for formation of small ribosomal subunit in yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 55
structure length 175
sequence length 175
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17903 KH_8 Krr1 KH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4qmfB01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4qmfB02
2E3UA 2HH2A 2NN6G 2JZXA 2CPQA 2HH3A 4NBQA 1ZZKA 3VKEA 1ZZIA 1K1GA 2PQUA 1EC6A 2BL5A 2ANNA 1J4WA 2CTMA 2QNDA 2JEBI 2Z0SA 2CTKA 2AXYA 4IFDG 2CTEA 4JVHA 1WVNA 3L7ZC 1DT4A 1X4MA 3V69A 1ZZJA 2MJHA 2ANRA 4BA1I 4AIMA 2JVZA 1J5KA 4BA2I 4WALA 2FMRA 1ZTGA 1KHMA 4QMFB 1DTJA 1VIHA 2CTFA 5JEAG 3U1KA 2JEAI 1TUAA 4OO1G 2CTJA 2JE6I 2DGRA 4AM3A 1X4NA 4LIJA 2JA9A 2CTLA 2OPUA 2YQRA 2PY9A 5C0XG 4B8TA 4JVYA 2OPVA 1WE8A 3AEVB 4WANA 2BA0A 1VIGA 5K36G 2P2RA
chains in the Genus database with same CATH superfamily
2E3UA 2HH2A 4JVYA 1ZZKA 1ZZIA 1EC6A 3KDGA 4LF7H 2CTMA 1WVNA 2LTMA 5FLXW 4DV1H 4LF6H 4BA1I 1N36H 2JVZA 3KDKA 1J5KA 1HR0H 4WALA 2FMRA 2VQEH 4JI8H 1VIHA 1I94H 2JEAI 4FJSA 1TUAA 2CTJA 4NZRM 3QD7X 2X06A 3GABA 2F4VH 2UUBH 1J5EH 1X4NA 2JA9A 4DV5H 4JI5H 4DV0H 1N33H 2Y3MA 4E9JA 1XMQH 4H8AA 1V8CA 1HNXH 5K36G 2P2RA 1VBIA 2NN6G 4NBQA 2JZXA 2CPQA 3VKEA 2PQUA 1XRHA 1ODHA 2UU9H 2ANNA 2CPMA 2ZQEA 4EC5A 1J4WA 1I6UA 2Z0SA 3J80W 2JEBI 1Z2IA 3UOEA 5IT9W 2ZM6H 4IFDG 4G08A 2AXYA 2CTEA 2CWHA 4DR6H 3J7AK 3NCVA 1ZZJA 4JYAH 3FAUA 1FKAH 4AIMA 4GKKH 4JI0H 4LFAH 3I0PA 4DR1H 5LMUH 1KHMA 2CTFA 1S20A 5LL6b 4YHHH 4DR2H 3OTOH 1HNZH 4X65H 1UG8A 4K0KH 4LIJA 4JI3H 2D9IA 4NXMH 2FFMA 4B3SH 3EZJA 4DV3H 4OCHA 1SEIA 1WE8A 3AEVB 4JI7H 2A1SA 4JV5H 1VIGA 4AQYH 2K1HA 2VQFH 4DR5H 1K1GA 2HH3A 2LF0A 4JI1H 4DR7H 2BL5A 4X66H 1X9ZA 4LF8H 4B3RH 3GKUA 4DUYH 1F0XA 2CTKA 4LF5H 1XNQH 3L7ZC 1DT4A 1X4MA 3OSSD 3V69A 4OD6A 4KHPH 1IBLH 1N32H 1PQXA 3J81W 4B8CD 1V9NA 2M6QA 2O4CA 4QMFB 5IWAH 4NXNH 4LFBH 4FJUA 4OO1G 4B3TH 4PDBA 2JE6I 2UXDH 2DGRA 4JI6H 2PT7G 4JI4H 4AM3A 4LFCH 2LTLA 2UXCH 2OPUA 3T1HH 2FPHX 2YQRA 4JI2H 5C0XG 2PY9A 4WANA 5BR8H 4DV4H 4NZTM 4LF4H 2BA0A 1HNWH 2HHHH 2G8YA 2E5LH 3T1YH 4B3MH 4DV7H 2QNDA 1WHRA 4OX9H 1IBKH 4LF9H 4JVHA 2VKCA 2MJHA 3RF2A 4DV2H 1N34H 2ANRA 5A2QW 2UUAH 4BA2I 1AN7A 1XMOH 1ZTGA 4YY3H 1DTJA 1S03G 5JEAG 1X0AA 3U1KA 1NXUA 4X62H 5LMNH 1IBMH 2UXBH 4DV6H 4X64H 1MSZA 3GR5A 4GKJH 3OETA 3SB1A 2CTLA 4DR3H 2UUCH 1XNRH 4B8TA 2OPVA 2CWFA 1FJGH 4DR4H 2LRRA 1WTJA 5DT9A 2M8WA 3JAMW 4DUZH
chains in the Genus database with same CATH topology
2E3UA 2HH2A 2NN6G 2JZXA 2CPQA 2HH3A 4NBQA 1ZZKA 3VKEA 1ZZIA 1K1GA 2PQUA 1EC6A 2BL5A 2ANNA 1J4WA 2CTMA 2QNDA 2JEBI 2Z0SA 2CTKA 2AXYA 4IFDG 2CTEA 4JVHA 1WVNA 3L7ZC 1DT4A 1X4MA 3V69A 1ZZJA 2MJHA 2ANRA 4BA1I 4AIMA 2JVZA 1J5KA 4BA2I 4WALA 2FMRA 1ZTGA 1KHMA 4QMFB 1DTJA 1VIHA 2CTFA 5JEAG 3U1KA 2JEAI 1TUAA 4OO1G 2CTJA 2JE6I 2DGRA 4AM3A 1X4NA 4LIJA 2JA9A 2CTLA 2OPUA 2YQRA 2PY9A 5C0XG 4B8TA 4JVYA 2OPVA 1WE8A 3AEVB 4WANA 2BA0A 1VIGA 5K36G 2P2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3U A;  2HH2 A;  2NN6 G;  2JZX A;  2CPQ A;  2HH3 A;  4NBQ A;  1ZZK A;  3VKE A;  1ZZI A;  1K1G A;  2PQU A;  1EC6 A;  2BL5 A;  2ANN A;  1J4W A;  2CTM A;  2QND A;  2JEB I;  2Z0S A;  2CTK A;  2AXY A;  4IFD G;  2CTE A;  4JVH A;  1WVN A;  3L7Z C;  1DT4 A;  1X4M A;  3V69 A;  1ZZJ A;  2MJH A;  2ANR A;  4BA1 I;  4AIM A;  2JVZ A;  1J5K A;  4BA2 I;  4WAL A;  2FMR A;  1ZTG A;  1KHM A;  4QMF B;  1DTJ A;  1VIH A;  2CTF A;  5JEA G;  3U1K A;  2JEA I;  1TUA A;  4OO1 G;  2CTJ A;  2JE6 I;  2DGR A;  4AM3 A;  1X4N A;  4LIJ A;  2JA9 A;  2CTL A;  2OPU A;  2YQR A;  2PY9 A;  5C0X G;  4B8T A;  4JVY A;  2OPV A;  1WE8 A;  3AEV B;  4WAN A;  2BA0 A;  1VIG A;  5K36 G;  2P2R A; 
#chains in the Genus database with same CATH topology
 2E3U A;  2HH2 A;  4JVY A;  1ZZK A;  1ZZI A;  1EC6 A;  3KDG A;  4LF7 H;  2CTM A;  1WVN A;  2LTM A;  5FLX W;  4DV1 H;  4LF6 H;  4BA1 I;  1N36 H;  2JVZ A;  3KDK A;  1J5K A;  1HR0 H;  4WAL A;  2FMR A;  2VQE H;  4JI8 H;  1VIH A;  1I94 H;  2JEA I;  4FJS A;  1TUA A;  2CTJ A;  4NZR M;  3QD7 X;  2X06 A;  3GAB A;  2F4V H;  2UUB H;  1J5E H;  1X4N A;  2JA9 A;  4DV5 H;  4JI5 H;  4DV0 H;  1N33 H;  2Y3M A;  4E9J A;  1XMQ H;  4H8A A;  1V8C A;  1HNX H;  5K36 G;  2P2R A;  1VBI A;  2NN6 G;  4NBQ A;  2JZX A;  2CPQ A;  3VKE A;  2PQU A;  1XRH A;  1ODH A;  2UU9 H;  2ANN A;  2CPM A;  2ZQE A;  4EC5 A;  1J4W A;  1I6U A;  2Z0S A;  3J80 W;  2JEB I;  1Z2I A;  3UOE A;  5IT9 W;  2ZM6 H;  4IFD G;  4G08 A;  2AXY A;  2CTE A;  2CWH A;  4DR6 H;  3J7A K;  3NCV A;  1ZZJ A;  4JYA H;  3FAU A;  1FKA H;  4AIM A;  4GKK H;  4JI0 H;  4LFA H;  3I0P A;  4DR1 H;  5LMU H;  1KHM A;  2CTF A;  1S20 A;  5LL6 b;  4YHH H;  4DR2 H;  3OTO H;  1HNZ H;  4X65 H;  1UG8 A;  4K0K H;  4LIJ A;  4JI3 H;  2D9I A;  4NXM H;  2FFM A;  4B3S H;  3EZJ A;  4DV3 H;  4OCH A;  1SEI A;  1WE8 A;  3AEV B;  4JI7 H;  2A1S A;  4JV5 H;  1VIG A;  4AQY H;  2K1H A;  2VQF H;  4DR5 H;  1K1G A;  2HH3 A;  2LF0 A;  4JI1 H;  4DR7 H;  2BL5 A;  4X66 H;  1X9Z A;  4LF8 H;  4B3R H;  3GKU A;  4DUY H;  1F0X A;  2CTK A;  4LF5 H;  1XNQ H;  3L7Z C;  1DT4 A;  1X4M A;  3OSS D;  3V69 A;  4OD6 A;  4KHP H;  1IBL H;  1N32 H;  1PQX A;  3J81 W;  4B8C D;  1V9N A;  2M6Q A;  2O4C A;  4QMF B;  5IWA H;  4NXN H;  4LFB H;  4FJU A;  4OO1 G;  4B3T H;  4PDB A;  2JE6 I;  2UXD H;  2DGR A;  4JI6 H;  2PT7 G;  4JI4 H;  4AM3 A;  4LFC H;  2LTL A;  2UXC H;  2OPU A;  3T1H H;  2FPH X;  2YQR A;  4JI2 H;  5C0X G;  2PY9 A;  4WAN A;  5BR8 H;  4DV4 H;  4NZT M;  4LF4 H;  2BA0 A;  1HNW H;  2HHH H;  2G8Y A;  2E5L H;  3T1Y H;  4B3M H;  4DV7 H;  2QND A;  1WHR A;  4OX9 H;  1IBK H;  4LF9 H;  4JVH A;  2VKC A;  2MJH A;  3RF2 A;  4DV2 H;  1N34 H;  2ANR A;  5A2Q W;  2UUA H;  4BA2 I;  1AN7 A;  1XMO H;  1ZTG A;  4YY3 H;  1DTJ A;  1S03 G;  5JEA G;  1X0A A;  3U1K A;  1NXU A;  4X62 H;  5LMN H;  1IBM H;  2UXB H;  4DV6 H;  4X64 H;  1MSZ A;  3GR5 A;  4GKJ H;  3OET A;  3SB1 A;  2CTL A;  4DR3 H;  2UUC H;  1XNR H;  4B8T A;  2OPV A;  2CWF A;  1FJG H;  4DR4 H;  2LRR A;  1WTJ A;  5DT9 A;  2M8W A;  3JAM W;  4DUZ H; 
#chains in the Genus database with same CATH homology
 2E3U A;  2HH2 A;  2NN6 G;  2JZX A;  2CPQ A;  2HH3 A;  4NBQ A;  1ZZK A;  3VKE A;  1ZZI A;  1K1G A;  2PQU A;  1EC6 A;  2BL5 A;  2ANN A;  1J4W A;  2CTM A;  2QND A;  2JEB I;  2Z0S A;  2CTK A;  2AXY A;  4IFD G;  2CTE A;  4JVH A;  1WVN A;  3L7Z C;  1DT4 A;  1X4M A;  3V69 A;  1ZZJ A;  2MJH A;  2ANR A;  4BA1 I;  4AIM A;  2JVZ A;  1J5K A;  4BA2 I;  4WAL A;  2FMR A;  1ZTG A;  1KHM A;  4QMF B;  1DTJ A;  1VIH A;  2CTF A;  5JEA G;  3U1K A;  2JEA I;  1TUA A;  4OO1 G;  2CTJ A;  2JE6 I;  2DGR A;  4AM3 A;  1X4N A;  4LIJ A;  2JA9 A;  2CTL A;  2OPU A;  2YQR A;  2PY9 A;  5C0X G;  4B8T A;  4JVY A;  2OPV A;  1WE8 A;  3AEV B;  4WAN A;  2BA0 A;  1VIG A;  5K36 G;  2P2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...