The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
91
|
structure length |
91
|
Chain Sequence |
MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFELEHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Solution Strucutre of the Hypothetical Staphylococcus Aureus protein SAV1430. Northest Strucutral Genomics Consortium target ZR18
rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Staphylococcus aureus subsp. aureus mu50
|
molecule keywords |
conserved hypothetical protein
|
total genus |
10
|
structure length |
91
|
sequence length |
91
|
ec nomenclature | |
pdb deposition date | 2003-06-19 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF08712 | Nfu_N | Scaffold protein Nfu/NifU N terminal |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Ribosomal Protein S8; Chain: A, domain 1 | Scaffold protein Nfu/NifU, N-terminal domain |
#chains in the Genus database with same CATH superfamily 2M8W A; 2FFM A; 2LTL A; 2LTM A; 2M6Q A; 1PQX A; 2K1H A; #chains in the Genus database with same CATH topology 2BL5 A; 2NN6 G; 2JA9 A; 4YHH H; 1K1G A; 4JI3 H; 3KDG A; 5JEA G; 2LF0 A; 4LFC H; 4WAN A; 4DV4 H; 2JEA I; 1HR0 H; 4LFB H; 4DR5 H; 4B3T H; 2ANN A; 4DR1 H; 2F4V H; 1VIG A; 5IWA H; 4NZT M; 2CPQ A; 2DGR A; 2HH2 A; 4DR3 H; 1WHR A; 4OO1 G; 4JI8 H; 4BA2 I; 4JYA H; 4B3S H; 2OPV A; 4X66 H; 4LF8 H; 1X9Z A; 2CTM A; 3V69 A; 2CTJ A; 1I94 H; 1N34 H; 4AIM A; 2UUA H; 4AQY H; 1HNW H; 5K36 G; 2LTL A; 4DUY H; 4JI2 H; 1XNQ H; 1SEI A; 2OPU A; 4NZR M; 1HNZ H; 5IT9 W; 3RF2 A; 4LIJ A; 4LF7 H; 3OSS D; 2CTK A; 2UUC H; 1I6U A; 2G8Y A; 4FJS A; 4OD6 A; 2VKC A; 4LF4 H; 2LTM A; 1VBI A; 2CTL A; 1ZZJ A; 1VIH A; 3AEV B; 2YQR A; 2HHH H; 2A1S A; 3SB1 A; 1IBK H; 2Z0S A; 3OET A; 2ZM6 H; 4DR2 H; 3T1Y H; 2UXC H; 5LMU H; 3J81 W; 4GKJ H; 1N33 H; 2HH3 A; 4OX9 H; 2PT7 G; 3EZJ A; 1XRH A; 5C0X G; 2P2R A; 2M8W A; 2UU9 H; 2PQU A; 4LF5 H; 1FJG H; 3KDK A; 4DR6 H; 1XNR H; 1IBL H; 4JI0 H; 3U1K A; 1AN7 A; 3OTO H; 4AM3 A; 4FJU A; 5DT9 A; 3UOE A; 1FKA H; 3JAM W; 3L7Z C; 1ODH A; 5LL6 b; 5FLX W; 2M6Q A; 4KHP H; 1ZZI A; 2JE6 I; 1KHM A; 1WTJ A; 1J4W A; 3I0P A; 4DV5 H; 2FMR A; 3QD7 X; 4DV7 H; 1DT4 A; 2JZX A; 4DV2 H; 1WE8 A; 4DV6 H; 1N36 H; 4IFD G; 1PQX A; 2FPH X; 4E9J A; 4WAL A; 1J5K A; 3J7A K; 2LRR A; 4JI5 H; 4JI7 H; 3T1H H; 1IBM H; 2CWF A; 1WVN A; 4H8A A; 1MSZ A; 4EC5 A; 4YY3 H; 2Y3M A; 2D9I A; 2MJH A; 4LF6 H; 3NCV A; 4NXM H; 4JV5 H; 1X4M A; 2ZQE A; 1XMQ H; 4NXN H; 4G08 A; 2ANR A; 2VQE H; 1S20 A; 1J5E H; 2X06 A; 4X64 H; 4B8C D; 4B3M H; 1DTJ A; 2JVZ A; 4GKK H; 1N32 H; 4DUZ H; 4X65 H; 2FFM A; 2CPM A; 3J80 W; 1S03 G; 2BA0 A; 2E5L H; 2VQF H; 4DV3 H; 4DR4 H; 2CWH A; 5BR8 H; 4LFA H; 3VKE A; 2K1H A; 2E3U A; 3FAU A; 1NXU A; 1ZZK A; 2PY9 A; 4B3R H; 4JI1 H; 1UG8 A; 4K0K H; 1X4N A; 1EC6 A; 1HNX H; 1X0A A; 1XMO H; 2CTE A; 4DR7 H; 2O4C A; 2UXD H; 1Z2I A; 4JI4 H; 2CTF A; 1TUA A; 4QMF B; 4DV1 H; 2JEB I; 3GAB A; 3GR5 A; 2UUB H; 5A2Q W; 4BA1 I; 4NBQ A; 4B8T A; 4OCH A; 4JI6 H; 3GKU A; 1ZTG A; 2AXY A; 1F0X A; 4JVY A; 1V8C A; 4DV0 H; 4PDB A; 5LMN H; 1V9N A; 4LF9 H; 4JVH A; 2UXB H; 4X62 H; 2QND A; #chains in the Genus database with same CATH homology 2M8W A; 2FFM A; 2LTL A; 2LTM A; 2M6Q A; 1PQX A; 2K1H A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...