1HSKA

Crystal structure of s. aureus murb
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
303
structure length
303
Chain Sequence
NKDIYQALQQLIPNEKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIEVSDDAIIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYRNSIIQKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRIIGEHPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUCTASE
publication title A structural variation for MurB: X-ray crystal structure of Staphylococcus aureus UDP-N-acetylenolpyruvylglucosamine reductase (MurB).
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 98
structure length 303
sequence length 303
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 2000-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1hskA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1hskA01
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 1hskA03
4XLOA 5ADZA 3FW7A 1QLUA 3NVVB 1FFVC 2W54A 3SR6B 5HQXA 3D2JA 1N5XA 2BVGA 3KJMA 3NVZB 1W1JA 1AHVA 1W1RA 2VAOA 1W1KA 3LAEA 1WVEA 5AE2A 2QPMA 3AMZA 4BCAA 3AM9A 5FXFA 5G5HB 1AHUA 2VFSA 1W1LA 3S1DA 4BC9A 3BW7A 2PLSA 4JB1A 4PZFA 2VFTA 2OAIA 3S1EA 4PWBA 2E3TA 1N60C 3LLBA 3NVWB 1N5WC 2W3SA 2VFVA 4EC3A 1UXYA 3JS8A 2W55A 2W3RA 4MLAA 3W8ZA 4PVJA 1WVFA 1VDVA 3DQ0A 5G5GB 2GQTA 3NVYB 3NRZB 1DIIA 1ZXIC 2I0KA 1F0XA 1VAOA 3W8XA 1W1MA 1SB3B 3S1FA 5AE3A 1V97A 1RM6B 3VTEA 2P4PA 1DZNA 3W8WA 1WYGA 2MBRA 4UD8A 2AXRA 1N61C 3PM9A 2BVFA 4PVKA 4JAYA 1E8GA 1I19A 3C0PA 4BC7A 1HSKA 2BVHA 1W1QA 4OALA 3TX1A 5FXPA 2Q85A 5D79A 2GQUA 2P3HA 5FXDA 2VFUA 1DIQA 4HG0A 3FWAA 1MBTA 1QLTA 4PWCA 3I99A 2QKNA 1MBBA 4O95A 2PLIA 2EXRA 5AE1A 5HHZA 2R2ZA 2R8DA 2O3GA 3TSHA 1JROA 1N63C 4BBYA 3TSJA 1FIQB 2Q4WA 4DNSA 1FO4A 3EUB3 1AHZA 1T3QC 4PYTA 3D2DA 1N62C 1ZR6A 3AN1A 4ML8A 3GSYA 5HMRA 3B9JB 1W1SA 3D2HA 4PVEA 1E0YA 1E8HA 4ZOHB 1JRPA 2NQWA 1FFUC 3FW8A 3FW9A 4PVHA 5FXEA 2P13A 3DEDA 3HRDC 2RK5A 1W1OA 3ETRB 2YVSA 1E8FA 3NS1B 3S1CA 2VFRA
chains in the Genus database with same CATH superfamily
4XLOA 5ADZA 3FW7A 1QLUA 3NVVB 1FFVC 2W54A 3SR6B 5HQXA 3D2JA 1N5XA 2BVGA 3KJMA 3NVZB 1W1JA 1AHVA 1W1RA 2VAOA 1W1KA 3LAEA 1WVEA 3PQBA 2Y3RA 5AE2A 2QPMA 3EJDB 3AMZA 2UUUA 2IPIA 4BCAA 3POPA 3AM9A 5FXFA 5G5HB 1AHUA 2VFSA 1W1LA 3RJ8A 3S1DA 4BC9A 3BW7A 2PLSA 4JB1A 4PZFA 2VFTA 2OAIA 5I1VA 3S1EA 4PWBA 2E3TA 1N60C 3LLBA 3NVWB 1N5WC 2W3SA 3HSUA 2VFVA 5L6FA 4EC3A 5K8EA 1UXYA 3JS8A 2W55A 2W3RA 4MLAA 3W8ZA 4PVJA 1WVFA 1VDVA 3DQ0A 5G5GB 3EJBB 2GQTA 3NVYB 2Y4GA 3NRZB 1DIIA 1ZXIC 2I0KA 1F0XA 1VAOA 3W8XA 1W1MA 1SB3B 3S1FA 5AE3A 1V97A 1RM6B 5I1WA 3VTEA 2P4PA 1DZNA 3W8WA 1WYGA 2MBRA 5L6GA 4UD8A 2AXRA 1N61C 3PM9A 2BVFA 4PVKA 5AWVA 4JAYA 1E8GA 1I19A 3C0PA 4BC7A 1HSKA 2BVHA 1W1QA 4OALA 3TX1A 5FXPA 2Q85A 2UUVA 5D79A 2GQUA 2P3HA 5FXDA 2VFUA 1DIQA 4HG0A 3FWAA 1MBTA 1QLTA 4PWCA 3I99A 2QKNA 2Y3SA 1MBBA 4O95A 2PLIA 2EXRA 5AE1A 3RJAA 5HHZA 2R2ZA 2R8DA 2O3GA 3TSHA 1JROA 1N63C 4BBYA 3TSJA 1FIQB 2Q4WA 4DNSA 1FO4A 3EUB3 1AHZA 1T3QC 4PYTA 2WDWA 3D2DA 1N62C 1ZR6A 3AN1A 4ML8A 3GSYA 5HMRA 3B9JB 1W1SA 3D2HA 4PVEA 1E0YA 1E8HA 2Y08A 4ZOHB 1JRPA 2NQWA 1FFUC 3FW8A 3FW9A 4PVHA 5FXEA 2P13A 3DEDA 3HRDC 3EJEB 2RK5A 1W1OA 3ETRB 2YVSA 1E8FA 3NS1B 3S1CA 2VFRA
chains in the Genus database with same CATH topology
4XLOA 5ADZA 3FW7A 1QLUA 3NVVB 1FFVC 2W54A 3SR6B 5HQXA 3D2JA 1N5XA 2BVGA 3KJMA 3NVZB 1W1JA 1AHVA 1W1RA 2VAOA 1W1KA 3LAEA 1WVEA 3PQBA 2Y3RA 5AE2A 2QPMA 2UUUA 3AMZA 3POPA 2IPIA 4BCAA 3AM9A 5FXFA 5G5HB 1AHUA 2VFSA 1W1LA 3RJ8A 3S1DA 4BC9A 3BW7A 2PLSA 4JB1A 4PZFA 2VFTA 2OAIA 5I1VA 3S1EA 4PWBA 2E3TA 1N60C 3LLBA 3NVWB 1N5WC 2W3SA 3HSUA 2VFVA 5L6FA 4EC3A 5K8EA 1UXYA 3JS8A 2W55A 2W3RA 4MLAA 3W8ZA 4PVJA 1WVFA 1VDVA 3DQ0A 5G5GB 2GQTA 3NVYB 2Y4GA 3NRZB 1DIIA 1ZXIC 2I0KA 1F0XA 1VAOA 3W8XA 1W1MA 1SB3B 3S1FA 5AE3A 1V97A 1RM6B 5I1WA 3VTEA 2P4PA 1DZNA 3W8WA 1WYGA 2MBRA 5L6GA 4UD8A 2AXRA 1N61C 3PM9A 2BVFA 4PVKA 5AWVA 4JAYA 1E8GA 1I19A 3C0PA 4BC7A 1HSKA 2BVHA 1W1QA 4OALA 3TX1A 5FXPA 2Q85A 2UUVA 5D79A 2GQUA 2P3HA 5FXDA 2VFUA 1DIQA 4HG0A 3FWAA 1MBTA 1QLTA 4PWCA 3I99A 2QKNA 2Y3SA 1MBBA 4O95A 2PLIA 2EXRA 5AE1A 3RJAA 5HHZA 2R2ZA 2R8DA 2O3GA 3TSHA 1JROA 1N63C 4BBYA 3TSJA 1FIQB 2Q4WA 4DNSA 1FO4A 3EUB3 1AHZA 1T3QC 4PYTA 2WDWA 3D2DA 1N62C 1ZR6A 3AN1A 4ML8A 3GSYA 5HMRA 3B9JB 1W1SA 3D2HA 4PVEA 1E0YA 1E8HA 2Y08A 4ZOHB 1JRPA 2NQWA 1FFUC 3FW8A 3FW9A 4PVHA 5FXEA 2P13A 3DEDA 3HRDC 2RK5A 1W1OA 3ETRB 2YVSA 1E8FA 3NS1B 3S1CA 2VFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLO A;  5ADZ A;  3FW7 A;  1QLU A;  3NVV B;  1FFV C;  2W54 A;  3SR6 B;  5HQX A;  3D2J A;  1N5X A;  2BVG A;  3KJM A;  3NVZ B;  1W1J A;  1AHV A;  1W1R A;  2VAO A;  1W1K A;  3LAE A;  1WVE A;  5AE2 A;  2QPM A;  3AMZ A;  4BCA A;  3AM9 A;  5FXF A;  5G5H B;  1AHU A;  2VFS A;  1W1L A;  3S1D A;  4BC9 A;  3BW7 A;  2PLS A;  4JB1 A;  4PZF A;  2VFT A;  2OAI A;  3S1E A;  4PWB A;  2E3T A;  1N60 C;  3LLB A;  3NVW B;  1N5W C;  2W3S A;  2VFV A;  4EC3 A;  1UXY A;  3JS8 A;  2W55 A;  2W3R A;  4MLA A;  3W8Z A;  4PVJ A;  1WVF A;  1VDV A;  3DQ0 A;  5G5G B;  2GQT A;  3NVY B;  3NRZ B;  1DII A;  1ZXI C;  2I0K A;  1F0X A;  1VAO A;  3W8X A;  1W1M A;  1SB3 B;  3S1F A;  5AE3 A;  1V97 A;  1RM6 B;  3VTE A;  2P4P A;  1DZN A;  3W8W A;  1WYG A;  2MBR A;  4UD8 A;  2AXR A;  1N61 C;  3PM9 A;  2BVF A;  4PVK A;  4JAY A;  1E8G A;  1I19 A;  3C0P A;  4BC7 A;  1HSK A;  2BVH A;  1W1Q A;  4OAL A;  3TX1 A;  5FXP A;  2Q85 A;  5D79 A;  2GQU A;  2P3H A;  5FXD A;  2VFU A;  1DIQ A;  4HG0 A;  3FWA A;  1MBT A;  1QLT A;  4PWC A;  3I99 A;  2QKN A;  1MBB A;  4O95 A;  2PLI A;  2EXR A;  5AE1 A;  5HHZ A;  2R2Z A;  2R8D A;  2O3G A;  3TSH A;  1JRO A;  1N63 C;  4BBY A;  3TSJ A;  1FIQ B;  2Q4W A;  4DNS A;  1FO4 A;  3EUB 3;  1AHZ A;  1T3Q C;  4PYT A;  3D2D A;  1N62 C;  1ZR6 A;  3AN1 A;  4ML8 A;  3GSY A;  5HMR A;  3B9J B;  1W1S A;  3D2H A;  4PVE A;  1E0Y A;  1E8H A;  4ZOH B;  1JRP A;  2NQW A;  1FFU C;  3FW8 A;  3FW9 A;  4PVH A;  5FXE A;  2P13 A;  3DED A;  3HRD C;  2RK5 A;  1W1O A;  3ETR B;  2YVS A;  1E8F A;  3NS1 B;  3S1C A;  2VFR A; 
#chains in the Genus database with same CATH topology
 4XLO A;  5ADZ A;  3FW7 A;  1QLU A;  3NVV B;  1FFV C;  2W54 A;  3SR6 B;  5HQX A;  3D2J A;  1N5X A;  2BVG A;  3KJM A;  3NVZ B;  1W1J A;  1AHV A;  1W1R A;  2VAO A;  1W1K A;  3LAE A;  1WVE A;  3PQB A;  2Y3R A;  5AE2 A;  2QPM A;  3EJD B;  3AMZ A;  2UUU A;  2IPI A;  4BCA A;  3POP A;  3AM9 A;  5FXF A;  5G5H B;  1AHU A;  2VFS A;  1W1L A;  3RJ8 A;  3S1D A;  4BC9 A;  3BW7 A;  2PLS A;  4JB1 A;  4PZF A;  2VFT A;  2OAI A;  5I1V A;  3S1E A;  4PWB A;  2E3T A;  1N60 C;  3LLB A;  3NVW B;  1N5W C;  2W3S A;  3HSU A;  2VFV A;  5L6F A;  4EC3 A;  5K8E A;  1UXY A;  3JS8 A;  2W55 A;  2W3R A;  4MLA A;  3W8Z A;  4PVJ A;  1WVF A;  1VDV A;  3DQ0 A;  5G5G B;  3EJB B;  2GQT A;  3NVY B;  2Y4G A;  3NRZ B;  1DII A;  1ZXI C;  2I0K A;  1F0X A;  1VAO A;  3W8X A;  1W1M A;  1SB3 B;  3S1F A;  5AE3 A;  1V97 A;  1RM6 B;  5I1W A;  3VTE A;  2P4P A;  1DZN A;  3W8W A;  1WYG A;  2MBR A;  5L6G A;  4UD8 A;  2AXR A;  1N61 C;  3PM9 A;  2BVF A;  4PVK A;  5AWV A;  4JAY A;  1E8G A;  1I19 A;  3C0P A;  4BC7 A;  1HSK A;  2BVH A;  1W1Q A;  4OAL A;  3TX1 A;  5FXP A;  2Q85 A;  2UUV A;  5D79 A;  2GQU A;  2P3H A;  5FXD A;  2VFU A;  1DIQ A;  4HG0 A;  3FWA A;  1MBT A;  1QLT A;  4PWC A;  3I99 A;  2QKN A;  2Y3S A;  1MBB A;  4O95 A;  2PLI A;  2EXR A;  5AE1 A;  3RJA A;  5HHZ A;  2R2Z A;  2R8D A;  2O3G A;  3TSH A;  1JRO A;  1N63 C;  4BBY A;  3TSJ A;  1FIQ B;  2Q4W A;  4DNS A;  1FO4 A;  3EUB 3;  1AHZ A;  1T3Q C;  4PYT A;  2WDW A;  3D2D A;  1N62 C;  1ZR6 A;  3AN1 A;  4ML8 A;  3GSY A;  5HMR A;  3B9J B;  1W1S A;  3D2H A;  4PVE A;  1E0Y A;  1E8H A;  2Y08 A;  4ZOH B;  1JRP A;  2NQW A;  1FFU C;  3FW8 A;  3FW9 A;  4PVH A;  5FXE A;  2P13 A;  3DED A;  3HRD C;  3EJE B;  2RK5 A;  1W1O A;  3ETR B;  2YVS A;  1E8F A;  3NS1 B;  3S1C A;  2VFR A; 
#chains in the Genus database with same CATH homology
 4XLO A;  5ADZ A;  3FW7 A;  1QLU A;  3NVV B;  1FFV C;  2W54 A;  3SR6 B;  5HQX A;  3D2J A;  1N5X A;  2BVG A;  3KJM A;  3NVZ B;  1W1J A;  1AHV A;  1W1R A;  2VAO A;  1W1K A;  3LAE A;  1WVE A;  3PQB A;  2Y3R A;  5AE2 A;  2QPM A;  2UUU A;  3AMZ A;  3POP A;  2IPI A;  4BCA A;  3AM9 A;  5FXF A;  5G5H B;  1AHU A;  2VFS A;  1W1L A;  3RJ8 A;  3S1D A;  4BC9 A;  3BW7 A;  2PLS A;  4JB1 A;  4PZF A;  2VFT A;  2OAI A;  5I1V A;  3S1E A;  4PWB A;  2E3T A;  1N60 C;  3LLB A;  3NVW B;  1N5W C;  2W3S A;  3HSU A;  2VFV A;  5L6F A;  4EC3 A;  5K8E A;  1UXY A;  3JS8 A;  2W55 A;  2W3R A;  4MLA A;  3W8Z A;  4PVJ A;  1WVF A;  1VDV A;  3DQ0 A;  5G5G B;  2GQT A;  3NVY B;  2Y4G A;  3NRZ B;  1DII A;  1ZXI C;  2I0K A;  1F0X A;  1VAO A;  3W8X A;  1W1M A;  1SB3 B;  3S1F A;  5AE3 A;  1V97 A;  1RM6 B;  5I1W A;  3VTE A;  2P4P A;  1DZN A;  3W8W A;  1WYG A;  2MBR A;  5L6G A;  4UD8 A;  2AXR A;  1N61 C;  3PM9 A;  2BVF A;  4PVK A;  5AWV A;  4JAY A;  1E8G A;  1I19 A;  3C0P A;  4BC7 A;  1HSK A;  2BVH A;  1W1Q A;  4OAL A;  3TX1 A;  5FXP A;  2Q85 A;  2UUV A;  5D79 A;  2GQU A;  2P3H A;  5FXD A;  2VFU A;  1DIQ A;  4HG0 A;  3FWA A;  1MBT A;  1QLT A;  4PWC A;  3I99 A;  2QKN A;  2Y3S A;  1MBB A;  4O95 A;  2PLI A;  2EXR A;  5AE1 A;  3RJA A;  5HHZ A;  2R2Z A;  2R8D A;  2O3G A;  3TSH A;  1JRO A;  1N63 C;  4BBY A;  3TSJ A;  1FIQ B;  2Q4W A;  4DNS A;  1FO4 A;  3EUB 3;  1AHZ A;  1T3Q C;  4PYT A;  2WDW A;  3D2D A;  1N62 C;  1ZR6 A;  3AN1 A;  4ML8 A;  3GSY A;  5HMR A;  3B9J B;  1W1S A;  3D2H A;  4PVE A;  1E0Y A;  1E8H A;  2Y08 A;  4ZOH B;  1JRP A;  2NQW A;  1FFU C;  3FW8 A;  3FW9 A;  4PVH A;  5FXE A;  2P13 A;  3DED A;  3HRD C;  2RK5 A;  1W1O A;  3ETR B;  2YVS A;  1E8F A;  3NS1 B;  3S1C A;  2VFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...