1HSKA

Crystal structure of s. aureus murb
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
303
structure length
303
Chain Sequence
NKDIYQALQQLIPNEKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIEVSDDAIIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYRNSIIQKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRIIGEHPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural variation for MurB: X-ray crystal structure of Staphylococcus aureus UDP-N-acetylenolpyruvylglucosamine reductase (MurB).
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
molecule keywords UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUCTASE
total genus 98
structure length 303
sequence length 303
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 2000-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1hskA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1hskA01
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 1hskA03
2GQUA 2VFTA 1DIIA 1ZR6A 3PM9A 1W1OA 2W3SA 2R2ZA 2AXRA 2PLSA 2PLIA 1N60C 5AE1A 4PYTA 2QKNA 5FXPA 3S1FA 2NQWA 4EC3A 1VDVA 1N63C 3AMZA 1E8FA 2VFUA 4XLOA 1UXYA 3W8WA 1MBBA 1WVEA 5G5GB 4PVKA 3FW7A 3ETRB 2VFSA 2EXRA 3D2JA 2P3HA 4ML8A 1N62C 2VAOA 3TX1A 3NRZB 5HQXA 3SR6B 2I0KA 2W54A 4O95A 5D79A 4BCAA 2R8DA 1DZNA 3AM9A 1ZXIC 5G5HB 2Q85A 3KJMA 1WVFA 1JRPA 3S1CA 1E0YA 4BBYA 1N5WC 1AHVA 2O3GA 2VFVA 4DNSA 2YVSA 4PWCA 5HHZA 3TSJA 4JB1A 4JAYA 5HMRA 1W1KA 3LAEA 1AHUA 2P13A 2W3RA 4OALA 3S1DA 1I19A 4PVHA 1V97A 3DEDA 2VFRA 3EUB3 1W1QA 1DIQA 4BC9A 1E8HA 2RK5A 4PZFA 5FXEA 3FWAA 2Q4WA 3NVYB 1MBTA 1N5XA 1W1LA 3I99A 3NS1B 1W1JA 1E8GA 1VAOA 2W55A 3JS8A 3B9JB 3AN1A 3DQ0A 1W1SA 4ZOHB 1QLTA 1QLUA 3VTEA 4UD8A 1F0XA 2QPMA 3BW7A 2BVGA 3FW9A 1AHZA 4PWBA 1FIQB 2BVHA 1RM6B 3NVVB 3W8XA 1W1RA 3S1EA 4BC7A 4MLAA 1N61C 1T3QC 2E3TA 5FXFA 2GQTA 2MBRA 1FO4A 3TSHA 3D2DA 2BVFA 1FFUC 3FW8A 5AE3A 3LLBA 1HSKA 3NVZB 4PVJA 5AE2A 1SB3B 3GSYA 2P4PA 5ADZA 3NVWB 5FXDA 1W1MA 3D2HA 4PVEA 3HRDC 3C0PA 4HG0A 3W8ZA 2OAIA 1JROA 1FFVC 1WYGA
chains in the Genus database with same CATH superfamily
5I1WA 2GQUA 2VFTA 1DIIA 1ZR6A 3PM9A 1W1OA 2W3SA 2R2ZA 2AXRA 2PLSA 2PLIA 1N60C 5AE1A 4PYTA 2QKNA 5FXPA 5AWVA 3S1FA 2NQWA 3EJEB 4EC3A 1VDVA 1N63C 3AMZA 1E8FA 2VFUA 4XLOA 1UXYA 3W8WA 1MBBA 1WVEA 5G5GB 4PVKA 5L6FA 3FW7A 3ETRB 2VFSA 2EXRA 3D2JA 2P3HA 4ML8A 2Y3SA 1N62C 2VAOA 3TX1A 3NRZB 5HQXA 3SR6B 2I0KA 2W54A 4O95A 5D79A 4BCAA 2R8DA 5L6GA 3HSUA 1DZNA 3AM9A 3POPA 1ZXIC 5G5HB 2UUVA 2Q85A 3KJMA 2Y4GA 1WVFA 1JRPA 3S1CA 1E0YA 4BBYA 1N5WC 1AHVA 2O3GA 2VFVA 4DNSA 2YVSA 4PWCA 5HHZA 2Y3RA 3TSJA 4JB1A 4JAYA 5HMRA 1W1KA 3EJDB 3LAEA 1AHUA 2P13A 3EJBB 2W3RA 4OALA 3S1DA 1I19A 4PVHA 1V97A 3DEDA 2VFRA 3EUB3 1W1QA 1DIQA 4BC9A 1E8HA 2RK5A 4PZFA 5FXEA 3FWAA 2Q4WA 3NVYB 1MBTA 2IPIA 2WDWA 1N5XA 1W1LA 3I99A 3NS1B 1W1JA 1E8GA 1VAOA 2W55A 3JS8A 3B9JB 3RJ8A 3AN1A 3DQ0A 1W1SA 4ZOHB 1QLTA 1QLUA 3VTEA 4UD8A 1F0XA 2QPMA 3BW7A 2BVGA 1AHZA 3FW9A 3NVVB 1FIQB 2BVHA 4PWBA 1RM6B 3W8XA 1W1RA 3S1EA 4BC7A 4MLAA 1N61C 1T3QC 2E3TA 5FXFA 2GQTA 2MBRA 1FO4A 3TSHA 3D2DA 2BVFA 1FFUC 3FW8A 5AE3A 3LLBA 1HSKA 3NVZB 4PVJA 5AE2A 1SB3B 3GSYA 2P4PA 5ADZA 3NVWB 3RJAA 5FXDA 1W1MA 3D2HA 5K8EA 4PVEA 3HRDC 3C0PA 2UUUA 4HG0A 5I1VA 3W8ZA 2OAIA 1JROA 1FFVC 1WYGA 2Y08A 3PQBA
chains in the Genus database with same CATH topology
5I1WA 2GQUA 2VFTA 1DIIA 1ZR6A 3PM9A 1W1OA 2W3SA 2R2ZA 2AXRA 2PLSA 2PLIA 1N60C 5AE1A 4PYTA 2QKNA 5FXPA 5AWVA 3S1FA 2NQWA 4EC3A 1VDVA 1N63C 3AMZA 1E8FA 2VFUA 4XLOA 1UXYA 3W8WA 1MBBA 1WVEA 5G5GB 4PVKA 5L6FA 3FW7A 3ETRB 2VFSA 2EXRA 3D2JA 2P3HA 4ML8A 2Y3SA 1N62C 2VAOA 3TX1A 3NRZB 5HQXA 3SR6B 2I0KA 2W54A 4O95A 5D79A 4BCAA 2R8DA 5L6GA 3HSUA 1DZNA 3AM9A 3POPA 1ZXIC 5G5HB 2UUVA 2Q85A 3KJMA 2Y4GA 1WVFA 1JRPA 3S1CA 1E0YA 4BBYA 1N5WC 1AHVA 2O3GA 2VFVA 4DNSA 2YVSA 4PWCA 5HHZA 2Y3RA 3TSJA 4JB1A 4JAYA 5HMRA 1W1KA 3LAEA 1AHUA 2P13A 2W3RA 4OALA 3S1DA 1I19A 4PVHA 1V97A 3DEDA 2VFRA 3EUB3 1W1QA 1DIQA 4BC9A 1E8HA 2RK5A 4PZFA 5FXEA 3FWAA 2Q4WA 3NVYB 1MBTA 2IPIA 2WDWA 1N5XA 1W1LA 3I99A 3NS1B 1W1JA 1E8GA 1VAOA 2W55A 3JS8A 3B9JB 3RJ8A 3AN1A 3DQ0A 1W1SA 4ZOHB 1QLTA 1QLUA 3VTEA 4UD8A 1F0XA 2QPMA 3BW7A 2BVGA 3FW9A 1AHZA 4PWBA 1FIQB 2BVHA 1RM6B 3NVVB 3W8XA 1W1RA 3S1EA 4BC7A 4MLAA 1N61C 1T3QC 2E3TA 5FXFA 2GQTA 2MBRA 1FO4A 3TSHA 3D2DA 2BVFA 1FFUC 3FW8A 5AE3A 3LLBA 1HSKA 3NVZB 4PVJA 5AE2A 1SB3B 3GSYA 2P4PA 5ADZA 3NVWB 3RJAA 5FXDA 1W1MA 3D2HA 5K8EA 4PVEA 3HRDC 3C0PA 2UUUA 4HG0A 5I1VA 3W8ZA 2OAIA 1JROA 1FFVC 1WYGA 2Y08A 3PQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQU A;  2VFT A;  1DII A;  1ZR6 A;  3PM9 A;  1W1O A;  2W3S A;  2R2Z A;  2AXR A;  2PLS A;  2PLI A;  1N60 C;  5AE1 A;  4PYT A;  2QKN A;  5FXP A;  3S1F A;  2NQW A;  4EC3 A;  1VDV A;  1N63 C;  3AMZ A;  1E8F A;  2VFU A;  4XLO A;  1UXY A;  3W8W A;  1MBB A;  1WVE A;  5G5G B;  4PVK A;  3FW7 A;  3ETR B;  2VFS A;  2EXR A;  3D2J A;  2P3H A;  4ML8 A;  1N62 C;  2VAO A;  3TX1 A;  3NRZ B;  5HQX A;  3SR6 B;  2I0K A;  2W54 A;  4O95 A;  5D79 A;  4BCA A;  2R8D A;  1DZN A;  3AM9 A;  1ZXI C;  5G5H B;  2Q85 A;  3KJM A;  1WVF A;  1JRP A;  3S1C A;  1E0Y A;  4BBY A;  1N5W C;  1AHV A;  2O3G A;  2VFV A;  4DNS A;  2YVS A;  4PWC A;  5HHZ A;  3TSJ A;  4JB1 A;  4JAY A;  5HMR A;  1W1K A;  3LAE A;  1AHU A;  2P13 A;  2W3R A;  4OAL A;  3S1D A;  1I19 A;  4PVH A;  1V97 A;  3DED A;  2VFR A;  3EUB 3;  1W1Q A;  1DIQ A;  4BC9 A;  1E8H A;  2RK5 A;  4PZF A;  5FXE A;  3FWA A;  2Q4W A;  3NVY B;  1MBT A;  1N5X A;  1W1L A;  3I99 A;  3NS1 B;  1W1J A;  1E8G A;  1VAO A;  2W55 A;  3JS8 A;  3B9J B;  3AN1 A;  3DQ0 A;  1W1S A;  4ZOH B;  1QLT A;  1QLU A;  3VTE A;  4UD8 A;  1F0X A;  2QPM A;  3BW7 A;  2BVG A;  3FW9 A;  1AHZ A;  4PWB A;  1FIQ B;  2BVH A;  1RM6 B;  3NVV B;  3W8X A;  1W1R A;  3S1E A;  4BC7 A;  4MLA A;  1N61 C;  1T3Q C;  2E3T A;  5FXF A;  2GQT A;  2MBR A;  1FO4 A;  3TSH A;  3D2D A;  2BVF A;  1FFU C;  3FW8 A;  5AE3 A;  3LLB A;  1HSK A;  3NVZ B;  4PVJ A;  5AE2 A;  1SB3 B;  3GSY A;  2P4P A;  5ADZ A;  3NVW B;  5FXD A;  1W1M A;  3D2H A;  4PVE A;  3HRD C;  3C0P A;  4HG0 A;  3W8Z A;  2OAI A;  1JRO A;  1FFV C;  1WYG A; 
#chains in the Genus database with same CATH topology
 5I1W A;  2GQU A;  2VFT A;  1DII A;  1ZR6 A;  3PM9 A;  1W1O A;  2W3S A;  2R2Z A;  2AXR A;  2PLS A;  2PLI A;  1N60 C;  5AE1 A;  4PYT A;  2QKN A;  5FXP A;  5AWV A;  3S1F A;  2NQW A;  3EJE B;  4EC3 A;  1VDV A;  1N63 C;  3AMZ A;  1E8F A;  2VFU A;  4XLO A;  1UXY A;  3W8W A;  1MBB A;  1WVE A;  5G5G B;  4PVK A;  5L6F A;  3FW7 A;  3ETR B;  2VFS A;  2EXR A;  3D2J A;  2P3H A;  4ML8 A;  2Y3S A;  1N62 C;  2VAO A;  3TX1 A;  3NRZ B;  5HQX A;  3SR6 B;  2I0K A;  2W54 A;  4O95 A;  5D79 A;  4BCA A;  2R8D A;  5L6G A;  3HSU A;  1DZN A;  3AM9 A;  3POP A;  1ZXI C;  5G5H B;  2UUV A;  2Q85 A;  3KJM A;  2Y4G A;  1WVF A;  1JRP A;  3S1C A;  1E0Y A;  4BBY A;  1N5W C;  1AHV A;  2O3G A;  2VFV A;  4DNS A;  2YVS A;  4PWC A;  5HHZ A;  2Y3R A;  3TSJ A;  4JB1 A;  4JAY A;  5HMR A;  1W1K A;  3EJD B;  3LAE A;  1AHU A;  2P13 A;  3EJB B;  2W3R A;  4OAL A;  3S1D A;  1I19 A;  4PVH A;  1V97 A;  3DED A;  2VFR A;  3EUB 3;  1W1Q A;  1DIQ A;  4BC9 A;  1E8H A;  2RK5 A;  4PZF A;  5FXE A;  3FWA A;  2Q4W A;  3NVY B;  1MBT A;  2IPI A;  2WDW A;  1N5X A;  1W1L A;  3I99 A;  3NS1 B;  1W1J A;  1E8G A;  1VAO A;  2W55 A;  3JS8 A;  3B9J B;  3RJ8 A;  3AN1 A;  3DQ0 A;  1W1S A;  4ZOH B;  1QLT A;  1QLU A;  3VTE A;  4UD8 A;  1F0X A;  2QPM A;  3BW7 A;  2BVG A;  1AHZ A;  3FW9 A;  3NVV B;  1FIQ B;  2BVH A;  4PWB A;  1RM6 B;  3W8X A;  1W1R A;  3S1E A;  4BC7 A;  4MLA A;  1N61 C;  1T3Q C;  2E3T A;  5FXF A;  2GQT A;  2MBR A;  1FO4 A;  3TSH A;  3D2D A;  2BVF A;  1FFU C;  3FW8 A;  5AE3 A;  3LLB A;  1HSK A;  3NVZ B;  4PVJ A;  5AE2 A;  1SB3 B;  3GSY A;  2P4P A;  5ADZ A;  3NVW B;  3RJA A;  5FXD A;  1W1M A;  3D2H A;  5K8E A;  4PVE A;  3HRD C;  3C0P A;  2UUU A;  4HG0 A;  5I1V A;  3W8Z A;  2OAI A;  1JRO A;  1FFV C;  1WYG A;  2Y08 A;  3PQB A; 
#chains in the Genus database with same CATH homology
 5I1W A;  2GQU A;  2VFT A;  1DII A;  1ZR6 A;  3PM9 A;  1W1O A;  2W3S A;  2R2Z A;  2AXR A;  2PLS A;  2PLI A;  1N60 C;  5AE1 A;  4PYT A;  2QKN A;  5FXP A;  5AWV A;  3S1F A;  2NQW A;  4EC3 A;  1VDV A;  1N63 C;  3AMZ A;  1E8F A;  2VFU A;  4XLO A;  1UXY A;  3W8W A;  1MBB A;  1WVE A;  5G5G B;  4PVK A;  5L6F A;  3FW7 A;  3ETR B;  2VFS A;  2EXR A;  3D2J A;  2P3H A;  4ML8 A;  2Y3S A;  1N62 C;  2VAO A;  3TX1 A;  3NRZ B;  5HQX A;  3SR6 B;  2I0K A;  2W54 A;  4O95 A;  5D79 A;  4BCA A;  2R8D A;  5L6G A;  3HSU A;  1DZN A;  3AM9 A;  3POP A;  1ZXI C;  5G5H B;  2UUV A;  2Q85 A;  3KJM A;  2Y4G A;  1WVF A;  1JRP A;  3S1C A;  1E0Y A;  4BBY A;  1N5W C;  1AHV A;  2O3G A;  2VFV A;  4DNS A;  2YVS A;  4PWC A;  5HHZ A;  2Y3R A;  3TSJ A;  4JB1 A;  4JAY A;  5HMR A;  1W1K A;  3LAE A;  1AHU A;  2P13 A;  2W3R A;  4OAL A;  3S1D A;  1I19 A;  4PVH A;  1V97 A;  3DED A;  2VFR A;  3EUB 3;  1W1Q A;  1DIQ A;  4BC9 A;  1E8H A;  2RK5 A;  4PZF A;  5FXE A;  3FWA A;  2Q4W A;  3NVY B;  1MBT A;  2IPI A;  2WDW A;  1N5X A;  1W1L A;  3I99 A;  3NS1 B;  1W1J A;  1E8G A;  1VAO A;  2W55 A;  3JS8 A;  3B9J B;  3RJ8 A;  3AN1 A;  3DQ0 A;  1W1S A;  4ZOH B;  1QLT A;  1QLU A;  3VTE A;  4UD8 A;  1F0X A;  2QPM A;  3BW7 A;  2BVG A;  3FW9 A;  1AHZ A;  4PWB A;  1FIQ B;  2BVH A;  1RM6 B;  3NVV B;  3W8X A;  1W1R A;  3S1E A;  4BC7 A;  4MLA A;  1N61 C;  1T3Q C;  2E3T A;  5FXF A;  2GQT A;  2MBR A;  1FO4 A;  3TSH A;  3D2D A;  2BVF A;  1FFU C;  3FW8 A;  5AE3 A;  3LLB A;  1HSK A;  3NVZ B;  4PVJ A;  5AE2 A;  1SB3 B;  3GSY A;  2P4P A;  5ADZ A;  3NVW B;  3RJA A;  5FXD A;  1W1M A;  3D2H A;  5K8E A;  4PVE A;  3HRD C;  3C0P A;  2UUU A;  4HG0 A;  5I1V A;  3W8Z A;  2OAI A;  1JRO A;  1FFV C;  1WYG A;  2Y08 A;  3PQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...