1HSKA

Crystal structure of s. aureus murb
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
303
structure length
303
Chain Sequence
NKDIYQALQQLIPNEKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIEVSDDAIIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYRNSIIQKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRIIGEHPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUCTASE
publication title A structural variation for MurB: X-ray crystal structure of Staphylococcus aureus UDP-N-acetylenolpyruvylglucosamine reductase (MurB).
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 98
structure length 303
sequence length 303
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 2000-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1hskA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1hskA01
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 1hskA03
3NVVB 2QPMA 1V97A 1W1JA 4XLOA 5AE2A 3S1DA 3VTEA 5AE1A 4PVKA 5HMRA 4PZFA 2P13A 2YVSA 1AHVA 3DEDA 4BBYA 2R2ZA 1FIQB 1W1MA 3PM9A 3SR6B 1AHZA 1QLTA 2W3RA 1T3QC 3C0PA 1QLUA 4JAYA 4O95A 2MBRA 3JS8A 2Q85A 1MBBA 3HRDC 4JB1A 1I19A 5G5GB 2OAIA 2VFSA 2W54A 2AXRA 1W1QA 4MLAA 2I0KA 3W8XA 5FXFA 3I99A 2GQUA 2BVFA 4PVJA 4PWBA 3NVWB 3AM9A 2PLIA 3S1CA 3EUB3 1VAOA 1ZR6A 5D79A 3B9JB 5HQXA 3D2JA 4HG0A 5HHZA 1VDVA 2W55A 1AHUA 4PVHA 3FW8A 3ETRB 4PYTA 3KJMA 5AE3A 1RM6B 3FW9A 1FO4A 1FFVC 3LLBA 5FXDA 1N5XA 1JRPA 3TX1A 3W8WA 2P4PA 3S1EA 1E8GA 3LAEA 3TSJA 1HSKA 4EC3A 1DIQA 2Q4WA 1N63C 1FFUC 2VFVA 3AMZA 5ADZA 1UXYA 3TSHA 2VFRA 2W3SA 1ZXIC 2PLSA 2E3TA 4PWCA 3DQ0A 4ZOHB 1WVEA 2VAOA 5FXEA 3NVYB 4BCAA 4BC9A 1N61C 4ML8A 2GQTA 3GSYA 4UD8A 4OALA 1W1SA 1JROA 1W1RA 1F0XA 3NVZB 1E8FA 1N60C 1E8HA 4PVEA 2VFTA 3BW7A 1WYGA 3AN1A 3NRZB 3D2DA 3D2HA 2NQWA 3W8ZA 1W1LA 2RK5A 1DIIA 2BVGA 2BVHA 2R8DA 5G5HB 1WVFA 3FW7A 2P3HA 2O3GA 1N5WC 2QKNA 1DZNA 1W1OA 1N62C 1W1KA 3FWAA 5FXPA 3S1FA 4BC7A 1MBTA 1SB3B 2EXRA 3NS1B 2VFUA 4DNSA 1E0YA
chains in the Genus database with same CATH superfamily
3NVVB 2QPMA 1V97A 1W1JA 2Y3SA 4XLOA 5AE2A 3S1DA 3PQBA 3VTEA 5AE1A 4PVKA 5HMRA 4PZFA 2P13A 2YVSA 1AHVA 3DEDA 4BBYA 2R2ZA 1FIQB 1W1MA 3PM9A 3EJBB 3SR6B 1AHZA 1QLTA 2W3RA 1T3QC 3C0PA 1QLUA 4JAYA 4O95A 2MBRA 3JS8A 2Q85A 1MBBA 3HRDC 4JB1A 1I19A 5G5GB 2OAIA 2Y08A 2VFSA 2W54A 2AXRA 1W1QA 4MLAA 2I0KA 3W8XA 5FXFA 3I99A 3POPA 2GQUA 2BVFA 4PVJA 4PWBA 3HSUA 3NVWB 3AM9A 2PLIA 3S1CA 3EUB3 1VAOA 1ZR6A 5I1WA 5D79A 3B9JB 5HQXA 3D2JA 4HG0A 5HHZA 1VDVA 2W55A 1AHUA 4PVHA 3FW8A 3ETRB 4PYTA 3KJMA 5AE3A 1RM6B 3FW9A 1FO4A 1FFVC 3LLBA 5I1VA 5FXDA 1N5XA 1JRPA 3TX1A 3W8WA 2P4PA 3S1EA 1E8GA 3LAEA 3TSJA 5L6FA 2WDWA 1HSKA 4EC3A 2UUVA 1DIQA 2Q4WA 1N63C 1FFUC 2VFVA 3AMZA 5ADZA 1UXYA 3TSHA 3EJEB 5AWVA 3RJAA 2VFRA 2W3SA 1ZXIC 2PLSA 2E3TA 4PWCA 3DQ0A 4ZOHB 1WVEA 2VAOA 5FXEA 2Y4GA 3NVYB 4BCAA 4BC9A 1N61C 4ML8A 2GQTA 3GSYA 4UD8A 4OALA 1W1SA 1JROA 1W1RA 1F0XA 3NVZB 1E8FA 1N60C 1E8HA 4PVEA 2VFTA 3BW7A 1WYGA 3AN1A 3NRZB 2Y3RA 3D2DA 3D2HA 2NQWA 3W8ZA 1W1LA 2RK5A 1DIIA 2BVGA 2BVHA 2R8DA 5G5HB 3EJDB 1WVFA 3FW7A 2P3HA 2O3GA 1N5WC 2QKNA 1DZNA 1W1OA 2UUUA 1N62C 1W1KA 2IPIA 3FWAA 5FXPA 5L6GA 3S1FA 3RJ8A 4BC7A 1MBTA 5K8EA 1SB3B 2EXRA 3NS1B 2VFUA 4DNSA 1E0YA
chains in the Genus database with same CATH topology
3NVVB 2QPMA 1V97A 1W1JA 2Y3SA 4XLOA 5AE2A 3S1DA 3PQBA 3VTEA 5AE1A 4PVKA 5HMRA 4PZFA 2P13A 2YVSA 1AHVA 3DEDA 4BBYA 2R2ZA 1FIQB 1W1MA 3PM9A 3SR6B 1AHZA 1QLTA 2W3RA 1T3QC 3C0PA 1QLUA 4JAYA 4O95A 2MBRA 3JS8A 2Q85A 1MBBA 3HRDC 4JB1A 1I19A 5G5GB 2OAIA 2Y08A 2VFSA 2W54A 2AXRA 1W1QA 4MLAA 2I0KA 3W8XA 5FXFA 3I99A 3POPA 2GQUA 2BVFA 4PVJA 4PWBA 3HSUA 3NVWB 3AM9A 2PLIA 3S1CA 3EUB3 1VAOA 1ZR6A 5I1WA 5D79A 3B9JB 5HQXA 3D2JA 4HG0A 5HHZA 1VDVA 2W55A 1AHUA 4PVHA 3FW8A 3ETRB 4PYTA 3KJMA 5AE3A 1RM6B 3FW9A 1FO4A 1FFVC 3LLBA 5I1VA 5FXDA 1N5XA 1JRPA 3TX1A 3W8WA 2P4PA 3S1EA 1E8GA 3LAEA 3TSJA 5L6FA 2WDWA 1HSKA 4EC3A 2UUVA 1DIQA 2Q4WA 1N63C 1FFUC 2VFVA 3AMZA 5ADZA 1UXYA 3TSHA 5AWVA 3RJAA 2VFRA 2W3SA 1ZXIC 2PLSA 2E3TA 4PWCA 3DQ0A 4ZOHB 1WVEA 2VAOA 5FXEA 2Y4GA 3NVYB 4BCAA 4BC9A 1N61C 4ML8A 2GQTA 3GSYA 4UD8A 4OALA 1W1SA 1JROA 1W1RA 1F0XA 3NVZB 1E8FA 1N60C 1E8HA 4PVEA 2VFTA 3BW7A 1WYGA 3AN1A 3NRZB 2Y3RA 3D2DA 3D2HA 2NQWA 3W8ZA 1W1LA 2RK5A 1DIIA 2BVGA 2BVHA 2R8DA 5G5HB 1WVFA 3FW7A 2P3HA 2O3GA 1N5WC 2QKNA 1DZNA 1W1OA 2UUUA 1N62C 1W1KA 2IPIA 3FWAA 5FXPA 5L6GA 3S1FA 3RJ8A 4BC7A 1MBTA 5K8EA 1SB3B 2EXRA 3NS1B 2VFUA 4DNSA 1E0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVV B;  2QPM A;  1V97 A;  1W1J A;  4XLO A;  5AE2 A;  3S1D A;  3VTE A;  5AE1 A;  4PVK A;  5HMR A;  4PZF A;  2P13 A;  2YVS A;  1AHV A;  3DED A;  4BBY A;  2R2Z A;  1FIQ B;  1W1M A;  3PM9 A;  3SR6 B;  1AHZ A;  1QLT A;  2W3R A;  1T3Q C;  3C0P A;  1QLU A;  4JAY A;  4O95 A;  2MBR A;  3JS8 A;  2Q85 A;  1MBB A;  3HRD C;  4JB1 A;  1I19 A;  5G5G B;  2OAI A;  2VFS A;  2W54 A;  2AXR A;  1W1Q A;  4MLA A;  2I0K A;  3W8X A;  5FXF A;  3I99 A;  2GQU A;  2BVF A;  4PVJ A;  4PWB A;  3NVW B;  3AM9 A;  2PLI A;  3S1C A;  3EUB 3;  1VAO A;  1ZR6 A;  5D79 A;  3B9J B;  5HQX A;  3D2J A;  4HG0 A;  5HHZ A;  1VDV A;  2W55 A;  1AHU A;  4PVH A;  3FW8 A;  3ETR B;  4PYT A;  3KJM A;  5AE3 A;  1RM6 B;  3FW9 A;  1FO4 A;  1FFV C;  3LLB A;  5FXD A;  1N5X A;  1JRP A;  3TX1 A;  3W8W A;  2P4P A;  3S1E A;  1E8G A;  3LAE A;  3TSJ A;  1HSK A;  4EC3 A;  1DIQ A;  2Q4W A;  1N63 C;  1FFU C;  2VFV A;  3AMZ A;  5ADZ A;  1UXY A;  3TSH A;  2VFR A;  2W3S A;  1ZXI C;  2PLS A;  2E3T A;  4PWC A;  3DQ0 A;  4ZOH B;  1WVE A;  2VAO A;  5FXE A;  3NVY B;  4BCA A;  4BC9 A;  1N61 C;  4ML8 A;  2GQT A;  3GSY A;  4UD8 A;  4OAL A;  1W1S A;  1JRO A;  1W1R A;  1F0X A;  3NVZ B;  1E8F A;  1N60 C;  1E8H A;  4PVE A;  2VFT A;  3BW7 A;  1WYG A;  3AN1 A;  3NRZ B;  3D2D A;  3D2H A;  2NQW A;  3W8Z A;  1W1L A;  2RK5 A;  1DII A;  2BVG A;  2BVH A;  2R8D A;  5G5H B;  1WVF A;  3FW7 A;  2P3H A;  2O3G A;  1N5W C;  2QKN A;  1DZN A;  1W1O A;  1N62 C;  1W1K A;  3FWA A;  5FXP A;  3S1F A;  4BC7 A;  1MBT A;  1SB3 B;  2EXR A;  3NS1 B;  2VFU A;  4DNS A;  1E0Y A; 
#chains in the Genus database with same CATH topology
 3NVV B;  2QPM A;  1V97 A;  1W1J A;  2Y3S A;  4XLO A;  5AE2 A;  3S1D A;  3PQB A;  3VTE A;  5AE1 A;  4PVK A;  5HMR A;  4PZF A;  2P13 A;  2YVS A;  1AHV A;  3DED A;  4BBY A;  2R2Z A;  1FIQ B;  1W1M A;  3PM9 A;  3EJB B;  3SR6 B;  1AHZ A;  1QLT A;  2W3R A;  1T3Q C;  3C0P A;  1QLU A;  4JAY A;  4O95 A;  2MBR A;  3JS8 A;  2Q85 A;  1MBB A;  3HRD C;  4JB1 A;  1I19 A;  5G5G B;  2OAI A;  2Y08 A;  2VFS A;  2W54 A;  2AXR A;  1W1Q A;  4MLA A;  2I0K A;  3W8X A;  5FXF A;  3I99 A;  3POP A;  2GQU A;  2BVF A;  4PVJ A;  4PWB A;  3HSU A;  3NVW B;  3AM9 A;  2PLI A;  3S1C A;  3EUB 3;  1VAO A;  1ZR6 A;  5I1W A;  5D79 A;  3B9J B;  5HQX A;  3D2J A;  4HG0 A;  5HHZ A;  1VDV A;  2W55 A;  1AHU A;  4PVH A;  3FW8 A;  3ETR B;  4PYT A;  3KJM A;  5AE3 A;  1RM6 B;  3FW9 A;  1FO4 A;  1FFV C;  3LLB A;  5I1V A;  5FXD A;  1N5X A;  1JRP A;  3TX1 A;  3W8W A;  2P4P A;  3S1E A;  1E8G A;  3LAE A;  3TSJ A;  5L6F A;  2WDW A;  1HSK A;  4EC3 A;  2UUV A;  1DIQ A;  2Q4W A;  1N63 C;  1FFU C;  2VFV A;  3AMZ A;  5ADZ A;  1UXY A;  3TSH A;  3EJE B;  5AWV A;  3RJA A;  2VFR A;  2W3S A;  1ZXI C;  2PLS A;  2E3T A;  4PWC A;  3DQ0 A;  4ZOH B;  1WVE A;  2VAO A;  5FXE A;  2Y4G A;  3NVY B;  4BCA A;  4BC9 A;  1N61 C;  4ML8 A;  2GQT A;  3GSY A;  4UD8 A;  4OAL A;  1W1S A;  1JRO A;  1W1R A;  1F0X A;  3NVZ B;  1E8F A;  1N60 C;  1E8H A;  4PVE A;  2VFT A;  3BW7 A;  1WYG A;  3AN1 A;  3NRZ B;  2Y3R A;  3D2D A;  3D2H A;  2NQW A;  3W8Z A;  1W1L A;  2RK5 A;  1DII A;  2BVG A;  2BVH A;  2R8D A;  5G5H B;  3EJD B;  1WVF A;  3FW7 A;  2P3H A;  2O3G A;  1N5W C;  2QKN A;  1DZN A;  1W1O A;  2UUU A;  1N62 C;  1W1K A;  2IPI A;  3FWA A;  5FXP A;  5L6G A;  3S1F A;  3RJ8 A;  4BC7 A;  1MBT A;  5K8E A;  1SB3 B;  2EXR A;  3NS1 B;  2VFU A;  4DNS A;  1E0Y A; 
#chains in the Genus database with same CATH homology
 3NVV B;  2QPM A;  1V97 A;  1W1J A;  2Y3S A;  4XLO A;  5AE2 A;  3S1D A;  3PQB A;  3VTE A;  5AE1 A;  4PVK A;  5HMR A;  4PZF A;  2P13 A;  2YVS A;  1AHV A;  3DED A;  4BBY A;  2R2Z A;  1FIQ B;  1W1M A;  3PM9 A;  3SR6 B;  1AHZ A;  1QLT A;  2W3R A;  1T3Q C;  3C0P A;  1QLU A;  4JAY A;  4O95 A;  2MBR A;  3JS8 A;  2Q85 A;  1MBB A;  3HRD C;  4JB1 A;  1I19 A;  5G5G B;  2OAI A;  2Y08 A;  2VFS A;  2W54 A;  2AXR A;  1W1Q A;  4MLA A;  2I0K A;  3W8X A;  5FXF A;  3I99 A;  3POP A;  2GQU A;  2BVF A;  4PVJ A;  4PWB A;  3HSU A;  3NVW B;  3AM9 A;  2PLI A;  3S1C A;  3EUB 3;  1VAO A;  1ZR6 A;  5I1W A;  5D79 A;  3B9J B;  5HQX A;  3D2J A;  4HG0 A;  5HHZ A;  1VDV A;  2W55 A;  1AHU A;  4PVH A;  3FW8 A;  3ETR B;  4PYT A;  3KJM A;  5AE3 A;  1RM6 B;  3FW9 A;  1FO4 A;  1FFV C;  3LLB A;  5I1V A;  5FXD A;  1N5X A;  1JRP A;  3TX1 A;  3W8W A;  2P4P A;  3S1E A;  1E8G A;  3LAE A;  3TSJ A;  5L6F A;  2WDW A;  1HSK A;  4EC3 A;  2UUV A;  1DIQ A;  2Q4W A;  1N63 C;  1FFU C;  2VFV A;  3AMZ A;  5ADZ A;  1UXY A;  3TSH A;  5AWV A;  3RJA A;  2VFR A;  2W3S A;  1ZXI C;  2PLS A;  2E3T A;  4PWC A;  3DQ0 A;  4ZOH B;  1WVE A;  2VAO A;  5FXE A;  2Y4G A;  3NVY B;  4BCA A;  4BC9 A;  1N61 C;  4ML8 A;  2GQT A;  3GSY A;  4UD8 A;  4OAL A;  1W1S A;  1JRO A;  1W1R A;  1F0X A;  3NVZ B;  1E8F A;  1N60 C;  1E8H A;  4PVE A;  2VFT A;  3BW7 A;  1WYG A;  3AN1 A;  3NRZ B;  2Y3R A;  3D2D A;  3D2H A;  2NQW A;  3W8Z A;  1W1L A;  2RK5 A;  1DII A;  2BVG A;  2BVH A;  2R8D A;  5G5H B;  1WVF A;  3FW7 A;  2P3H A;  2O3G A;  1N5W C;  2QKN A;  1DZN A;  1W1O A;  2UUU A;  1N62 C;  1W1K A;  2IPI A;  3FWA A;  5FXP A;  5L6G A;  3S1F A;  3RJ8 A;  4BC7 A;  1MBT A;  5K8E A;  1SB3 B;  2EXR A;  3NS1 B;  2VFU A;  4DNS A;  1E0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...