1HSKA

Crystal structure of s. aureus murb
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
303
structure length
303
Chain Sequence
NKDIYQALQQLIPNEKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIEVSDDAIIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYRNSIIQKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRIIGEHPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUCTASE
publication title A structural variation for MurB: X-ray crystal structure of Staphylococcus aureus UDP-N-acetylenolpyruvylglucosamine reductase (MurB).
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 98
structure length 303
sequence length 303
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 2000-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1hskA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1hskA01
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 1hskA03
3W8WA 2GQUA 2BVHA 2R8DA 3C0PA 5G5HB 3S1EA 3FW8A 1E0YA 1WVFA 4OALA 2P4PA 1FFVC 1W1RA 1VAOA 1V97A 3FW9A 4PVJA 3TSHA 1FO4A 3AMZA 2PLSA 5HHZA 3DEDA 5G5GB 4BC9A 1W1MA 4ML8A 3NVYB 1N5WC 1W1SA 2VAOA 4EC3A 3GSYA 1WVEA 3NVVB 2W55A 1MBTA 3B9JB 3PM9A 4PYTA 3LAEA 5HMRA 1E8HA 1DZNA 1AHZA 2P3HA 4PWBA 1N61C 3TSJA 4HG0A 3LLBA 3DQ0A 4DNSA 3BW7A 3NVWB 3I99A 1HSKA 4PZFA 3EUB3 4JB1A 4ZOHB 3TX1A 4BC7A 2VFRA 5FXDA 2AXRA 1W1JA 2MBRA 3S1CA 2RK5A 2Q85A 2VFVA 3AM9A 1N60C 4O95A 1W1KA 3S1FA 3AN1A 3W8ZA 4PVEA 1RM6B 2VFUA 2P13A 1MBBA 5AE1A 1W1QA 1UXYA 5FXPA 1JROA 3S1DA 2BVFA 3FWAA 3NVZB 5AE3A 2GQTA 3NRZB 2E3TA 4JAYA 3W8XA 2R2ZA 1ZR6A 2W54A 1F0XA 1FFUC 2W3SA 2Q4WA 3JS8A 3SR6B 5FXEA 1N63C 2EXRA 2VFTA 1ZXIC 2VFSA 3NS1B 2O3GA 2W3RA 3ETRB 1I19A 5AE2A 2YVSA 1W1OA 1DIIA 4MLAA 5D79A 4PVKA 1E8GA 1N5XA 1N62C 4BCAA 1WYGA 5FXFA 2BVGA 4PWCA 3VTEA 1QLTA 3KJMA 3D2HA 2NQWA 2QPMA 2I0KA 1E8FA 4UD8A 4XLOA 1QLUA 4BBYA 1AHUA 4PVHA 5HQXA 1SB3B 3D2JA 3FW7A 1DIQA 1AHVA 2OAIA 2PLIA 1VDVA 3HRDC 1T3QC 1W1LA 1FIQB 1JRPA 5ADZA 3D2DA 2QKNA
chains in the Genus database with same CATH superfamily
3W8WA 2GQUA 2BVHA 2R8DA 3C0PA 5G5HB 3S1EA 2Y4GA 3FW8A 1E0YA 1WVFA 4OALA 2P4PA 1FFVC 1W1RA 1VAOA 1V97A 3FW9A 4PVJA 5I1VA 3TSHA 1FO4A 3AMZA 2PLSA 5HHZA 3DEDA 5G5GB 4BC9A 1W1MA 2UUUA 4ML8A 3NVYB 1N5WC 1W1SA 5AWVA 2VAOA 4EC3A 5K8EA 3GSYA 1WVEA 3NVVB 2W55A 1MBTA 2Y3SA 3B9JB 3PM9A 4PYTA 3LAEA 5HMRA 1E8HA 1DZNA 1AHZA 2P3HA 4PWBA 1N61C 3TSJA 4HG0A 3LLBA 3DQ0A 4DNSA 3BW7A 3NVWB 3I99A 1HSKA 4PZFA 3HSUA 3EUB3 4JB1A 2WDWA 4ZOHB 3TX1A 4BC7A 5L6FA 2VFRA 5FXDA 2AXRA 1W1JA 2MBRA 3S1CA 2RK5A 2Q85A 2VFVA 3AM9A 1N60C 4O95A 5L6GA 3EJEB 1W1KA 5I1WA 3S1FA 3AN1A 3W8ZA 4PVEA 1RM6B 2VFUA 2P13A 1MBBA 5AE1A 3RJAA 1W1QA 1UXYA 5FXPA 1JROA 3S1DA 2BVFA 3FWAA 3NVZB 5AE3A 2GQTA 3NRZB 2E3TA 4JAYA 3W8XA 2R2ZA 1ZR6A 2W54A 1F0XA 1FFUC 2W3SA 2IPIA 2Q4WA 3JS8A 3SR6B 5FXEA 1N63C 2EXRA 2VFTA 3EJBB 1ZXIC 2VFSA 3NS1B 2O3GA 2W3RA 3ETRB 1I19A 5AE2A 2YVSA 1W1OA 1DIIA 4MLAA 5D79A 4PVKA 1E8GA 1N5XA 2Y08A 3POPA 1N62C 4BCAA 1WYGA 5FXFA 2BVGA 4PWCA 3VTEA 2Y3RA 1QLTA 3KJMA 3D2HA 2NQWA 2QPMA 2I0KA 1E8FA 3EJDB 4UD8A 4XLOA 1QLUA 4BBYA 1AHUA 4PVHA 5HQXA 1SB3B 3D2JA 3FW7A 3PQBA 1DIQA 1AHVA 2OAIA 2PLIA 1VDVA 2UUVA 3RJ8A 3HRDC 1T3QC 1W1LA 1FIQB 1JRPA 5ADZA 3D2DA 2QKNA
chains in the Genus database with same CATH topology
3W8WA 2GQUA 2BVHA 2R8DA 3C0PA 5G5HB 3S1EA 2Y4GA 3FW8A 1E0YA 1WVFA 4OALA 2P4PA 1FFVC 1W1RA 1VAOA 1V97A 3FW9A 4PVJA 5I1VA 3TSHA 1FO4A 3AMZA 2PLSA 5HHZA 3DEDA 5G5GB 4BC9A 1W1MA 2UUUA 4ML8A 3NVYB 1N5WC 1W1SA 5AWVA 2VAOA 4EC3A 5K8EA 3GSYA 1WVEA 3NVVB 2W55A 1MBTA 2Y3SA 3B9JB 3PM9A 4PYTA 3LAEA 5HMRA 1E8HA 1DZNA 1AHZA 2P3HA 4PWBA 1N61C 3TSJA 4HG0A 3LLBA 3DQ0A 4DNSA 3BW7A 3NVWB 3I99A 1HSKA 4PZFA 3HSUA 3EUB3 4JB1A 2WDWA 4ZOHB 3TX1A 4BC7A 5L6FA 2VFRA 5FXDA 2AXRA 1W1JA 2MBRA 3S1CA 2RK5A 2Q85A 2VFVA 3AM9A 1N60C 4O95A 5L6GA 1W1KA 5I1WA 3S1FA 3AN1A 3W8ZA 4PVEA 1RM6B 2VFUA 2P13A 1MBBA 5AE1A 3RJAA 1W1QA 1UXYA 5FXPA 1JROA 3S1DA 2BVFA 3FWAA 3NVZB 5AE3A 2GQTA 3NRZB 2E3TA 4JAYA 3W8XA 2R2ZA 1ZR6A 2W54A 1F0XA 1FFUC 2W3SA 2IPIA 2Q4WA 3JS8A 3SR6B 5FXEA 1N63C 2EXRA 2VFTA 1ZXIC 2VFSA 3NS1B 2O3GA 2W3RA 3ETRB 1I19A 5AE2A 2YVSA 1W1OA 1DIIA 4MLAA 5D79A 4PVKA 1E8GA 1N5XA 2Y08A 3POPA 1N62C 4BCAA 1WYGA 5FXFA 2BVGA 4PWCA 3VTEA 2Y3RA 1QLTA 3KJMA 3D2HA 2NQWA 2QPMA 2I0KA 1E8FA 4UD8A 4XLOA 1QLUA 4BBYA 1AHUA 4PVHA 5HQXA 1SB3B 3D2JA 3FW7A 3PQBA 1DIQA 1AHVA 2OAIA 2PLIA 1VDVA 2UUVA 3RJ8A 3HRDC 1T3QC 1W1LA 1FIQB 1JRPA 5ADZA 3D2DA 2QKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W8W A;  2GQU A;  2BVH A;  2R8D A;  3C0P A;  5G5H B;  3S1E A;  3FW8 A;  1E0Y A;  1WVF A;  4OAL A;  2P4P A;  1FFV C;  1W1R A;  1VAO A;  1V97 A;  3FW9 A;  4PVJ A;  3TSH A;  1FO4 A;  3AMZ A;  2PLS A;  5HHZ A;  3DED A;  5G5G B;  4BC9 A;  1W1M A;  4ML8 A;  3NVY B;  1N5W C;  1W1S A;  2VAO A;  4EC3 A;  3GSY A;  1WVE A;  3NVV B;  2W55 A;  1MBT A;  3B9J B;  3PM9 A;  4PYT A;  3LAE A;  5HMR A;  1E8H A;  1DZN A;  1AHZ A;  2P3H A;  4PWB A;  1N61 C;  3TSJ A;  4HG0 A;  3LLB A;  3DQ0 A;  4DNS A;  3BW7 A;  3NVW B;  3I99 A;  1HSK A;  4PZF A;  3EUB 3;  4JB1 A;  4ZOH B;  3TX1 A;  4BC7 A;  2VFR A;  5FXD A;  2AXR A;  1W1J A;  2MBR A;  3S1C A;  2RK5 A;  2Q85 A;  2VFV A;  3AM9 A;  1N60 C;  4O95 A;  1W1K A;  3S1F A;  3AN1 A;  3W8Z A;  4PVE A;  1RM6 B;  2VFU A;  2P13 A;  1MBB A;  5AE1 A;  1W1Q A;  1UXY A;  5FXP A;  1JRO A;  3S1D A;  2BVF A;  3FWA A;  3NVZ B;  5AE3 A;  2GQT A;  3NRZ B;  2E3T A;  4JAY A;  3W8X A;  2R2Z A;  1ZR6 A;  2W54 A;  1F0X A;  1FFU C;  2W3S A;  2Q4W A;  3JS8 A;  3SR6 B;  5FXE A;  1N63 C;  2EXR A;  2VFT A;  1ZXI C;  2VFS A;  3NS1 B;  2O3G A;  2W3R A;  3ETR B;  1I19 A;  5AE2 A;  2YVS A;  1W1O A;  1DII A;  4MLA A;  5D79 A;  4PVK A;  1E8G A;  1N5X A;  1N62 C;  4BCA A;  1WYG A;  5FXF A;  2BVG A;  4PWC A;  3VTE A;  1QLT A;  3KJM A;  3D2H A;  2NQW A;  2QPM A;  2I0K A;  1E8F A;  4UD8 A;  4XLO A;  1QLU A;  4BBY A;  1AHU A;  4PVH A;  5HQX A;  1SB3 B;  3D2J A;  3FW7 A;  1DIQ A;  1AHV A;  2OAI A;  2PLI A;  1VDV A;  3HRD C;  1T3Q C;  1W1L A;  1FIQ B;  1JRP A;  5ADZ A;  3D2D A;  2QKN A; 
#chains in the Genus database with same CATH topology
 3W8W A;  2GQU A;  2BVH A;  2R8D A;  3C0P A;  5G5H B;  3S1E A;  2Y4G A;  3FW8 A;  1E0Y A;  1WVF A;  4OAL A;  2P4P A;  1FFV C;  1W1R A;  1VAO A;  1V97 A;  3FW9 A;  4PVJ A;  5I1V A;  3TSH A;  1FO4 A;  3AMZ A;  2PLS A;  5HHZ A;  3DED A;  5G5G B;  4BC9 A;  1W1M A;  2UUU A;  4ML8 A;  3NVY B;  1N5W C;  1W1S A;  5AWV A;  2VAO A;  4EC3 A;  5K8E A;  3GSY A;  1WVE A;  3NVV B;  2W55 A;  1MBT A;  2Y3S A;  3B9J B;  3PM9 A;  4PYT A;  3LAE A;  5HMR A;  1E8H A;  1DZN A;  1AHZ A;  2P3H A;  4PWB A;  1N61 C;  3TSJ A;  4HG0 A;  3LLB A;  3DQ0 A;  4DNS A;  3BW7 A;  3NVW B;  3I99 A;  1HSK A;  4PZF A;  3HSU A;  3EUB 3;  4JB1 A;  2WDW A;  4ZOH B;  3TX1 A;  4BC7 A;  5L6F A;  2VFR A;  5FXD A;  2AXR A;  1W1J A;  2MBR A;  3S1C A;  2RK5 A;  2Q85 A;  2VFV A;  3AM9 A;  1N60 C;  4O95 A;  5L6G A;  3EJE B;  1W1K A;  5I1W A;  3S1F A;  3AN1 A;  3W8Z A;  4PVE A;  1RM6 B;  2VFU A;  2P13 A;  1MBB A;  5AE1 A;  3RJA A;  1W1Q A;  1UXY A;  5FXP A;  1JRO A;  3S1D A;  2BVF A;  3FWA A;  3NVZ B;  5AE3 A;  2GQT A;  3NRZ B;  2E3T A;  4JAY A;  3W8X A;  2R2Z A;  1ZR6 A;  2W54 A;  1F0X A;  1FFU C;  2W3S A;  2IPI A;  2Q4W A;  3JS8 A;  3SR6 B;  5FXE A;  1N63 C;  2EXR A;  2VFT A;  3EJB B;  1ZXI C;  2VFS A;  3NS1 B;  2O3G A;  2W3R A;  3ETR B;  1I19 A;  5AE2 A;  2YVS A;  1W1O A;  1DII A;  4MLA A;  5D79 A;  4PVK A;  1E8G A;  1N5X A;  2Y08 A;  3POP A;  1N62 C;  4BCA A;  1WYG A;  5FXF A;  2BVG A;  4PWC A;  3VTE A;  2Y3R A;  1QLT A;  3KJM A;  3D2H A;  2NQW A;  2QPM A;  2I0K A;  1E8F A;  3EJD B;  4UD8 A;  4XLO A;  1QLU A;  4BBY A;  1AHU A;  4PVH A;  5HQX A;  1SB3 B;  3D2J A;  3FW7 A;  3PQB A;  1DIQ A;  1AHV A;  2OAI A;  2PLI A;  1VDV A;  2UUV A;  3RJ8 A;  3HRD C;  1T3Q C;  1W1L A;  1FIQ B;  1JRP A;  5ADZ A;  3D2D A;  2QKN A; 
#chains in the Genus database with same CATH homology
 3W8W A;  2GQU A;  2BVH A;  2R8D A;  3C0P A;  5G5H B;  3S1E A;  2Y4G A;  3FW8 A;  1E0Y A;  1WVF A;  4OAL A;  2P4P A;  1FFV C;  1W1R A;  1VAO A;  1V97 A;  3FW9 A;  4PVJ A;  5I1V A;  3TSH A;  1FO4 A;  3AMZ A;  2PLS A;  5HHZ A;  3DED A;  5G5G B;  4BC9 A;  1W1M A;  2UUU A;  4ML8 A;  3NVY B;  1N5W C;  1W1S A;  5AWV A;  2VAO A;  4EC3 A;  5K8E A;  3GSY A;  1WVE A;  3NVV B;  2W55 A;  1MBT A;  2Y3S A;  3B9J B;  3PM9 A;  4PYT A;  3LAE A;  5HMR A;  1E8H A;  1DZN A;  1AHZ A;  2P3H A;  4PWB A;  1N61 C;  3TSJ A;  4HG0 A;  3LLB A;  3DQ0 A;  4DNS A;  3BW7 A;  3NVW B;  3I99 A;  1HSK A;  4PZF A;  3HSU A;  3EUB 3;  4JB1 A;  2WDW A;  4ZOH B;  3TX1 A;  4BC7 A;  5L6F A;  2VFR A;  5FXD A;  2AXR A;  1W1J A;  2MBR A;  3S1C A;  2RK5 A;  2Q85 A;  2VFV A;  3AM9 A;  1N60 C;  4O95 A;  5L6G A;  1W1K A;  5I1W A;  3S1F A;  3AN1 A;  3W8Z A;  4PVE A;  1RM6 B;  2VFU A;  2P13 A;  1MBB A;  5AE1 A;  3RJA A;  1W1Q A;  1UXY A;  5FXP A;  1JRO A;  3S1D A;  2BVF A;  3FWA A;  3NVZ B;  5AE3 A;  2GQT A;  3NRZ B;  2E3T A;  4JAY A;  3W8X A;  2R2Z A;  1ZR6 A;  2W54 A;  1F0X A;  1FFU C;  2W3S A;  2IPI A;  2Q4W A;  3JS8 A;  3SR6 B;  5FXE A;  1N63 C;  2EXR A;  2VFT A;  1ZXI C;  2VFS A;  3NS1 B;  2O3G A;  2W3R A;  3ETR B;  1I19 A;  5AE2 A;  2YVS A;  1W1O A;  1DII A;  4MLA A;  5D79 A;  4PVK A;  1E8G A;  1N5X A;  2Y08 A;  3POP A;  1N62 C;  4BCA A;  1WYG A;  5FXF A;  2BVG A;  4PWC A;  3VTE A;  2Y3R A;  1QLT A;  3KJM A;  3D2H A;  2NQW A;  2QPM A;  2I0K A;  1E8F A;  4UD8 A;  4XLO A;  1QLU A;  4BBY A;  1AHU A;  4PVH A;  5HQX A;  1SB3 B;  3D2J A;  3FW7 A;  3PQB A;  1DIQ A;  1AHV A;  2OAI A;  2PLI A;  1VDV A;  2UUV A;  3RJ8 A;  3HRD C;  1T3Q C;  1W1L A;  1FIQ B;  1JRP A;  5ADZ A;  3D2D A;  2QKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...