2R2ZA

The crystal structure of a hemolysin domain from enterococcus faecalis v583
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
84
structure length
84
Chain Sequence
NLYTQVADNEYLVQGRMLIDEFNEVFETDLHMSDVDTMAGYLITALGTIPDEGEKPSFEVGNIKLTAEEMEGTRLLVLRVHFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a hemolysin domain from Enterococcus faecalis V583.
rcsb
source organism Enterococcus faecalis
molecule tags Toxin
molecule keywords Hemolysin
total genus 15
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2007-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2r2zA00
1E8GA 2EXRA 5HQXA 4BC9A 3AM9A 2QKNA 1FFUC 1W1MA 1JROA 5G5HB 1E0YA 5FXDA 2P13A 5G5GB 1ZR6A 2E3TA 1QLTA 5AE1A 1MBTA 3BW7A 2W55A 1DIQA 2VFVA 1I19A 5FXFA 2W3RA 2RK5A 2QPMA 2BVFA 2VFTA 1N63C 2AXRA 2R2ZA 1W1JA 1N5WC 5FXEA 2P3HA 1AHZA 3LLBA 4HG0A 3W8ZA 2VFUA 2R8DA 5HHZA 2GQTA 4PYTA 1N60C 1RM6B 1W1KA 2NQWA 3S1CA 3JS8A 1N5XA 3NRZB 3EUB3 5FXPA 4BC7A 1E8HA 2PLIA 2GQUA 3NVVB 2VAOA 2VFSA 1DZNA 2BVHA 3HRDC 4ZOHB 4JAYA 3NVYB 2W3SA 5ADZA 1W1LA 3W8XA 5AE2A 3S1DA 1W1OA 1FIQB 3SR6B 2Q85A 3S1EA 2VFRA 1UXYA 1F0XA 1ZXIC 1WVEA 3DEDA 2PLSA 3DQ0A 1E8FA 1WVFA 1SB3B 1QLUA 3I99A 2YVSA 1W1SA 3PM9A 1WYGA 1FO4A 1AHUA 1V97A 1W1RA 4JB1A 4XLOA 3LAEA 5AE3A 3NVWB 1VDVA 1AHVA 2BVGA 1JRPA 4OALA 2W54A 3NVZB 2O3GA 3NS1B 2Q4WA 4BCAA 2OAIA 3S1FA 4ML8A 1N62C 5HMRA 3TX1A 1FFVC 1N61C 3AN1A 3B9JB 1DIIA 3C0PA 3KJMA 1MBBA 2P4PA 1W1QA 4O95A 3AMZA 1T3QC 3ETRB 4BBYA 1HSKA 3W8WA 4MLAA 1VAOA 2I0KA 2MBRA
chains in the Genus database with same CATH superfamily
1E8GA 2EXRA 5HQXA 4BC9A 3AM9A 2QKNA 1FFUC 1W1MA 1JROA 3FW9A 5G5HB 1E0YA 5FXDA 3GSYA 2Y4GA 2P13A 2IPIA 5G5GB 1ZR6A 2E3TA 2UUVA 1QLTA 5AE1A 1MBTA 3BW7A 2W55A 3D2DA 1DIQA 2VFVA 1I19A 5FXFA 2W3RA 2RK5A 2QPMA 2BVFA 2VFTA 4PZFA 1N63C 2AXRA 2R2ZA 1W1JA 4EC3A 3VTEA 1N5WC 5FXEA 2P3HA 1AHZA 3LLBA 4HG0A 4PWBA 3TSJA 4PVHA 3W8ZA 2VFUA 2Y08A 2R8DA 5HHZA 2GQTA 4PYTA 1N60C 1RM6B 1W1KA 2NQWA 3S1CA 2Y3SA 4PVKA 3JS8A 1N5XA 3NRZB 3EUB3 5FXPA 4BC7A 1E8HA 5L6GA 2PLIA 2GQUA 3NVVB 2VAOA 2VFSA 5D79A 4DNSA 1DZNA 2BVHA 3PQBA 3HRDC 4ZOHB 4JAYA 3NVYB 2W3SA 5ADZA 1W1LA 5AWVA 3W8XA 5AE2A 3S1DA 1W1OA 3RJ8A 1FIQB 3SR6B 2Q85A 3S1EA 2VFRA 1UXYA 1F0XA 1ZXIC 1WVEA 3DEDA 2PLSA 3DQ0A 3FW7A 1E8FA 1WVFA 1SB3B 4PWCA 1QLUA 3I99A 4UD8A 5I1VA 2YVSA 1W1SA 3D2JA 3PM9A 1WYGA 1FO4A 1AHUA 4PVEA 1V97A 1W1RA 4JB1A 4XLOA 5L6FA 3LAEA 5AE3A 3NVWB 1VDVA 3D2HA 1AHVA 2BVGA 1JRPA 3FWAA 2Y3RA 5I1WA 4OALA 2W54A 3FW8A 2UUUA 3NVZB 2O3GA 5K8EA 3NS1B 2Q4WA 4BCAA 2OAIA 3S1FA 4ML8A 1N62C 2WDWA 4PVJA 5HMRA 3TX1A 3TSHA 1FFVC 1N61C 3AN1A 3B9JB 1DIIA 3C0PA 3KJMA 3POPA 3RJAA 1MBBA 2P4PA 1W1QA 4O95A 3AMZA 1T3QC 3ETRB 4BBYA 1HSKA 3W8WA 4MLAA 1VAOA 2I0KA 3HSUA 2MBRA
chains in the Genus database with same CATH topology
1E8GA 2EXRA 5HQXA 4BC9A 3AM9A 2QKNA 1FFUC 1W1MA 1JROA 3FW9A 5G5HB 1E0YA 5FXDA 3GSYA 2Y4GA 2P13A 2IPIA 5G5GB 1ZR6A 2E3TA 2UUVA 1QLTA 5AE1A 1MBTA 3BW7A 2W55A 3D2DA 1DIQA 2VFVA 1I19A 5FXFA 2W3RA 2RK5A 2QPMA 2BVFA 2VFTA 4PZFA 1N63C 2AXRA 2R2ZA 1W1JA 4EC3A 3VTEA 1N5WC 5FXEA 2P3HA 1AHZA 3LLBA 4HG0A 4PWBA 3TSJA 4PVHA 3W8ZA 2VFUA 2Y08A 2R8DA 5HHZA 2GQTA 4PYTA 1N60C 1RM6B 1W1KA 2NQWA 3S1CA 2Y3SA 4PVKA 3JS8A 1N5XA 3NRZB 3EUB3 5FXPA 4BC7A 1E8HA 5L6GA 2PLIA 2GQUA 3NVVB 2VAOA 2VFSA 5D79A 4DNSA 1DZNA 2BVHA 3PQBA 3HRDC 4ZOHB 4JAYA 3NVYB 2W3SA 5ADZA 1W1LA 5AWVA 3W8XA 5AE2A 3S1DA 1W1OA 3RJ8A 1FIQB 3SR6B 2Q85A 3S1EA 2VFRA 1UXYA 1F0XA 1ZXIC 1WVEA 3DEDA 2PLSA 3DQ0A 3FW7A 1E8FA 1WVFA 1SB3B 4PWCA 1QLUA 3I99A 4UD8A 5I1VA 2YVSA 1W1SA 3D2JA 3PM9A 1WYGA 1FO4A 1AHUA 4PVEA 1V97A 1W1RA 4JB1A 4XLOA 5L6FA 3LAEA 5AE3A 3NVWB 1VDVA 3D2HA 1AHVA 2BVGA 1JRPA 3FWAA 2Y3RA 5I1WA 4OALA 2W54A 3FW8A 2UUUA 3NVZB 2O3GA 5K8EA 3NS1B 2Q4WA 4BCAA 2OAIA 3S1FA 4ML8A 1N62C 2WDWA 4PVJA 5HMRA 3TX1A 3TSHA 1FFVC 1N61C 3AN1A 3B9JB 1DIIA 3C0PA 3KJMA 3POPA 3RJAA 1MBBA 2P4PA 1W1QA 4O95A 3AMZA 1T3QC 3ETRB 4BBYA 1HSKA 3W8WA 4MLAA 1VAOA 2I0KA 3HSUA 2MBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E8G A;  2EXR A;  5HQX A;  4BC9 A;  3AM9 A;  2QKN A;  1FFU C;  1W1M A;  1JRO A;  5G5H B;  1E0Y A;  5FXD A;  2P13 A;  5G5G B;  1ZR6 A;  2E3T A;  1QLT A;  5AE1 A;  1MBT A;  3BW7 A;  2W55 A;  1DIQ A;  2VFV A;  1I19 A;  5FXF A;  2W3R A;  2RK5 A;  2QPM A;  2BVF A;  2VFT A;  1N63 C;  2AXR A;  2R2Z A;  1W1J A;  1N5W C;  5FXE A;  2P3H A;  1AHZ A;  3LLB A;  4HG0 A;  3W8Z A;  2VFU A;  2R8D A;  5HHZ A;  2GQT A;  4PYT A;  1N60 C;  1RM6 B;  1W1K A;  2NQW A;  3S1C A;  3JS8 A;  1N5X A;  3NRZ B;  3EUB 3;  5FXP A;  4BC7 A;  1E8H A;  2PLI A;  2GQU A;  3NVV B;  2VAO A;  2VFS A;  1DZN A;  2BVH A;  3HRD C;  4ZOH B;  4JAY A;  3NVY B;  2W3S A;  5ADZ A;  1W1L A;  3W8X A;  5AE2 A;  3S1D A;  1W1O A;  1FIQ B;  3SR6 B;  2Q85 A;  3S1E A;  2VFR A;  1UXY A;  1F0X A;  1ZXI C;  1WVE A;  3DED A;  2PLS A;  3DQ0 A;  1E8F A;  1WVF A;  1SB3 B;  1QLU A;  3I99 A;  2YVS A;  1W1S A;  3PM9 A;  1WYG A;  1FO4 A;  1AHU A;  1V97 A;  1W1R A;  4JB1 A;  4XLO A;  3LAE A;  5AE3 A;  3NVW B;  1VDV A;  1AHV A;  2BVG A;  1JRP A;  4OAL A;  2W54 A;  3NVZ B;  2O3G A;  3NS1 B;  2Q4W A;  4BCA A;  2OAI A;  3S1F A;  4ML8 A;  1N62 C;  5HMR A;  3TX1 A;  1FFV C;  1N61 C;  3AN1 A;  3B9J B;  1DII A;  3C0P A;  3KJM A;  1MBB A;  2P4P A;  1W1Q A;  4O95 A;  3AMZ A;  1T3Q C;  3ETR B;  4BBY A;  1HSK A;  3W8W A;  4MLA A;  1VAO A;  2I0K A;  2MBR A; 
#chains in the Genus database with same CATH topology
 1E8G A;  2EXR A;  5HQX A;  4BC9 A;  3AM9 A;  2QKN A;  1FFU C;  1W1M A;  1JRO A;  3FW9 A;  5G5H B;  1E0Y A;  5FXD A;  3GSY A;  2Y4G A;  2P13 A;  2IPI A;  5G5G B;  1ZR6 A;  2E3T A;  2UUV A;  1QLT A;  5AE1 A;  1MBT A;  3BW7 A;  2W55 A;  3D2D A;  1DIQ A;  2VFV A;  1I19 A;  5FXF A;  2W3R A;  2RK5 A;  2QPM A;  2BVF A;  2VFT A;  4PZF A;  1N63 C;  2AXR A;  2R2Z A;  1W1J A;  4EC3 A;  3VTE A;  1N5W C;  5FXE A;  2P3H A;  1AHZ A;  3LLB A;  4HG0 A;  4PWB A;  3TSJ A;  4PVH A;  3W8Z A;  2VFU A;  2Y08 A;  2R8D A;  5HHZ A;  2GQT A;  4PYT A;  1N60 C;  1RM6 B;  1W1K A;  2NQW A;  3S1C A;  2Y3S A;  4PVK A;  3JS8 A;  1N5X A;  3NRZ B;  3EUB 3;  5FXP A;  4BC7 A;  1E8H A;  5L6G A;  2PLI A;  2GQU A;  3NVV B;  2VAO A;  2VFS A;  5D79 A;  4DNS A;  1DZN A;  2BVH A;  3PQB A;  3HRD C;  4ZOH B;  4JAY A;  3NVY B;  2W3S A;  5ADZ A;  1W1L A;  5AWV A;  3W8X A;  5AE2 A;  3S1D A;  1W1O A;  3RJ8 A;  1FIQ B;  3SR6 B;  2Q85 A;  3S1E A;  2VFR A;  1UXY A;  1F0X A;  1ZXI C;  1WVE A;  3DED A;  2PLS A;  3DQ0 A;  3FW7 A;  1E8F A;  1WVF A;  1SB3 B;  4PWC A;  1QLU A;  3I99 A;  4UD8 A;  5I1V A;  2YVS A;  1W1S A;  3D2J A;  3PM9 A;  1WYG A;  1FO4 A;  1AHU A;  4PVE A;  1V97 A;  1W1R A;  4JB1 A;  4XLO A;  5L6F A;  3LAE A;  5AE3 A;  3NVW B;  1VDV A;  3D2H A;  1AHV A;  2BVG A;  1JRP A;  3FWA A;  2Y3R A;  5I1W A;  4OAL A;  2W54 A;  3FW8 A;  2UUU A;  3NVZ B;  2O3G A;  5K8E A;  3NS1 B;  2Q4W A;  4BCA A;  2OAI A;  3S1F A;  4ML8 A;  1N62 C;  2WDW A;  4PVJ A;  5HMR A;  3TX1 A;  3TSH A;  1FFV C;  1N61 C;  3AN1 A;  3B9J B;  1DII A;  3C0P A;  3KJM A;  3POP A;  3RJA A;  1MBB A;  2P4P A;  1W1Q A;  4O95 A;  3AMZ A;  1T3Q C;  3ETR B;  4BBY A;  1HSK A;  3W8W A;  4MLA A;  1VAO A;  2I0K A;  3HSU A;  2MBR A; 
#chains in the Genus database with same CATH homology
 1E8G A;  2EXR A;  5HQX A;  4BC9 A;  3AM9 A;  2QKN A;  1FFU C;  1W1M A;  1JRO A;  3FW9 A;  5G5H B;  1E0Y A;  5FXD A;  3GSY A;  2Y4G A;  2P13 A;  2IPI A;  5G5G B;  1ZR6 A;  2E3T A;  2UUV A;  1QLT A;  5AE1 A;  1MBT A;  3BW7 A;  2W55 A;  3D2D A;  1DIQ A;  2VFV A;  1I19 A;  5FXF A;  2W3R A;  2RK5 A;  2QPM A;  2BVF A;  2VFT A;  4PZF A;  1N63 C;  2AXR A;  2R2Z A;  1W1J A;  4EC3 A;  3VTE A;  1N5W C;  5FXE A;  2P3H A;  1AHZ A;  3LLB A;  4HG0 A;  4PWB A;  3TSJ A;  4PVH A;  3W8Z A;  2VFU A;  2Y08 A;  2R8D A;  5HHZ A;  2GQT A;  4PYT A;  1N60 C;  1RM6 B;  1W1K A;  2NQW A;  3S1C A;  2Y3S A;  4PVK A;  3JS8 A;  1N5X A;  3NRZ B;  3EUB 3;  5FXP A;  4BC7 A;  1E8H A;  5L6G A;  2PLI A;  2GQU A;  3NVV B;  2VAO A;  2VFS A;  5D79 A;  4DNS A;  1DZN A;  2BVH A;  3PQB A;  3HRD C;  4ZOH B;  4JAY A;  3NVY B;  2W3S A;  5ADZ A;  1W1L A;  5AWV A;  3W8X A;  5AE2 A;  3S1D A;  1W1O A;  3RJ8 A;  1FIQ B;  3SR6 B;  2Q85 A;  3S1E A;  2VFR A;  1UXY A;  1F0X A;  1ZXI C;  1WVE A;  3DED A;  2PLS A;  3DQ0 A;  3FW7 A;  1E8F A;  1WVF A;  1SB3 B;  4PWC A;  1QLU A;  3I99 A;  4UD8 A;  5I1V A;  2YVS A;  1W1S A;  3D2J A;  3PM9 A;  1WYG A;  1FO4 A;  1AHU A;  4PVE A;  1V97 A;  1W1R A;  4JB1 A;  4XLO A;  5L6F A;  3LAE A;  5AE3 A;  3NVW B;  1VDV A;  3D2H A;  1AHV A;  2BVG A;  1JRP A;  3FWA A;  2Y3R A;  5I1W A;  4OAL A;  2W54 A;  3FW8 A;  2UUU A;  3NVZ B;  2O3G A;  5K8E A;  3NS1 B;  2Q4W A;  4BCA A;  2OAI A;  3S1F A;  4ML8 A;  1N62 C;  2WDW A;  4PVJ A;  5HMR A;  3TX1 A;  3TSH A;  1FFV C;  1N61 C;  3AN1 A;  3B9J B;  1DII A;  3C0P A;  3KJM A;  3POP A;  3RJA A;  1MBB A;  2P4P A;  1W1Q A;  4O95 A;  3AMZ A;  1T3Q C;  3ETR B;  4BBY A;  1HSK A;  3W8W A;  4MLA A;  1VAO A;  2I0K A;  3HSU A;  2MBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...