2R2ZA

The crystal structure of a hemolysin domain from enterococcus faecalis v583
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
84
structure length
84
Chain Sequence
NLYTQVADNEYLVQGRMLIDEFNEVFETDLHMSDVDTMAGYLITALGTIPDEGEKPSFEVGNIKLTAEEMEGTRLLVLRVHFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a hemolysin domain from Enterococcus faecalis V583.
rcsb
source organism Enterococcus faecalis
molecule tags Toxin
molecule keywords Hemolysin
total genus 15
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2007-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2r2zA00
3DQ0A 5FXEA 5G5GB 5ADZA 4XLOA 3NVWB 2I0KA 2W3RA 1ZR6A 1W1JA 1N61C 2E3TA 4ML8A 5FXDA 1VDVA 1JRPA 1W1QA 1E8HA 2BVHA 1DIIA 1WYGA 2W55A 3AM9A 1FFVC 2R8DA 3NVVB 1E8FA 3W8ZA 1W1LA 1E0YA 2GQUA 2BVGA 3B9JB 2EXRA 3BW7A 1UXYA 1ZXIC 3KJMA 1N60C 3EUB3 2QPMA 1W1OA 1I19A 2QKNA 4PYTA 1AHUA 1FO4A 3JS8A 4BC7A 5HQXA 3I99A 1N62C 2PLIA 5AE3A 4ZOHB 3ETRB 5FXPA 2P4PA 2NQWA 1AHZA 1MBBA 3HRDC 4JAYA 3S1EA 1T3QC 2OAIA 2VFVA 2VFSA 4JB1A 5HHZA 2W3SA 4HG0A 1W1SA 1N5WC 2VFRA 2AXRA 4BCAA 4MLAA 2P3HA 5AE2A 1FFUC 5G5HB 1W1KA 4O95A 1HSKA 3NVYB 2RK5A 1QLTA 3S1DA 2Q4WA 2VAOA 1V97A 2PLSA 1DIQA 1N63C 2BVFA 1WVFA 1FIQB 3SR6B 2O3GA 3LAEA 3LLBA 5FXFA 2VFTA 1JROA 3NRZB 1F0XA 2R2ZA 4OALA 1QLUA 1W1MA 3TX1A 1MBTA 3NVZB 1WVEA 3DEDA 1N5XA 2P13A 1AHVA 2MBRA 2W54A 1DZNA 4BC9A 2YVSA 1E8GA 5AE1A 4BBYA 3NS1B 3W8XA 1VAOA 2VFUA 2Q85A 3AMZA 3AN1A 1SB3B 3S1CA 3W8WA 1W1RA 2GQTA 3C0PA 1RM6B 5HMRA 3S1FA 3PM9A
chains in the Genus database with same CATH superfamily
4PVKA 3DQ0A 3FWAA 5FXEA 5G5GB 3POPA 5ADZA 4XLOA 3NVWB 2I0KA 2W3RA 1ZR6A 1W1JA 1N61C 2E3TA 4ML8A 5FXDA 1VDVA 1JRPA 1W1QA 1E8HA 2BVHA 1DIIA 1WYGA 2W55A 3AM9A 5I1VA 1FFVC 2R8DA 3NVVB 1E8FA 4PWCA 3W8ZA 1W1LA 3HSUA 1E0YA 2GQUA 2BVGA 3B9JB 2EXRA 3BW7A 1UXYA 4DNSA 3D2DA 1ZXIC 3KJMA 1N60C 3EUB3 2QPMA 1W1OA 1I19A 2QKNA 4PYTA 1AHUA 1FO4A 3JS8A 4BC7A 5HQXA 3I99A 1N62C 2PLIA 5AE3A 4ZOHB 3ETRB 5FXPA 2P4PA 2NQWA 1AHZA 1MBBA 3HRDC 4JAYA 3S1EA 1T3QC 2OAIA 3FW7A 2VFVA 2VFSA 2IPIA 4JB1A 5HHZA 2W3SA 4PVHA 4HG0A 4UD8A 1W1SA 3TSJA 5D79A 1N5WC 2VFRA 2AXRA 3VTEA 4BCAA 4MLAA 2P3HA 4EC3A 4PVEA 5K8EA 5AE2A 1FFUC 5G5HB 1W1KA 4O95A 1HSKA 3NVYB 4PWBA 3PQBA 2RK5A 1QLTA 2WDWA 2Q4WA 3D2JA 2VAOA 3FW9A 3S1DA 1V97A 2PLSA 1DIQA 1N63C 2BVFA 1WVFA 3D2HA 5AWVA 1FIQB 3SR6B 2O3GA 3LAEA 5I1WA 3LLBA 5L6FA 5FXFA 2VFTA 4PZFA 1JROA 3NRZB 1F0XA 2R2ZA 5L6GA 4OALA 1QLUA 1W1MA 3RJ8A 3TX1A 1MBTA 2Y3SA 3NVZB 1WVEA 3DEDA 1N5XA 2Y3RA 2P13A 1AHVA 2MBRA 2W54A 1DZNA 4BC9A 2YVSA 2Y08A 1E8GA 3RJAA 2Y4GA 5AE1A 4BBYA 3NS1B 3W8XA 4PVJA 1VAOA 2VFUA 2UUVA 3GSYA 2Q85A 2UUUA 3AMZA 3AN1A 1SB3B 3S1CA 3TSHA 3W8WA 1W1RA 2GQTA 3C0PA 3FW8A 1RM6B 5HMRA 3S1FA 3PM9A
chains in the Genus database with same CATH topology
4PVKA 3DQ0A 3FWAA 5FXEA 5G5GB 3POPA 5ADZA 4XLOA 3NVWB 2I0KA 2W3RA 1ZR6A 1W1JA 1N61C 2E3TA 4ML8A 5FXDA 1VDVA 1JRPA 1W1QA 1E8HA 2BVHA 1DIIA 1WYGA 2W55A 3AM9A 5I1VA 1FFVC 2R8DA 3NVVB 1E8FA 4PWCA 3W8ZA 1W1LA 3HSUA 1E0YA 2GQUA 2BVGA 3B9JB 2EXRA 3BW7A 1UXYA 4DNSA 3D2DA 1ZXIC 3KJMA 1N60C 3EUB3 2QPMA 1W1OA 1I19A 2QKNA 4PYTA 1AHUA 1FO4A 3JS8A 4BC7A 5HQXA 3I99A 1N62C 2PLIA 5AE3A 4ZOHB 3ETRB 5FXPA 2P4PA 2NQWA 1AHZA 1MBBA 3HRDC 4JAYA 3S1EA 1T3QC 2OAIA 3FW7A 2VFVA 2VFSA 2IPIA 4JB1A 5HHZA 2W3SA 4PVHA 4HG0A 4UD8A 1W1SA 3TSJA 5D79A 1N5WC 2VFRA 2AXRA 3VTEA 4BCAA 4MLAA 2P3HA 4EC3A 4PVEA 5K8EA 5AE2A 1FFUC 5G5HB 1W1KA 4O95A 1HSKA 3NVYB 4PWBA 3PQBA 2RK5A 1QLTA 2WDWA 2Q4WA 3D2JA 2VAOA 3FW9A 3S1DA 1V97A 2PLSA 1DIQA 1N63C 2BVFA 1WVFA 3D2HA 5AWVA 1FIQB 3SR6B 2O3GA 3LAEA 5I1WA 3LLBA 5L6FA 5FXFA 2VFTA 4PZFA 1JROA 3NRZB 1F0XA 2R2ZA 5L6GA 4OALA 1QLUA 1W1MA 3RJ8A 3TX1A 1MBTA 2Y3SA 3NVZB 1WVEA 3DEDA 1N5XA 2Y3RA 2P13A 1AHVA 2MBRA 2W54A 1DZNA 4BC9A 2YVSA 2Y08A 1E8GA 3RJAA 2Y4GA 5AE1A 4BBYA 3NS1B 3W8XA 4PVJA 1VAOA 2VFUA 2UUVA 3GSYA 2Q85A 2UUUA 3AMZA 3AN1A 1SB3B 3S1CA 3TSHA 3W8WA 1W1RA 2GQTA 3C0PA 3FW8A 1RM6B 5HMRA 3S1FA 3PM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQ0 A;  5FXE A;  5G5G B;  5ADZ A;  4XLO A;  3NVW B;  2I0K A;  2W3R A;  1ZR6 A;  1W1J A;  1N61 C;  2E3T A;  4ML8 A;  5FXD A;  1VDV A;  1JRP A;  1W1Q A;  1E8H A;  2BVH A;  1DII A;  1WYG A;  2W55 A;  3AM9 A;  1FFV C;  2R8D A;  3NVV B;  1E8F A;  3W8Z A;  1W1L A;  1E0Y A;  2GQU A;  2BVG A;  3B9J B;  2EXR A;  3BW7 A;  1UXY A;  1ZXI C;  3KJM A;  1N60 C;  3EUB 3;  2QPM A;  1W1O A;  1I19 A;  2QKN A;  4PYT A;  1AHU A;  1FO4 A;  3JS8 A;  4BC7 A;  5HQX A;  3I99 A;  1N62 C;  2PLI A;  5AE3 A;  4ZOH B;  3ETR B;  5FXP A;  2P4P A;  2NQW A;  1AHZ A;  1MBB A;  3HRD C;  4JAY A;  3S1E A;  1T3Q C;  2OAI A;  2VFV A;  2VFS A;  4JB1 A;  5HHZ A;  2W3S A;  4HG0 A;  1W1S A;  1N5W C;  2VFR A;  2AXR A;  4BCA A;  4MLA A;  2P3H A;  5AE2 A;  1FFU C;  5G5H B;  1W1K A;  4O95 A;  1HSK A;  3NVY B;  2RK5 A;  1QLT A;  3S1D A;  2Q4W A;  2VAO A;  1V97 A;  2PLS A;  1DIQ A;  1N63 C;  2BVF A;  1WVF A;  1FIQ B;  3SR6 B;  2O3G A;  3LAE A;  3LLB A;  5FXF A;  2VFT A;  1JRO A;  3NRZ B;  1F0X A;  2R2Z A;  4OAL A;  1QLU A;  1W1M A;  3TX1 A;  1MBT A;  3NVZ B;  1WVE A;  3DED A;  1N5X A;  2P13 A;  1AHV A;  2MBR A;  2W54 A;  1DZN A;  4BC9 A;  2YVS A;  1E8G A;  5AE1 A;  4BBY A;  3NS1 B;  3W8X A;  1VAO A;  2VFU A;  2Q85 A;  3AMZ A;  3AN1 A;  1SB3 B;  3S1C A;  3W8W A;  1W1R A;  2GQT A;  3C0P A;  1RM6 B;  5HMR A;  3S1F A;  3PM9 A; 
#chains in the Genus database with same CATH topology
 4PVK A;  3DQ0 A;  3FWA A;  5FXE A;  5G5G B;  3POP A;  5ADZ A;  4XLO A;  3NVW B;  2I0K A;  2W3R A;  1ZR6 A;  1W1J A;  1N61 C;  2E3T A;  4ML8 A;  5FXD A;  1VDV A;  1JRP A;  1W1Q A;  1E8H A;  2BVH A;  1DII A;  1WYG A;  2W55 A;  3AM9 A;  5I1V A;  1FFV C;  2R8D A;  3NVV B;  1E8F A;  4PWC A;  3W8Z A;  1W1L A;  3HSU A;  1E0Y A;  2GQU A;  2BVG A;  3B9J B;  2EXR A;  3BW7 A;  1UXY A;  4DNS A;  3D2D A;  1ZXI C;  3KJM A;  1N60 C;  3EUB 3;  2QPM A;  1W1O A;  1I19 A;  2QKN A;  4PYT A;  1AHU A;  1FO4 A;  3JS8 A;  4BC7 A;  5HQX A;  3I99 A;  1N62 C;  2PLI A;  5AE3 A;  4ZOH B;  3ETR B;  5FXP A;  2P4P A;  2NQW A;  1AHZ A;  1MBB A;  3HRD C;  4JAY A;  3S1E A;  1T3Q C;  2OAI A;  3FW7 A;  2VFV A;  2VFS A;  2IPI A;  4JB1 A;  5HHZ A;  2W3S A;  4PVH A;  4HG0 A;  4UD8 A;  1W1S A;  3TSJ A;  5D79 A;  1N5W C;  2VFR A;  2AXR A;  3VTE A;  4BCA A;  4MLA A;  2P3H A;  4EC3 A;  4PVE A;  5K8E A;  5AE2 A;  1FFU C;  5G5H B;  1W1K A;  4O95 A;  1HSK A;  3NVY B;  4PWB A;  3PQB A;  2RK5 A;  1QLT A;  2WDW A;  2Q4W A;  3D2J A;  2VAO A;  3FW9 A;  3S1D A;  1V97 A;  2PLS A;  1DIQ A;  1N63 C;  2BVF A;  1WVF A;  3D2H A;  5AWV A;  1FIQ B;  3SR6 B;  2O3G A;  3LAE A;  5I1W A;  3LLB A;  5L6F A;  5FXF A;  2VFT A;  4PZF A;  1JRO A;  3NRZ B;  1F0X A;  2R2Z A;  5L6G A;  4OAL A;  1QLU A;  1W1M A;  3RJ8 A;  3TX1 A;  1MBT A;  2Y3S A;  3NVZ B;  1WVE A;  3DED A;  1N5X A;  2Y3R A;  2P13 A;  1AHV A;  2MBR A;  2W54 A;  1DZN A;  4BC9 A;  2YVS A;  2Y08 A;  1E8G A;  3RJA A;  2Y4G A;  5AE1 A;  4BBY A;  3NS1 B;  3W8X A;  4PVJ A;  1VAO A;  2VFU A;  2UUV A;  3GSY A;  2Q85 A;  2UUU A;  3AMZ A;  3AN1 A;  1SB3 B;  3S1C A;  3TSH A;  3W8W A;  1W1R A;  2GQT A;  3C0P A;  3FW8 A;  1RM6 B;  5HMR A;  3S1F A;  3PM9 A; 
#chains in the Genus database with same CATH homology
 4PVK A;  3DQ0 A;  3FWA A;  5FXE A;  5G5G B;  3POP A;  5ADZ A;  4XLO A;  3NVW B;  2I0K A;  2W3R A;  1ZR6 A;  1W1J A;  1N61 C;  2E3T A;  4ML8 A;  5FXD A;  1VDV A;  1JRP A;  1W1Q A;  1E8H A;  2BVH A;  1DII A;  1WYG A;  2W55 A;  3AM9 A;  5I1V A;  1FFV C;  2R8D A;  3NVV B;  1E8F A;  4PWC A;  3W8Z A;  1W1L A;  3HSU A;  1E0Y A;  2GQU A;  2BVG A;  3B9J B;  2EXR A;  3BW7 A;  1UXY A;  4DNS A;  3D2D A;  1ZXI C;  3KJM A;  1N60 C;  3EUB 3;  2QPM A;  1W1O A;  1I19 A;  2QKN A;  4PYT A;  1AHU A;  1FO4 A;  3JS8 A;  4BC7 A;  5HQX A;  3I99 A;  1N62 C;  2PLI A;  5AE3 A;  4ZOH B;  3ETR B;  5FXP A;  2P4P A;  2NQW A;  1AHZ A;  1MBB A;  3HRD C;  4JAY A;  3S1E A;  1T3Q C;  2OAI A;  3FW7 A;  2VFV A;  2VFS A;  2IPI A;  4JB1 A;  5HHZ A;  2W3S A;  4PVH A;  4HG0 A;  4UD8 A;  1W1S A;  3TSJ A;  5D79 A;  1N5W C;  2VFR A;  2AXR A;  3VTE A;  4BCA A;  4MLA A;  2P3H A;  4EC3 A;  4PVE A;  5K8E A;  5AE2 A;  1FFU C;  5G5H B;  1W1K A;  4O95 A;  1HSK A;  3NVY B;  4PWB A;  3PQB A;  2RK5 A;  1QLT A;  2WDW A;  2Q4W A;  3D2J A;  2VAO A;  3FW9 A;  3S1D A;  1V97 A;  2PLS A;  1DIQ A;  1N63 C;  2BVF A;  1WVF A;  3D2H A;  5AWV A;  1FIQ B;  3SR6 B;  2O3G A;  3LAE A;  5I1W A;  3LLB A;  5L6F A;  5FXF A;  2VFT A;  4PZF A;  1JRO A;  3NRZ B;  1F0X A;  2R2Z A;  5L6G A;  4OAL A;  1QLU A;  1W1M A;  3RJ8 A;  3TX1 A;  1MBT A;  2Y3S A;  3NVZ B;  1WVE A;  3DED A;  1N5X A;  2Y3R A;  2P13 A;  1AHV A;  2MBR A;  2W54 A;  1DZN A;  4BC9 A;  2YVS A;  2Y08 A;  1E8G A;  3RJA A;  2Y4G A;  5AE1 A;  4BBY A;  3NS1 B;  3W8X A;  4PVJ A;  1VAO A;  2VFU A;  2UUV A;  3GSY A;  2Q85 A;  2UUU A;  3AMZ A;  3AN1 A;  1SB3 B;  3S1C A;  3TSH A;  3W8W A;  1W1R A;  2GQT A;  3C0P A;  3FW8 A;  1RM6 B;  5HMR A;  3S1F A;  3PM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...