2W55A

Crystal structure of xanthine dehydrogenase (e232q variant) from rhodobacter capsulatus in complex with hypoxanthine
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
molecule keywords XANTHINE DEHYDROGENASE
total genus 114
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w55A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w55A01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w55A03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w55A05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w55A04
2BS4B 1N60C 2MJEA 1VLBA 4N58A 3AB5A 1E7PB 3HVZA 2G1EA 3AEEB 4LTUA 1DIQA 2CJNA 2K9XA 1AHVA 1XO3A 5GXGB 2BS2B 1N5XA 4C7YA 3BIID 2BT6A 1ZP0B 2B76B 3KJMA 4YSYB 1W1QA 3LXFA 1NI3A 1E8HA 3NVYB 4DNSA 1ZR6A 4N6EB 4JWSC 3W8XA 3PM9A 5D79A 2VFTA 4ZOHB 4BC9A 3FWAA 4KX6B 4ZHOA 2P3HA 1YQ3B 1TKYA 3AEDB 1CJEA 4YXDB 2PVGC 3P4SB 3L4PA 2FBWB 1CZPA 3VRAB 4JWUC 1NYRA 2RK5A 2H89B 2QPMA 3A7RA 2M19A 1N62C 4ITKA 2Q85A 1J7CA 3LAEA 4BCAA 3B2FA 3NS1B 1TJEA 2EKIA 2JQRB 1JROA 1VQZA 3AM9A 1VAOA 1GAQB 1WGKA 1AHZA 4JB1A 1W1SA 2WDRB 3BW7A 1X2HA 3KWLA 4US8A 3B9JA 1GPXA 1KFYB 1L0VB 4PWCA 3NVVB 3AE7B 3CIRB 4US9A 1QLUA 4YT0B 3AE2B 2DWQA 3FW9A 3AE9B 1QLBB 1SF0A 2CJOA 3D2HA 1E10A 2OAIA 5EE0A 3C0PA 5EE1A 3A7UA 5G5GA 1OQRA 2WDQB 3FC4A 4C7ZA 2LEKA 1TKEA 1SB3C 1KRHA 3AMZA 4PVHA 4PVJA 1NENB 2H88B 3R07C 3SR6B 3CWIA 3AEFB 4JX1C 1FFVC 5MPOA 3W5VB 1QF6A 5HMRA 2BS3B 1JRPA 1QOBA 1N62A 1N5WA 4C80A 4YSZB 3PO0A 3S1EA 1N5WC 3NVWB 3LB8C 5AE2A 1JWAD 2NQWA 1OFFA 1MBTA 3ZYYX 3SFDB 3NVZB 3VTEA 1PDXA 3GSYA 4HG0A 1TKGA 4YSXB 4XLOA 1XLNA 1E0YA 1L6UA 3AH7A 1W1LA 3EUB3 3NS1A 5HQXA 2WLBA 1E8FA 1AWDA 1WXQA 1E0ZA 5G5GB 1KF6B 2K22A 1N63A 5FXDA 2VFVA 2GQTA 1YJIA 2AX5A 2E5AA 2WDVB 2ACZB 1FFUA 4JAYA 2VFSA 3ABVB 1WWTA 3AE4B 3AEBB 4IDIA 2QKNA 1W1JA 2VFUA 1NYQA 2WQYB 4ML8A 5ADZA 1DIIA 4HROA 5H92C 1FIQA 1UXYA 3LLBA 1RWSA 2WU5B 2PVOD 1XLQA 2PKOA 4BC7A 1SIJA 2EXRA 5C3JB 5AE1A 2OHFA 4ZHPA 2KMMA 3DWGC 2M56B 4A9AA 1W1MA 1L6VA 3DEDA 1RFKA 1N63C 3P4QB 3TX1A 4P6VF 4O95A 2L52A 2YVSA 1E8GA 1J7BA 3NVVA 1F0ZA 2GQUA 4PVKA 1FRDA 1WVFA 1FMAD 2WS3B 2VFRA 1FFVA 2MJDA 1N60A 4PWBA 1NVID 2BVFA 4HRSA 1FXAA 4MLAA 2QJLA 1IUEA 3P4PB 2KAJA 1VJKA 2P4PA 3AE6B 3AE3B 2MH7A 1I19A 1MBBA 5FXPA 1FO4A 4WQMA 4PYTA 4YTNB 3AE5B 1SB3B 2AXRA 4PZFA 2HTME 2N0SB 1AHUA 2I0KA 2WU2B 3D2DA 3FW7A 4N59A 3VR8B 1DZNA 1I7HA 5EE9A 4ZOHC 3ETRB 1QOAA 3ETRA 1NEKB 4PVEA 3HUIA 1RYJA 1YQ4B 4TVYA 1T3QC 3P4RB 2Q4WA 2K5PA 1FRRA 1TYGB 3W8ZA 2PLIA 1JQ4A 1WYGA 4FXCA 1ROEA 3P63A 1PUTA 3W9CB 1N61C 2QIEB 4USAA 2BVHA 2E3TA 3AN1A 3AE1B 5G5HA 4TVWA 3S1FA 1V8CA 1XLOA 1ZXIA 1A70A 1HSKA 1B9RA 5AE3A 1PFDA 1EWYC 1DGJA 1JW9D 1QLTA 3DWMA 3D2JA 4YTPB 3AEGB 5H8YE 4WWMA 2W3SA 1RM6C 2JX5A 3NVZA 1QOFA 2P13A 1JWBD 2Q5WD 1V97A 1DOXA 2PIAA 1W1RA 1FIQB 3W5UB 5FXEA 2O3GA 1W1OA 3FW8A 4OALA 5AUIA 1UWMA 5EE3A 5G5HB 1L5PA 3I99A 3NVWA 3W8WA 3AV8A 1VDVA 2Y5CA 3AECB 1X2GA 2W3RA 3TSJA 4YTMB 1N61A 3SR6A 3DQ0A 4BBYA 3HRDD 3S1DA 1DOYA 1OQQA 4EC3A 1WRIA 1F0XA 3B2GA 2W55A 1QT9A 2CU3A 3HRDC 1FFUC 2L83A 3VRBB 1WVEA 2WP9B 5FXFA 3NRZB 5HHZA 3NRZA 1E6EB 5C2TB 2MJ3A 2PLSA 1YJJA 2BVGA 1W1KA 1FXIA 3FAHA 3SFEB 1ZXIC 1JALA 2VAOA 3TSHA 1RM6B 1ZUD2 2DBYA 1ZOYB 2MBRA 1FM0D 1QOGA 3EUB2 3AEAB 3AE8B 2R2ZA 3VR9B 5AUKA 3P1MA 3NVYA 3B9JB 3JS8A 1E9MA 2W54A 1T3QA 1R7SA 3RPFC 3WCQA 1J7AA 3A7AA 3S1CA 1AYFA 1DOIA 2R8DA 1XLPA 4UD8A
chains in the Genus database with same CATH superfamily
1LVLA 2MJEA 1S7MA 3RJ8A 1VLBA 4ZDVA 2WXHA 1VRAB 1ZQKA 5JTIA 5KFNA 1HTQA 3TI0A 4I27A 2BR0A 2BQUA 3HIZA 1DIQA 4IKGA 2IHMA 3U8ZA 1AHVA 2DAFA 1ZJMA 8ICMA 1GC7A 2XH0A 2I5HA 3S6JA 8ICEA 1C20A 1D8YA 2BS2B 1GB1A 1N5XA 1XSNA 1YZ7A 3V7LA 4C7YA 2BT6A 2B76B 1S97A 3PHXB 2E1EA 1TGZB 1TAQA 2OJWA 3H7PA 4OVZA 4KZ0A 1RXVA 1J8CA 2O6VD 4EKUA 3KLJA 5D4BA 4ELTA 7ICVA 2PTWA 1E8HA 1NU5A 4PHPA 4YMNA 1JPDX 2Z59B 4DNSA 3QN3A 1ZR6A 4N6EB 2I9GA 4DSKA 4B95A 2BPFA 1JMSA 5D79A 3CB3A 3ZQ4A 3SSZA 7ENLA 2ZCCA 4ZRKA 2X99A 1KFDA 4TQ1A 4XDDA 3QE9Y 2DYMA 1V6EA 4EEWA 4Z1YA 4QZHA 1OEYA 4GYPC 3QFAA 4OW0A 9ICBA 5HR6A 8ICUA 1JWUD 4RCOA 1T0QC 4MT5A 2R9ZA 3BS7A 1SIFA 3B08A 3O65B 1HZ5A 3GD4A 2C7NB 2KMAA 2EQ8A 1VJ5A 4O3MA 3A1QA 2X8XX 3P4SB 1XQQA 4LIIA 4DFKA 4AWJA 5ALIA 4PZNA 1IYFA 4M02A 4DDID 2W9MA 2FMQA 2DENB 3C2LA 4CNQA 2G3QB 2H3QA 4KLQA 3EKGA 3A7RA 1EF1A 4GMEA 2G07A 1D8BA 1P7EA 2N9LA 3K1RB 9ICGA 4J6IA 1DXSA 4TV3A 2V3BA 2KXJA 4M6UA 5JZEB 3IDWA 5DB7A 2HHXA 3H40A 2BCQA 5IINA 4KKIA 2GR2A 3DERA 1TY0A 3EYZA 3MR3A 4W9CA 1EC7A 2CXYA 3K75D 7ICIA 4IHCA 4UATA 1B1ZA 3RUIB 1FNVA 1XCTL 1TJEA 4DS5A 3T5LA 3PR4A 4APNA 2LRWA 3DBRB 4DL3A 1JXEA 4UAUA 3KKAA 4I29A 1DK2A 4ECTA 2JY6A 5JCKA 3PZPA 3C8YA 1MDLA 4JB1A 3PW4A 5FJRA 3FVDA 2KD1A 2BTEA 1W1SA 4KITB 3RCYA 1Z1BA 2KC2A 3N28A 4DF8A 2IMWP 2NVKX 1F44A 2GBKA 3MQTA 3I1YA 5AKZA 1V59A 4UDUC 3BW7A 2KTRB 2GR0A 1E8WA 2YB1A 3Q8FA 2WF5A 4TUPA 1X2HA 5ALSA 2JEFA 4LVSA 4BJQA 2Y9TA 1SXDA 1EF5A 1SGHA 4EZLA 1L0VB 2DZKA 3MFHA 1NI2A 5E6PA 1UGMA 2EZXA 3QC8B 4MM3B 4RGTA 1KRPA 2OZTA 1XO1A 3PT2B 4P4MA 4YD2A 4US9A 3IV6A 4A3OA 1PK3A 1QLUA 2KLCA 3DJJA 2DWQA 3V3WA 2J3NA 4QWEA 5KFYA 4P0PA 3JW0X 3IHPC 5FK9C 2M9NA 2RP5A 4FZMA 1LV5A 1A0PA 3R7QA 2W0HA 4KVGB 3GP7A 2ATLA 1EM7A 3KTQA 4EZKA 3C0PA 4I2JA 2QDDA 4PGYA 2IA6A 2HBJA 2JWZA 2AQ4A 4HWIB 1PK1B 5G5GA 4C7ZA 2IPKD 2LEKA 3DVGY 4W9GA 3PY8A 1SB3C 2ASDA 4YWGG 2KZRA 4PVJA 1GRHA 3SDLC 3ZDEA 1GV4A 2WOWA 3QU5A 1NENB 1RQNA 4M6WB 2G4SA 3R07C 2VANA 4Q45A 2LRUA 3VAWA 4L1BA 4QZ9A 2H5XA 4QZGA 5JU5A 4RNNA 1X9WA 2R8KA 3HP6A 3GV5B 3CWIA 4JX1C 4DN1A 3SD5A 1V9JA 1KKXA 3EJEB 4FBTA 2GBRA 3OSPA 3OP2A 1XHCA 1V80A 5DGAA 9ICKA 4EUTA 3GV7B 4DS4A 2WXMA 1BPDA 3PO0A 5KFGA 2KQ4X 1KBUA 5AK6A 5KFCA 4DQIA 2ZIVA 4MEXA 1KH0A 4J3ZA 2NBVB 2N7DA 3CGEA 5KFMA 2BCVA 2MBQA 3PVXA 3B0AA 2X8GA 5AE2A 3LVWA 2K6DB 1ZQAA 2KTRA 4W9FA 3GO2A 4IP4A 5TR3A 4BKTA 2IPIA 3TEZA 5ALEA 1ZQMA 4DHZB 2N1VA 3GIIA 4MH8A 2OCEA 5CTRC 4EBEA 3IT6B 4MACA 4MELA 1MFWA 2KVCA 4Y2TA 9ICVA 2AEHA 1I42A 3GSYA 1W6TA 2JHDA 2PU1A 1L4DB 1TKGA 1VZ7A 1FEZA 2BC0A 4YSXB 2WWZA 3MDCA 4C4VB 2GH1A 1XLNA 2KC1A 3K9OB 1PGBA 4EFOA 2G08A 3QU2A 4RT2A 9ICJA 1DK3A 2XVTA 1R4MB 4ED7A 2D3DA 1YN3A 1C78A 2JV3A 3ETLA 3AH7A 1W1LA 1TE6A 3U4EG 3Q69A 2KMCA 4LJPB 5HHHA 3N6JA 2EAOA 5JXVA 3SEBA 1C4PA 4DL7A 3OTRA 2VIXA 2KWCA 3Q4DA 3DVNU 3GZNI 1O03A 4BWMA 4F92B 4Z6EA 3QUCA 3LJ3A 2VFVA 4J9QA 1U4AA 3OPSA 5KFQA 5KFPA 1SV4A 2ZIWB 5ALZA 2P6UA 2DL0A 2SAKA 4IRKA 3WKCA 1Q8KA 4M9LA 3DIPA 1KOTA 2DZJA 4H4RA 3B0XA 2WAQF 1XCQL 2KQ7A 2MRPA 2EANA 3PW7A 4IL6U 2MWSB 3AXCA 3ISBA 4IUMB 4S17A 4XZ4A 1NK8A 2AKMA 2VFSA 5J0SA 4GXJA 3FCPA 3HKZF 1ISNA 3AEBB 1WYWB 1XT9B 3Q14C 2GBMA 3AUOA 3RJIA 3HILA 5KFUA 2CPRA 3LDAA 1NYQA 2N9EB 2HXTA 4PHAA 4DWFA 4ECWA 4LNOA 2IO2B 1ZQVA 2ZIUA 4M6WA 3OJ3A 4M0WA 2XSXA 1JI7A 4OJ6A 3PPAA 4C4TA 3RB0A 2JYTA 5KFEA 4ML8A 5B5EU 8ICRA 3RBEA 3MBYA 2KJRA 4J1OA 4RQ6A 1YMHE 5DKWA 5T14A 1S76D 3QIJA 2AH5A 3NASA 1RWSA 1R0MA 2IGDA 1L8LA 1WXMA 1SL1A 4BC7A 3EFUA 1SIJA 3GQCA 1NK0A 1YNTE 4YCXA 4ZHPA 4J9PA 4E0DA 2M56B 1JIHA 4Z6CA 2XBBC 3T9LA 4A9AA 1ZETA 3CK5A 1L6VA 4IT1A 4EQWA 4DSEA 1BPBA 2P66A 1N63C 1I4XA 1ZD4A 2WP6A 1U4BA 3H70A 2NMQA 4F4YA 1WG8A 4FJYA 2WF7A 1NK7A 2EAPA 3RMKC 1FNWA 4JQWC 2L52A 4J03A 2OVLA 2OX4A 4B6JA 4DOAA 1E8GA 4KPLA 2ISPA 3C5GA 1EC8A 1WWUA 4PVKA 1GETA 1FMAD 3ENEA 4EE2A 4NXZA 4NAMA 1PVQA 2WXNA 2MJDA 2ASQA 2JYEA 1D5MC 2BKEA 3N6HA 4QW8A 1ZDVA 5KG6A 2HHWA 4GGHA 3WKAA 4FS1A 1I19A 5BYQA 1RVKA 2KHVA 5FJPA 4QJFB 1SXTA 4H4XA 2M1MA 4QWAA 3RNEC 4PYTA 3KFUF 2F5ZA 1YT3A 2LHTA 4QZDA 2DF4B 8ICYA 1JDFA 4ZCWA 4F8CB 1WF9A 4JL9A 1OEPA 4ED2A 1SB3B 3WK9A 3AU6A 5GRTA 4KWSA 2HTME 2EMTA 4IL2A 2I0KA 3D2DA 4J9RA 4RGNA 3PX4A 1PDYA 1P1AA 3I6TA 8ICTA 2JGAA 1BPXA 1F77A 3BY4B 4N59A 4GFIA 4H83A 4FHKA 1V1PB 3MDAA 2KNJA 5G2NA 5BMIA 3ZLGA 1I7HA 2REXA 2FPKA 2P3ZA 5JCNA 2ES6A 5HFYA 1MDRA 3V72A 1WX8A 3ZVVA 1WM2A 2QILA 3RNGC 4ZOHC 4I2DA 1AARA 5CB1A 2JXXA 4MJSA 4JWNA 2AJQA 4GN1A 1PGXA 4YP3A 3UIOB 1UD7A 5HKHA 2ZIUB 2INCC 3R66C 3E58A 2BYTA 2LI6A 1TV9A 3HK0A 3BQTA 8ICFA 5BO4B 1F8WA 4HLEA 5J0TA 1YQZA 1YQ4B 1ZJNA 1T3QC 1X42A 3P4RB 3DFHA 5L6GA 3CMMB 5L1JA 4IM0A 2KSOA 2HDEA 4ED6A 4DHJD 5J04A 1A77A 1TYGB 2M17A 1GRFA 4JWMA 2RPVA 2PTYA 4UASA 2A3VA 3P3BA 4KGSA 5J8YA 1L0YB 3ICXA 2GGIA 1U48A 4DQQA 3AULA 3AN1A 4FI4A 1NPXA 3AE1B 5BOLA 1ZRMA 4MJSB 3GV8B 4OVUA 2Y0SF 1FCLA 3L5KA 2MHJA 2J0KA 4M00A 2HCFA 8ICGA 1SJHD 1DRGA 1XLOA 1JPMA 1IP9A 1NNLA 4M01A 1UBIA 1ZQLA 1XSLA 1ZQGA 3CW2C 4JB3A 1ZXIA 1RZTA 2KHQA 1SJBA 1NK5A 5GMVA 3E56A 2JXJA 2OZ3A 4H4SA 4O3RA 2CN1A 8ICZA 2DLBA 2AL2B 1TT5B 2HNEA 2Q0ZX 4EYHB 1FECA 3Q45A 1UELA 4RGMA 2EAMA 2GLEA 1IM4A 2MAXA 4HCPB 1C3TA 3ALBA 4DFDA 3H8JA 3PSFA 1QQ7A 3QUTA 4QWCA 2RSUA 3DWMA 4LZDA 4HCDA 5KHQA 3G6YA 2BCRA 4I2BA 9ICTA 3T4WA 3GD6A 2D8CA 4QZIA 2JZPA 2LASA 3PRMB 1LB2B 1FEBA 4YTPB 2UUUA 4RH6A 5H8YE 3QUBA 3ORYA 3QLDA 5KL1B 3D2QA 4ZRIA 2VA8A 4ED0A 3H0RB 3NVZA 1QOFA 1JWBD 2Q5WD 1NBFC 3DDMA 3T79A 2HE7A 2KG5A 5J2JA 2VZKD 1FIQB 3DJGX 5FXEA 5DLGA 3KUDB 4E8GA 2KFKA 3FW8A 3V6KA 4OALA 4JDRA 4EZ6A 3SEIA 3ZLHA 3OAWA 1TE2A 5G5HB 1P7FA 4Z6FA 2HHTA 2FE9A 2JRZA 3TFRA 2QB1A 4B9TA 1ZDLA 2LD9A 3WK8A 4W9IA 3R7RA 4F5QA 1H6VA 5HP4A 1HJPA 1X2GA 4J9OA 3PVLA 3T8QA 3GIKA 4DL4A 1Y8RC 2ZZPB 3K9PB 5E6JA 3R0UA 3MFGA 1K8RB 3PO5A 2E1FA 3R9KA 4GB9A 2RQ5A 5KT5A 1T0SC 2F44A 2K3UA 3S1DA 3PSEB 3ZJVA 2C5LC 4EC3A 4DSLA 4WAAA 4FN2A 2R2QA 4IL0A 1F0XA 2NRTA 1QT9A 4MDKE 2NO5A 4KLMA 4A8XC 3DQVA 4A6GA 4GDLA 4GISA 2XY6A 1SE4A 2QSDA 2WXJA 5J0YA 3CXOA 1TK5A 3VCBA 2HOIA 2YMLA 1YX5B 3C0RB 1KLGD 5G55A 2PLSA 4IR1A 1YJJA 2GOWA 4ECZA 2KE7A 4KLDA 4KPRA 3TMPB 1WCLA 2IOFA 1FXIA 3HSUA 2JEGA 4ELVA 1N48A 2P4PA 2ZXIA 2L76A 3P42A 1NJXA 1HEZE 4EBCA 2B0CA 7ICQA 2OJRA 2ZVNA 4W9KA 1K5OA 4G0NB 2KP7A 1ZXIC 4H4TA 5CHFA 2EELA 3M9NB 2L00B 2PP1A 3PSIA 2BPGA 2VAOA 3TSHA 1RM6B 2KV2A 5HI1A 1Z2MA 4DXFA 3OTQA 1UH6A 1YX6B 2PA6A 1YEYA 1ZOYB 5J2HA 1KSPA 2BDPA 3BVMA 4MGKE 1GC6A 5IO9A 1WGHA 1S0VA 2UWQA 1V85A 5AI9A 3PGEA 3WAMA 1S0OA 3VR9B 2EZZA 5JCLA 3NVYA 4WJ3B 4KKJA 5HG2A 3ED5A 4M8NA 3KUMA 1KD0A 1HEKA 5KG7A 2C9WB 1K1SA 5J2RA 3LXDA 2W54A 4I2EA 2GMIC 1T3QA 5TSSA 5AM1A 3JPSA 1NK9A 3RPFC 4D2KA 4J9LA 3MC0B 3I76A 3ZD8A 3ZKJC 2C2RA 1I4QA 3NFUA 3C2MA 4IG7B 3SV4A 3PW5A 1X9MA 3T3NA 4NV0A 4XA5A 3DHHC 1MO9A 3RYTA 1BKHA 4KX3A 1TKDA 1JCKB 9ICFA 4RF0A 4J57A 1EWCA 1N60C 1ET9A 3A9KA 4GFJA 4TSSA 1BPZA 4QWBA 5FP0A 1QSYA 2I1KA 3HVZA 3I5JC 3OJUA 2FUG1 4DL2A 1HE8A 1KEJA 2G1EA 2WX1A 2YVGA 1WWVA 4OJLA 4UAYA 2YVJA 4DX3A 2YEPF 2RDXA 2UUVA 2WXKA 2KN4A 4K3BA 1ZQ1C 5KG2A 1WUDA 1ENFA 2DW7A 3EEZA 2BPSA 5GXGB 1ZD5A 3UI3A 2JSVX 4F4ZA 3T6CA 2K4IA 5J29A 2KACA 4UARA 3BJSA 2A1JA 5J2GA 7ICPA 2XY5A 2E8OA 2WYQA 4U6PA 4I2AA 1ZP0B 4NL9A 2ON8A 3BIID 5TR5A 1P9DU 4NWIA 4BDPA 3KOOA 1W1QA 5CRXA 1Z5SB 1KFSA 2ZJAA 4TQ0A 1MQ2A 2NRXA 3RNAC 2G06A 3RB3A 5KG5A 3NVYB 4DF4A 2MLBA 9ICRA 2M4NA 5KFIA 2WGSA 4KZCA 5J0UA 1WH3A 3CSFA 3IAS1 2BCUA 4KLSA 2J7QB 1HTOA 2KDEB 3FILB 4F5OA 2VFTA 3TANA 1Z00B 1L7NA 2HXUA 2ZG6A 5A0LA 4P4PA 5L6FA 5ALNA 3I63C 2IHNA 4BXOB 3H1UA 3AL0B 2GH5A 2BKRB 2P3HA 4OO1J 5AM3A 2LMCA 4URKA 2A19A 3DGZA 1CJEA 1ZQEA 3R0KA 2INNE 2PVGC 3X23A 3PSPA 3NOBA 3L4PA 2FBWB 8ICQA 4F5PA 1WXSA 4W9JA 3RH6A 1NYRA 3Q3JA 2H89B 3LYYA 4DHZE 2OEDA 2WDTB 2QPMA 2MEKA 1ZYQA 2VH2A 3H4BA 5C0YA 4ITKA 5L95C 2DHZA 3ZXRA 3KHHA 3HM6X 4KGRA 4NAWA 4A35A 1ZQSA 1EXNA 4PS3A 1UNSA 5CEHA 2PE9A 4C8MA 2C60A 2LYAA 1WMHA 1C1YB 3V6EB 4F1SA 1ZQDA 3EC8A 4ED8A 2Q85A 2V4IB 3TADC 2PE6B 3P0WA 3RR1A 2Y08A 2DUYA 4RM8A 2MU2A 4BCAA 2JH1A 4UAZA 3QARA 3O13A 5TISU 3NS1B 1MUCA 3A33B 2IJ0A 3DOWA 1C79A 4GXBA 2JQRB 1SV0C 1YN5A 3KHLA 1WJ6A 2D2QA 3VH4B 1GRBA 3EAOA 2KJHB 1GAQB 2OFJA 2ESEA 4JV0A 5IIIA 3N30A 1UPHA 1UQVA 2MUCA 3QU4A 1GO3F 3DK9A 1SWVA 4CYEA 5D3DA 2M8SA 3Q8QB 3WIMA 1ZQWA 5KVHA 2ZPNA 2WDRB 4RQ7A 2BGWA 2JZ3B 4JIOU 2C22A 1NOMA 2YMQA 1FNUA 2V3AA 5KFHA 4P7IA 4F2SA 2HBKA 3B9JA 5J0QA 1SJCA 3VFCA 4I2CA 1KFYB 4ZH4A 2K0PA 1GNUA 2AL3A 3AE7B 3NVVB 4P0QB 2FMPA 1JWMD 2WB1C 5J0XA 2IGGA 3MJWA 4M9HA 4QZFA 4JV1A 1KLNA 4YT0B 5FS9A 2J52A 2W8KA 1Y56A 2BQRA 5CHVC 4ARIA 4G3IA 5HHIA 3TCAA 2DX5B 5JH5C 3D2HA 4S0RA 3A9JB 4AP4C 5EE0A 2NPTA 5L1MA 1RQLA 2KJ9A 1E90A 4NLZA 2LBOA 2Y3AA 3ONNA 1XPYA 2J0JA 3PW0A 1K51A 5BOMA 2FAZA 5KFFA 2QEJC 3RD2A 1V2YA 5D7GA 2R8HA 4PS7A 2L32A 3ZDCA 1WRDB 4WWNA 5AIAA 4GYPA 3S2AA 1BPEA 3PZDA 5AK4A 1JMLA 2ZTCA 2GI9A 2WDQB 3UXLA 2IOFK 2FLPA 4CRXA 1O08A 2WAQC 4W9DA 1NHPA 4JPSA 1EU3A 4QAYA 2OO6A 1T94A 3N32A 3QNMA 2RD0A 3AEVA 2KVSA 5BOEA 1PYWD 1TTNA 1SZHA 3Q8SB 2FLLA 3SR6B 4R66A 4H4QA 4IW0A 3PV8A 4GIVA 2R8IA 3JZUA 1TS5A 1FFVC 3W5VB 3QJZA 5HMRA 4JV2A 4R3DA 4I6PA 4NJCA 4UB5A 3OLMD 4O9MA 1N5WA 4RU9A 2QARA 2G5HB 1L4ZB 3ZLZA 5KFTA 1TK0A 2WXIA 1QZEA 4IC9A 4ANWA 4CQNA 2K8AA 4F7ZA 4F2RA 1T6BX 1RDFA 4ECQA 5BYRA 5E6NA 4RZRA 2MUTB 4F5RA 4RM9A 4UQGA 3NO1A 1N56A 1L6NA 5ER0A 5DPRA 1JWAD 2ZJDA 5KFZA 3DH9A 4HCLA 4RPZA 4I28A 5AZHA 3ZYYX 1RXWA 3SFDB 5EU9A 4JHMA 1HXYD 3T8MA 4WWOA 2MRLA 2LPEA 3JVAA 3JPNA 3V4BA 1V86A 1XXGA 4Y2PA 4AOFA 4XLOA 2PFNA 2QARB 2AL1A 5F9LA 3M6ZA 5ALVA 3GILA 1ECWA 3PRPB 2I5QA 3RNBC 3PFRA 3UGBB 4C4RA 2HHUA 3KHGA 4RQ1A 2HJ8A 5HMLA 3UPQA 4J3OD 1E0YA 4L23A 2WPEA 1L6UA 4BAXA 2JK6A 1QKZA 2DZIA 4UB3A 3L08A 2OH2A 1D3ZA 2DGZA 1E8FA 1B22A 2IBKA 3UXKA 3SMVA 2ZADA 2BGFA 2FJ6A 1YIWA 3L3FX 3QHTA 2AHOB 2LYBA 2PSNA 2PU0A 5L1LA 4REZA 1WXQA 2PLPA 3I9V1 1F3PA 2WPCA 2XH4A 2WXPA 3HPFA 1PVPA 1KF6B 1L0XB 2JT4B 3L8KA 5AICA 2K22A 4JN7A 4UBCA 3B1LX 1BUIC 5FXDA 3E2EA 2KIVA 4F50A 2XCPA 4ECRA 4RT3A 3D6JA 2J4XA 2B3AA 3JPOA 2NRZA 1YJIA 3PG6A 2M0XA 2QMTA 2ACZB 4I6LB 1GSNA 2AGPA 3NG0A 2ZJ8A 4J56A 5AM0A 3ABVB 4ENLA 5CJ7A 9ICAA 4PGQA 2GGJA 4DFJA 1HIWA 4UBBA 4XRHA 1ZY8A 3SAHA 4HJGE 4DFMA 2J53A 3R1ZA 1CEZA 3LWLA 1MPEA 2AL6A 4YL8A 1Q1OA 2VFUA 1TAUA 4O5KA 3N1ZC 2QDFA 4LA1A 4AJWA 2KWDA 2BCPA 2EKEC 3SV3A 3VQIA 2KFJA 2QJJA 4UB4A 3I57A 3CGDA 1I4PA 5HNKA 4YR2A 3GE3C 2ALZA 2KFKB 3UCDA 2QB0A 4DSJA 5HHDG 3IJIA 4FO6A 1FHVA 1NKBA 2CRXA 1QSSA 4JE3B 4QNLA 2AXTU 3MHZA 4RQ3A 1D6EC 2X8HA 2XN9C 3RAQA 1UWXA 1COKA 3SQSA 1RFKA 1NJYA 3LB8A 1ZQZA 2GOLA 4LCDE 4H50A 3H7IA 3RJEA 5FJUA 3TX1A 4P6VF 3PQBA 3HW8A 1SWWA 2MA9B 3ZRCA 4CO7A 3CYJA 4KLEA 1V5TA 3RJGA 3PREA 4HJKA 2WX0A 4O5EA 3IK4A 2YVSA 2PTXA 3ZIMA 1STZA 2MA1A 2QCZA 2YAUA 4F72A 3WK5A 2VFRA 3QK0A 4NAWB 2IO0B 4QZBA 7ICSA 5IA7A 4RQNA 2KT7A 5AKHA 1N60A 1LGRA 2NTTA 2MSNA 1AROP 5ALMA 5IIKA 4PWBA 1TVAA 1XU4A 2BVFA 2ZC8A 4RUCA 1JCTA 4O0IA 4NM2A 4ECSA 1U45A 3MZNA 4YMMA 1ZQHA 1CUKA 2BCSA 3RTVA 4RQ2A 3TARA 1AN8A 2K1FA 2KAJA 5L1IA 2LVOA 2IDYA 1B43A 1JUDA 2MH7A 1IBXA 7ICRA 3RJJA 3M1YA 1XNSA 2HBMA 2PI5A 2HW3A 2ZVOA 2GR3A 3UQ0A 3EPGA 4I2FA 4WQMA 4KDIC 2O2VA 2O56A 2L0TA 4HNCA 2HTHA 2BZFA 2MBOA 5ALKA 4DOBA 3GIJA 4PL2A 2N1RA 1KLVA 3RN9C 2JWUA 4HPLB 3L54A 1Z00A 2E6XA 5IP4D 2XH2A 3PMLA 4CGZA 2HD5B 3BOXA 2PMZC 3Q8LA 4EWJA 2YMMA 4HCNB 1SKWA 3SN1A 2QQ6A 3P93A 3VTUA 2WDWA 2AWTA 1Z4OA 5ALPA 1DZNA 3APDA 1S8OA 4MGIE 2KHWB 3Q3OC 4KDLB 2KKCA 2CHRA 3TACB 4B9SA 2QC8A 4EX7A 4JQ9A 3OG5A 3VDGA 4ECUA 4RQ0A 1NEKB 1UCVA 4GSWA 3VHTC 3IJQA 4Q2JA 4LNNA 4BUGA 3H4DA 1V1PA 3I28A 4B9NA 2PPHA 2C7MB 1IYXA 4TQSA 1K4QA 5AKLA 3DBHI 2ZZ0A 1GUAB 3HX0A 4TVYA 3TWBA 1WZ3A 3THVA 1ZQRA 2YX8A 5AI8A 4PGXA 2XNAC 2ZNVC 2FKPA 2O2VB 5DGBA 1FRRA 3W8ZA 3IBEA 2PLIA 5CR0A 1J19A 1D5XC 4F5NA 1TS4A 5DG8A 4P0QA 4RNMA 4ANVA 3RFAA 4FLHA 2KK8A 3T5HA 4F91B 2W11A 4J9MA 2SEBD 2QJNA 4KEMA 2CKHB 2IZVB 2V4RA 2E8PA 3DBHB 3S1FA 4GGBA 3MKCA 3M6KA 1E7UA 3HVDA 4DOCA 2KN7A 1DYQA 2F2AB 1L5UA 1FCCC 2LGDA 3KH0A 2KFZA 3A9JA 1A70A 2BHNA 1PZNA 3UINB 4KSKC 1HSKA 3SU8X 1V49A 4WAFA 1B9RA 2OQHA 4YMOA 4J9NA 1PFDA 5KFWA 4DO9A 2WF8A 2OOBB 2TPRA 3UMBA 3VC8A 5KTQA 2LGXA 4KLTA 8ICWA 3EWAA 3H0LB 9ICOA 1NHRA 3QXGA 4HVBA 4RPYA 4DXKA 3D2JA 4LK0M 1ED1A 3OJ4B 3GIMA 3RRHA 3RB4A 2MP2A 2Y5BB 1Q3UA 2Z7JA 1P3QU 2Y3RA 3AEGB 2RLTA 4NEWA 1TS2A 1DXLA 2W3SA 3H12A 1C76A 3BQ7A 3ISDA 3VTVA 1RYSA 1WXVA 2PMVA 4XGAB 1ONFA 3QKEA 1K52A 3JSVB 3ZNHB 3MGIA 1DOXA 1TZZA 2WPFA 2KN5A 4PYZA 3W5UB 4K4HA 4C56C 1W1RA 3OJSA 1QLNA 4IQTA 3ZDBA 3EA6A 1W1OA 5LNK1 3M7DA 1BPYA 1UWMA 3U7DA 4ASWC 4Y2RA 1FXTB 3R2IA 2LUEA 2ZUCA 3I99A 3NVWA 3U26A 2EDUA 2W7OA 4Y2VA 2JEIA 2UVRA 1X2IA 1S9FA 7ICEA 2LZ6A 1KL9A 4KLUA 4XYCA 2EQ6A 3AV8A 5LXIB 5KT6A 1ZQJA 1L2NA 3TEXA 2W3RA 1SJED 4TMAB 4YTMB 4ELUA 3CGCA 1CMXB 3HRDD 5AI4A 4KGTA 1SE9A 1C9FA 3SQIA 1UA1A 3H8SA 2HVIA 2KJ5A 3B2GA 3BWUD 2MCNB 1ZK7A 2LMRA 4LDTB 2J42A 3NZGA 5U1OA 4HCHA 3PS6A 5AWVA 1RYRA 3WANA 5FXFA 4FULA 3NRZA 5C2TB 4ADWA 4M0WB 2MJ3A 3VUXA 1NZPA 5AI5A 5DB6A 4HDQA 3IT4B 3ZVIA 5J0RA 2BVGA 5ALDA 4GLXA 2KO3A 4BBNC 2D07B 2UU7A 1A6SA 2CHWA 4ICVA 2VA2A 3VFKA 1ESFA 3FDSA 1HUZA 1N6ZA 5KL8B 3PZ8A 4K7WA 3SFEB 2RHFA 2KSOB 2N4FA 7ICLA 1JALA 2DFLA 4B9MA 2G9HD 3BYTB 4HDOA 3W1SC 3HHMA 5HMMA 4HAIA 2WF9A 1E7VA 3GU3A 1WJUA 4WQOB 3TIXA 3EPIA 3DEQA 7ICJA 1C4AA 4EMIA 4K4GA 4II3B 3ALRA 2MBRA 1L8OA 3E9SA 1FM0D 1QOGA 1GRGA 2ZIWA 4H2HA 4NPNA 1SL0A 1MJDA 2R2ZA 3II4A 4UW9A 2XGPA 3RJHA 2PMQA 3RITA 3B97A 5AUKA 3KLSX 2QJMA 1GESA 2NBUA 4H2AA 1SXEA 5J2AA 3NGDA 3DCGA 3J9CA 3R8BA 3JS8A 1XO0A 4JLCA 3IP4B 1AQ6A 5TZVA 1WI0A 3F5EA 1SZPA 1V38A 2JUOA 3Q8EA 1R7SA 3RRGA 5IIJA 3WCQA 4E4UA 4PT5A 1AYFA 1TY2A 1WFYA 1DOIA 4RF1A 1KTQA 1XLPA 2ZXHA 3NZ3A 2JVCA 2ZIVB 3DHIC 4FHJA 5F9NA 4A90A 2IOHA 3A9KB 3JVZX 2K6QA 5ALUA 3U52E 4PL1A 2I1JA 4RNOA 4N58A 2E8MA 3KHRA 3V5FA 4Z17A 3AEEB 1YZ6A 2Y0SC 3BZDB 5J0OA 3IXSA 3NTUA 3ZDDA 3GS2A 4LTUA 2G45B 2KMDA 4FBUA 2OWOA 3VVWB 1XO3A 2ODGA 7ICTA 5FMHA 2X50A 2PFPA 2V3PA 1NDDA 3FM9A 5KAFU 4MSMB 2ZZBA 5L83A 3H8MA 5ALWA 2NS5A 1E8YA 3MY9A 5DPSA 3CF6E 4EQXA 1OGWA 2D3GA 3HKZC 2NYVA 1SKRA 1NI3A 1X9SA 1XF5L 4R65A 1WGYA 5U25A 3DGHA 1L3SA 2VZKB 3TQ1A 4ZYSA 1I4GA 1KN0A 3M63B 4G11A 3MC8A 3V05A 3UJSA 2NPTB 3W8XA 4H4VA 2BYEA 4FZLA 3P2BA 4BC9A 1DOQA 2MBBB 4N9F4 1V9PA 4ICAA 1YJ1A 3FYYA 2YQUA 1GERA 2M0AA 3RGTA 1T0RC 4QIWC 4KX6B 3ML9A 3FWAA 4ZHOA 1YQ3B 1TKYA 3VXWA 1LVHA 3MFIA 4DXGA 3AEDB 2W9CA 1XEEA 4ZRJA 3QZ8A 4YXDB 3WU2U 1RAXA 2FCSA 3V7JA 2JXTA 4C0ZA 3AU2A 3Q8RB 4RQ5A 5D46A 4U7CA 3EJDB 3H7SA 2JEJA 4EZ9A 4JWUC 2RK5A 3JPTA 1H4RA 5KT4A 1WIAA 2M19A 3I4KA 3RRAA 1F2RI 4B9LA 5JHBA 3QZ7A 1N62C 3BDPA 2GQWA 1P48A 2LVQA 2YMPA 1TKKA 2JZBB 2QAEA 1ZMDA 1ZQXA 2FIDA 3Q8AA 1X66A 1OUQA 2ISOA 1ZX9A 2MSED 3BVZA 1IXRA 2BWES 2MBHA 3IFWB 3LAEA 4PK1A 4EENA 2KVRA 4DYEA 3B2FA 4YG2A 2W9BB 4ARCA 3F2DA 3RH4A 5BMGA 2EKIA 3Q3FA 3BVGA 1Y88A 1JROA 2L8JA 3PHWB 3AM9A 1VAOA 5BMHA 4E3CA 1WGKA 1AHZA 1GXFA 3N1YC 4F4KA 3FKYA 3GRSA 5J2DA 3DV9A 2KVZA 1D8LA 2GGHA 5KFBA 1SGGA 3WKEA 2FIFA 1J97A 4GIBA 5J0PA 5AM4A 2KJ6A 3HM3A 5T8IA 3ZRFA 7ICKA 1ZGUB 3POPA 3NZSA 5KAIU 3KWLA 2K4HA 4OZBA 1U49A 2AAQA 3U2SC 4US8A 2WB1F 2K89A 2KWUB 1GPXA 4M52A 1UHUA 1LKYB 2WF6A 1EBHA 4FE3A 3QCAA 3G6XA 3STPA 4PWCA 3WKDA 4CF4A 4NM1A 3CIRB 1D4BA 2F1JA 7ICGA 4KIKB 3PSTA 5DB8A 9ICIA 3WK7A 2BYFA 2J6TA 2ZW1A 3TCSA 1DTNA 8ICHA 5AKYA 2RR9A 3CYMA 3T5KA 1QLBB 2HJ1A 4YN4A 5KFDA 1S0MA 2CJOA 2OQYA 4TURA 3D2SA 4MGZE 2OAIA 1WGRA 2YVCA 1J0GA 1BMLC 1WUEA 2L05A 5I1WA 1TS3A 3IN5A 2LUMA 4KMUA 3UQ2A 8ICNA 4MMWA 2BQQA 3DG7A 1D9FA 1B0XA 3N20C 2XI9A 3MGHA 4K81A 4ZA0A 2WXRA 1KLUD 1ZQYA 1OQRA 5EOZA 2ZPYA 2MBEA 3AU4A 2EZYA 3QUQA 2A1JB 4C8KA 2D11A 1KRHA 3P4PB 3A1QB 4PVHA 9ICXA 2JH7A 3VA8A 8ICLA 2H88B 2NTSA 2ASLA 8ICJA 4NY0A 1ZW7A 2FI1A 3IG3A 2GGGA 8ICKA 2PCEA 2FPLA 3AEFB 5AKEA 3Q3MC 3PRZA 2MW5A 3C28A 5MPOA 1IPGA 1QF6A 3L16A 2BS3B 1JRPA 3F53A 4BFRA 4KIKA 2QDEA 5JRBA 3NXLA 1N62A 4C80A 4IQWA 5DBAA 4YSZB 2QVHA 1DGSA 4NLNA 1SE2A 2RDBC 5J18A 1XS2A 2GSHA 5KFJA 3DK4A 2HDOA 4I2GA 4DQOC 1N5WC 4B0EA 3NVWB 7ICFA 2N9KA 2ICIA 4K4IA 3RCZA 4NNJB 4HPPA 5GTHU 2GRTA 1SKSA 4AUQC 2HZGA 1U47A 2V4LA 5GTIU 2N9PC 4QZCA 2N9XA 1MBTA 1NJZA 3NHEB 3DG6A 4KMOB 1Q0WB 1BVSA 4IP5A 3QEBZ 4YWOA 4X57B 3NUQA 3LWMA 5AI6A 4I2IA 4HG0A 3DBLI 3N97B 4ROPA 1ZD2P 2PTZA 3QU7A 1P98A 2MP2B 2L3ZA 4LJOB 1MNSA 4TUQA 2DKXA 1NELA 3MHSD 4K7ZA 1G6JA 2W7PA 1L3VA 3NS8A 3WA0A 2LXCA 2ZIXB 4I6NB 3MC1A 4K8DA 4GGQA 4ECXA 3KZIU 3NS1A 3H6NA 1X6IA 8ICVA 3V60A 2OM6A 1R6WA 2G09A 4FP1A 3D47A 2ZTEA 4F4XA 3KKAC 2ZJ5A 9ICHA 1AWDA 1M4VA 1RFAA 3EECA 3EHVA 2BB6A 3EGRA 2FNJB 2HMXA 1TBEA 1ZPSA 3ZI4A 2R8JA 3ISCA 1E0ZA 5G5GB 1ZRNA 4O3QA 2BYVE 2YVFA 3F2BA 1ZQPA 3UJ2A 1XS9D 1K53A 3ZNID 5DDMA 4G9BA 4WJQA 4GRTA 1X9XA 2QHOA 2E5AA 2FMSA 3IG8A 4H4UA 2LGIA 1KKOA 4R8UA 2BC1A 1F9JA 1OW5A 1NHSA 2B21A 5KFLA 2XH7A 1FFUA 4WJNA 4JAYA 4B9UA 3RT3B 1V81A 1Q3VA 3AE4B 4OZAA 4IDIA 4XWTA 2QKNA 3QX1A 4Z6DA 2L1AA 1T0YA 4AS1A 4E5TA 4X2PA 4F93B 1MQ3A 1XANA 2H3IA 3UJRA 3TAQA 4FJZA 4JMUA 3V62A 1BZLA 5FR6A 2BB5A 2BF8B 3VTWA 2WQYB 5K8EA 2BPCA 4O3OA 5DB9A 9ICUA 5ADZA 1SJDA 4FA6A 4HROA 5H92C 1FIQA 2RDJA 1UXYA 2C28A 2A8XA 5KG0A 3C19A 2PVOD 5I4DA 1XLQA 2PKOA 3L5OA 8ICAA 4P4OA 3G6VA 4ED1A 5C3JB 5AE1A 1OJTA 2OHFA 2UVUA 5AZFA 3DWGC 4XDCA 4RGOS 4BWJA 1W1MA 1R4NB 5IILA 7ICOA 4QWDA 2PGEA 3APCA 2PI4A 1NZBA 3IVFA 1FPYA 4M9NA 3SQPA 1M6YA 1JOAA 2PP0A 2GBNA 2IO1B 3TBLD 4O95A 1C4CA 1Z3EB 5CX3A 4J9KA 2HHVA 1IV8A 4KN7A 3A4RA 4A20A 2FYMA 1WM3A 1F0ZA 2GQUA 4AYBC 3JW7A 1FRDA 2XK5B 1PQSA 5DPWA 1EO6A 2XEWA 5KFKA 4E6MA 4ICUA 2R18A 3H7PB 1BWCA 9ICQA 3F2CA 1NVID 2V9WA 1OTRB 4ECYA 4HRSA 1FXAA 4OZCA 1L8PA 1XDIA 2YQEA 3RJKA 2Y9UA 2MUTA 3Q8MA 2QJLA 4MLAA 2K8CB 1M6IA 4UB6U 4YXJA 5AEKB 3AE6B 3AE3B 5KHOA 4MGGA 3KYDD 1L7OA 1TZOA 2YY6A 4LLGM 4KT2A 4NLCA 3THUA 3VUWA 2GDQA 5FJTA 3L13A 1FO4A 3MABA 2GWSA 3EFCA 3I3TB 4DCCA 3ZDTA 4YTNB 1RPLA 2GL5A 3LADA 1S1QB 2LI5A 4NLBA 2AXRA 2D5GA 3DHGC 3PK7A 4PZFA 1AOGA 1AHUA 4M0XA 2WU2B 3M8RA 1ET6A 4DL6A 4K7SA 3FW7A 4QZAA 4AYBF 5DQHA 3DBLB 1WE7A 1A76A 3ZTCA 5KT2A 5KT3A 1X6JA 3GOEA 3PW2A 5DQGA 2Y1JA 3RNFC 1QOAA 3M62B 3ETRA 2BBCA 2HSZA 1T4GA 1NK6A 4KSLC 1ZKQA 2ZZCA 3N4EA 4FADA 1MRAA 4PVEA 4AJYB 4BBNF 2ZUDA 4Y2QA 4F3OA 3V5CA 3ZVHA 3DDCB 3HUIA 4W9EA 3ZTDA 4EZJA 2EH9A 2W9CB 5KFVA 2VA3A 2D3CA 4MEMA 3DPDA 4RFBA 3OWEB 3N7PD 1C77A 2Q4WA 3OZMA 1JXLA 4RMAA 3Q6BA 1XD3B 2J6SA 4NLKA 2K5PA 1Z4NA 4LZGA 4MGYE 2H3FA 1YN4A 4TQRA 4M8MA 3EW9A 5JHAA 5IIMA 1ROEA 3DVGX 9ICEA 1JQ4A 3GD3A 3PWIA 1N61C 4MM3A 2HOQA 4ZRPA 5KG1A 2E3TA 2VKQA 1ZQQA 2KLGA 5J2CA 2ZCBA 1VZ6A 2EMSA 2P8CA 4IQVA 5G5HA 4YR3A 3M9MB 2XC9A 1CK1A 1RLFA 4Y2UA 1L3UA 2HHSA 3BINA 4HK2A 4TVWA 2FPMA 3U30A 2VJ4A 2BQ3A 1NDAA 1LXDA 2PW9A 5DBCA 5C23A 4UAWA 2XY7A 5CWRA 1Q1RA 3CT2A 1WCNA 1WE6A 4LNFA 4XC2A 3L0WB 3O0HA 1L7PA 3FJ4A 5AE3A 3IM1A 2PXIA 3TJIA 3QPEA 1Q1WA 1S0NA 2KTQA 5J0WA 1ZQFA 1EWYC 1WY8A 3NRWA 3ECIA 4IWQA 5EWFA 4Y2YA 4H4ZA 4G8TA 3OZYA 5ALGA 1QLTA 1FD6A 5ENLA 4CCHA 5DG9A 1TK8A 4LJXA 4K1WA 1WMHB 1QQRA 5IAAC 2NVUI 1CRXA 5C1ZA 3IAM1 3ZDMC 1ZQCA 3V61A 2WBAA 3TFSA 2JX5A 2P13A 2K8CA 3GRTA 1V97A 1H38A 2PODA 3TEWA 5J2IA 2DPIA 2W43A 4PYUA 1SV0A 7ICNA 2G0AA 2HOFA 5D2MB 4PHEA 1L5PA 1KW4A 5EWGA 3BQ0A 1ZQOA 4IRDA 4M47A 2L0FA 3A4SC 3AU5A 1L7MA 3MC9A 3Q3NC 2P35A 3W8WA 1VDVA 1KTKA 4BVUC 2Y5CA 3AECB 3BQ1A 2J0MA 3WALA 5ALOA 2E8NA 3N4FA 4YD1A 1LM8B 3ZO5B 3R11A 3TOYA 4BGDA 2INPE 4KLFA 4NLGA 4BBYA 4I2HA 5CP2A 1KQQA 8ICIA 2WXLA 2LFIA 3W1YA 4ED3A 3JPQA 2I38A 4PZOA 5D49A 1DOYA 2L5YA 3SZ2A 3ZJUA 1MVKA 5AKKA 4WJPA 1I4RA 1WX9A 3C23A 4UAVA 4IWPA 3N3KB 2J6UA 3V6HA 5ALYA 1NK4A 4PS8A 5IDZA 4Y2XA 1FFUC 3VRBB 1WVEA 2AGQA 2WP9B 1URJA 4EQSA 3MSYA 3NRZB 2NV3A 1OEYJ 4EX6A 2KDMA 3UCCA 1JX4A 5ALTA 3A0HU 3T3OA 1F5SA 1AW7A 3GFKB 4A6QA 2K4PA 2WXQA 5EDSA 1WGDA 1W1KA 1F1HA 2DYBA 2KJ8A 1J2MA 3KBBA 1FHUA 4Y2JA 4WIPA 1ECQA 3U4FA 1KM7A 3D46A 2RPQA 5AK5A 1WX7A 2VJ5A 2LWPA 3N1XC 3PZ7A 4NJ8A 3KZXA 2XGQA 1ZUD2 2DBYA 2KDBA 5EBKA 1K50A 3TL5A 4KX5A 2V3NA 5J8YC 4C4VA 5C5JA 3EUB2 5AZGA 2PGWA 1QQ5A 3AE8B 1IBXB 2WFAA 4L2YA 5DPTA 5KFXA 3X0WA 3OGUA 3P1MA 4KLJA 4RQMA 1ZD3A 3PLVA 4ACOA 3DEEA 5FKAC 3D9XA 3HT3A 4P16A 1GJZA 3B9JB 5ALRA 4NEVA 4OHJA 3WK6A 3KUZA 1C7YA 4DHGA 1E9MA 3FV9A 5BYSA 2C3CA 2HQMA 4JK1A 3MR6A 2XCAA 3N4MB 2M0NA 3GZFA 4RPXA 2CHXA 3D2NA 5ALQA 2ZW0A 4TUSA 3Q8KA 1NHQA 4GXIA 3A7AA 2BKFA 3S1CA 3WAPA 3EJBB 1MC8A 1L7YA 4FBJB 4OJPA 2WOIA 4K7UA 1Z19A 4EMWA 3C5FA 3EZ5A 1JRUA 2BS4B 3RJFA 3R3MA 4UD8A 1VZ8A 2V4QA 3O0FA 4OJOA 5KG3A 1ZE3D 1E7PB 2V1YA 3AB5A 4BKSA 4UB2A 2WNMA 3GB1A 4XE0A 4WWPA 1TYPA 2A1AA 4CF5A 3QTPA 2Y4GA 3PX0A 2P8BA 3TJPA 1BGXT 2IO3B 2AQ1B 2CJNA 2K9XA 4O3SA 4ZYNA 1MI0A 2JRIB 2KX0A 4OVVA 5AHXA 1F0MA 4GMVA 4M04A 3NUHB 1IG6A 1H8CA 4CDGA 3KJMA 3L17A 4YSYB 4YWSA 2PFOA 5DLFA 3LXFA 5F3XB 4CF3A 1A5RA 1E8ZA 1V1OA 1ZQUA 3OHAA 4JWSC 3BSMA 4A55A 3PM9A 3URYA 3BK2A 4ZOHB 3TW9A 2JPHA 4G50A 1R4NI 4ECVA 2LGSA 2KYWA 5FR3A 2WOVA 2KIWA 3TTEA 4RNAA 1MSWD 5AM5A 4BXOA 1XSPA 1STEA 4KLHA 3PTFC 3MUCA 3SJNA 3ZVHB 4EYIB 5KVIA 1UUPA 3PR5B 5D94A 4FS2A 1WZ0A 2F76X 1NKCA 1I4HA 3A0BU 5CA7A 4FJVB 4BOSC 3MWCA 5E79U 5AKXA 1CZPA 3SHQA 2QLTA 3VRAB 1P0RA 1NKEA 2E5SA 2Z0DB 3ZNZB 4IS7A 3GDXA 1R4MI 3VH3B 3ZDAA 1EBDA 1GREA 5DDYA 3BZCA 2UVWA 3MJ5A 5ALLA 4KN4A 4Q8EA 1ZQBA 3MR5A 5CHGA 1GG3A 2AQ3B 4YXMA 2NO4A 3BZKA 3VCNA 4EOYA 5D6JB 1ZDXA 2NRWA 2DYOA 1QQ6A 3PMNA 4PH5A 1J7CA 5DCNA 2R8GA 2KFNA 5LXHA 4YQWA 3VC5A 4Q44A 2PPGA 1YOVB 4HPNA 1UA0A 3RFZB 3BQ2A 1VQZA 3QYPA 3IC9A 1BXTA 4EELA 3SENA 4LNIA 3K4GA 4NQKE 3H7VA 2RGFA 1QCKA 3VDZA 3V6JA 5BPCA 2INDC 3NY5A 2RDGA 3IG5A 1LPFA 2IY0B 4H19A 9ICPA 2D3BA 2KDIA 1Q46A 2QKQA 4DNAA 4QW9A 9ICNA 2K60A 2GRIA 3E0FA 2O6VB 3VC6A 4F71A 2PKEA 4DQRA 2FCMA 1T8EA 3R10A 4NJ6A 2ZNVB 4M2YA 5IN7A 2F1IA 3JPRA 3UXOA 4DSIA 2X38A 4Q43A 4MH0E 9ICCA 3UXPA 1SBBB 1U9LA 4GU2A 3I6EA 3OPXA 2GB1A 4DLGA 2R2OA 3DK8A 3QFBA 3RAXA 3V7KA 5KFSA 2YN4A 3OSNA 4DDGD 1WJ4A 4MFAA 3SYZA 2C2DA 5ALJA 1UT8A 4RQ4A 3CRXA 2RDHA 3AE2B 3AE9B 2KD0A 3C29A 3FW9A 3QWZB 2P88A 2BW2A 2I1QA 2MNRA 4LNKA 3ES8A 1S10A 3DESA 9ICSA 2G5IB 1SF0A 2W9BA 2JF5A 2F1HA 2RMMA 2FE8A 3MP9A 1E10A 1ZQTA 1TFRA 5AK3A 1P7DA 3QEAZ 4R63A 4JUZA 1CI4A 2ONEA 2KZZA 2DAJA 3F5AA 2JR5A 4EEYA 4JN8A 2PTLA 2QB0B 2ZEQA 4ANUA 4YVZA 4OCZA 4Y2SA 4J9SA 5EE1A 5H2FU 7ICUA 1EU4A 2OKTA 3A7UA 3BJYA 2WTFA 3MGVA 1BT0A 3FC4A 4GC6A 1PK1A 8ICOA 2IYDB 1TKEA 3AQFA 2V6OA 3T9PA 4GDLB 2AKZA 3AMZA 8ICCA 2A5UA 1WSPA 4HEA1 3C21A 1T5XD 2RABA 4DLEA 4K1RB 2K39A 3UF8A 3Q2AC 3RNCC 3QQ8B 3KQ4A 2CU1A 1D5ZC 2LGYA 4IC7B 1GEUA 1QOBA 4NQLB 4G7FA 1XWLA 1X40A 4AP9A 5AKJA 3JYUA 1RYUA 4FFDA 4C8NA 3TKAA 2Z0EB 1VR9A 5CHWA 4ANXA 3S1EA 4MFCA 5AI0A 5J2KA 3S5SA 1RRBA 3QAQA 4YFKA 3MR2A 1LFDA 1WXAA 3GC2A 1F2RC 3LB8C 5IKCM 4KLIA 3CAWA 2K8BB 4IWOA 4WURA 2JU6X 2FLNA 3UMGA 3DG3A 2NQWA 2JMGA 1OFFA 1JEHA 4B6WA 4HYRA 4BURA 3SAGA 3BS5B 3RR7A 1D7YA 3NVZB 4UB1A 2LYHA 4OJ5A 2ZUBA 3VTEA 2KZ3A 1PDXA 1J2NA 8ICSA 2EQYA 5J2BA 2X8CA 4C4SA 2Q4TA 4X5VA 1T7PA 4HN8A 3H4KA 4IRCA 5E6OA 5IIOA 2POZA 3TAPA 9ICLA 1WGGA 4RQ8A 2G4DB 3KVFB 3RBDA 3RO6A 1SSNA 2MQJA 1QILA 5AKGA 4MSQB 1ZQNA 3CGBA 2UVVA 3EUB3 2XIDA 4NL9C 5DQIA 1NJWA 1HUOA 5HQXA 5B66U 1QTMA 4F4RA 2WLBA 2AL2A 4FZNA 3ENLA 2O6KA 3ZW3A 2KOBA 5I1VA 4DK5A 3PO4A 1LO5D 5DG7A 5JCMA 1IGCA 3CSTA 3KD3A 1ZOLA 3W1SA 2GBJA 9ICMA 3JPPA 4DL5A 4BKGA 3RJAA 1N63A 3SAFA 1X1MA 3KYCD 1EBGA 1KN5A 4B9VA 4DHJB 2I2YA 2AGOA 2JZZA 3KWVA 4NZLB 2DNFA 3R2TA 2GQTA 2AX5A 4MEYA 2UYZB 2WDVB 1UT5A 1Z1VA 1OXJA 4DEZA 2PS2A 5FJOA 2OXOA 3T3FA 2KX3A 4YR0A 3QX7A 1CQVA 1WWTA 1HA5A 1WJNA 2NCNA 3GZNB 1W1JA 2DKZA 3H0MB 1MG4A 2CR5A 2D3AA 4TUUA 3DDHA 5J2EA 2PMZF 4C00A 3SN0A 2IBIB 2JRHA 3BK1A 3L10B 1WUFA 1H2IA 2KZMA 1UZXB 4WH4A 2CS4A 2DW6A 1UGJA 8ICPA 9ICWA 4M0AA 2C7HA 1LQBA 4JGHB 3ZGZA 3M9OB 3ES7A 2KWVB 3RZFA 1DIIA 4HKQA 4QIWF 3WK4A 2VH1A 3URHA 4EBDA 3LLBA 2RDIA 4DSFA 2O6VA 2PJHA 2WU5B 3WAOA 5ALHA 2EXRA 1Q10A 4F8RA 2HVHA 2C2EA 3KUCB 1PDZA 7ICHA 2KMMA 3H8HA 2PFQA 2KANA 4HYKA 5KFRA 4E71A 2LKYA 3DEDA 3HJEA 2W03A 5JUMA 3LDZE 5L9XA 4PPXA 4A8EA 1XC9A 1QSLA 3SI8A 3P4QB 1WR6E 2EQ9A 1TYTA 4IR9A 4R8UB 4TKNA 1BNPA 1LKYA 3ML8A 5J17A 4MF8A 3TSSA 2W9AA 1J7BA 3NVVA 3ZD9A 1JWSD 2RRDA 3N7SC 1WVFA 2CDUA 3CP8A 2FUHB 2WHEA 2KQSA 2WS3B 4IM3A 4ZRQA 3RULA 1V5OA 3TEYA 1FFVA 4EMJA 3QU9A 8ICBA 3LK9A 3PLUA 3H8AA 2I6XA 2D6FC 3ZXVA 3PV1A 4DQPA 5EWEA 2DPJA 1IUEA 1MOKA 1OQYA 2K8BA 1VJKA 1YD8U 3HPOA 1MBBA 2LHDA 5FXPA 1P43A 4K2SA 5JCIA 3M8SA 1UF0A 3K1ZA 5JRTA 2MX2A 2HHQA 4MFFA 1M94A 3OC4A 2W04A 2ZTDA 4MKSA 4PHDA 3WKBA 2F8KA 1EUVB 1E8XA 3AE5B 4HNLA 2QGYA 4NY8A 4F4WA 1MG8A 3V6CB 2F8LA 2N0SB 3UQBA 3ZJTA 2LJIA 4WJOA 1GRTA 2CFYA 2OPJA 1MA7A 4EEKA 2KEYA 3Q8CA 2C3DA 3K1GA 1YQBA 2OG9A 3VR8B 4DWIA 2N1WA 4XQ8A 4MF2A 3FYHA 3NJTA 1KKRA 1SJAA 1S5LU 3DGBA 1S3SG 2W9NA 2KDFB 1EC9A 3OW1A 2ONQA 4BV6A 3VCCA 5EE9A 3RNMA 1HZ6A 2V3SA 3OHBA 5ALFA 3ETRB 5KG4A 4P1CC 1HQRD 2NQLA 4LDTD 3R25A 4MHVA 3S47A 2HBLA 2ASJA 3TQPA 3M3JA 1GRAA 4C8OA 2FDRA 2K4EA 2VRRB 2Y5PA 1ELSA 3EANA 3TJ4A 1KFTA 1RYJA 2KTFA 2P6RA 2OYYA 2AQ2B 5AKIA 4O5CA 1D9DA 5J2FA 4HXDA 2Z8LA 1L3TA 4M9JA 5AIBA 3N9YC 3CNHA 2KKPA 2AQ0A 3N7RC 4E74A 2WP5A 1JN3A 1PUZA 4C8LA 1WYGA 5AM2A 3P63A 4FXCA 1FEHA 2WXOA 1PUTA 2BWFA 2V9HA 3FILA 3M95A 3W9CB 2QIEB 4USAA 3BYYB 3UIPB 2BVHA 3SN4A 3RZWC 5DBBA 4H1ZA 1ACCA 1SL2A 2IGHA 3DFYA 4KLGA 4GDKB 4HKZE 1KDHA 1I35A 1ZQIA 2WXGA 1V8CA 3RH5A 4O3NA 4K8GA 5IOIA 3TADA 5ALXA 1PVRA 4P2HA 3ONSA 2N7EA 2YEPB 2PEAA 4K3CA 4A3PA 3UJFA 2YTUA 4KTQA 3EF6A 3IRUA 2YLMA 1F52A 2OEHA 4KV2A 1VD2A 3C2KA 3UMCA 4IM2A 2WXFA 4Q8FA 1DGJA 4QZEA 2N7JA 4O1NA 1JW9D 4O3PA 1UBQA 1E5WA 4DXAB 2LJ5A 3RF9A 1K1QA 2GO7A 4BOZB 2LHEA 1KJTA 1IGDA 4UB8U 2NR2A 1VCBA 2BDUA 2XICA 3ZUNA 2YB4A 3APFA 4WWMA 1MHXA 2KNBA 2HI0A 2NRVA 1RM6C 2CHZA 5KFOA 3RI7C 2V0GA 1ZKHA 3PWGA 4EQRA 2H3ZA 4G3XB 2GR1A 4M9GA 2PIAA 4IZGA 6ENLA 4R64A 1KCZA 5KT7A 2AYOB 2XK5A 1ONEA 2XGZA 2O3GA 4B0MA 4KLOA 1COOA 2GGEA 4XX5A 3H8WA 4KLLA 2L7RA 5AUIA 5EE3A 4AQ7A 4GDKA 1S77D 3U7ZA 3B0YA 4CE6A 3Q8PB 3QA8A 1T3NA 4W9HA 3H9DA 2FCQA 4CHKA 5FS7A 3DBSA 4FDCB 3IHQB 4GIRA 2LM4A 1MHHE 3V3XA 1F9CA 2WHIA 2OZ8A 2DQNB 3C1ZA 3W2DA 2NPXA 3UJEA 2XO7A 4W9LA 3ZNGC 4BX9C 3NZUA 1N2XA 3TSJA 3KW5B 1N61A 2R61A 3SR6A 3RR8A 3DQ0A 3SD7A 2NBWB 3TUOA 3PX6A 4H4PA 4OD0A 4ACFA 4BKSD 1SE3A 4BZAA 1ZMCA 3UM9A 1OQQA 4QZ8A 5K4LA 1DNCA 2W82A 2Y1IA 1WRIA 3MTNB 2F77X 2W55A 3LYSA 4RUAA 2JZBA 2CU3A 2IY1B 1E9IA 3HRDC 4GLSC 2L83A 4H4YA 3DBRI 2KK0A 5HHZA 1E6EB 4DBGA 2LM1A 2DZMA 2A4ZA 1BQGA 2KKVA 2LVPA 3Q6JA 3U9IA 3UGVA 3ZLFA 4DQSA 2BVCA 5L1KA 2P0IA 2Y3SA 5D3IB 1TIFA 3CXBA 3J81j 4EM3A 3UXNA 1TZ1A 4II2B 1QH9A 4PJ0U 3UQAA 2F3NA 4GC7A 3PNCA 2KOXA 2KICA 3FAHA 3HWTA 1WR1A 1Q5WB 1ZXHA 4H4WA 3GY1A 4DWDA 4HPMB 5FS8A 1SEBD 4P0PB 3VUYA 1PGAA 2FCNA 3AI5A 4A3RA 5KFAA 1GOZA 8ICXA 3AQEA 3AEAB 3T5JA 2H3VA 5FS6A 2K8HA 3DVNV 4FX9A 4NJ7A 1BNOA 4XWWA 3C1YA 3LVVA 4P1BC 4EM4A 4IQUA 3BS5A 3D32A 4GXKA 4GOCA 2OLAA 4E4FA 3GE8C 1FEAA 3JSVA 3SBFA 1RG6A 2W8LA 2AU0A 5HR7A 3TWAA 2D10A 4IOIE 2B6GA 4DFPA 1GB4A 2LXAA 2K25A 2EQ7A 5BOFA 3Q8BA 3FG2P 1MN8A 1J7AA 1TAMA 5KNIA 3RB6A 2GLSA 2PP3A 4XUSA 3FXGA 1IIPA 1B4FA 3HW2A 7ICMA 2TSSA 5LLIA 3IJLA 2ZIXA 2R8DA 4B9KA 4GR1A
chains in the Genus database with same CATH topology
2BS4B 1EWCA 1N60C 1ET9A 2MJEA 1VZ8A 3RJ8A 4TSSA 1VLBA 2WXHA 1VRAB 1ZE3D 1E7PB 3AB5A 3HVZA 2FUG1 2G1EA 4N58A 2WNMA 3AEEB 3GB1A 4XE0A 3BZDB 2Y4GA 3IXSA 3GS2A 4LTUA 2YEPF 2UUVA 2WXKA 2KN4A 2AQ1B 2CJNA 1DIQA 2K9XA 4IKGA 1AHVA 1ENFA 1MI0A 1XO3A 5GXGB 3UI3A 2JSVX 2V3PA 2BS2B 2KACA 1GB1A 1N5XA 4C7YA 3BIID 2BT6A 1ZP0B 3NUHB 2ON8A 2B76B 3KJMA 4OVZA 4YSYB 1W1QA 3LXFA 1NI3A 1XF5L 4TQ0A 1V1OA 1E8HA 3NVYB 4DNSA 2VZKB 1ZR6A 4ZYSA 4N6EB 1I4GA 3IAS1 4JWSC 3V05A 4A55A 3W8XA 3FILB 3PM9A 5D79A 2VFTA 3ZQ4A 3URYA 3BK2A 4ZOHB 4BC9A 4TQ1A 4XDDA 2DYMA 5FR3A 5L6FA 2M0AA 4RNAA 3FWAA 4KX6B 4OW0A 1STEA 4RCOA 4ZHOA 1JWUD 1TKYA 1YQ3B 2P3HA 4MT5A 2LMCA 4DXGA 3AEDB 1CJEA 1UUPA 1XEEA 4YXDB 1HZ5A 2INNE 2PVGC 2JXTA 3P4SB 1I4HA 3L4PA 2FBWB 1CZPA 3VRAB 4JWUC 1NYRA 2RK5A 2H89B 3LYYA 2OEDA 2QPMA 3A7RA 2M19A 1F2RI 1P7EA 2N9LA 1N62C 2MEKA 3MJ5A 4ITKA 4KGRA 3Q8AA 2AQ3B 1UNSA 4KKIA 2Q85A 1ZDXA 3BVZA 2Y08A 1TY0A 2DYOA 2V4IB 1J7CA 3LAEA 4BCAA 3B2FA 1B1ZA 4ARCA 3O13A 1FNVA 1XCTL 3NS1B 1TJEA 2EKIA 5BMGA 2IJ0A 1C79A 3BVGA 2JQRB 1JROA 1YN5A 3RFZB 1VQZA 3AM9A 1VAOA 1GAQB 5BMHA 1WGKA 1AHZA 1BXTA 3C8YA 4JB1A 2BTEA 1W1SA 5D3DA 2RDGA 2WDRB 5T8IA 4UDUC 3BW7A 2GRIA 3Q8FA 3POPA 1FNUA 1X2HA 3KWLA 4OZBA 3U2SC 4US8A 3B9JA 2X38A 1GPXA 1KFYB 1SBBB 1L0VB 2K0PA 4PWCA 2GB1A 3NVVB 3AE7B 3CIRB 1D4BA 4MM3B 4RGTA 1JWMD 2IGGA 4US9A 2ZW1A 1QLUA 4YT0B 2J52A 3AE2B 2DWQA 3FW9A 2RDHA 3AE9B 1Y56A 4ARIA 1QLBB 2BW2A 1SF0A 2CJOA 2RMMA 3MP9A 1E10A 3D2HA 2FE8A 2OAIA 5FK9C 1BMLC 5EE0A 2Y3AA 5I1WA 1TS3A 2LUMA 3GP7A 1EM7A 1K51A 2PTLA 2QEJC 5D7GA 3C0PA 2L32A 5EE1A 1EU4A 3A7UA 2WXRA 1KLUD 5G5GA 1OQRA 1JMLA 2WDQB 3FC4A 4C7ZA 2GI9A 2IPKD 2LEKA 1TKEA 1SB3C 1KRHA 4GDLB 3AMZA 4JPSA 1EU3A 4YWGG 4PVHA 4PVJA 1NENB 2H88B 1WSPA 4HEA1 3R07C 2NTSA 1PYWD 1T5XD 3SR6B 4L1BA 3CWIA 3AEFB 4JX1C 1TS5A 5MPOA 1FFVC 3KQ4A 3W5VB 1QF6A 5HMRA 4R3DA 2BS3B 1JRPA 1D5ZC 4NJCA 1QOBA 1N62A 1N5WA 4C80A 1L4ZB 2WXMA 4YSZB 3PO0A 1SE2A 2WXIA 4CQNA 2KQ4X 1VR9A 3S1EA 1T6BX 4DQOC 1N5WC 5BYRA 4B0EA 1KH0A 3NVWB 2N9KA 2ICIA 1F2RC 3LB8C 5AE2A 4WURA 2JU6X 1JWAD 2IPIA 2NQWA 3TEZA 1OFFA 1MBTA 3ZYYX 4MH8A 3SFDB 3IT6B 1HXYD 4MACA 3NVZB 3VTEA 1PDXA 3GSYA 1XXGA 1L4DB 1TKGA 1VZ7A 4HG0A 4YSXB 4XLOA 1XLNA 1PGBA 1YN3A 1E0YA 4J3OD 1C78A 1SSNA 1QILA 4L23A 1L6UA 3AH7A 1W1LA 3U4EG 3EUB3 1QKZA 3NS1A 3Q69A 5HQXA 2WLBA 5JXVA 3SEBA 1E8FA 1AWDA 1M4VA 5I1VA 1C4PA 2BB6A 3EGRA 1ZPSA 4REZA 1LO5D 1IGCA 1WXQA 2PLPA 3I9V1 3W1SA 1E0ZA 2WXPA 5G5GB 1KF6B 1L0XB 2K22A 3RJAA 1N63A 1BUIC 5FXDA 2VFVA 1K53A 2SAKA 2I2YA 2J4XA 3KWVA 4NZLB 3R2TA 2GQTA 1YJIA 2AX5A 2E5AA 2LGIA 2QMTA 1XCQL 2WDVB 2ACZB 1FFUA 4JAYA 2VFSA 1CQVA 3ABVB 1WWTA 1HA5A 3AE4B 3AEBB 4IDIA 4OZAA 4XWTA 1W1JA 4HJGE 2L1AA 2QKNA 2J53A 4AS1A 2VFUA 1MPEA 1NYQA 3BK1A 4WH4A 4M0WA 2KWDA 2BB5A 5K8EA 1UGJA 2WQYB 2JYTA 3VQIA 3ZGZA 4ML8A 5ADZA 1DIIA 3I57A 4HKQA 4HROA 1I4PA 1YMHE 5H92C 1FIQA 1UXYA 3LLBA 1RWSA 2WU5B 2IGDA 2PVOD 5I4DA 1XLQA 2PKOA 4BC7A 1SIJA 2EXRA 1Q10A 1YNTE 5C3JB 5HHDG 5AE1A 2OHFA 4ZHPA 2KMMA 3H8HA 3DWGC 2M56B 4JE3B 4XDCA 4A9AA 4RGOS 3MHZA 1D6EC 1W1MA 2XN9C 1L6VA 3DEDA 1UWXA 1RFKA 1N63C 1I4XA 3P4QB 2NMQA 3PQBA 3TX1A 4P6VF 4O95A 1C4CA 1FNWA 2L52A 2YVSA 1E8GA 3TSSA 1J7BA 3NVVA 1F0ZA 2GQUA 4PVKA 1JWSD 1FRDA 1WVFA 1FMAD 2WS3B 4ZRQA 3TEYA 2VFRA 4EE2A 4NAWB 4NAMA 1FFVA 2WXNA 2MJDA 1N60A 2NTTA 4PWBA 2JYEA 1D5MC 1NVID 4OZCA 2BVFA 4HRSA 1FXAA 1ZDVA 4MLAA 2QJLA 1AN8A 1IUEA 3P4PB 2KAJA 1VJKA 2P4PA 2IDYA 3AE6B 2LHDA 2MH7A 3AE3B 5BYQA 1IBXA 1I19A 1MBBA 1TZOA 5FXPA 4LLGM 1SXTA 1FO4A 4WQMA 4PYTA 4YTNB 3AE5B 1SB3B 2AXRA 2D5GA 2JWUA 4PZFA 3ZJTA 2HTME 2N0SB 2E6XA 2LJIA 1AHUA 2I0KA 2WU2B 3D2DA 1ET6A 3Q8CA 4RGNA 3FW7A 4N59A 1F77A 3VR8B 1V1PB 2WDWA 5BMIA 2ONQA 1DZNA 1I7HA 5EE9A 5HFYA 1HZ6A 2QILA 4ZOHC 3ETRB 1QOAA 3ETRA 1HQRD 2BBCA 1PGXA 1NEKB 4Q2JA 2BYTA 4PVEA 1V1PA 3HUIA 2Y5PA 1RYJA 2AQ2B 1YQ4B 4TVYA 4RFBA 1T3QC 3OWEB 1C77A 3P4RB 5L6GA 2Z8LA 2Q4WA 2XNAC 2HDEA 3N9YC 2K5PA 1FRRA 1TYGB 3W8ZA 2RPVA 2PLIA 1YN4A 1JQ4A 1WYGA 3P63A 1ROEA 1FEHA 1D5XC 2WXOA 1PUTA 3FILA 4FXCA 4KGSA 3W9CB 1L0YB 1TS4A 2QIEB 4USAA 3BYYB 4ZRPA 1N61C 2E3TA 2BVHA 3AN1A 2SEBD 3AE1B 1ACCA 1VZ6A 2IGHA 5G5HA 4GDKB 4HKZE 1CK1A 1FCLA 4TVWA 3S1FA 2WXGA 1V8CA 1SJHD 1XLOA 3HVDA 1DYQA 1FCCC 2PW9A 2YEPB 1ZXIA 1A70A 3E56A 1HSKA 4WAFA 1B9RA 2DLBA 1PFDA 5AE3A 2WXFA 1EWYC 2N7JA 1DGJA 4RGMA 4O1NA 1JW9D 1QLTA 1FD6A 3DWMA 4LK0M 3D2JA 2LHEA 1IGDA 2JZPA 2Y3RA 2UUUA 4YTPB 3AEGB 4RH6A 5H8YE 1QQRA 1TS2A 4WWMA 2W3SA 1C76A 1MHXA 3IAM1 1RM6C 2PMVA 2JX5A 3NVZA 1QOFA 2V0GA 1JWBD 2P13A 2Q5WD 1K52A 1V97A 1DOXA 3TEWA 2PIAA 2VZKD 1W1RA 1FIQB 3W5UB 4C56C 5FXEA 2O3GA 3EA6A 4B0MA 1W1OA 3FW8A 4OALA 5AUIA 5LNK1 1UWMA 5EE3A 4AQ7A 1P7FA 3U7ZA 5G5HB 3R2IA 1L5PA 3I99A 3NVWA 1MHHE 3V3XA 3W8WA 3AV8A 1VDVA 1KTKA 2Y5CA 3AECB 3W2DA 1X2GA 3TEXA 2W3RA 3TSJA 5E6JA 1SJED 4TMAB 4YTMB 1N61A 2INPE 3MFGA 2R61A 3SR6A 3DQ0A 4BBYA 3HRDD 3TUOA 2WXLA 2K3UA 1SE3A 2LFIA 4KGTA 3S1DA 2I38A 1DOYA 1OQQA 3ZJVA 1C9FA 3ZJUA 4EC3A 1MVKA 2W82A 1I4RA 1WRIA 1F0XA 3B2GA 2W55A 1QT9A 2CU3A 3BWUD 2J42A 4A8XC 4GLSC 3HRDC 1SE4A 2QSDA 2L83A 2WXJA 3VRBB 1FFUC 2WP9B 1WVEA 5FXFA 5AWVA 3NRZB 5HHZA 3NRZA 1E6EB 1KLGD 2KDMA 5C2TB 2MJ3A 3T3OA 2PLSA 3IT4B 1YJJA 1AW7A 2BVGA 4A6QA 2WXQA 2Y3SA 5D3IB 1W1KA 1FXIA 3HSUA 1ESFA 3P42A 1HEZE 3PZ8A 3FAHA 4WIPA 3SFEB 4A90A 1ZXHA 1ZXIC 2G9HD 1JALA 2EELA 3BYTB 3U52E 1SEBD 2VAOA 3PZ7A 3TSHA 1RM6B 1PGAA 1ZUD2 5HI1A 4DXFA 1C4AA 2DBYA 1ZOYB 1K50A 2MBRA 1GOZA 3BVMA 2V3NA 3E9SA 1FM0D 1QOGA 3EUB2 3AEAB 3AE8B 1IBXB 2R2ZA 4L2YA 4XWWA 3VR9B 5AUKA 3P1MA 3KLSX 3NVYA 4KKJA 5HG2A 4H2AA 5FKAC 3B9JB 3J9CA 4OHJA 3R8BA 3JS8A 1E9MA 5BYSA 2W54A 4IOIE 4P16A 1GB4A 3Q8EA 1T3QA 2ZW0A 5TSSA 3Q8BA 1R7SA 3RPFC 3WCQA 1J7AA 4D2KA 3MC0B 1AYFA 4PT5A 3S1CA 3A7AA 1TY2A 1DOIA 1I4QA 4RF1A 2R8DA 1XLPA 2TSSA 3NZ3A 3T3NA 1JCKB 4RF0A 4UD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BS4 B;  1N60 C;  2MJE A;  1VLB A;  4N58 A;  3AB5 A;  1E7P B;  3HVZ A;  2G1E A;  3AEE B;  4LTU A;  1DIQ A;  2CJN A;  2K9X A;  1AHV A;  1XO3 A;  5GXG B;  2BS2 B;  1N5X A;  4C7Y A;  3BII D;  2BT6 A;  1ZP0 B;  2B76 B;  3KJM A;  4YSY B;  1W1Q A;  3LXF A;  1NI3 A;  1E8H A;  3NVY B;  4DNS A;  1ZR6 A;  4N6E B;  4JWS C;  3W8X A;  3PM9 A;  5D79 A;  2VFT A;  4ZOH B;  4BC9 A;  3FWA A;  4KX6 B;  4ZHO A;  2P3H A;  1YQ3 B;  1TKY A;  3AED B;  1CJE A;  4YXD B;  2PVG C;  3P4S B;  3L4P A;  2FBW B;  1CZP A;  3VRA B;  4JWU C;  1NYR A;  2RK5 A;  2H89 B;  2QPM A;  3A7R A;  2M19 A;  1N62 C;  4ITK A;  2Q85 A;  1J7C A;  3LAE A;  4BCA A;  3B2F A;  3NS1 B;  1TJE A;  2EKI A;  2JQR B;  1JRO A;  1VQZ A;  3AM9 A;  1VAO A;  1GAQ B;  1WGK A;  1AHZ A;  4JB1 A;  1W1S A;  2WDR B;  3BW7 A;  1X2H A;  3KWL A;  4US8 A;  3B9J A;  1GPX A;  1KFY B;  1L0V B;  4PWC A;  3NVV B;  3AE7 B;  3CIR B;  4US9 A;  1QLU A;  4YT0 B;  3AE2 B;  2DWQ A;  3FW9 A;  3AE9 B;  1QLB B;  1SF0 A;  2CJO A;  3D2H A;  1E10 A;  2OAI A;  5EE0 A;  3C0P A;  5EE1 A;  3A7U A;  5G5G A;  1OQR A;  2WDQ B;  3FC4 A;  4C7Z A;  2LEK A;  1TKE A;  1SB3 C;  1KRH A;  3AMZ A;  4PVH A;  4PVJ A;  1NEN B;  2H88 B;  3R07 C;  3SR6 B;  3CWI A;  3AEF B;  4JX1 C;  1FFV C;  5MPO A;  3W5V B;  1QF6 A;  5HMR A;  2BS3 B;  1JRP A;  1QOB A;  1N62 A;  1N5W A;  4C80 A;  4YSZ B;  3PO0 A;  3S1E A;  1N5W C;  3NVW B;  3LB8 C;  5AE2 A;  1JWA D;  2NQW A;  1OFF A;  1MBT A;  3ZYY X;  3SFD B;  3NVZ B;  3VTE A;  1PDX A;  3GSY A;  4HG0 A;  1TKG A;  4YSX B;  4XLO A;  1XLN A;  1E0Y A;  1L6U A;  3AH7 A;  1W1L A;  3EUB 3;  3NS1 A;  5HQX A;  2WLB A;  1E8F A;  1AWD A;  1WXQ A;  1E0Z A;  5G5G B;  1KF6 B;  2K22 A;  1N63 A;  5FXD A;  2VFV A;  2GQT A;  1YJI A;  2AX5 A;  2E5A A;  2WDV B;  2ACZ B;  1FFU A;  4JAY A;  2VFS A;  3ABV B;  1WWT A;  3AE4 B;  3AEB B;  4IDI A;  2QKN A;  1W1J A;  2VFU A;  1NYQ A;  2WQY B;  4ML8 A;  5ADZ A;  1DII A;  4HRO A;  5H92 C;  1FIQ A;  1UXY A;  3LLB A;  1RWS A;  2WU5 B;  2PVO D;  1XLQ A;  2PKO A;  4BC7 A;  1SIJ A;  2EXR A;  5C3J B;  5AE1 A;  2OHF A;  4ZHP A;  2KMM A;  3DWG C;  2M56 B;  4A9A A;  1W1M A;  1L6V A;  3DED A;  1RFK A;  1N63 C;  3P4Q B;  3TX1 A;  4P6V F;  4O95 A;  2L52 A;  2YVS A;  1E8G A;  1J7B A;  3NVV A;  1F0Z A;  2GQU A;  4PVK A;  1FRD A;  1WVF A;  1FMA D;  2WS3 B;  2VFR A;  1FFV A;  2MJD A;  1N60 A;  4PWB A;  1NVI D;  2BVF A;  4HRS A;  1FXA A;  4MLA A;  2QJL A;  1IUE A;  3P4P B;  2KAJ A;  1VJK A;  2P4P A;  3AE6 B;  3AE3 B;  2MH7 A;  1I19 A;  1MBB A;  5FXP A;  1FO4 A;  4WQM A;  4PYT A;  4YTN B;  3AE5 B;  1SB3 B;  2AXR A;  4PZF A;  2HTM E;  2N0S B;  1AHU A;  2I0K A;  2WU2 B;  3D2D A;  3FW7 A;  4N59 A;  3VR8 B;  1DZN A;  1I7H A;  5EE9 A;  4ZOH C;  3ETR B;  1QOA A;  3ETR A;  1NEK B;  4PVE A;  3HUI A;  1RYJ A;  1YQ4 B;  4TVY A;  1T3Q C;  3P4R B;  2Q4W A;  2K5P A;  1FRR A;  1TYG B;  3W8Z A;  2PLI A;  1JQ4 A;  1WYG A;  4FXC A;  1ROE A;  3P63 A;  1PUT A;  3W9C B;  1N61 C;  2QIE B;  4USA A;  2BVH A;  2E3T A;  3AN1 A;  3AE1 B;  5G5H A;  4TVW A;  3S1F A;  1V8C A;  1XLO A;  1ZXI A;  1A70 A;  1HSK A;  1B9R A;  5AE3 A;  1PFD A;  1EWY C;  1DGJ A;  1JW9 D;  1QLT A;  3DWM A;  3D2J A;  4YTP B;  3AEG B;  5H8Y E;  4WWM A;  2W3S A;  1RM6 C;  2JX5 A;  3NVZ A;  1QOF A;  2P13 A;  1JWB D;  2Q5W D;  1V97 A;  1DOX A;  2PIA A;  1W1R A;  1FIQ B;  3W5U B;  5FXE A;  2O3G A;  1W1O A;  3FW8 A;  4OAL A;  5AUI A;  1UWM A;  5EE3 A;  5G5H B;  1L5P A;  3I99 A;  3NVW A;  3W8W A;  3AV8 A;  1VDV A;  2Y5C A;  3AEC B;  1X2G A;  2W3R A;  3TSJ A;  4YTM B;  1N61 A;  3SR6 A;  3DQ0 A;  4BBY A;  3HRD D;  3S1D A;  1DOY A;  1OQQ A;  4EC3 A;  1WRI A;  1F0X A;  3B2G A;  2W55 A;  1QT9 A;  2CU3 A;  3HRD C;  1FFU C;  2L83 A;  3VRB B;  1WVE A;  2WP9 B;  5FXF A;  3NRZ B;  5HHZ A;  3NRZ A;  1E6E B;  5C2T B;  2MJ3 A;  2PLS A;  1YJJ A;  2BVG A;  1W1K A;  1FXI A;  3FAH A;  3SFE B;  1ZXI C;  1JAL A;  2VAO A;  3TSH A;  1RM6 B;  1ZUD 2;  2DBY A;  1ZOY B;  2MBR A;  1FM0 D;  1QOG A;  3EUB 2;  3AEA B;  3AE8 B;  2R2Z A;  3VR9 B;  5AUK A;  3P1M A;  3NVY A;  3B9J B;  3JS8 A;  1E9M A;  2W54 A;  1T3Q A;  1R7S A;  3RPF C;  3WCQ A;  1J7A A;  3A7A A;  3S1C A;  1AYF A;  1DOI A;  2R8D A;  1XLP A;  4UD8 A; 
#chains in the Genus database with same CATH topology
 1LVL A;  2MJE A;  1S7M A;  3RJ8 A;  1VLB A;  4ZDV A;  2WXH A;  1VRA B;  1ZQK A;  5JTI A;  5KFN A;  1HTQ A;  3TI0 A;  4I27 A;  2BR0 A;  2BQU A;  3HIZ A;  1DIQ A;  4IKG A;  2IHM A;  3U8Z A;  1AHV A;  2DAF A;  1ZJM A;  8ICM A;  1GC7 A;  2XH0 A;  2I5H A;  3S6J A;  8ICE A;  1C20 A;  1D8Y A;  2BS2 B;  1GB1 A;  1N5X A;  1XSN A;  1YZ7 A;  3V7L A;  4C7Y A;  2BT6 A;  2B76 B;  1S97 A;  3PHX B;  2E1E A;  1TGZ B;  1TAQ A;  2OJW A;  3H7P A;  4OVZ A;  4KZ0 A;  1RXV A;  1J8C A;  2O6V D;  4EKU A;  3KLJ A;  5D4B A;  4ELT A;  7ICV A;  2PTW A;  1E8H A;  1NU5 A;  4PHP A;  4YMN A;  1JPD X;  2Z59 B;  4DNS A;  3QN3 A;  1ZR6 A;  4N6E B;  2I9G A;  4DSK A;  4B95 A;  2BPF A;  1JMS A;  5D79 A;  3CB3 A;  3ZQ4 A;  3SSZ A;  7ENL A;  2ZCC A;  4ZRK A;  2X99 A;  1KFD A;  4TQ1 A;  4XDD A;  3QE9 Y;  2DYM A;  1V6E A;  4EEW A;  4Z1Y A;  4QZH A;  1OEY A;  4GYP C;  3QFA A;  4OW0 A;  9ICB A;  5HR6 A;  8ICU A;  1JWU D;  4RCO A;  1T0Q C;  4MT5 A;  2R9Z A;  3BS7 A;  1SIF A;  3B08 A;  3O65 B;  1HZ5 A;  3GD4 A;  2C7N B;  2KMA A;  2EQ8 A;  1VJ5 A;  4O3M A;  3A1Q A;  2X8X X;  3P4S B;  1XQQ A;  4LII A;  4DFK A;  4AWJ A;  5ALI A;  4PZN A;  1IYF A;  4M02 A;  4DDI D;  2W9M A;  2FMQ A;  2DEN B;  3C2L A;  4CNQ A;  2G3Q B;  2H3Q A;  4KLQ A;  3EKG A;  3A7R A;  1EF1 A;  4GME A;  2G07 A;  1D8B A;  1P7E A;  2N9L A;  3K1R B;  9ICG A;  4J6I A;  1DXS A;  4TV3 A;  2V3B A;  2KXJ A;  4M6U A;  5JZE B;  3IDW A;  5DB7 A;  2HHX A;  3H40 A;  2BCQ A;  5IIN A;  4KKI A;  2GR2 A;  3DER A;  1TY0 A;  3EYZ A;  3MR3 A;  4W9C A;  1EC7 A;  2CXY A;  3K75 D;  7ICI A;  4IHC A;  4UAT A;  1B1Z A;  3RUI B;  1FNV A;  1XCT L;  1TJE A;  4DS5 A;  3T5L A;  3PR4 A;  4APN A;  2LRW A;  3DBR B;  4DL3 A;  1JXE A;  4UAU A;  3KKA A;  4I29 A;  1DK2 A;  4ECT A;  2JY6 A;  5JCK A;  3PZP A;  3C8Y A;  1MDL A;  4JB1 A;  3PW4 A;  5FJR A;  3FVD A;  2KD1 A;  2BTE A;  1W1S A;  4KIT B;  3RCY A;  1Z1B A;  2KC2 A;  3N28 A;  4DF8 A;  2IMW P;  2NVK X;  1F44 A;  2GBK A;  3MQT A;  3I1Y A;  5AKZ A;  1V59 A;  4UDU C;  3BW7 A;  2KTR B;  2GR0 A;  1E8W A;  2YB1 A;  3Q8F A;  2WF5 A;  4TUP A;  1X2H A;  5ALS A;  2JEF A;  4LVS A;  4BJQ A;  2Y9T A;  1SXD A;  1EF5 A;  1SGH A;  4EZL A;  1L0V B;  2DZK A;  3MFH A;  1NI2 A;  5E6P A;  1UGM A;  2EZX A;  3QC8 B;  4MM3 B;  4RGT A;  1KRP A;  2OZT A;  1XO1 A;  3PT2 B;  4P4M A;  4YD2 A;  4US9 A;  3IV6 A;  4A3O A;  1PK3 A;  1QLU A;  2KLC A;  3DJJ A;  2DWQ A;  3V3W A;  2J3N A;  4QWE A;  5KFY A;  4P0P A;  3JW0 X;  3IHP C;  5FK9 C;  2M9N A;  2RP5 A;  4FZM A;  1LV5 A;  1A0P A;  3R7Q A;  2W0H A;  4KVG B;  3GP7 A;  2ATL A;  1EM7 A;  3KTQ A;  4EZK A;  3C0P A;  4I2J A;  2QDD A;  4PGY A;  2IA6 A;  2HBJ A;  2JWZ A;  2AQ4 A;  4HWI B;  1PK1 B;  5G5G A;  4C7Z A;  2IPK D;  2LEK A;  3DVG Y;  4W9G A;  3PY8 A;  1SB3 C;  2ASD A;  4YWG G;  2KZR A;  4PVJ A;  1GRH A;  3SDL C;  3ZDE A;  1GV4 A;  2WOW A;  3QU5 A;  1NEN B;  1RQN A;  4M6W B;  2G4S A;  3R07 C;  2VAN A;  4Q45 A;  2LRU A;  3VAW A;  4L1B A;  4QZ9 A;  2H5X A;  4QZG A;  5JU5 A;  4RNN A;  1X9W A;  2R8K A;  3HP6 A;  3GV5 B;  3CWI A;  4JX1 C;  4DN1 A;  3SD5 A;  1V9J A;  1KKX A;  3EJE B;  4FBT A;  2GBR A;  3OSP A;  3OP2 A;  1XHC A;  1V80 A;  5DGA A;  9ICK A;  4EUT A;  3GV7 B;  4DS4 A;  2WXM A;  1BPD A;  3PO0 A;  5KFG A;  2KQ4 X;  1KBU A;  5AK6 A;  5KFC A;  4DQI A;  2ZIV A;  4MEX A;  1KH0 A;  4J3Z A;  2NBV B;  2N7D A;  3CGE A;  5KFM A;  2BCV A;  2MBQ A;  3PVX A;  3B0A A;  2X8G A;  5AE2 A;  3LVW A;  2K6D B;  1ZQA A;  2KTR A;  4W9F A;  3GO2 A;  4IP4 A;  5TR3 A;  4BKT A;  2IPI A;  3TEZ A;  5ALE A;  1ZQM A;  4DHZ B;  2N1V A;  3GII A;  4MH8 A;  2OCE A;  5CTR C;  4EBE A;  3IT6 B;  4MAC A;  4MEL A;  1MFW A;  2KVC A;  4Y2T A;  9ICV A;  2AEH A;  1I42 A;  3GSY A;  1W6T A;  2JHD A;  2PU1 A;  1L4D B;  1TKG A;  1VZ7 A;  1FEZ A;  2BC0 A;  4YSX B;  2WWZ A;  3MDC A;  4C4V B;  2GH1 A;  1XLN A;  2KC1 A;  3K9O B;  1PGB A;  4EFO A;  2G08 A;  3QU2 A;  4RT2 A;  9ICJ A;  1DK3 A;  2XVT A;  1R4M B;  4ED7 A;  2D3D A;  1YN3 A;  1C78 A;  2JV3 A;  3ETL A;  3AH7 A;  1W1L A;  1TE6 A;  3U4E G;  3Q69 A;  2KMC A;  4LJP B;  5HHH A;  3N6J A;  2EAO A;  5JXV A;  3SEB A;  1C4P A;  4DL7 A;  3OTR A;  2VIX A;  2KWC A;  3Q4D A;  3DVN U;  3GZN I;  1O03 A;  4BWM A;  4F92 B;  4Z6E A;  3QUC A;  3LJ3 A;  2VFV A;  4J9Q A;  1U4A A;  3OPS A;  5KFQ A;  5KFP A;  1SV4 A;  2ZIW B;  5ALZ A;  2P6U A;  2DL0 A;  2SAK A;  4IRK A;  3WKC A;  1Q8K A;  4M9L A;  3DIP A;  1KOT A;  2DZJ A;  4H4R A;  3B0X A;  2WAQ F;  1XCQ L;  2KQ7 A;  2MRP A;  2EAN A;  3PW7 A;  4IL6 U;  2MWS B;  3AXC A;  3ISB A;  4IUM B;  4S17 A;  4XZ4 A;  1NK8 A;  2AKM A;  2VFS A;  5J0S A;  4GXJ A;  3FCP A;  3HKZ F;  1ISN A;  3AEB B;  1WYW B;  1XT9 B;  3Q14 C;  2GBM A;  3AUO A;  3RJI A;  3HIL A;  5KFU A;  2CPR A;  3LDA A;  1NYQ A;  2N9E B;  2HXT A;  4PHA A;  4DWF A;  4ECW A;  4LNO A;  2IO2 B;  1ZQV A;  2ZIU A;  4M6W A;  3OJ3 A;  4M0W A;  2XSX A;  1JI7 A;  4OJ6 A;  3PPA A;  4C4T A;  3RB0 A;  2JYT A;  5KFE A;  4ML8 A;  5B5E U;  8ICR A;  3RBE A;  3MBY A;  2KJR A;  4J1O A;  4RQ6 A;  1YMH E;  5DKW A;  5T14 A;  1S76 D;  3QIJ A;  2AH5 A;  3NAS A;  1RWS A;  1R0M A;  2IGD A;  1L8L A;  1WXM A;  1SL1 A;  4BC7 A;  3EFU A;  1SIJ A;  3GQC A;  1NK0 A;  1YNT E;  4YCX A;  4ZHP A;  4J9P A;  4E0D A;  2M56 B;  1JIH A;  4Z6C A;  2XBB C;  3T9L A;  4A9A A;  1ZET A;  3CK5 A;  1L6V A;  4IT1 A;  4EQW A;  4DSE A;  1BPB A;  2P66 A;  1N63 C;  1I4X A;  1ZD4 A;  2WP6 A;  1U4B A;  3H70 A;  2NMQ A;  4F4Y A;  1WG8 A;  4FJY A;  2WF7 A;  1NK7 A;  2EAP A;  3RMK C;  1FNW A;  4JQW C;  2L52 A;  4J03 A;  2OVL A;  2OX4 A;  4B6J A;  4DOA A;  1E8G A;  4KPL A;  2ISP A;  3C5G A;  1EC8 A;  1WWU A;  4PVK A;  1GET A;  1FMA D;  3ENE A;  4EE2 A;  4NXZ A;  4NAM A;  1PVQ A;  2WXN A;  2MJD A;  2ASQ A;  2JYE A;  1D5M C;  2BKE A;  3N6H A;  4QW8 A;  1ZDV A;  5KG6 A;  2HHW A;  4GGH A;  3WKA A;  4FS1 A;  1I19 A;  5BYQ A;  1RVK A;  2KHV A;  5FJP A;  4QJF B;  1SXT A;  4H4X A;  2M1M A;  4QWA A;  3RNE C;  4PYT A;  3KFU F;  2F5Z A;  1YT3 A;  2LHT A;  4QZD A;  2DF4 B;  8ICY A;  1JDF A;  4ZCW A;  4F8C B;  1WF9 A;  4JL9 A;  1OEP A;  4ED2 A;  1SB3 B;  3WK9 A;  3AU6 A;  5GRT A;  4KWS A;  2HTM E;  2EMT A;  4IL2 A;  2I0K A;  3D2D A;  4J9R A;  4RGN A;  3PX4 A;  1PDY A;  1P1A A;  3I6T A;  8ICT A;  2JGA A;  1BPX A;  1F77 A;  3BY4 B;  4N59 A;  4GFI A;  4H83 A;  4FHK A;  1V1P B;  3MDA A;  2KNJ A;  5G2N A;  5BMI A;  3ZLG A;  1I7H A;  2REX A;  2FPK A;  2P3Z A;  5JCN A;  2ES6 A;  5HFY A;  1MDR A;  3V72 A;  1WX8 A;  3ZVV A;  1WM2 A;  2QIL A;  3RNG C;  4ZOH C;  4I2D A;  1AAR A;  5CB1 A;  2JXX A;  4MJS A;  4JWN A;  2AJQ A;  4GN1 A;  1PGX A;  4YP3 A;  3UIO B;  1UD7 A;  5HKH A;  2ZIU B;  2INC C;  3R66 C;  3E58 A;  2BYT A;  2LI6 A;  1TV9 A;  3HK0 A;  3BQT A;  8ICF A;  5BO4 B;  1F8W A;  4HLE A;  5J0T A;  1YQZ A;  1YQ4 B;  1ZJN A;  1T3Q C;  1X42 A;  3P4R B;  3DFH A;  5L6G A;  3CMM B;  5L1J A;  4IM0 A;  2KSO A;  2HDE A;  4ED6 A;  4DHJ D;  5J04 A;  1A77 A;  1TYG B;  2M17 A;  1GRF A;  4JWM A;  2RPV A;  2PTY A;  4UAS A;  2A3V A;  3P3B A;  4KGS A;  5J8Y A;  1L0Y B;  3ICX A;  2GGI A;  1U48 A;  4DQQ A;  3AUL A;  3AN1 A;  4FI4 A;  1NPX A;  3AE1 B;  5BOL A;  1ZRM A;  4MJS B;  3GV8 B;  4OVU A;  2Y0S F;  1FCL A;  3L5K A;  2MHJ A;  2J0K A;  4M00 A;  2HCF A;  8ICG A;  1SJH D;  1DRG A;  1XLO A;  1JPM A;  1IP9 A;  1NNL A;  4M01 A;  1UBI A;  1ZQL A;  1XSL A;  1ZQG A;  3CW2 C;  4JB3 A;  1ZXI A;  1RZT A;  2KHQ A;  1SJB A;  1NK5 A;  5GMV A;  3E56 A;  2JXJ A;  2OZ3 A;  4H4S A;  4O3R A;  2CN1 A;  8ICZ A;  2DLB A;  2AL2 B;  1TT5 B;  2HNE A;  2Q0Z X;  4EYH B;  1FEC A;  3Q45 A;  1UEL A;  4RGM A;  2EAM A;  2GLE A;  1IM4 A;  2MAX A;  4HCP B;  1C3T A;  3ALB A;  4DFD A;  3H8J A;  3PSF A;  1QQ7 A;  3QUT A;  4QWC A;  2RSU A;  3DWM A;  4LZD A;  4HCD A;  5KHQ A;  3G6Y A;  2BCR A;  4I2B A;  9ICT A;  3T4W A;  3GD6 A;  2D8C A;  4QZI A;  2JZP A;  2LAS A;  3PRM B;  1LB2 B;  1FEB A;  4YTP B;  2UUU A;  4RH6 A;  5H8Y E;  3QUB A;  3ORY A;  3QLD A;  5KL1 B;  3D2Q A;  4ZRI A;  2VA8 A;  4ED0 A;  3H0R B;  3NVZ A;  1QOF A;  1JWB D;  2Q5W D;  1NBF C;  3DDM A;  3T79 A;  2HE7 A;  2KG5 A;  5J2J A;  2VZK D;  1FIQ B;  3DJG X;  5FXE A;  5DLG A;  3KUD B;  4E8G A;  2KFK A;  3FW8 A;  3V6K A;  4OAL A;  4JDR A;  4EZ6 A;  3SEI A;  3ZLH A;  3OAW A;  1TE2 A;  5G5H B;  1P7F A;  4Z6F A;  2HHT A;  2FE9 A;  2JRZ A;  3TFR A;  2QB1 A;  4B9T A;  1ZDL A;  2LD9 A;  3WK8 A;  4W9I A;  3R7R A;  4F5Q A;  1H6V A;  5HP4 A;  1HJP A;  1X2G A;  4J9O A;  3PVL A;  3T8Q A;  3GIK A;  4DL4 A;  1Y8R C;  2ZZP B;  3K9P B;  5E6J A;  3R0U A;  3MFG A;  1K8R B;  3PO5 A;  2E1F A;  3R9K A;  4GB9 A;  2RQ5 A;  5KT5 A;  1T0S C;  2F44 A;  2K3U A;  3S1D A;  3PSE B;  3ZJV A;  2C5L C;  4EC3 A;  4DSL A;  4WAA A;  4FN2 A;  2R2Q A;  4IL0 A;  1F0X A;  2NRT A;  1QT9 A;  4MDK E;  2NO5 A;  4KLM A;  4A8X C;  3DQV A;  4A6G A;  4GDL A;  4GIS A;  2XY6 A;  1SE4 A;  2QSD A;  2WXJ A;  5J0Y A;  3CXO A;  1TK5 A;  3VCB A;  2HOI A;  2YML A;  1YX5 B;  3C0R B;  1KLG D;  5G55 A;  2PLS A;  4IR1 A;  1YJJ A;  2GOW A;  4ECZ A;  2KE7 A;  4KLD A;  4KPR A;  3TMP B;  1WCL A;  2IOF A;  1FXI A;  3HSU A;  2JEG A;  4ELV A;  1N48 A;  2P4P A;  2ZXI A;  2L76 A;  3P42 A;  1NJX A;  1HEZ E;  4EBC A;  2B0C A;  7ICQ A;  2OJR A;  2ZVN A;  4W9K A;  1K5O A;  4G0N B;  2KP7 A;  1ZXI C;  4H4T A;  5CHF A;  2EEL A;  3M9N B;  2L00 B;  2PP1 A;  3PSI A;  2BPG A;  2VAO A;  3TSH A;  1RM6 B;  2KV2 A;  5HI1 A;  1Z2M A;  4DXF A;  3OTQ A;  1UH6 A;  1YX6 B;  2PA6 A;  1YEY A;  1ZOY B;  5J2H A;  1KSP A;  2BDP A;  3BVM A;  4MGK E;  1GC6 A;  5IO9 A;  1WGH A;  1S0V A;  2UWQ A;  1V85 A;  5AI9 A;  3PGE A;  3WAM A;  1S0O A;  3VR9 B;  2EZZ A;  5JCL A;  3NVY A;  4WJ3 B;  4KKJ A;  5HG2 A;  3ED5 A;  4M8N A;  3KUM A;  1KD0 A;  1HEK A;  5KG7 A;  2C9W B;  1K1S A;  5J2R A;  3LXD A;  2W54 A;  4I2E A;  2GMI C;  1T3Q A;  5TSS A;  5AM1 A;  3JPS A;  1NK9 A;  3RPF C;  4D2K A;  4J9L A;  3MC0 B;  3I76 A;  3ZD8 A;  3ZKJ C;  2C2R A;  1I4Q A;  3NFU A;  3C2M A;  4IG7 B;  3SV4 A;  3PW5 A;  1X9M A;  3T3N A;  4NV0 A;  4XA5 A;  3DHH C;  1MO9 A;  3RYT A;  1BKH A;  4KX3 A;  1TKD A;  1JCK B;  9ICF A;  4RF0 A;  4J57 A;  1EWC A;  1N60 C;  1ET9 A;  3A9K A;  4GFJ A;  4TSS A;  1BPZ A;  4QWB A;  5FP0 A;  1QSY A;  2I1K A;  3HVZ A;  3I5J C;  3OJU A;  2FUG 1;  4DL2 A;  1HE8 A;  1KEJ A;  2G1E A;  2WX1 A;  2YVG A;  1WWV A;  4OJL A;  4UAY A;  2YVJ A;  4DX3 A;  2YEP F;  2RDX A;  2UUV A;  2WXK A;  2KN4 A;  4K3B A;  1ZQ1 C;  5KG2 A;  1WUD A;  1ENF A;  2DW7 A;  3EEZ A;  2BPS A;  5GXG B;  1ZD5 A;  3UI3 A;  2JSV X;  4F4Z A;  3T6C A;  2K4I A;  5J29 A;  2KAC A;  4UAR A;  3BJS A;  2A1J A;  5J2G A;  7ICP A;  2XY5 A;  2E8O A;  2WYQ A;  4U6P A;  4I2A A;  1ZP0 B;  4NL9 A;  2ON8 A;  3BII D;  5TR5 A;  1P9D U;  4NWI A;  4BDP A;  3KOO A;  1W1Q A;  5CRX A;  1Z5S B;  1KFS A;  2ZJA A;  4TQ0 A;  1MQ2 A;  2NRX A;  3RNA C;  2G06 A;  3RB3 A;  5KG5 A;  3NVY B;  4DF4 A;  2MLB A;  9ICR A;  2M4N A;  5KFI A;  2WGS A;  4KZC A;  5J0U A;  1WH3 A;  3CSF A;  3IAS 1;  2BCU A;  4KLS A;  2J7Q B;  1HTO A;  2KDE B;  3FIL B;  4F5O A;  2VFT A;  3TAN A;  1Z00 B;  1L7N A;  2HXU A;  2ZG6 A;  5A0L A;  4P4P A;  5L6F A;  5ALN A;  3I63 C;  2IHN A;  4BXO B;  3H1U A;  3AL0 B;  2GH5 A;  2BKR B;  2P3H A;  4OO1 J;  5AM3 A;  2LMC A;  4URK A;  2A19 A;  3DGZ A;  1CJE A;  1ZQE A;  3R0K A;  2INN E;  2PVG C;  3X23 A;  3PSP A;  3NOB A;  3L4P A;  2FBW B;  8ICQ A;  4F5P A;  1WXS A;  4W9J A;  3RH6 A;  1NYR A;  3Q3J A;  2H89 B;  3LYY A;  4DHZ E;  2OED A;  2WDT B;  2QPM A;  2MEK A;  1ZYQ A;  2VH2 A;  3H4B A;  5C0Y A;  4ITK A;  5L95 C;  2DHZ A;  3ZXR A;  3KHH A;  3HM6 X;  4KGR A;  4NAW A;  4A35 A;  1ZQS A;  1EXN A;  4PS3 A;  1UNS A;  5CEH A;  2PE9 A;  4C8M A;  2C60 A;  2LYA A;  1WMH A;  1C1Y B;  3V6E B;  4F1S A;  1ZQD A;  3EC8 A;  4ED8 A;  2Q85 A;  2V4I B;  3TAD C;  2PE6 B;  3P0W A;  3RR1 A;  2Y08 A;  2DUY A;  4RM8 A;  2MU2 A;  4BCA A;  2JH1 A;  4UAZ A;  3QAR A;  3O13 A;  5TIS U;  3NS1 B;  1MUC A;  3A33 B;  2IJ0 A;  3DOW A;  1C79 A;  4GXB A;  2JQR B;  1SV0 C;  1YN5 A;  3KHL A;  1WJ6 A;  2D2Q A;  3VH4 B;  1GRB A;  3EAO A;  2KJH B;  1GAQ B;  2OFJ A;  2ESE A;  4JV0 A;  5III A;  3N30 A;  1UPH A;  1UQV A;  2MUC A;  3QU4 A;  1GO3 F;  3DK9 A;  1SWV A;  4CYE A;  5D3D A;  2M8S A;  3Q8Q B;  3WIM A;  1ZQW A;  5KVH A;  2ZPN A;  2WDR B;  4RQ7 A;  2BGW A;  2JZ3 B;  4JIO U;  2C22 A;  1NOM A;  2YMQ A;  1FNU A;  2V3A A;  5KFH A;  4P7I A;  4F2S A;  2HBK A;  3B9J A;  5J0Q A;  1SJC A;  3VFC A;  4I2C A;  1KFY B;  4ZH4 A;  2K0P A;  1GNU A;  2AL3 A;  3AE7 B;  3NVV B;  4P0Q B;  2FMP A;  1JWM D;  2WB1 C;  5J0X A;  2IGG A;  3MJW A;  4M9H A;  4QZF A;  4JV1 A;  1KLN A;  4YT0 B;  5FS9 A;  2J52 A;  2W8K A;  1Y56 A;  2BQR A;  5CHV C;  4ARI A;  4G3I A;  5HHI A;  3TCA A;  2DX5 B;  5JH5 C;  3D2H A;  4S0R A;  3A9J B;  4AP4 C;  5EE0 A;  2NPT A;  5L1M A;  1RQL A;  2KJ9 A;  1E90 A;  4NLZ A;  2LBO A;  2Y3A A;  3ONN A;  1XPY A;  2J0J A;  3PW0 A;  1K51 A;  5BOM A;  2FAZ A;  5KFF A;  2QEJ C;  3RD2 A;  1V2Y A;  5D7G A;  2R8H A;  4PS7 A;  2L32 A;  3ZDC A;  1WRD B;  4WWN A;  5AIA A;  4GYP A;  3S2A A;  1BPE A;  3PZD A;  5AK4 A;  1JML A;  2ZTC A;  2GI9 A;  2WDQ B;  3UXL A;  2IOF K;  2FLP A;  4CRX A;  1O08 A;  2WAQ C;  4W9D A;  1NHP A;  4JPS A;  1EU3 A;  4QAY A;  2OO6 A;  1T94 A;  3N32 A;  3QNM A;  2RD0 A;  3AEV A;  2KVS A;  5BOE A;  1PYW D;  1TTN A;  1SZH A;  3Q8S B;  2FLL A;  3SR6 B;  4R66 A;  4H4Q A;  4IW0 A;  3PV8 A;  4GIV A;  2R8I A;  3JZU A;  1TS5 A;  1FFV C;  3W5V B;  3QJZ A;  5HMR A;  4JV2 A;  4R3D A;  4I6P A;  4NJC A;  4UB5 A;  3OLM D;  4O9M A;  1N5W A;  4RU9 A;  2QAR A;  2G5H B;  1L4Z B;  3ZLZ A;  5KFT A;  1TK0 A;  2WXI A;  1QZE A;  4IC9 A;  4ANW A;  4CQN A;  2K8A A;  4F7Z A;  4F2R A;  1T6B X;  1RDF A;  4ECQ A;  5BYR A;  5E6N A;  4RZR A;  2MUT B;  4F5R A;  4RM9 A;  4UQG A;  3NO1 A;  1N56 A;  1L6N A;  5ER0 A;  5DPR A;  1JWA D;  2ZJD A;  5KFZ A;  3DH9 A;  4HCL A;  4RPZ A;  4I28 A;  5AZH A;  3ZYY X;  1RXW A;  3SFD B;  5EU9 A;  4JHM A;  1HXY D;  3T8M A;  4WWO A;  2MRL A;  2LPE A;  3JVA A;  3JPN A;  3V4B A;  1V86 A;  1XXG A;  4Y2P A;  4AOF A;  4XLO A;  2PFN A;  2QAR B;  2AL1 A;  5F9L A;  3M6Z A;  5ALV A;  3GIL A;  1ECW A;  3PRP B;  2I5Q A;  3RNB C;  3PFR A;  3UGB B;  4C4R A;  2HHU A;  3KHG A;  4RQ1 A;  2HJ8 A;  5HML A;  3UPQ A;  4J3O D;  1E0Y A;  4L23 A;  2WPE A;  1L6U A;  4BAX A;  2JK6 A;  1QKZ A;  2DZI A;  4UB3 A;  3L08 A;  2OH2 A;  1D3Z A;  2DGZ A;  1E8F A;  1B22 A;  2IBK A;  3UXK A;  3SMV A;  2ZAD A;  2BGF A;  2FJ6 A;  1YIW A;  3L3F X;  3QHT A;  2AHO B;  2LYB A;  2PSN A;  2PU0 A;  5L1L A;  4REZ A;  1WXQ A;  2PLP A;  3I9V 1;  1F3P A;  2WPC A;  2XH4 A;  2WXP A;  3HPF A;  1PVP A;  1KF6 B;  1L0X B;  2JT4 B;  3L8K A;  5AIC A;  2K22 A;  4JN7 A;  4UBC A;  3B1L X;  1BUI C;  5FXD A;  3E2E A;  2KIV A;  4F50 A;  2XCP A;  4ECR A;  4RT3 A;  3D6J A;  2J4X A;  2B3A A;  3JPO A;  2NRZ A;  1YJI A;  3PG6 A;  2M0X A;  2QMT A;  2ACZ B;  4I6L B;  1GSN A;  2AGP A;  3NG0 A;  2ZJ8 A;  4J56 A;  5AM0 A;  3ABV B;  4ENL A;  5CJ7 A;  9ICA A;  4PGQ A;  2GGJ A;  4DFJ A;  1HIW A;  4UBB A;  4XRH A;  1ZY8 A;  3SAH A;  4HJG E;  4DFM A;  2J53 A;  3R1Z A;  1CEZ A;  3LWL A;  1MPE A;  2AL6 A;  4YL8 A;  1Q1O A;  2VFU A;  1TAU A;  4O5K A;  3N1Z C;  2QDF A;  4LA1 A;  4AJW A;  2KWD A;  2BCP A;  2EKE C;  3SV3 A;  3VQI A;  2KFJ A;  2QJJ A;  4UB4 A;  3I57 A;  3CGD A;  1I4P A;  5HNK A;  4YR2 A;  3GE3 C;  2ALZ A;  2KFK B;  3UCD A;  2QB0 A;  4DSJ A;  5HHD G;  3IJI A;  4FO6 A;  1FHV A;  1NKB A;  2CRX A;  1QSS A;  4JE3 B;  4QNL A;  2AXT U;  3MHZ A;  4RQ3 A;  1D6E C;  2X8H A;  2XN9 C;  3RAQ A;  1UWX A;  1COK A;  3SQS A;  1RFK A;  1NJY A;  3LB8 A;  1ZQZ A;  2GOL A;  4LCD E;  4H50 A;  3H7I A;  3RJE A;  5FJU A;  3TX1 A;  4P6V F;  3PQB A;  3HW8 A;  1SWW A;  2MA9 B;  3ZRC A;  4CO7 A;  3CYJ A;  4KLE A;  1V5T A;  3RJG A;  3PRE A;  4HJK A;  2WX0 A;  4O5E A;  3IK4 A;  2YVS A;  2PTX A;  3ZIM A;  1STZ A;  2MA1 A;  2QCZ A;  2YAU A;  4F72 A;  3WK5 A;  2VFR A;  3QK0 A;  4NAW B;  2IO0 B;  4QZB A;  7ICS A;  5IA7 A;  4RQN A;  2KT7 A;  5AKH A;  1N60 A;  1LGR A;  2NTT A;  2MSN A;  1ARO P;  5ALM A;  5IIK A;  4PWB A;  1TVA A;  1XU4 A;  2BVF A;  2ZC8 A;  4RUC A;  1JCT A;  4O0I A;  4NM2 A;  4ECS A;  1U45 A;  3MZN A;  4YMM A;  1ZQH A;  1CUK A;  2BCS A;  3RTV A;  4RQ2 A;  3TAR A;  1AN8 A;  2K1F A;  2KAJ A;  5L1I A;  2LVO A;  2IDY A;  1B43 A;  1JUD A;  2MH7 A;  1IBX A;  7ICR A;  3RJJ A;  3M1Y A;  1XNS A;  2HBM A;  2PI5 A;  2HW3 A;  2ZVO A;  2GR3 A;  3UQ0 A;  3EPG A;  4I2F A;  4WQM A;  4KDI C;  2O2V A;  2O56 A;  2L0T A;  4HNC A;  2HTH A;  2BZF A;  2MBO A;  5ALK A;  4DOB A;  3GIJ A;  4PL2 A;  2N1R A;  1KLV A;  3RN9 C;  2JWU A;  4HPL B;  3L54 A;  1Z00 A;  2E6X A;  5IP4 D;  2XH2 A;  3PML A;  4CGZ A;  2HD5 B;  3BOX A;  2PMZ C;  3Q8L A;  4EWJ A;  2YMM A;  4HCN B;  1SKW A;  3SN1 A;  2QQ6 A;  3P93 A;  3VTU A;  2WDW A;  2AWT A;  1Z4O A;  5ALP A;  1DZN A;  3APD A;  1S8O A;  4MGI E;  2KHW B;  3Q3O C;  4KDL B;  2KKC A;  2CHR A;  3TAC B;  4B9S A;  2QC8 A;  4EX7 A;  4JQ9 A;  3OG5 A;  3VDG A;  4ECU A;  4RQ0 A;  1NEK B;  1UCV A;  4GSW A;  3VHT C;  3IJQ A;  4Q2J A;  4LNN A;  4BUG A;  3H4D A;  1V1P A;  3I28 A;  4B9N A;  2PPH A;  2C7M B;  1IYX A;  4TQS A;  1K4Q A;  5AKL A;  3DBH I;  2ZZ0 A;  1GUA B;  3HX0 A;  4TVY A;  3TWB A;  1WZ3 A;  3THV A;  1ZQR A;  2YX8 A;  5AI8 A;  4PGX A;  2XNA C;  2ZNV C;  2FKP A;  2O2V B;  5DGB A;  1FRR A;  3W8Z A;  3IBE A;  2PLI A;  5CR0 A;  1J19 A;  1D5X C;  4F5N A;  1TS4 A;  5DG8 A;  4P0Q A;  4RNM A;  4ANV A;  3RFA A;  4FLH A;  2KK8 A;  3T5H A;  4F91 B;  2W11 A;  4J9M A;  2SEB D;  2QJN A;  4KEM A;  2CKH B;  2IZV B;  2V4R A;  2E8P A;  3DBH B;  3S1F A;  4GGB A;  3MKC A;  3M6K A;  1E7U A;  3HVD A;  4DOC A;  2KN7 A;  1DYQ A;  2F2A B;  1L5U A;  1FCC C;  2LGD A;  3KH0 A;  2KFZ A;  3A9J A;  1A70 A;  2BHN A;  1PZN A;  3UIN B;  4KSK C;  1HSK A;  3SU8 X;  1V49 A;  4WAF A;  1B9R A;  2OQH A;  4YMO A;  4J9N A;  1PFD A;  5KFW A;  4DO9 A;  2WF8 A;  2OOB B;  2TPR A;  3UMB A;  3VC8 A;  5KTQ A;  2LGX A;  4KLT A;  8ICW A;  3EWA A;  3H0L B;  9ICO A;  1NHR A;  3QXG A;  4HVB A;  4RPY A;  4DXK A;  3D2J A;  4LK0 M;  1ED1 A;  3OJ4 B;  3GIM A;  3RRH A;  3RB4 A;  2MP2 A;  2Y5B B;  1Q3U A;  2Z7J A;  1P3Q U;  2Y3R A;  3AEG B;  2RLT A;  4NEW A;  1TS2 A;  1DXL A;  2W3S A;  3H12 A;  1C76 A;  3BQ7 A;  3ISD A;  3VTV A;  1RYS A;  1WXV A;  2PMV A;  4XGA B;  1ONF A;  3QKE A;  1K52 A;  3JSV B;  3ZNH B;  3MGI A;  1DOX A;  1TZZ A;  2WPF A;  2KN5 A;  4PYZ A;  3W5U B;  4K4H A;  4C56 C;  1W1R A;  3OJS A;  1QLN A;  4IQT A;  3ZDB A;  3EA6 A;  1W1O A;  5LNK 1;  3M7D A;  1BPY A;  1UWM A;  3U7D A;  4ASW C;  4Y2R A;  1FXT B;  3R2I A;  2LUE A;  2ZUC A;  3I99 A;  3NVW A;  3U26 A;  2EDU A;  2W7O A;  4Y2V A;  2JEI A;  2UVR A;  1X2I A;  1S9F A;  7ICE A;  2LZ6 A;  1KL9 A;  4KLU A;  4XYC A;  2EQ6 A;  3AV8 A;  5LXI B;  5KT6 A;  1ZQJ A;  1L2N A;  3TEX A;  2W3R A;  1SJE D;  4TMA B;  4YTM B;  4ELU A;  3CGC A;  1CMX B;  3HRD D;  5AI4 A;  4KGT A;  1SE9 A;  1C9F A;  3SQI A;  1UA1 A;  3H8S A;  2HVI A;  2KJ5 A;  3B2G A;  3BWU D;  2MCN B;  1ZK7 A;  2LMR A;  4LDT B;  2J42 A;  3NZG A;  5U1O A;  4HCH A;  3PS6 A;  5AWV A;  1RYR A;  3WAN A;  5FXF A;  4FUL A;  3NRZ A;  5C2T B;  4ADW A;  4M0W B;  2MJ3 A;  3VUX A;  1NZP A;  5AI5 A;  5DB6 A;  4HDQ A;  3IT4 B;  3ZVI A;  5J0R A;  2BVG A;  5ALD A;  4GLX A;  2KO3 A;  4BBN C;  2D07 B;  2UU7 A;  1A6S A;  2CHW A;  4ICV A;  2VA2 A;  3VFK A;  1ESF A;  3FDS A;  1HUZ A;  1N6Z A;  5KL8 B;  3PZ8 A;  4K7W A;  3SFE B;  2RHF A;  2KSO B;  2N4F A;  7ICL A;  1JAL A;  2DFL A;  4B9M A;  2G9H D;  3BYT B;  4HDO A;  3W1S C;  3HHM A;  5HMM A;  4HAI A;  2WF9 A;  1E7V A;  3GU3 A;  1WJU A;  4WQO B;  3TIX A;  3EPI A;  3DEQ A;  7ICJ A;  1C4A A;  4EMI A;  4K4G A;  4II3 B;  3ALR A;  2MBR A;  1L8O A;  3E9S A;  1FM0 D;  1QOG A;  1GRG A;  2ZIW A;  4H2H A;  4NPN A;  1SL0 A;  1MJD A;  2R2Z A;  3II4 A;  4UW9 A;  2XGP A;  3RJH A;  2PMQ A;  3RIT A;  3B97 A;  5AUK A;  3KLS X;  2QJM A;  1GES A;  2NBU A;  4H2A A;  1SXE A;  5J2A A;  3NGD A;  3DCG A;  3J9C A;  3R8B A;  3JS8 A;  1XO0 A;  4JLC A;  3IP4 B;  1AQ6 A;  5TZV A;  1WI0 A;  3F5E A;  1SZP A;  1V38 A;  2JUO A;  3Q8E A;  1R7S A;  3RRG A;  5IIJ A;  3WCQ A;  4E4U A;  4PT5 A;  1AYF A;  1TY2 A;  1WFY A;  1DOI A;  4RF1 A;  1KTQ A;  1XLP A;  2ZXH A;  3NZ3 A;  2JVC A;  2ZIV B;  3DHI C;  4FHJ A;  5F9N A;  4A90 A;  2IOH A;  3A9K B;  3JVZ X;  2K6Q A;  5ALU A;  3U52 E;  4PL1 A;  2I1J A;  4RNO A;  4N58 A;  2E8M A;  3KHR A;  3V5F A;  4Z17 A;  3AEE B;  1YZ6 A;  2Y0S C;  3BZD B;  5J0O A;  3IXS A;  3NTU A;  3ZDD A;  3GS2 A;  4LTU A;  2G45 B;  2KMD A;  4FBU A;  2OWO A;  3VVW B;  1XO3 A;  2ODG A;  7ICT A;  5FMH A;  2X50 A;  2PFP A;  2V3P A;  1NDD A;  3FM9 A;  5KAF U;  4MSM B;  2ZZB A;  5L83 A;  3H8M A;  5ALW A;  2NS5 A;  1E8Y A;  3MY9 A;  5DPS A;  3CF6 E;  4EQX A;  1OGW A;  2D3G A;  3HKZ C;  2NYV A;  1SKR A;  1NI3 A;  1X9S A;  1XF5 L;  4R65 A;  1WGY A;  5U25 A;  3DGH A;  1L3S A;  2VZK B;  3TQ1 A;  4ZYS A;  1I4G A;  1KN0 A;  3M63 B;  4G11 A;  3MC8 A;  3V05 A;  3UJS A;  2NPT B;  3W8X A;  4H4V A;  2BYE A;  4FZL A;  3P2B A;  4BC9 A;  1DOQ A;  2MBB B;  4N9F 4;  1V9P A;  4ICA A;  1YJ1 A;  3FYY A;  2YQU A;  1GER A;  2M0A A;  3RGT A;  1T0R C;  4QIW C;  4KX6 B;  3ML9 A;  3FWA A;  4ZHO A;  1YQ3 B;  1TKY A;  3VXW A;  1LVH A;  3MFI A;  4DXG A;  3AED B;  2W9C A;  1XEE A;  4ZRJ A;  3QZ8 A;  4YXD B;  3WU2 U;  1RAX A;  2FCS A;  3V7J A;  2JXT A;  4C0Z A;  3AU2 A;  3Q8R B;  4RQ5 A;  5D46 A;  4U7C A;  3EJD B;  3H7S A;  2JEJ A;  4EZ9 A;  4JWU C;  2RK5 A;  3JPT A;  1H4R A;  5KT4 A;  1WIA A;  2M19 A;  3I4K A;  3RRA A;  1F2R I;  4B9L A;  5JHB A;  3QZ7 A;  1N62 C;  3BDP A;  2GQW A;  1P48 A;  2LVQ A;  2YMP A;  1TKK A;  2JZB B;  2QAE A;  1ZMD A;  1ZQX A;  2FID A;  3Q8A A;  1X66 A;  1OUQ A;  2ISO A;  1ZX9 A;  2MSE D;  3BVZ A;  1IXR A;  2BWE S;  2MBH A;  3IFW B;  3LAE A;  4PK1 A;  4EEN A;  2KVR A;  4DYE A;  3B2F A;  4YG2 A;  2W9B B;  4ARC A;  3F2D A;  3RH4 A;  5BMG A;  2EKI A;  3Q3F A;  3BVG A;  1Y88 A;  1JRO A;  2L8J A;  3PHW B;  3AM9 A;  1VAO A;  5BMH A;  4E3C A;  1WGK A;  1AHZ A;  1GXF A;  3N1Y C;  4F4K A;  3FKY A;  3GRS A;  5J2D A;  3DV9 A;  2KVZ A;  1D8L A;  2GGH A;  5KFB A;  1SGG A;  3WKE A;  2FIF A;  1J97 A;  4GIB A;  5J0P A;  5AM4 A;  2KJ6 A;  3HM3 A;  5T8I A;  3ZRF A;  7ICK A;  1ZGU B;  3POP A;  3NZS A;  5KAI U;  3KWL A;  2K4H A;  4OZB A;  1U49 A;  2AAQ A;  3U2S C;  4US8 A;  2WB1 F;  2K89 A;  2KWU B;  1GPX A;  4M52 A;  1UHU A;  1LKY B;  2WF6 A;  1EBH A;  4FE3 A;  3QCA A;  3G6X A;  3STP A;  4PWC A;  3WKD A;  4CF4 A;  4NM1 A;  3CIR B;  1D4B A;  2F1J A;  7ICG A;  4KIK B;  3PST A;  5DB8 A;  9ICI A;  3WK7 A;  2BYF A;  2J6T A;  2ZW1 A;  3TCS A;  1DTN A;  8ICH A;  5AKY A;  2RR9 A;  3CYM A;  3T5K A;  1QLB B;  2HJ1 A;  4YN4 A;  5KFD A;  1S0M A;  2CJO A;  2OQY A;  4TUR A;  3D2S A;  4MGZ E;  2OAI A;  1WGR A;  2YVC A;  1J0G A;  1BML C;  1WUE A;  2L05 A;  5I1W A;  1TS3 A;  3IN5 A;  2LUM A;  4KMU A;  3UQ2 A;  8ICN A;  4MMW A;  2BQQ A;  3DG7 A;  1D9F A;  1B0X A;  3N20 C;  2XI9 A;  3MGH A;  4K81 A;  4ZA0 A;  2WXR A;  1KLU D;  1ZQY A;  1OQR A;  5EOZ A;  2ZPY A;  2MBE A;  3AU4 A;  2EZY A;  3QUQ A;  2A1J B;  4C8K A;  2D11 A;  1KRH A;  3P4P B;  3A1Q B;  4PVH A;  9ICX A;  2JH7 A;  3VA8 A;  8ICL A;  2H88 B;  2NTS A;  2ASL A;  8ICJ A;  4NY0 A;  1ZW7 A;  2FI1 A;  3IG3 A;  2GGG A;  8ICK A;  2PCE A;  2FPL A;  3AEF B;  5AKE A;  3Q3M C;  3PRZ A;  2MW5 A;  3C28 A;  5MPO A;  1IPG A;  1QF6 A;  3L16 A;  2BS3 B;  1JRP A;  3F53 A;  4BFR A;  4KIK A;  2QDE A;  5JRB A;  3NXL A;  1N62 A;  4C80 A;  4IQW A;  5DBA A;  4YSZ B;  2QVH A;  1DGS A;  4NLN A;  1SE2 A;  2RDB C;  5J18 A;  1XS2 A;  2GSH A;  5KFJ A;  3DK4 A;  2HDO A;  4I2G A;  4DQO C;  1N5W C;  4B0E A;  3NVW B;  7ICF A;  2N9K A;  2ICI A;  4K4I A;  3RCZ A;  4NNJ B;  4HPP A;  5GTH U;  2GRT A;  1SKS A;  4AUQ C;  2HZG A;  1U47 A;  2V4L A;  5GTI U;  2N9P C;  4QZC A;  2N9X A;  1MBT A;  1NJZ A;  3NHE B;  3DG6 A;  4KMO B;  1Q0W B;  1BVS A;  4IP5 A;  3QEB Z;  4YWO A;  4X57 B;  3NUQ A;  3LWM A;  5AI6 A;  4I2I A;  4HG0 A;  3DBL I;  3N97 B;  4ROP A;  1ZD2 P;  2PTZ A;  3QU7 A;  1P98 A;  2MP2 B;  2L3Z A;  4LJO B;  1MNS A;  4TUQ A;  2DKX A;  1NEL A;  3MHS D;  4K7Z A;  1G6J A;  2W7P A;  1L3V A;  3NS8 A;  3WA0 A;  2LXC A;  2ZIX B;  4I6N B;  3MC1 A;  4K8D A;  4GGQ A;  4ECX A;  3KZI U;  3NS1 A;  3H6N A;  1X6I A;  8ICV A;  3V60 A;  2OM6 A;  1R6W A;  2G09 A;  4FP1 A;  3D47 A;  2ZTE A;  4F4X A;  3KKA C;  2ZJ5 A;  9ICH A;  1AWD A;  1M4V A;  1RFA A;  3EEC A;  3EHV A;  2BB6 A;  3EGR A;  2FNJ B;  2HMX A;  1TBE A;  1ZPS A;  3ZI4 A;  2R8J A;  3ISC A;  1E0Z A;  5G5G B;  1ZRN A;  4O3Q A;  2BYV E;  2YVF A;  3F2B A;  1ZQP A;  3UJ2 A;  1XS9 D;  1K53 A;  3ZNI D;  5DDM A;  4G9B A;  4WJQ A;  4GRT A;  1X9X A;  2QHO A;  2E5A A;  2FMS A;  3IG8 A;  4H4U A;  2LGI A;  1KKO A;  4R8U A;  2BC1 A;  1F9J A;  1OW5 A;  1NHS A;  2B21 A;  5KFL A;  2XH7 A;  1FFU A;  4WJN A;  4JAY A;  4B9U A;  3RT3 B;  1V81 A;  1Q3V A;  3AE4 B;  4OZA A;  4IDI A;  4XWT A;  2QKN A;  3QX1 A;  4Z6D A;  2L1A A;  1T0Y A;  4AS1 A;  4E5T A;  4X2P A;  4F93 B;  1MQ3 A;  1XAN A;  2H3I A;  3UJR A;  3TAQ A;  4FJZ A;  4JMU A;  3V62 A;  1BZL A;  5FR6 A;  2BB5 A;  2BF8 B;  3VTW A;  2WQY B;  5K8E A;  2BPC A;  4O3O A;  5DB9 A;  9ICU A;  5ADZ A;  1SJD A;  4FA6 A;  4HRO A;  5H92 C;  1FIQ A;  2RDJ A;  1UXY A;  2C28 A;  2A8X A;  5KG0 A;  3C19 A;  2PVO D;  5I4D A;  1XLQ A;  2PKO A;  3L5O A;  8ICA A;  4P4O A;  3G6V A;  4ED1 A;  5C3J B;  5AE1 A;  1OJT A;  2OHF A;  2UVU A;  5AZF A;  3DWG C;  4XDC A;  4RGO S;  4BWJ A;  1W1M A;  1R4N B;  5IIL A;  7ICO A;  4QWD A;  2PGE A;  3APC A;  2PI4 A;  1NZB A;  3IVF A;  1FPY A;  4M9N A;  3SQP A;  1M6Y A;  1JOA A;  2PP0 A;  2GBN A;  2IO1 B;  3TBL D;  4O95 A;  1C4C A;  1Z3E B;  5CX3 A;  4J9K A;  2HHV A;  1IV8 A;  4KN7 A;  3A4R A;  4A20 A;  2FYM A;  1WM3 A;  1F0Z A;  2GQU A;  4AYB C;  3JW7 A;  1FRD A;  2XK5 B;  1PQS A;  5DPW A;  1EO6 A;  2XEW A;  5KFK A;  4E6M A;  4ICU A;  2R18 A;  3H7P B;  1BWC A;  9ICQ A;  3F2C A;  1NVI D;  2V9W A;  1OTR B;  4ECY A;  4HRS A;  1FXA A;  4OZC A;  1L8P A;  1XDI A;  2YQE A;  3RJK A;  2Y9U A;  2MUT A;  3Q8M A;  2QJL A;  4MLA A;  2K8C B;  1M6I A;  4UB6 U;  4YXJ A;  5AEK B;  3AE6 B;  3AE3 B;  5KHO A;  4MGG A;  3KYD D;  1L7O A;  1TZO A;  2YY6 A;  4LLG M;  4KT2 A;  4NLC A;  3THU A;  3VUW A;  2GDQ A;  5FJT A;  3L13 A;  1FO4 A;  3MAB A;  2GWS A;  3EFC A;  3I3T B;  4DCC A;  3ZDT A;  4YTN B;  1RPL A;  2GL5 A;  3LAD A;  1S1Q B;  2LI5 A;  4NLB A;  2AXR A;  2D5G A;  3DHG C;  3PK7 A;  4PZF A;  1AOG A;  1AHU A;  4M0X A;  2WU2 B;  3M8R A;  1ET6 A;  4DL6 A;  4K7S A;  3FW7 A;  4QZA A;  4AYB F;  5DQH A;  3DBL B;  1WE7 A;  1A76 A;  3ZTC A;  5KT2 A;  5KT3 A;  1X6J A;  3GOE A;  3PW2 A;  5DQG A;  2Y1J A;  3RNF C;  1QOA A;  3M62 B;  3ETR A;  2BBC A;  2HSZ A;  1T4G A;  1NK6 A;  4KSL C;  1ZKQ A;  2ZZC A;  3N4E A;  4FAD A;  1MRA A;  4PVE A;  4AJY B;  4BBN F;  2ZUD A;  4Y2Q A;  4F3O A;  3V5C A;  3ZVH A;  3DDC B;  3HUI A;  4W9E A;  3ZTD A;  4EZJ A;  2EH9 A;  2W9C B;  5KFV A;  2VA3 A;  2D3C A;  4MEM A;  3DPD A;  4RFB A;  3OWE B;  3N7P D;  1C77 A;  2Q4W A;  3OZM A;  1JXL A;  4RMA A;  3Q6B A;  1XD3 B;  2J6S A;  4NLK A;  2K5P A;  1Z4N A;  4LZG A;  4MGY E;  2H3F A;  1YN4 A;  4TQR A;  4M8M A;  3EW9 A;  5JHA A;  5IIM A;  1ROE A;  3DVG X;  9ICE A;  1JQ4 A;  3GD3 A;  3PWI A;  1N61 C;  4MM3 A;  2HOQ A;  4ZRP A;  5KG1 A;  2E3T A;  2VKQ A;  1ZQQ A;  2KLG A;  5J2C A;  2ZCB A;  1VZ6 A;  2EMS A;  2P8C A;  4IQV A;  5G5H A;  4YR3 A;  3M9M B;  2XC9 A;  1CK1 A;  1RLF A;  4Y2U A;  1L3U A;  2HHS A;  3BIN A;  4HK2 A;  4TVW A;  2FPM A;  3U30 A;  2VJ4 A;  2BQ3 A;  1NDA A;  1LXD A;  2PW9 A;  5DBC A;  5C23 A;  4UAW A;  2XY7 A;  5CWR A;  1Q1R A;  3CT2 A;  1WCN A;  1WE6 A;  4LNF A;  4XC2 A;  3L0W B;  3O0H A;  1L7P A;  3FJ4 A;  5AE3 A;  3IM1 A;  2PXI A;  3TJI A;  3QPE A;  1Q1W A;  1S0N A;  2KTQ A;  5J0W A;  1ZQF A;  1EWY C;  1WY8 A;  3NRW A;  3ECI A;  4IWQ A;  5EWF A;  4Y2Y A;  4H4Z A;  4G8T A;  3OZY A;  5ALG A;  1QLT A;  1FD6 A;  5ENL A;  4CCH A;  5DG9 A;  1TK8 A;  4LJX A;  4K1W A;  1WMH B;  1QQR A;  5IAA C;  2NVU I;  1CRX A;  5C1Z A;  3IAM 1;  3ZDM C;  1ZQC A;  3V61 A;  2WBA A;  3TFS A;  2JX5 A;  2P13 A;  2K8C A;  3GRT A;  1V97 A;  1H38 A;  2POD A;  3TEW A;  5J2I A;  2DPI A;  2W43 A;  4PYU A;  1SV0 A;  7ICN A;  2G0A A;  2HOF A;  5D2M B;  4PHE A;  1L5P A;  1KW4 A;  5EWG A;  3BQ0 A;  1ZQO A;  4IRD A;  4M47 A;  2L0F A;  3A4S C;  3AU5 A;  1L7M A;  3MC9 A;  3Q3N C;  2P35 A;  3W8W A;  1VDV A;  1KTK A;  4BVU C;  2Y5C A;  3AEC B;  3BQ1 A;  2J0M A;  3WAL A;  5ALO A;  2E8N A;  3N4F A;  4YD1 A;  1LM8 B;  3ZO5 B;  3R11 A;  3TOY A;  4BGD A;  2INP E;  4KLF A;  4NLG A;  4BBY A;  4I2H A;  5CP2 A;  1KQQ A;  8ICI A;  2WXL A;  2LFI A;  3W1Y A;  4ED3 A;  3JPQ A;  2I38 A;  4PZO A;  5D49 A;  1DOY A;  2L5Y A;  3SZ2 A;  3ZJU A;  1MVK A;  5AKK A;  4WJP A;  1I4R A;  1WX9 A;  3C23 A;  4UAV A;  4IWP A;  3N3K B;  2J6U A;  3V6H A;  5ALY A;  1NK4 A;  4PS8 A;  5IDZ A;  4Y2X A;  1FFU C;  3VRB B;  1WVE A;  2AGQ A;  2WP9 B;  1URJ A;  4EQS A;  3MSY A;  3NRZ B;  2NV3 A;  1OEY J;  4EX6 A;  2KDM A;  3UCC A;  1JX4 A;  5ALT A;  3A0H U;  3T3O A;  1F5S A;  1AW7 A;  3GFK B;  4A6Q A;  2K4P A;  2WXQ A;  5EDS A;  1WGD A;  1W1K A;  1F1H A;  2DYB A;  2KJ8 A;  1J2M A;  3KBB A;  1FHU A;  4Y2J A;  4WIP A;  1ECQ A;  3U4F A;  1KM7 A;  3D46 A;  2RPQ A;  5AK5 A;  1WX7 A;  2VJ5 A;  2LWP A;  3N1X C;  3PZ7 A;  4NJ8 A;  3KZX A;  2XGQ A;  1ZUD 2;  2DBY A;  2KDB A;  5EBK A;  1K50 A;  3TL5 A;  4KX5 A;  2V3N A;  5J8Y C;  4C4V A;  5C5J A;  3EUB 2;  5AZG A;  2PGW A;  1QQ5 A;  3AE8 B;  1IBX B;  2WFA A;  4L2Y A;  5DPT A;  5KFX A;  3X0W A;  3OGU A;  3P1M A;  4KLJ A;  4RQM A;  1ZD3 A;  3PLV A;  4ACO A;  3DEE A;  5FKA C;  3D9X A;  3HT3 A;  4P16 A;  1GJZ A;  3B9J B;  5ALR A;  4NEV A;  4OHJ A;  3WK6 A;  3KUZ A;  1C7Y A;  4DHG A;  1E9M A;  3FV9 A;  5BYS A;  2C3C A;  2HQM A;  4JK1 A;  3MR6 A;  2XCA A;  3N4M B;  2M0N A;  3GZF A;  4RPX A;  2CHX A;  3D2N A;  5ALQ A;  2ZW0 A;  4TUS A;  3Q8K A;  1NHQ A;  4GXI A;  3A7A A;  2BKF A;  3S1C A;  3WAP A;  3EJB B;  1MC8 A;  1L7Y A;  4FBJ B;  4OJP A;  2WOI A;  4K7U A;  1Z19 A;  4EMW A;  3C5F A;  3EZ5 A;  1JRU A;  2BS4 B;  3RJF A;  3R3M A;  4UD8 A;  1VZ8 A;  2V4Q A;  3O0F A;  4OJO A;  5KG3 A;  1ZE3 D;  1E7P B;  2V1Y A;  3AB5 A;  4BKS A;  4UB2 A;  2WNM A;  3GB1 A;  4XE0 A;  4WWP A;  1TYP A;  2A1A A;  4CF5 A;  3QTP A;  2Y4G A;  3PX0 A;  2P8B A;  3TJP A;  1BGX T;  2IO3 B;  2AQ1 B;  2CJN A;  2K9X A;  4O3S A;  4ZYN A;  1MI0 A;  2JRI B;  2KX0 A;  4OVV A;  5AHX A;  1F0M A;  4GMV A;  4M04 A;  3NUH B;  1IG6 A;  1H8C A;  4CDG A;  3KJM A;  3L17 A;  4YSY B;  4YWS A;  2PFO A;  5DLF A;  3LXF A;  5F3X B;  4CF3 A;  1A5R A;  1E8Z A;  1V1O A;  1ZQU A;  3OHA A;  4JWS C;  3BSM A;  4A55 A;  3PM9 A;  3URY A;  3BK2 A;  4ZOH B;  3TW9 A;  2JPH A;  4G50 A;  1R4N I;  4ECV A;  2LGS A;  2KYW A;  5FR3 A;  2WOV A;  2KIW A;  3TTE A;  4RNA A;  1MSW D;  5AM5 A;  4BXO A;  1XSP A;  1STE A;  4KLH A;  3PTF C;  3MUC A;  3SJN A;  3ZVH B;  4EYI B;  5KVI A;  1UUP A;  3PR5 B;  5D94 A;  4FS2 A;  1WZ0 A;  2F76 X;  1NKC A;  1I4H A;  3A0B U;  5CA7 A;  4FJV B;  4BOS C;  3MWC A;  5E79 U;  5AKX A;  1CZP A;  3SHQ A;  2QLT A;  3VRA B;  1P0R A;  1NKE A;  2E5S A;  2Z0D B;  3ZNZ B;  4IS7 A;  3GDX A;  1R4M I;  3VH3 B;  3ZDA A;  1EBD A;  1GRE A;  5DDY A;  3BZC A;  2UVW A;  3MJ5 A;  5ALL A;  4KN4 A;  4Q8E A;  1ZQB A;  3MR5 A;  5CHG A;  1GG3 A;  2AQ3 B;  4YXM A;  2NO4 A;  3BZK A;  3VCN A;  4EOY A;  5D6J B;  1ZDX A;  2NRW A;  2DYO A;  1QQ6 A;  3PMN A;  4PH5 A;  1J7C A;  5DCN A;  2R8G A;  2KFN A;  5LXH A;  4YQW A;  3VC5 A;  4Q44 A;  2PPG A;  1YOV B;  4HPN A;  1UA0 A;  3RFZ B;  3BQ2 A;  1VQZ A;  3QYP A;  3IC9 A;  1BXT A;  4EEL A;  3SEN A;  4LNI A;  3K4G A;  4NQK E;  3H7V A;  2RGF A;  1QCK A;  3VDZ A;  3V6J A;  5BPC A;  2IND C;  3NY5 A;  2RDG A;  3IG5 A;  1LPF A;  2IY0 B;  4H19 A;  9ICP A;  2D3B A;  2KDI A;  1Q46 A;  2QKQ A;  4DNA A;  4QW9 A;  9ICN A;  2K60 A;  2GRI A;  3E0F A;  2O6V B;  3VC6 A;  4F71 A;  2PKE A;  4DQR A;  2FCM A;  1T8E A;  3R10 A;  4NJ6 A;  2ZNV B;  4M2Y A;  5IN7 A;  2F1I A;  3JPR A;  3UXO A;  4DSI A;  2X38 A;  4Q43 A;  4MH0 E;  9ICC A;  3UXP A;  1SBB B;  1U9L A;  4GU2 A;  3I6E A;  3OPX A;  2GB1 A;  4DLG A;  2R2O A;  3DK8 A;  3QFB A;  3RAX A;  3V7K A;  5KFS A;  2YN4 A;  3OSN A;  4DDG D;  1WJ4 A;  4MFA A;  3SYZ A;  2C2D A;  5ALJ A;  1UT8 A;  4RQ4 A;  3CRX A;  2RDH A;  3AE2 B;  3AE9 B;  2KD0 A;  3C29 A;  3FW9 A;  3QWZ B;  2P88 A;  2BW2 A;  2I1Q A;  2MNR A;  4LNK A;  3ES8 A;  1S10 A;  3DES A;  9ICS A;  2G5I B;  1SF0 A;  2W9B A;  2JF5 A;  2F1H A;  2RMM A;  2FE8 A;  3MP9 A;  1E10 A;  1ZQT A;  1TFR A;  5AK3 A;  1P7D A;  3QEA Z;  4R63 A;  4JUZ A;  1CI4 A;  2ONE A;  2KZZ A;  2DAJ A;  3F5A A;  2JR5 A;  4EEY A;  4JN8 A;  2PTL A;  2QB0 B;  2ZEQ A;  4ANU A;  4YVZ A;  4OCZ A;  4Y2S A;  4J9S A;  5EE1 A;  5H2F U;  7ICU A;  1EU4 A;  2OKT A;  3A7U A;  3BJY A;  2WTF A;  3MGV A;  1BT0 A;  3FC4 A;  4GC6 A;  1PK1 A;  8ICO A;  2IYD B;  1TKE A;  3AQF A;  2V6O A;  3T9P A;  4GDL B;  2AKZ A;  3AMZ A;  8ICC A;  2A5U A;  1WSP A;  4HEA 1;  3C21 A;  1T5X D;  2RAB A;  4DLE A;  4K1R B;  2K39 A;  3UF8 A;  3Q2A C;  3RNC C;  3QQ8 B;  3KQ4 A;  2CU1 A;  1D5Z C;  2LGY A;  4IC7 B;  1GEU A;  1QOB A;  4NQL B;  4G7F A;  1XWL A;  1X40 A;  4AP9 A;  5AKJ A;  3JYU A;  1RYU A;  4FFD A;  4C8N A;  3TKA A;  2Z0E B;  1VR9 A;  5CHW A;  4ANX A;  3S1E A;  4MFC A;  5AI0 A;  5J2K A;  3S5S A;  1RRB A;  3QAQ A;  4YFK A;  3MR2 A;  1LFD A;  1WXA A;  3GC2 A;  1F2R C;  3LB8 C;  5IKC M;  4KLI A;  3CAW A;  2K8B B;  4IWO A;  4WUR A;  2JU6 X;  2FLN A;  3UMG A;  3DG3 A;  2NQW A;  2JMG A;  1OFF A;  1JEH A;  4B6W A;  4HYR A;  4BUR A;  3SAG A;  3BS5 B;  3RR7 A;  1D7Y A;  3NVZ B;  4UB1 A;  2LYH A;  4OJ5 A;  2ZUB A;  3VTE A;  2KZ3 A;  1PDX A;  1J2N A;  8ICS A;  2EQY A;  5J2B A;  2X8C A;  4C4S A;  2Q4T A;  4X5V A;  1T7P A;  4HN8 A;  3H4K A;  4IRC A;  5E6O A;  5IIO A;  2POZ A;  3TAP A;  9ICL A;  1WGG A;  4RQ8 A;  2G4D B;  3KVF B;  3RBD A;  3RO6 A;  1SSN A;  2MQJ A;  1QIL A;  5AKG A;  4MSQ B;  1ZQN A;  3CGB A;  2UVV A;  3EUB 3;  2XID A;  4NL9 C;  5DQI A;  1NJW A;  1HUO A;  5HQX A;  5B66 U;  1QTM A;  4F4R A;  2WLB A;  2AL2 A;  4FZN A;  3ENL A;  2O6K A;  3ZW3 A;  2KOB A;  5I1V A;  4DK5 A;  3PO4 A;  1LO5 D;  5DG7 A;  5JCM A;  1IGC A;  3CST A;  3KD3 A;  1ZOL A;  3W1S A;  2GBJ A;  9ICM A;  3JPP A;  4DL5 A;  4BKG A;  3RJA A;  1N63 A;  3SAF A;  1X1M A;  3KYC D;  1EBG A;  1KN5 A;  4B9V A;  4DHJ B;  2I2Y A;  2AGO A;  2JZZ A;  3KWV A;  4NZL B;  2DNF A;  3R2T A;  2GQT A;  2AX5 A;  4MEY A;  2UYZ B;  2WDV B;  1UT5 A;  1Z1V A;  1OXJ A;  4DEZ A;  2PS2 A;  5FJO A;  2OXO A;  3T3F A;  2KX3 A;  4YR0 A;  3QX7 A;  1CQV A;  1WWT A;  1HA5 A;  1WJN A;  2NCN A;  3GZN B;  1W1J A;  2DKZ A;  3H0M B;  1MG4 A;  2CR5 A;  2D3A A;  4TUU A;  3DDH A;  5J2E A;  2PMZ F;  4C00 A;  3SN0 A;  2IBI B;  2JRH A;  3BK1 A;  3L10 B;  1WUF A;  1H2I A;  2KZM A;  1UZX B;  4WH4 A;  2CS4 A;  2DW6 A;  1UGJ A;  8ICP A;  9ICW A;  4M0A A;  2C7H A;  1LQB A;  4JGH B;  3ZGZ A;  3M9O B;  3ES7 A;  2KWV B;  3RZF A;  1DII A;  4HKQ A;  4QIW F;  3WK4 A;  2VH1 A;  3URH A;  4EBD A;  3LLB A;  2RDI A;  4DSF A;  2O6V A;  2PJH A;  2WU5 B;  3WAO A;  5ALH A;  2EXR A;  1Q10 A;  4F8R A;  2HVH A;  2C2E A;  3KUC B;  1PDZ A;  7ICH A;  2KMM A;  3H8H A;  2PFQ A;  2KAN A;  4HYK A;  5KFR A;  4E71 A;  2LKY A;  3DED A;  3HJE A;  2W03 A;  5JUM A;  3LDZ E;  5L9X A;  4PPX A;  4A8E A;  1XC9 A;  1QSL A;  3SI8 A;  3P4Q B;  1WR6 E;  2EQ9 A;  1TYT A;  4IR9 A;  4R8U B;  4TKN A;  1BNP A;  1LKY A;  3ML8 A;  5J17 A;  4MF8 A;  3TSS A;  2W9A A;  1J7B A;  3NVV A;  3ZD9 A;  1JWS D;  2RRD A;  3N7S C;  1WVF A;  2CDU A;  3CP8 A;  2FUH B;  2WHE A;  2KQS A;  2WS3 B;  4IM3 A;  4ZRQ A;  3RUL A;  1V5O A;  3TEY A;  1FFV A;  4EMJ A;  3QU9 A;  8ICB A;  3LK9 A;  3PLU A;  3H8A A;  2I6X A;  2D6F C;  3ZXV A;  3PV1 A;  4DQP A;  5EWE A;  2DPJ A;  1IUE A;  1MOK A;  1OQY A;  2K8B A;  1VJK A;  1YD8 U;  3HPO A;  1MBB A;  2LHD A;  5FXP A;  1P43 A;  4K2S A;  5JCI A;  3M8S A;  1UF0 A;  3K1Z A;  5JRT A;  2MX2 A;  2HHQ A;  4MFF A;  1M94 A;  3OC4 A;  2W04 A;  2ZTD A;  4MKS A;  4PHD A;  3WKB A;  2F8K A;  1EUV B;  1E8X A;  3AE5 B;  4HNL A;  2QGY A;  4NY8 A;  4F4W A;  1MG8 A;  3V6C B;  2F8L A;  2N0S B;  3UQB A;  3ZJT A;  2LJI A;  4WJO A;  1GRT A;  2CFY A;  2OPJ A;  1MA7 A;  4EEK A;  2KEY A;  3Q8C A;  2C3D A;  3K1G A;  1YQB A;  2OG9 A;  3VR8 B;  4DWI A;  2N1W A;  4XQ8 A;  4MF2 A;  3FYH A;  3NJT A;  1KKR A;  1SJA A;  1S5L U;  3DGB A;  1S3S G;  2W9N A;  2KDF B;  1EC9 A;  3OW1 A;  2ONQ A;  4BV6 A;  3VCC A;  5EE9 A;  3RNM A;  1HZ6 A;  2V3S A;  3OHB A;  5ALF A;  3ETR B;  5KG4 A;  4P1C C;  1HQR D;  2NQL A;  4LDT D;  3R25 A;  4MHV A;  3S47 A;  2HBL A;  2ASJ A;  3TQP A;  3M3J A;  1GRA A;  4C8O A;  2FDR A;  2K4E A;  2VRR B;  2Y5P A;  1ELS A;  3EAN A;  3TJ4 A;  1KFT A;  1RYJ A;  2KTF A;  2P6R A;  2OYY A;  2AQ2 B;  5AKI A;  4O5C A;  1D9D A;  5J2F A;  4HXD A;  2Z8L A;  1L3T A;  4M9J A;  5AIB A;  3N9Y C;  3CNH A;  2KKP A;  2AQ0 A;  3N7R C;  4E74 A;  2WP5 A;  1JN3 A;  1PUZ A;  4C8L A;  1WYG A;  5AM2 A;  3P63 A;  4FXC A;  1FEH A;  2WXO A;  1PUT A;  2BWF A;  2V9H A;  3FIL A;  3M95 A;  3W9C B;  2QIE B;  4USA A;  3BYY B;  3UIP B;  2BVH A;  3SN4 A;  3RZW C;  5DBB A;  4H1Z A;  1ACC A;  1SL2 A;  2IGH A;  3DFY A;  4KLG A;  4GDK B;  4HKZ E;  1KDH A;  1I35 A;  1ZQI A;  2WXG A;  1V8C A;  3RH5 A;  4O3N A;  4K8G A;  5IOI A;  3TAD A;  5ALX A;  1PVR A;  4P2H A;  3ONS A;  2N7E A;  2YEP B;  2PEA A;  4K3C A;  4A3P A;  3UJF A;  2YTU A;  4KTQ A;  3EF6 A;  3IRU A;  2YLM A;  1F52 A;  2OEH A;  4KV2 A;  1VD2 A;  3C2K A;  3UMC A;  4IM2 A;  2WXF A;  4Q8F A;  1DGJ A;  4QZE A;  2N7J A;  4O1N A;  1JW9 D;  4O3P A;  1UBQ A;  1E5W A;  4DXA B;  2LJ5 A;  3RF9 A;  1K1Q A;  2GO7 A;  4BOZ B;  2LHE A;  1KJT A;  1IGD A;  4UB8 U;  2NR2 A;  1VCB A;  2BDU A;  2XIC A;  3ZUN A;  2YB4 A;  3APF A;  4WWM A;  1MHX A;  2KNB A;  2HI0 A;  2NRV A;  1RM6 C;  2CHZ A;  5KFO A;  3RI7 C;  2V0G A;  1ZKH A;  3PWG A;  4EQR A;  2H3Z A;  4G3X B;  2GR1 A;  4M9G A;  2PIA A;  4IZG A;  6ENL A;  4R64 A;  1KCZ A;  5KT7 A;  2AYO B;  2XK5 A;  1ONE A;  2XGZ A;  2O3G A;  4B0M A;  4KLO A;  1COO A;  2GGE A;  4XX5 A;  3H8W A;  4KLL A;  2L7R A;  5AUI A;  5EE3 A;  4AQ7 A;  4GDK A;  1S77 D;  3U7Z A;  3B0Y A;  4CE6 A;  3Q8P B;  3QA8 A;  1T3N A;  4W9H A;  3H9D A;  2FCQ A;  4CHK A;  5FS7 A;  3DBS A;  4FDC B;  3IHQ B;  4GIR A;  2LM4 A;  1MHH E;  3V3X A;  1F9C A;  2WHI A;  2OZ8 A;  2DQN B;  3C1Z A;  3W2D A;  2NPX A;  3UJE A;  2XO7 A;  4W9L A;  3ZNG C;  4BX9 C;  3NZU A;  1N2X A;  3TSJ A;  3KW5 B;  1N61 A;  2R61 A;  3SR6 A;  3RR8 A;  3DQ0 A;  3SD7 A;  2NBW B;  3TUO A;  3PX6 A;  4H4P A;  4OD0 A;  4ACF A;  4BKS D;  1SE3 A;  4BZA A;  1ZMC A;  3UM9 A;  1OQQ A;  4QZ8 A;  5K4L A;  1DNC A;  2W82 A;  2Y1I A;  1WRI A;  3MTN B;  2F77 X;  2W55 A;  3LYS A;  4RUA A;  2JZB A;  2CU3 A;  2IY1 B;  1E9I A;  3HRD C;  4GLS C;  2L83 A;  4H4Y A;  3DBR I;  2KK0 A;  5HHZ A;  1E6E B;  4DBG A;  2LM1 A;  2DZM A;  2A4Z A;  1BQG A;  2KKV A;  2LVP A;  3Q6J A;  3U9I A;  3UGV A;  3ZLF A;  4DQS A;  2BVC A;  5L1K A;  2P0I A;  2Y3S A;  5D3I B;  1TIF A;  3CXB A;  3J81 j;  4EM3 A;  3UXN A;  1TZ1 A;  4II2 B;  1QH9 A;  4PJ0 U;  3UQA A;  2F3N A;  4GC7 A;  3PNC A;  2KOX A;  2KIC A;  3FAH A;  3HWT A;  1WR1 A;  1Q5W B;  1ZXH A;  4H4W A;  3GY1 A;  4DWD A;  4HPM B;  5FS8 A;  1SEB D;  4P0P B;  3VUY A;  1PGA A;  2FCN A;  3AI5 A;  4A3R A;  5KFA A;  1GOZ A;  8ICX A;  3AQE A;  3AEA B;  3T5J A;  2H3V A;  5FS6 A;  2K8H A;  3DVN V;  4FX9 A;  4NJ7 A;  1BNO A;  4XWW A;  3C1Y A;  3LVV A;  4P1B C;  4EM4 A;  4IQU A;  3BS5 A;  3D32 A;  4GXK A;  4GOC A;  2OLA A;  4E4F A;  3GE8 C;  1FEA A;  3JSV A;  3SBF A;  1RG6 A;  2W8L A;  2AU0 A;  5HR7 A;  3TWA A;  2D10 A;  4IOI E;  2B6G A;  4DFP A;  1GB4 A;  2LXA A;  2K25 A;  2EQ7 A;  5BOF A;  3Q8B A;  3FG2 P;  1MN8 A;  1J7A A;  1TAM A;  5KNI A;  3RB6 A;  2GLS A;  2PP3 A;  4XUS A;  3FXG A;  1IIP A;  1B4F A;  3HW2 A;  7ICM A;  2TSS A;  5LLI A;  3IJL A;  2ZIX A;  2R8D A;  4B9K A;  4GR1 A; 
#chains in the Genus database with same CATH homology
 2BS4 B;  1EWC A;  1N60 C;  1ET9 A;  2MJE A;  1VZ8 A;  3RJ8 A;  4TSS A;  1VLB A;  2WXH A;  1VRA B;  1ZE3 D;  1E7P B;  3AB5 A;  3HVZ A;  2FUG 1;  2G1E A;  4N58 A;  2WNM A;  3AEE B;  3GB1 A;  4XE0 A;  3BZD B;  2Y4G A;  3IXS A;  3GS2 A;  4LTU A;  2YEP F;  2UUV A;  2WXK A;  2KN4 A;  2AQ1 B;  2CJN A;  1DIQ A;  2K9X A;  4IKG A;  1AHV A;  1ENF A;  1MI0 A;  1XO3 A;  5GXG B;  3UI3 A;  2JSV X;  2V3P A;  2BS2 B;  2KAC A;  1GB1 A;  1N5X A;  4C7Y A;  3BII D;  2BT6 A;  1ZP0 B;  3NUH B;  2ON8 A;  2B76 B;  3KJM A;  4OVZ A;  4YSY B;  1W1Q A;  3LXF A;  1NI3 A;  1XF5 L;  4TQ0 A;  1V1O A;  1E8H A;  3NVY B;  4DNS A;  2VZK B;  1ZR6 A;  4ZYS A;  4N6E B;  1I4G A;  3IAS 1;  4JWS C;  3V05 A;  4A55 A;  3W8X A;  3FIL B;  3PM9 A;  5D79 A;  2VFT A;  3ZQ4 A;  3URY A;  3BK2 A;  4ZOH B;  4BC9 A;  4TQ1 A;  4XDD A;  2DYM A;  5FR3 A;  5L6F A;  2M0A A;  4RNA A;  3FWA A;  4KX6 B;  4OW0 A;  1STE A;  4RCO A;  4ZHO A;  1JWU D;  1TKY A;  1YQ3 B;  2P3H A;  4MT5 A;  2LMC A;  4DXG A;  3AED B;  1CJE A;  1UUP A;  1XEE A;  4YXD B;  1HZ5 A;  2INN E;  2PVG C;  2JXT A;  3P4S B;  1I4H A;  3L4P A;  2FBW B;  1CZP A;  3VRA B;  4JWU C;  1NYR A;  2RK5 A;  2H89 B;  3LYY A;  2OED A;  2QPM A;  3A7R A;  2M19 A;  1F2R I;  1P7E A;  2N9L A;  1N62 C;  2MEK A;  3MJ5 A;  4ITK A;  4KGR A;  3Q8A A;  2AQ3 B;  1UNS A;  4KKI A;  2Q85 A;  1ZDX A;  3BVZ A;  2Y08 A;  1TY0 A;  2DYO A;  2V4I B;  1J7C A;  3LAE A;  4BCA A;  3B2F A;  1B1Z A;  4ARC A;  3O13 A;  1FNV A;  1XCT L;  3NS1 B;  1TJE A;  2EKI A;  5BMG A;  2IJ0 A;  1C79 A;  3BVG A;  2JQR B;  1JRO A;  1YN5 A;  3RFZ B;  1VQZ A;  3AM9 A;  1VAO A;  1GAQ B;  5BMH A;  1WGK A;  1AHZ A;  1BXT A;  3C8Y A;  4JB1 A;  2BTE A;  1W1S A;  5D3D A;  2RDG A;  2WDR B;  5T8I A;  4UDU C;  3BW7 A;  2GRI A;  3Q8F A;  3POP A;  1FNU A;  1X2H A;  3KWL A;  4OZB A;  3U2S C;  4US8 A;  3B9J A;  2X38 A;  1GPX A;  1KFY B;  1SBB B;  1L0V B;  2K0P A;  4PWC A;  2GB1 A;  3NVV B;  3AE7 B;  3CIR B;  1D4B A;  4MM3 B;  4RGT A;  1JWM D;  2IGG A;  4US9 A;  2ZW1 A;  1QLU A;  4YT0 B;  2J52 A;  3AE2 B;  2DWQ A;  3FW9 A;  2RDH A;  3AE9 B;  1Y56 A;  4ARI A;  1QLB B;  2BW2 A;  1SF0 A;  2CJO A;  2RMM A;  3MP9 A;  1E10 A;  3D2H A;  2FE8 A;  2OAI A;  5FK9 C;  1BML C;  5EE0 A;  2Y3A A;  5I1W A;  1TS3 A;  2LUM A;  3GP7 A;  1EM7 A;  1K51 A;  2PTL A;  2QEJ C;  5D7G A;  3C0P A;  2L32 A;  5EE1 A;  1EU4 A;  3A7U A;  2WXR A;  1KLU D;  5G5G A;  1OQR A;  1JML A;  2WDQ B;  3FC4 A;  4C7Z A;  2GI9 A;  2IPK D;  2LEK A;  1TKE A;  1SB3 C;  1KRH A;  4GDL B;  3AMZ A;  4JPS A;  1EU3 A;  4YWG G;  4PVH A;  4PVJ A;  1NEN B;  2H88 B;  1WSP A;  4HEA 1;  3R07 C;  2NTS A;  1PYW D;  1T5X D;  3SR6 B;  4L1B A;  3CWI A;  3AEF B;  4JX1 C;  1TS5 A;  5MPO A;  1FFV C;  3KQ4 A;  3W5V B;  1QF6 A;  5HMR A;  4R3D A;  2BS3 B;  1JRP A;  1D5Z C;  4NJC A;  1QOB A;  1N62 A;  1N5W A;  4C80 A;  1L4Z B;  2WXM A;  4YSZ B;  3PO0 A;  1SE2 A;  2WXI A;  4CQN A;  2KQ4 X;  1VR9 A;  3S1E A;  1T6B X;  4DQO C;  1N5W C;  5BYR A;  4B0E A;  1KH0 A;  3NVW B;  2N9K A;  2ICI A;  1F2R C;  3LB8 C;  5AE2 A;  4WUR A;  2JU6 X;  1JWA D;  2IPI A;  2NQW A;  3TEZ A;  1OFF A;  1MBT A;  3ZYY X;  4MH8 A;  3SFD B;  3IT6 B;  1HXY D;  4MAC A;  3NVZ B;  3VTE A;  1PDX A;  3GSY A;  1XXG A;  1L4D B;  1TKG A;  1VZ7 A;  4HG0 A;  4YSX B;  4XLO A;  1XLN A;  1PGB A;  1YN3 A;  1E0Y A;  4J3O D;  1C78 A;  1SSN A;  1QIL A;  4L23 A;  1L6U A;  3AH7 A;  1W1L A;  3U4E G;  3EUB 3;  1QKZ A;  3NS1 A;  3Q69 A;  5HQX A;  2WLB A;  5JXV A;  3SEB A;  1E8F A;  1AWD A;  1M4V A;  5I1V A;  1C4P A;  2BB6 A;  3EGR A;  1ZPS A;  4REZ A;  1LO5 D;  1IGC A;  1WXQ A;  2PLP A;  3I9V 1;  3W1S A;  1E0Z A;  2WXP A;  5G5G B;  1KF6 B;  1L0X B;  2K22 A;  3RJA A;  1N63 A;  1BUI C;  5FXD A;  2VFV A;  1K53 A;  2SAK A;  2I2Y A;  2J4X A;  3KWV A;  4NZL B;  3R2T A;  2GQT A;  1YJI A;  2AX5 A;  2E5A A;  2LGI A;  2QMT A;  1XCQ L;  2WDV B;  2ACZ B;  1FFU A;  4JAY A;  2VFS A;  1CQV A;  3ABV B;  1WWT A;  1HA5 A;  3AE4 B;  3AEB B;  4IDI A;  4OZA A;  4XWT A;  1W1J A;  4HJG E;  2L1A A;  2QKN A;  2J53 A;  4AS1 A;  2VFU A;  1MPE A;  1NYQ A;  3BK1 A;  4WH4 A;  4M0W A;  2KWD A;  2BB5 A;  5K8E A;  1UGJ A;  2WQY B;  2JYT A;  3VQI A;  3ZGZ A;  4ML8 A;  5ADZ A;  1DII A;  3I57 A;  4HKQ A;  4HRO A;  1I4P A;  1YMH E;  5H92 C;  1FIQ A;  1UXY A;  3LLB A;  1RWS A;  2WU5 B;  2IGD A;  2PVO D;  5I4D A;  1XLQ A;  2PKO A;  4BC7 A;  1SIJ A;  2EXR A;  1Q10 A;  1YNT E;  5C3J B;  5HHD G;  5AE1 A;  2OHF A;  4ZHP A;  2KMM A;  3H8H A;  3DWG C;  2M56 B;  4JE3 B;  4XDC A;  4A9A A;  4RGO S;  3MHZ A;  1D6E C;  1W1M A;  2XN9 C;  1L6V A;  3DED A;  1UWX A;  1RFK A;  1N63 C;  1I4X A;  3P4Q B;  2NMQ A;  3PQB A;  3TX1 A;  4P6V F;  4O95 A;  1C4C A;  1FNW A;  2L52 A;  2YVS A;  1E8G A;  3TSS A;  1J7B A;  3NVV A;  1F0Z A;  2GQU A;  4PVK A;  1JWS D;  1FRD A;  1WVF A;  1FMA D;  2WS3 B;  4ZRQ A;  3TEY A;  2VFR A;  4EE2 A;  4NAW B;  4NAM A;  1FFV A;  2WXN A;  2MJD A;  1N60 A;  2NTT A;  4PWB A;  2JYE A;  1D5M C;  1NVI D;  4OZC A;  2BVF A;  4HRS A;  1FXA A;  1ZDV A;  4MLA A;  2QJL A;  1AN8 A;  1IUE A;  3P4P B;  2KAJ A;  1VJK A;  2P4P A;  2IDY A;  3AE6 B;  2LHD A;  2MH7 A;  3AE3 B;  5BYQ A;  1IBX A;  1I19 A;  1MBB A;  1TZO A;  5FXP A;  4LLG M;  1SXT A;  1FO4 A;  4WQM A;  4PYT A;  4YTN B;  3AE5 B;  1SB3 B;  2AXR A;  2D5G A;  2JWU A;  4PZF A;  3ZJT A;  2HTM E;  2N0S B;  2E6X A;  2LJI A;  1AHU A;  2I0K A;  2WU2 B;  3D2D A;  1ET6 A;  3Q8C A;  4RGN A;  3FW7 A;  4N59 A;  1F77 A;  3VR8 B;  1V1P B;  2WDW A;  5BMI A;  2ONQ A;  1DZN A;  1I7H A;  5EE9 A;  5HFY A;  1HZ6 A;  2QIL A;  4ZOH C;  3ETR B;  1QOA A;  3ETR A;  1HQR D;  2BBC A;  1PGX A;  1NEK B;  4Q2J A;  2BYT A;  4PVE A;  1V1P A;  3HUI A;  2Y5P A;  1RYJ A;  2AQ2 B;  1YQ4 B;  4TVY A;  4RFB A;  1T3Q C;  3OWE B;  1C77 A;  3P4R B;  5L6G A;  2Z8L A;  2Q4W A;  2XNA C;  2HDE A;  3N9Y C;  2K5P A;  1FRR A;  1TYG B;  3W8Z A;  2RPV A;  2PLI A;  1YN4 A;  1JQ4 A;  1WYG A;  3P63 A;  1ROE A;  1FEH A;  1D5X C;  2WXO A;  1PUT A;  3FIL A;  4FXC A;  4KGS A;  3W9C B;  1L0Y B;  1TS4 A;  2QIE B;  4USA A;  3BYY B;  4ZRP A;  1N61 C;  2E3T A;  2BVH A;  3AN1 A;  2SEB D;  3AE1 B;  1ACC A;  1VZ6 A;  2IGH A;  5G5H A;  4GDK B;  4HKZ E;  1CK1 A;  1FCL A;  4TVW A;  3S1F A;  2WXG A;  1V8C A;  1SJH D;  1XLO A;  3HVD A;  1DYQ A;  1FCC C;  2PW9 A;  2YEP B;  1ZXI A;  1A70 A;  3E56 A;  1HSK A;  4WAF A;  1B9R A;  2DLB A;  1PFD A;  5AE3 A;  2WXF A;  1EWY C;  2N7J A;  1DGJ A;  4RGM A;  4O1N A;  1JW9 D;  1QLT A;  1FD6 A;  3DWM A;  4LK0 M;  3D2J A;  2LHE A;  1IGD A;  2JZP A;  2Y3R A;  2UUU A;  4YTP B;  3AEG B;  4RH6 A;  5H8Y E;  1QQR A;  1TS2 A;  4WWM A;  2W3S A;  1C76 A;  1MHX A;  3IAM 1;  1RM6 C;  2PMV A;  2JX5 A;  3NVZ A;  1QOF A;  2V0G A;  1JWB D;  2P13 A;  2Q5W D;  1K52 A;  1V97 A;  1DOX A;  3TEW A;  2PIA A;  2VZK D;  1W1R A;  1FIQ B;  3W5U B;  4C56 C;  5FXE A;  2O3G A;  3EA6 A;  4B0M A;  1W1O A;  3FW8 A;  4OAL A;  5AUI A;  5LNK 1;  1UWM A;  5EE3 A;  4AQ7 A;  1P7F A;  3U7Z A;  5G5H B;  3R2I A;  1L5P A;  3I99 A;  3NVW A;  1MHH E;  3V3X A;  3W8W A;  3AV8 A;  1VDV A;  1KTK A;  2Y5C A;  3AEC B;  3W2D A;  1X2G A;  3TEX A;  2W3R A;  3TSJ A;  5E6J A;  1SJE D;  4TMA B;  4YTM B;  1N61 A;  2INP E;  3MFG A;  2R61 A;  3SR6 A;  3DQ0 A;  4BBY A;  3HRD D;  3TUO A;  2WXL A;  2K3U A;  1SE3 A;  2LFI A;  4KGT A;  3S1D A;  2I38 A;  1DOY A;  1OQQ A;  3ZJV A;  1C9F A;  3ZJU A;  4EC3 A;  1MVK A;  2W82 A;  1I4R A;  1WRI A;  1F0X A;  3B2G A;  2W55 A;  1QT9 A;  2CU3 A;  3BWU D;  2J42 A;  4A8X C;  4GLS C;  3HRD C;  1SE4 A;  2QSD A;  2L83 A;  2WXJ A;  3VRB B;  1FFU C;  2WP9 B;  1WVE A;  5FXF A;  5AWV A;  3NRZ B;  5HHZ A;  3NRZ A;  1E6E B;  1KLG D;  2KDM A;  5C2T B;  2MJ3 A;  3T3O A;  2PLS A;  3IT4 B;  1YJJ A;  1AW7 A;  2BVG A;  4A6Q A;  2WXQ A;  2Y3S A;  5D3I B;  1W1K A;  1FXI A;  3HSU A;  1ESF A;  3P42 A;  1HEZ E;  3PZ8 A;  3FAH A;  4WIP A;  3SFE B;  4A90 A;  1ZXH A;  1ZXI C;  2G9H D;  1JAL A;  2EEL A;  3BYT B;  3U52 E;  1SEB D;  2VAO A;  3PZ7 A;  3TSH A;  1RM6 B;  1PGA A;  1ZUD 2;  5HI1 A;  4DXF A;  1C4A A;  2DBY A;  1ZOY B;  1K50 A;  2MBR A;  1GOZ A;  3BVM A;  2V3N A;  3E9S A;  1FM0 D;  1QOG A;  3EUB 2;  3AEA B;  3AE8 B;  1IBX B;  2R2Z A;  4L2Y A;  4XWW A;  3VR9 B;  5AUK A;  3P1M A;  3KLS X;  3NVY A;  4KKJ A;  5HG2 A;  4H2A A;  5FKA C;  3B9J B;  3J9C A;  4OHJ A;  3R8B A;  3JS8 A;  1E9M A;  5BYS A;  2W54 A;  4IOI E;  4P16 A;  1GB4 A;  3Q8E A;  1T3Q A;  2ZW0 A;  5TSS A;  3Q8B A;  1R7S A;  3RPF C;  3WCQ A;  1J7A A;  4D2K A;  3MC0 B;  1AYF A;  4PT5 A;  3S1C A;  3A7A A;  1TY2 A;  1DOI A;  1I4Q A;  4RF1 A;  2R8D A;  1XLP A;  2TSS A;  3NZ3 A;  3T3N A;  1JCK B;  4RF0 A;  4UD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...