2W55A

Crystal structure of xanthine dehydrogenase (e232q variant) from rhodobacter capsulatus in complex with hypoxanthine
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
462
structure length
450
Chain Sequence
b'MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE DEHYDROGENASE
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 114
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w55A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w55A01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w55A03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w55A05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w55A04
1QLBB 1JW9D 1E8FA 1DGJA 3WCQA 1N5XA 3LB8C 1L5PA 4N6EB 2Q85A 2HTME 4YXDB 2MBRA 3W5VB 3NVWB 1E9MA 4HG0A 2M19A 2BVGA 1FXIA 1ZXIA 2E5AA 1W1MA 1PFDA 2PLIA 4PVJA 2QKNA 3CWIA 1DZNA 1FFUC 3TSJA 2MJEA 1DIQA 1JALA 1KRHA 1TKGA 5HQXA 3C0PA 4US9A 1QLTA 2BS4B 3AE3B 3SFDB 5AUIA 5AUKA 2R8DA 2EXRA 2CU3A 5ADZA 3VR8B 4JX1C 3B9JB 4ZHOA 3DWMA 2K5PA 3S1DA 2WQYB 1FRDA 4YTMB 3TSHA 2KAJA 1E8GA 2I0KA 5C2TB 3BIID 1IUEA 1SB3C 4USAA 3VRBB 1GPXA 4KX6B 1F0ZA 2WDRB 3GSYA 5FXFA 3NRZB 1FIQB 1TJEA 5HMRA 3D2JA 2O3GA 3RPFC 4TVWA 4O95A 5MPOA 5GXGB 3AEGB 5G5HA 1NYRA 1E10A 4JWUC 2WDVB 1N61A 4UD8A 3A7RA 1JROA 4PWCA 5G5GA 3AE8B 1E0ZA 3W8XA 1QT9A 2BVFA 2W54A 3AE1B 3AE5B 4YTPB 5EE1A 1RFKA 2VFRA 3ZYYX 3TX1A 5AE2A 3A7UA 2WU5B 2W3RA 4JWSC 1A70A 4PVHA 1N5WC 1W1JA 5AE1A 1SB3B 1YJJA 5HHZA 1EWYC 1DOXA 1FFVA 3AE4B 3NVVA 4WWMA 1FRRA 1RM6C 2Q5WD 3AEEB 1XLNA 1FO4A 1QF6A 2MH7A 2W3SA 2G1EA 3AB5A 2P3HA 1N60A 1N63A 3ETRB 4TVYA 2Q4WA 3B2GA 4PVEA 3FWAA 2PVOD 3P4SB 3D2DA 3NVWA 3W5UB 2EKIA 1NEKB 4YSXB 3PM9A 3FW9A 2MJ3A 1NENB 3FW8A 1XLOA 2E3TA 1HSKA 1PDXA 3AM9A 1ZR6A 1W1RA 1RM6B 3AV8A 2WU2B 2N0SB 2AX5A 2BVHA 3AE6B 1TYGB 5FXEA 2BS2B 1JQ4A 1ZP0B 1NI3A 4N59A 3PO0A 2QPMA 1T3QC 3VR9B 3NVZB 3P63A 4BC7A 2P13A 3P4PB 2WP9B 3D2HA 3R07C 1FMAD 2PIAA 4PWBA 1WYGA 1VLBA 1QOBA 3S1EA 1I7HA 3NS1B 5C3JB 1DOYA 2NQWA 5EE3A 3NRZA 2L83A 1FIQA 3P1MA 1V97A 1W1KA 1XO3A 1XLPA 3KWLA 1YJIA 5FXDA 3JS8A 1L6UA 2GQUA 1FFVC 1J7BA 5AE3A 3DEDA 3FAHA 1MBBA 3HRDC 5G5HB 2OAIA 2ACZB 2VAOA 3NVYA 3CIRB 3AEFB 1QLUA 2QJLA 2VFVA 2KMMA 4JAYA 4PYTA 2QIEB 3HVZA 4JB1A 5G5GB 1XLQA 3S1CA 2FBWB 2LEKA 1JRPA 1AWDA 3AEBB 2BS3B 1N63C 1L0VB 3FW7A 2PKOA 4YTNB 1E6EB 1FM0D 2BT6A 3HUIA 1VJKA 1ZXIC 1W1OA 3SR6A 2PLSA 4C7ZA 3A7AA 3AE7B 3AH7A 3NVVB 4HROA 1ZOYB 3FC4A 3EUB3 4YSYB 4LTUA 3W9CB 3KJMA 2B76B 4PVKA 2P4PA 4ZHPA 1YQ3B 2WS3B 1X2GA 2W55A 1N5WA 5D79A 2H88B 1NVID 3LXFA 2Y5CA 4PZFA 1DIIA 1W1QA 1SIJA 2JX5A 1N62A 2H89B 3S1FA 1KFYB 3LAEA 4BC9A 3ABVB 4BCAA 3AECB 3W8WA 3P4QB 3LLBA 2OHFA 2AXRA 5FXPA 1TKYA 2VFTA 4C80A 3AE2B 5EE0A 2GQTA 3AEAB 4C7YA 3I99A 4HRSA 2WDQB 1UWMA 3AMZA 4XLOA 2RK5A 3VTEA 3B9JA 1AHUA 1OFFA 2PVGC 1J7AA 5H92C 3NVZA 3L4PA 1FXAA 4BBYA 3AE9B 3HRDD 1N61C 1J7CA 2YVSA 3NS1A 5EE9A 1AHZA 4P6VF 1FFUA 2JQRB 1E8HA 4EC3A 1NYQA 4IDIA 3BW7A 1WVEA 1RYJA 1R7SA 3SFEB 3P4RB 3VRAB 1SF0A 1JWAD 1QOFA 2CJNA 1W1SA 1L6VA 3AN1A 1QOGA 1V8CA 1ZUD2 1WVFA 1ROEA 2WLBA 4ITKA 1JWBD 1E0YA 1OQRA 1CZPA 2DBYA 1KF6B 1DOIA 1T3QA 3EUB2 4WQMA 4N58A 2L52A 1W1LA 1B9RA 1I19A 2CJOA 2VFUA 1F0XA 4ZOHC 1WGKA 1VAOA 1N60C 3AEDB 1TKEA 1AHVA 2DWQA 2K22A 4YSZB 3DWGC 4FXCA 3W8ZA 4ML8A 1VDVA 2MJDA 1RWSA 1UXYA 3DQ0A 4DNSA 1PUTA 3NVYB 1OQQA 1YQ4B 4YT0B 1X2HA 4US8A 1AYFA 1E7PB 1WRIA 1CJEA 1VQZA 1N62C 3ETRA 4OALA 5H8YE 1GAQB 2M56B 2K9XA 3B2FA 1WWTA 2VFSA 4MLAA 4ZOHB 3SR6B 2R2ZA 1QOAA 4A9AA 1WXQA 1MBTA
chains in the Genus database with same CATH superfamily
3QE9Y 3BS5B 2PI5A 1GRGA 2OCEA 2VIXA 5IA7A 1N5XA 4A8EA 3LB8C 1V1PA 2HHQA 4TKNA 5DG8A 4IL2A 2ZTEA 4N6EB 2BYTA 2FMQA 1IGDA 2Q85A 4GGHA 4ZH4A 1WH3A 3G6XA 9ICWA 1K1SA 2OYYA 5IILA 2WXFA 5F9LA 4EZKA 1GB4A 3Q45A 1B1ZA 3ZD9A 2BCUA 4IZGA 4LA1A 2MAXA 4RQ2A 8ICRA 1BVSA 3P42A 5JCLA 1PVRA 2DZMA 2QDFA 3ZNGC 4H4ZA 2BDUA 4LNKA 3VUXA 4M6WB 1E9MA 3N4FA 4HG0A 1X6JA 3M6ZA 3GIMA 3PZPA 2PLPA 3MDAA 4MDKE 1S8OA 2BVGA 1FXIA 5JCMA 4YD1A 2HBMA 4MSQB 4X5VA 3ECIA 4O3MA 4LZGA 2KKCA 3CWIA 2XGPA 2BKFA 2B3AA 3IT4B 3X23A 2LVOA 4NAMA 2CXYA 5DPWA 4OZAA 1DZNA 3ONSA 3L10B 4DQRA 1DIQA 1Z3EB 2LXCA 4GIBA 1TKGA 4L1BA 4WJOA 4IUMB 5FR6A 4Z1YA 4KEMA 2V3PA 3H8SA 1WG8A 4JE3B 2KG5A 1SSNA 4KGSA 3DK8A 3ZVHA 2YMPA 3KKAC 1S0MA 2A4ZA 4KV2A 1F5SA 5DLGA 4RQ4A 2DZJA 1BPBA 5AUIA 4EUTA 1MQ2A 1WX8A 5AUKA 2M4NA 3PMNA 3H7SA 3R2TA 2GBMA 2G5IB 1B4FA 3FXGA 3M63B 2PI4A 3ISDA 4M9GA 9ICIA 3IBEA 1X42A 2ZXHA 2IY1B 4HJKA 4ZRIA 5J2DA 9ICRA 2MU2A 3ZJVA 1EC7A 1JEHA 4K8DA 4C8KA 2C7HA 1RXVA 5IIJA 3C23A 1WGRA 2KDMA 5C2TB 3EEZA 2OZ8A 4DXKA 3WALA 4G8TA 1PK1A 3ETLA 3WKCA 1JX4A 2WDRB 3N6HA 2GMIC 4C56C 3AQEA 4RQ8A 5AM4A 2GDQA 5FXFA 4RT3A 3M1YA 2LASA 3OG5A 3UQBA 2Y1JA 1TKKA 3FCPA 7ENLA 4DXFA 1PGAA 4QZBA 1OTRB 3TADC 2AGOA 3RPFC 4HAIA 4HNCA 8ICOA 3AEGB 2INDC 1KKRA 4EEWA 1K50A 3RZFA 4F5OA 2FUHB 2IY0B 3JVAA 1TAMA 1DGSA 5FP0A 1KM7A 1MUCA 3QXGA 3NZUA 4JWUC 5KL8B 3X0WA 2I5HA 2Y3SA 3KZXA 2INPE 4HKQA 3QKEA 4PZNA 1QT9A 3H0RB 2W54A 3JPTA 2EZXA 4YTPB 1QQRA 3QNMA 4DEZA 1IPGA 3BVGA 1FNUA 2W9AA 3BYYB 1JIHA 1OUQA 2HDEA 2RP5A 3DJGX 3MC8A 2J0MA 3A7UA 2AYOB 3R25A 1BGXT 3BY4B 4TQSA 5AI4A 3T8MA 2K6DB 3QARA 4EX6A 2NRTA 4ED2A 1M6YA 1X9XA 4ECRA 1A70A 3H8MA 3Q3MC 2PFOA 1D9DA 3V6KA 1S0VA 2L7RA 3A33B 1Z4NA 2JU6X 1N5WC 1ZX9A 1LQBA 1F2RI 4K1RB 4C4VB 4GGBA 1XDIA 1F9JA 3M9MB 4K7SA 3DBSA 1YEYA 1X9WA 1K51A 4MF2A 8ICWA 3TAQA 1FFVA 2H5XA 3HSUA 1ET6A 4MF8A 4HVBA 2E8OA 5J2AA 1T5XD 1V5TA 4NAWA 2DYBA 2ISOA 3SAHA 5AHXA 4OZBA 3CGEA 2RDBC 4F4KA 3B1LX 4P0PA 3D9XA 1Q1WA 3QIJA 2OOBB 2W3SA 2YVJA 1WJ4A 3KD3A 1GB1A 2GO7A 3I28A 3DK4A 3A9KB 1N60A 4TVYA 3JVZX 3M95A 3GQCA 4KLQA 4URKA 4ZRPA 5KG6A 3RNAC 3NASA 2LFIA 2KSOB 1XO1A 3V6JA 3IDWA 5KFKA 2QEJC 3PK7A 2PVOD 3R1ZA 2IO0B 1SGHA 2G06A 2ASDA 4OW0A 3HKZC 1LVHA 4PGXA 4NLBA 2SEBD 3CNHA 3HPOA 5J2EA 4J3OD 3TJPA 1SJCA 3V7LA 1ENFA 4PHEA 4RGTA 3PM9A 2JH1A 3DHIC 4H4VA 1T7PA 3EC8A 3Q6JA 1QSSA 3PZ7A 1P9DU 1ZJNA 3ZIMA 1HEKA 3FW8A 1WXSA 3Q4DA 4CNQA 1Y88A 2IYDB 3NZ3A 9ICAA 1HSKA 1PDXA 3M8RA 3WK8A 3TARA 2BPGA 3DCGA 2KFJA 1W1RA 3II4A 3NFUA 3RJAA 3GZNI 2J53A 5J0SA 3DEQA 4EQXA 4QZCA 3JPRA 3AV8A 1LGRA 2WTFA 3MSYA 1S76D 4I2JA 2WU2B 4XDDA 2IGHA 1JXLA 4CHKA 4DHJD 3IC9A 1UQVA 4EELA 2IHMA 2JK6A 4KTQA 4QWAA 2KNBA 1CQVA 2BVHA 5DB6A 1ZQPA 1TYGB 3PRPB 1JQ4A 4C00A 1NI3A 3C1YA 3WKAA 2KX3A 2JV3A 4JUZA 1SXDA 2K8BB 2ZIWA 9ICLA 4N59A 1KJTA 4YQWA 3WANA 3LB8A 5KFIA 3ALBA 4REZA 4WJ3B 3ZVVA 1T3QC 2J0KA 1DXSA 3PFRA 1K1QA 4G11A 3PR5B 3ALRA 2KHWB 3IJQA 4PGYA 2P13A 4KPRA 1WX7A 4IWOA 1BT0A 3BYTB 4U6PA 4P4OA 4R64A 2WP9B 5KFAA 4LZDA 2MRLA 3AQFA 5BPCA 3H6NA 3KUMA 2PTXA 1Y56A 4NPNA 2KZMA 1ZQKA 2C3DA 2W9CB 2HHSA 5C3JB 1DOYA 2NQWA 3I1YA 5AIAA 2JR5A 5EE3A 4ARIA 2L83A 1HZ5A 4X57B 4XWTA 4GLSC 4J3ZA 8ICSA 4HJGE 3UI3A 5DB9A 2YVGA 3LWMA 3VH3B 3LVWA 2LWPA 2GR2A 3AU6A 2D2QA 3GC2A 3QUCA 7ICVA 2W11A 2QMTA 4NQKE 5JCKA 1L8OA 1RVKA 3DG3A 2BC1A 4FJYA 4JPSA 1YJIA 2ONQA 3P93A 1T94A 4Y2JA 4RFBA 4ICVA 4YCXA 2KIVA 4A3OA 4LNFA 5AKXA 4PT5A 1TYPA 3SD7A 2ZIUA 2YEPF 4DQPA 4YR3A 4HCLA 2W43A 1EU4A 1LVLA 3LYYA 2GQUA 4GYPA 1P7DA 4DLEA 5H2FU 2KJ6A 2OJRA 4II3B 2GGGA 7ICOA 2OXOA 1PDZA 2YQUA 1KN0A 2QCZA 4ICUA 4OJOA 2FCMA 2UVWA 4ELUA 2KTRB 2LRWA 1ELSA 2ACZB 2GH5A 4BOZB 1TZ1A 2XK5A 4GSWA 3BSMA 1PVQA 1KKXA 1YN4A 3N3KB 4DL5A 3T79A 4EM3A 2HHTA 3WAMA 3TWBA 4RGOS 3JYUA 4Z17A 2C60A 2DQNB 5L9XA 1SGGA 2M1MA 4JWNA 3SAFA 2JGAA 4HPLB 1AWDA 2OG9A 4ENLA 4W9KA 5KHOA 4UAWA 2JF5A 5L6FA 3DVGY 2HHWA 3D2SA 4AYBC 1PK3A 5AM1A 5DLFA 2HTHA 4OVVA 1I4RA 3TADA 4YTNB 4JB3A 9ICCA 1LO5D 1E6EB 1FM0D 4XGAB 5KFQA 3WAPA 3ZXRA 2F5ZA 2LMRA 2RRDA 4NJ8A 3EA6A 2XY6A 4IM2A 4M02A 4MJSA 3KLJA 1ZXIC 5CRXA 2PLSA 1C4CA 3RI7C 1WCLA 3RH5A 3A0BU 4Z6DA 2FMPA 3UCDA 3DBRB 3TQ1A 5J2HA 4MGZE 1WUDA 3QUBA 4RQ6A 1L7PA 1HQRD 1UNSA 1ZOYB 2M0XA 3ZVIA 4DO9A 1VZ7A 3KYDD 3Q6BA 3FV9A 3FC4A 2L76A 1RZTA 1C76A 4F3OA 1ZQBA 1HTOA 4QZIA 4QWDA 4MGYE 3W9CB 3HJEA 5CHVC 3MKCA 4KGRA 3SQSA 2Z8LA 3N7SC 1X2GA 2W55A 1N5WA 2NBWB 4ECTA 2N9PC 2DGZA 1A76A 2BHNA 1MC8A 5ALGA 1L2NA 1TV9A 3RBEA 2VA2A 2YTUA 2Y5CA 2BYEA 3V62A 3QEBZ 4ECSA 4BWJA 8ICBA 1DIIA 1OW5A 1HA5A 1L3TA 1OXJA 3QU4A 1SIJA 2HVIA 1W1QA 4HXDA 3HILA 2ZNVC 4DX3A 2RLTA 4B9MA 2ZZCA 4FDCB 4BKTA 5IIOA 5C0YA 1V9JA 1IBXB 4OVZA 4JMUA 1TK8A 2ONEA 4J9OA 2VA8A 5FXPA 4IOIE 2WF5A 4A3PA 2VFTA 5D3IB 4UB6U 4A8XC 3RUIB 2HDOA 5HI1A 3RFZB 1J97A 4HRSA 2C7MB 4XLOA 2RK5A 4F72A 3R9KA 4DSJA 3B9JA 3KFUF 1RFAA 4QAYA 2F76X 4F71A 3KUZA 1GOZA 1T0YA 1AHUA 2MP2A 3OC4A 1OFFA 4YMMA 1QILA 1X40A 3ZLHA 2G45B 4GC7A 2W9MA 2L00B 1WJNA 1FXAA 1HEZE 4I2EA 1U47A 2QLTA 4J9NA 2KMDA 2KQ4X 3MTNB 1T0QC 3N7RC 3BJSA 2FDRA 2WXMA 2ZJDA 3N1ZC 3RFAA 1N61C 2K4EA 2ZIXA 3NRWA 4MKSA 2XC9A 3BVMA 4DHZB 5KAFU 2AL2A 1XSPA 4JHMA 3UPQA 2IDYA 3GFKB 2I38A 5DBAA 4GFJA 2W03A 1AHZA 2YX8A 1TE2A 2IBIB 3WIMA 1K8RB 4RPXA 5KFBA 1QSYA 1WGDA 4Y2TA 4IDIA 4RH6A 5L95C 4EC3A 4NL9C 2PMQA 4JK1A 2F1JA 3AI5A 3NZSA 3U8ZA 2BR0A 1IGCA 1RYJA 2PSNA 3SFEB 3APFA 5IINA 5AK3A 1FCLA 1SF0A 3PW0A 1RYSA 2QB1A 4JV1A 5J0TA 2FCQA 1W1SA 4H2AA 3GILA 5J2IA 2BQQA 3E56A 3UMGA 4I2HA 3TEZA 3ZD8A 4C8LA 2HZGA 3T5LA 2N4FA 5KT2A 1UZXB 3PGEA 3UJRA 4F5QA 5I1WA 3OLMD 2D10A 3QAQA 1CZPA 4RM9A 2DBYA 2KMAA 3NTUA 1T3QA 9ICUA 3EUB2 3T5KA 2LYAA 4S0RA 3GU3A 4WAFA 4N58A 4F5RA 1JOAA 2RDXA 2R8HA 2CHWA 2F3NA 2OKTA 2AL6A 4X2PA 1B9RA 3BZDB 1I19A 3D2QA 3GV5B 2KWUB 2VFUA 4KITB 1Q46A 2E1EA 2FPKA 3H4DA 1BPXA 1WGKA 5KG0A 3PRZA 4AJWA 3RJKA 4ECYA 2JSVX 4B9SA 5J2FA 2LUEA 3IHPC 4PYZA 3U2SC 9ICJA 3RT3B 2KDEB 3N7PD 2IMWP 5J18A 5HHHA 4AQ7A 3BQ1A 4F4ZA 2DWQA 2BTEA 4ANXA 4BFRA 2DAFA 4LIIA 2DZKA 1BMLC 3JSVB 4O3QA 3GOEA 1ZQDA 3B0AA 3DQ0A 1XQQA 3UMBA 2QQ6A 4YT0B 1DTNA 3RJHA 3RZWC 2KFZA 4DL7A 1Q3UA 3GZFA 3LXDA 3QFBA 3T4WA 3MR5A 2B6GA 4QZFA 2RPVA 1Y8RC 3ML9A 1YMHE 3VDZA 5AKHA 3UIOB 1SWWA 2ASLA 1NKCA 2XIDA 1KFTA 1WSPA 2AJQA 4BKGA 1AYFA 3L16A 5C1ZA 5D3DA 4J6IA 4IC7B 2KN5A 4YWGG 2L1AA 7ICEA 2XH4A 1R4NI 5KFZA 1N62C 2D8CA 1H6VA 1Z1VA 3E9SA 2CFYA 3N30A 4XDCA 5J0OA 1S97A 2YEPB 3FKYA 4R65A 1JWUD 2WB1F 2L32A 5H8YE 3RJEA 2EAMA 3H8JA 4Y2QA 2BW2A 3RYTA 4UB4A 4QIWF 1LB2B 4OJ5A 3DEEA 1V1OA 2VFSA 4IRCA 3MC9A 2R2ZA 2ZCBA 4ED6A 1KFDA 4RNNA 4E6MA 3I6TA 5AK6A 5KFLA 3WKEA 4I28A 3FYHA 5DPSA 4B9NA 3WCQA 2LHEA 2C28A 1L5PA 1LKYB 1L8PA 3IG3A 3KW5B 5BMIA 2LM4A 5JZEB 5CB1A 1TZOA 3R11A 1BNPA 1NDAA 1JI7A 2HTME 2KN4A 4NWIA 2VH2A 5C23A 2JRHA 2OJWA 5CX3A 4GISA 4J9PA 4RQ1A 4KN4A 2IPKD 3HK0A 3W5VB 2G09A 5J2RA 1EXNA 1K5OA 2VA3A 3GE8C 3NVWB 1BKHA 2HMXA 2W7PA 1NKEA 1FNVA 5U25A 2OH2A 3WKDA 2M19A 5TR5A 3VC6A 4O1NA 4K81A 4I2GA 4L23A 1XSNA 3H8WA 4H2HA 3GIKA 4DS4A 1ZXIA 3VH4B 5DG9A 1PFDA 2EDUA 3PWGA 4UQGA 2FLPA 4YG2A 2Y5PA 2ZG6A 1FFUC 3ZDBA 4YR0A 2WHIA 1QZEA 8ICXA 2H3FA 1KRHA 4BVUC 1I4HA 3WK5A 3VDGA 4DSEA 2JXJA 5HQXA 1WIAA 1AARA 4WWPA 2MSNA 1QLTA 4BGDA 2KOBA 5U1OA 1D5MC 5BOEA 2XN9C 2L8JA 2LJ5A 2WXHA 3AE3B 1NK7A 4U7CA 1QQ7A 3BZKA 2LUMA 2WNMA 1J8CA 1IYXA 2AAQA 2E8NA 1SL1A 1HXYD 1MQ3A 2H3VA 1PYWD 2BBCA 4J9MA 3VR8B 4M9NA 2KFKB 1S1QB 4E74A 1ZETA 2FUG1 3SHQA 2N7JA 3C29A 3EFCA 4LJOB 2K5PA 2HBJA 3KHHA 1V59A 4K1WA 3DBLI 5J0QA 3S1DA 5KFGA 2CHXA 2JXXA 2WQYB 3TSHA 3DG7A 2K8CA 4DWIA 1MNSA 1L0YB 3EW9A 5KG7A 2N7EA 2HJ1A 1E8GA 4LDTD 4BXOA 2EQYA 4EYIB 2BQRA 1YD8U 4CF5A 2NPTA 3BIID 1IUEA 4USAA 4EMJA 4PPXA 2PFNA 4EE2A 1GPXA 3PLUA 2OX4A 3GB1A 2Y0SF 3NRZB 2O2VB 1WX9A 4PHDA 5E6JA 4RZRA 2WF8A 3VFKA 1TJEA 2NQLA 4XX5A 5DBBA 3KWVA 2O3GA 1C77A 2CHZA 4TVWA 5J0RA 3R7RA 4O95A 5ALQA 2Y1IA 2DW6A 3EECA 5LXIB 5G5HA 2OM6A 4P4MA 2FNJB 4H4TA 1TZZA 3DDHA 5AM2A 1LFDA 4KIKB 1S9FA 2DNFA 1E10A 1AROP 3A9JA 4RQ3A 1N61A 3QCAA 2PE6B 2RDGA 3ZNID 1YQZA 3A7RA 1JROA 2JZBA 4MEYA 5AICA 5G5GA 1M94A 2KLCA 3PY8A 4FJVB 4W9CA 4MM3A 1E0ZA 3W8XA 1MO9A 2BCRA 5GRTA 1X66A 3RR8A 1UELA 1EUVB 1NHRA 5EE1A 2BGWA 1RLFA 1XXGA 4QZ9A 3PW7A 3URYA 8ICMA 3QQ8B 3ZYYX 3TX1A 1AW7A 2GLEA 2WXIA 3H9DA 4JWSC 1TS2A 1KSPA 2RD0A 3DDCB 4Y2RA 4CGZA 2RDHA 4PHPA 1EBDA 5KFRA 3IV6A 4ACOA 4Z6EA 3IAM1 1OJTA 2KJ8A 2BPFA 2YMLA 1TAUA 1Z2MA 4W9LA 4RPZA 2W9BA 5AZGA 2X8GA 5J2KA 5HR6A 3MHSD 1ZQWA 3TOYA 3TFRA 2LD9A 2O6VB 8ICJA 4WWMA 4DHJB 1FRRA 2ZVOA 2J3NA 2J42A 2MSED 1NDDA 3UF8A 3GO2A 1ISNA 5EOZA 1TT5B 3RB4A 1L5UA 1NELA 2CHRA 1RQLA 1L0XB 2ZIVB 2MLBA 3HW8A 1UBIA 2KDIA 5G2NA 1ZRMA 3RNGC 4EENA 5FK9C 2NV3A 3KUCB 3GD4A 3BS5A 3AB5A 1D4BA 5KFYA 4ED1A 3CXOA 4WQOB 5CP2A 1BXTA 4ECZA 2J52A 2BCQA 5AI5A 1EO6A 4M8MA 2BQ3A 2N9EB 3ETRB 2Q4WA 4MFAA 2K8AA 4C4TA 1NHSA 2DL0A 2KKPA 3M8SA 3M62B 4EYHB 4PVEA 3OZYA 2RQ5A 3A0HU 4UB2A 3P4SB 3FWAA 5FJTA 3SN1A 4RPYA 4YR2A 3HHMA 4M6WA 1ONFA 3W5UB 4KKJA 3VTVA 1XO0A 5GMVA 4K4IA 4TUQA 3QJZA 4YSXB 1JCTA 2IGGA 4FBUA 2YN4A 4K3CA 4KLSA 2KVCA 1WMHB 2PMZC 3MBYA 4RCOA 2IO2B 3RRAA 3V5CA 2I6XA 2JXTA 8ICQA 2HSZA 4A35A 2P88A 1NK9A 1ZQZA 2R8JA 1ZQ1C 2R2OA 3TFSA 3SD5A 2C2RA 1IYFA 2LGXA 4F93B 4ANVA 3AM9A 2QJMA 5AWVA 1WXVA 2PPHA 4EKUA 3IG8A 4Y2VA 3L8KA 1IM4A 2LBOA 4HCDA 2BVCA 2GH1A 1S5LU 3AXCA 4M0WB 4XZ4A 3BK1A 2CRXA 4FLHA 2P8CA 3U30A 4H4PA 2FE8A 3IRUA 1GC7A 4NEVA 2AX5A 4I2FA 3SSZA 3PSIA 5FXEA 2O56A 3BK2A 2BCSA 2BS2B 4GIVA 4RGMA 5D7GA 1D3ZA 2HOQA 9ICEA 4UAVA 1JXEA 4KX5A 3ZDCA 2GBNA 1U48A 4O3SA 2N1RA 2LM1A 5AZHA 1P0RA 1X6IA 4UATA 2RABA 2V3BA 3W1SA 4J9RA 1NJXA 4AWJA 3ZLFA 4MGGA 3RBDA 7ICSA 3KQ4A 4K7WA 2X8HA 4C4SA 4IS7A 2WP6A 2WXPA 2OQHA 3ZRFA 2BCVA 4HYRA 2J0JA 2A3VA 2W82A 3P4PB 2P8BA 3UJFA 4MH0E 2KICA 3WK7A 4LJXA 5HMMA 4BZAA 3NXLA 3R07C 4LNNA 1ZGUB 2PIAA 1BNOA 2C3CA 1WYGA 2ZZPB 1A6SA 1C3TA 1QOBA 2GBKA 3S1EA 3D47A 2K89A 3PSTA 2JZ3B 3H7VA 4J1OA 2WXQA 4HN8A 3U9IA 3MDCA 4F50A 2RGFA 3MUCA 3N1XC 1ZQCA 1V38A 2K0PA 2LI6A 4P4PA 4RNAA 5KT4A 3MFGA 2MX2A 1W1KA 4MMWA 1TS5A 4ADWA 2W8KA 1ZQRA 1ECWA 1UCVA 1C20A 3PZDA 4DQSA 1PK1B 2R18A 3KWLA 4WJNA 3PX4A 3I5JC 4OHJA 2WXRA 2I5QA 5KFJA 3TJ4A 3JS8A 2G07A 4DBGA 1Q1OA 4DF8A 1L3SA 2X38A 4NJ7A 4YL8A 2E8MA 3DERA 5J2JA 4PL2A 1WWUA 3HWTA 1ZQLA 3K1ZA 2VJ5A 3EWAA 2IBKA 3ICXA 2FCSA 1MSWD 3DBHB 4LJPB 3DEDA 3DPDA 5IIMA 1SL2A 5L1MA 1IXRA 4H1ZA 1ZQXA 4JL9A 2PE9A 3S2AA 4ECQA 1MOKA 4YVZA 3GRTA 2AH5A 2V4IB 1GRAA 3K9PB 3C0RB 3TBLD 3KYCD 2QJLA 2JH7A 1PGXA 2ZW1A 3Q3JA 1NJWA 1C79A 2KMMA 1QLUA 3Q8KA 2R9ZA 2HCFA 4PYTA 3HVZA 1XLQA 4C4VA 2FBWB 4KLLA 4WIPA 3KHLA 4CF3A 3AEBB 4BURA 1ZDVA 1N63C 4J9QA 2UWQA 5KFTA 2KK8A 2WPFA 3ZTCA 3VXWA 4K4GA 2KQSA 3O0HA 4QZEA 3V72A 2BQUA 3LVVA 4UW9A 3WK9A 3ML8A 1XHCA 2NMQA 4ANWA 2A8XA 5EWEA 3QU5A 4W9DA 3VCCA 2BT6A 5J04A 2V3AA 1VJKA 1Z00B 2JT4B 2JWUA 4J9SA 1ZK7A 1W1OA 3SR6A 1S0OA 2JWZA 3ZDMC 2JRZA 5ALSA 3PQBA 2XY5A 2ZEQA 3A7AA 3V6EB 1SZHA 4XA5A 2KWCA 4M2YA 5HHDG 5FS8A 2LXAA 1V81A 1S3SG 2D3BA 4NAWB 1VD2A 5I1VA 2F1IA 4Y2YA 7ICPA 2R61A 1GJZA 2AGPA 2MNRA 4EZ9A 2BB5A 4YSYB 2KSOA 2KZ3A 1ZE3D 2EQ6A 2E1FA 1V80A 4Q45A 4IR9A 3CSFA 3QU7A 1W6TA 4KKIA 2H88B 1EU3A 3I9V1 4BKSA 4P0QB 1BPYA 3H1UA 5JHBA 2IZVB 1FIQB 5KFCA 4GOCA 3UXPA 5D94A 2KMCA 4UAZA 2UVRA 5L83A 3ZNHB 3MWCA 1L4ZB 4JDRA 3L0WB 8ICCA 4DSKA 4DF4A 1MA7A 2JX5A 4HPMB 5ALHA 4LCDE 4P7IA 2H89B 3RNFC 2KWDA 3QX1A 1KFYB 3LAEA 1BWCA 4BC9A 3ABVB 4HPPA 3W2DA 4AP4C 4KMOB 2QGYA 3W8WA 1ZRNA 3V3XA 2AXRA 1GETA 3BZCA 2NRXA 2NRVA 2HBKA 2WWZA 3JPQA 3PG6A 2GQTA 3AL0B 4ECUA 2X8XX 4R8UB 2INNE 2KOXA 3AEAB 4FA6A 4C7YA 1UWMA 3AMZA 3OSPA 1RYRA 3OHAA 3DVNU 4TQRA 8ICIA 2K8BA 5HKHA 4FZLA 2EMTA 4A20A 3TJIA 4ECWA 3TSSA 2KJRA 3JW7A 1UGMA 1XSLA 3APDA 2DYMA 5CHFA 1TVAA 4E71A 2B21A 3L3FX 1MHHE 1MPEA 1WR1A 1DOQA 5AKEA 2W8LA 3UXLA 4APNA 1ZQAA 3RJIA 2ATLA 3HRDD 2DPIA 4IR1A 4GC6A 2MBHA 5EU9A 4M0AA 2RHFA 1OEPA 3H4BA 4W9EA 4GLXA 1J7CA 1KCZA 3RCYA 3QPEA 1A5RA 2PTWA 2YVSA 2WAQC 3G6YA 2W9CA 2KIWA 3MZNA 4P6VF 1F77A 1UH6A 2ALZA 2N1WA 2FCNA 4CCHA 4GMVA 3UQ0A 1HZ6A 2AKZA 3H0LB 2IOFK 4MELA 3EYZA 5DPTA 3BS7A 3H7IA 1R7SA 4NXZA 1QCKA 2L05A 4JLCA 3ZUNA 3KKAA 3VRAB 3K4GA 4W9GA 2EZYA 3L17A 9ICHA 2M9NA 5AKZA 3M9OB 1JWAD 1QOFA 1STEA 4GDLB 4GDKB 4EFOA 4NV0A 4ECXA 1ZQHA 1QOGA 1V8CA 3IFWB 4YWSA 2MBOA 2OZTA 3IJIA 3H4KA 3V5FA 1NNLA 4OJ6A 5ALVA 2KYWA 3BINA 4YD2A 1ROEA 2W7OA 2PCEA 1ZQEA 4IRDA 4MFCA 3N6JA 3UGVA 3SMVA 3PW5A 1XS9D 8ICFA 3IP4B 2AL1A 2HNEA 1R4MI 3LWLA 4O5CA 1TGZB 5L1IA 2KTRA 3PVLA 5B5EU 1W1LA 3SV4A 4YN4A 2XY7A 2CS4A 2G9HD 3JZUA 4MEXA 3AU4A 2BYFA 3I76A 3N4MB 1F0XA 1B43A 2DUYA 3EPIA 2RMMA 5KHQA 2QDEA 2HHVA 2C9WB 5BOLA 2RSUA 1E7VA 4PS3A 3FILB 1L7OA 3Q8SB 3CGDA 2HXTA 5FS6A 3DFYA 1KTQA 1KL9A 1FD6A 1AHVA 2EQ8A 3RNEC 2FMSA 3DWGC 4KX3A 4M04A 1E5WA 1VDVA 4B0EA 2XK5B 1PUTA 2IO1B 1YQ4B 3ZQ4A 3DGBA 4TUUA 2K1FA 1TAQA 1N48A 1E9IA 2OPJA 3FYYA 2MEKA 4WWOA 1C7YA 2DKXA 3GDXA 2R8KA 2OWOA 2D3CA 3KBBA 5EWGA 4AYBF 2KWVB 2EQ7A 4US8A 2LGYA 2GLSA 1SXEA 5D49A 1CJEA 3N97B 5CHWA 5DKWA 3DG6A 2X99A 1ZD5A 2J7QB 4BJQA 4QZHA 1UT8A 4BDPA 2QJNA 2JUOA 1ECQA 4DS5A 1Q5WB 1WF9A 4WWNA 5E6NA 1DK3A 3WKBA 2K9XA 1KRPA 5GTIU 2HI0A 1WWTA 3O13A 3PRMB 4MJSB 4R63A 4EQRA 3C5FA 4DFKA 9ICMA 4XYCA 5HFYA 4KLJA 3I63C 2LGDA 2MJDA 1UGJA 2WS3B 3Q8CA 4ACFA 1QLBB 1JW9D 1E8FA 2BDPA 1DGJA 3J9CA 5AKLA 4M9HA 3VHTC 1CEZA 4KLTA 3H7PB 3KHGA 4GN1A 2M0AA 2VZKD 3IVFA 4LDTB 4IQTA 3RCZA 4YXDB 4ICAA 4KLIA 5ALUA 3V3WA 3TL5A 4BAXA 3OTRA 4FS1A 3PSEB 2MBRA 1SXTA 2LMCA 4DL4A 1KQQA 2SAKA 1IIPA 5AEKB 4FJZA 5J2CA 1ZKQA 4A55A 1IBXA 5K8EA 3TI0A 2UUVA 4KGTA 2NO4A 4C8MA 3PHXB 4MH8A 3BQ7A 3JPPA 2NCNA 3CT2A 5DDYA 2QSDA 2PXIA 1GUAB 2G08A 4FS2A 5ALJA 1ESFA 1H8CA 1W1MA 2E5AA 4CYEA 2KEYA 2QKNA 4E8GA 3VAWA 3AEVA 2DFLA 4FHKA 1WZ3A 2MJEA 4DQQA 2HW3A 4IC9A 1LPFA 4QJFB 4OZCA 5FJRA 4PYUA 5LLIA 2W9NA 2OEHA 2VANA 1XWLA 5ALKA 3N32A 2D07B 3QHTA 3U52E 3C0PA 1ZOLA 2ZUDA 2XH7A 3V4BA 2BS4B 2HVHA 3LDAA 2MBEA 4G50A 4KZCA 2FLLA 1L3VA 1JWMD 3TEXA 2DPJA 2EQ9A 2QKQA 1ZMDA 3O0FA 3JPSA 3S5SA 3SFDB 4DCCA 7ICHA 2I1KA 3TTEA 4FBJB 2BZFA 4F4YA 3U26A 1WGHA 5FS7A 4BBNC 5KFEA 4TUSA 5CA7A 4IQWA 4P2HA 4JX1C 3B9JB 3HPFA 4K7UA 3QLDA 3IHQB 3DWMA 3FM9A 2LVQA 2QILA 1TK5A 1KD0A 4H4SA 7ICGA 3VA8A 3V7JA 4YTMB 3UJSA 3B97A 2KAJA 2G4DB 3ZO5B 1NJZA 4HYKA 4EZ6A 2KFNA 3CXBA 3OJUA 2I0KA 2GQWA 1WWVA 2WFAA 2FPMA 4Y2SA 2H3ZA 2ZIXB 1WRDB 3AULA 3R66C 3NUQA 5KG1A 3VRBB 4ZYSA 2NRZA 1XS2A 4KX6B 3F5EA 3GSYA 2JEGA 2GBJA 2P6RA 1I4XA 1S10A 3EF6A 1T4GA 4G3XB 1F44A 2V4LA 1F0MA 2XVTA 4I27A 3UQ2A 4F4WA 7ICUA 1EF1A 4BKSD 5AKYA 4AOFA 1ZQOA 1Q3VA 1ZQNA 5I4DA 5HMRA 4H4YA 3T3OA 3D2JA 2F44A 3EJBB 3FVDA 3TCSA 5JCIA 5MPOA 1S77D 2IA6A 3CRXA 4O5EA 2BWES 3VTWA 1WE7A 3BJYA 2ZVNA 3UGBB 3QWZB 4HEA1 2WXGA 1C4PA 1MI0A 2ASQA 5TZVA 1E8YA 3OJ3A 2YAUA 2KK0A 3T3FA 4UD8A 3PNCA 3RULA 4PWCA 4LNOA 4M00A 1GERA 1EWCA 3UM9A 4KLFA 3RITA 2XH0A 3E0FA 1I4GA 3NG0A 2ZJ8A 1SKWA 1NZBA 4O3OA 3AE1B 5BO4B 3V60A 5T14A 2VFRA 4KDIC 1DNCA 1FECA 4P1BC 3GS2A 3U7DA 5B66U 3JSVA 2KHQA 2W3RA 1EF5A 3BQ0A 5FJUA 3F5AA 4GB9A 4N9F4 1K53A 2D6FC 4PVHA 1LM8B 4NM1A 1UPHA 3A4RA 5AE1A 2WF6A 3VTUA 4PJ0U 1D5XC 1SB3B 5KVIA 4J03A 1KKOA 4DL6A 3CAWA 2GOWA 5HHZA 2JHDA 2AQ3B 1FNWA 5KT6A 5DQIA 2M8SA 1WXAA 2AHOB 2KDFB 2KQ7A 3Q3NC 3AE4B 2GI9A 3NVVA 3VQIA 5AKIA 2E6XA 2YB4A 3ZDEA 2P6UA 2ZW0A 2XCAA 4XRHA 2OZ3A 5DG7A 3AEEB 3TW9A 3RB0A 3U4FA 2KVSA 3RD2A 1GXFA 3ZLZA 1RAXA 1FO4A 4R3DA 4YFKA 5KFSA 7ICTA 2HD5B 1QF6A 2MH7A 3D32A 1TYTA 1N6ZA 1DXLA 5DDMA 3T3NA 3E58A 4HCPB 2FYMA 3JPOA 2R8IA 9ICGA 1Q8KA 1CI4A 4QIWC 3STPA 3TUOA 4XE0A 5HHIA 4EWJA 4B9LA 4CDGA 1L3UA 2P3HA 2AGQA 2FLNA 7ICLA 2KLGA 1YIWA 3JW0X 5IDZA 3A1QB 2LYHA 2Y9UA 4OVUA 1KLGD 1ZQJA 2KKVA 1COKA 4HCNB 4HKZE 3TKAA 4NZLB 3NVWA 2C2EA 3PSPA 3DFHA 3SDLC 1KDHA 4YP3A 2KJ5A 2P0IA 2IPIA 4EX7A 3GZNB 3VVWB 5J29A 2RDJA 4YXMA 2FPLA 1P43A 4DSIA 2MJ3A 3CK5A 4FE3A 3GV7B 3C19A 4YWOA 3URHA 4KLGA 5DB8A 1WY8A 4BX9C 1NENB 3ZXVA 4MGKE 2IOHA 3IK4A 8ICTA 2A19A 3OHBA 2B0CA 1RDFA 3KVFB 2QDDA 1P98A 7ICKA 2KANA 4HLEA 2LGIA 1RM6B 3M9NB 3RJGA 3V05A 4ZDVA 2MCNB 2KJHB 1C78A 9ICOA 4UB5A 2QARB 1BPZA 2WX0A 1KLVA 4IWQA 2X50A 4RNMA 2XEWA 2XNAC 2N0SB 4KSLC 2LHDA 4DQOC 2X8CA 2QB0A 3Q8MA 3OWEB 9ICKA 5E6OA 3Q8AA 4PK1A 4NJCA 3EJEB 2KFKA 2PTYA 4PZOA 3SENA 4I2BA 3MJ5A 2QPMA 2G0AA 4ED7A 5KFNA 2O6KA 4C8NA 1DK2A 1XD3B 3CP8A 3Q14C 1D9FA 4TSSA 3NZGA 2Y08A 3OTQA 2INCC 3NVZB 3P63A 1TFRA 4FN2A 3RB3A 4BC7A 2ZUCA 1D6EC 1J0GA 2FIDA 2QAEA 4F1SA 2GGHA 1K4QA 1KLUD 4TQ1A 1YX6B 3D2HA 1FMAD 1OEYJ 4G9BA 4PWBA 4I29A 2P66A 2N9LA 2V3NA 4FULA 4FFDA 1NK5A 2A1JA 1GRTA 3QTPA 3TANA 3Q8LA 4AS1A 3DH9A 2XSXA 3NS1B 3CGBA 3NRZA 2K3UA 2O2VA 1H2IA 4ASWC 1WE6A 3N4EA 2JYEA 3LJ3A 1ZJMA 4NY8A 2BKEA 4ED8A 5JH5C 5J0YA 2MBBB 1SWVA 4GMEA 3Q8QB 4KMUA 5KFDA 3RNMA 5AI0A 1XO3A 3BQ2A 2DLBA 2KP7A 3SEIA 4GU2A 1EBGA 2OFJA 4H4QA 3IM1A 4DOAA 2NPTB 5D46A 3A4SC 1X9MA 1QKZA 3M7DA 2ON8A 3DJJA 1R4MB 3AU5A 5KFWA 4NLZA 2C22A 2HQMA 3IG5A 2ESEA 1V5OA 2ZCCA 1U49A 2DHZA 1STZA 4I2AA 2AQ1B 3CSTA 2YQEA 3RNCC 1FFVC 4DFDA 1SKSA 1I4PA 5LXHA 1E8WA 1J7BA 5AZFA 3RR7A 2VH1A 2A1AA 1V49A 5AE3A 1G6JA 3ES8A 1MBBA 3MY9A 4IP5A 2K60A 3DHGC 4FX9A 5G5HB 1E90A 1NHQA 3RH6A 2OAIA 4NL9A 1SZPA 8ICEA 3QA8A 3NVYA 3R0UA 3HT3A 3LYSA 4NLNA 4ELVA 2VRRB 3CIRB 3SJNA 1WM3A 3S47A 1GSNA 2MUTB 4BV6A 3D46A 2AXTU 3V6HA 2H3IA 1U4AA 2N9XA 2QIEB 5BYSA 2GR0A 3GY1A 5G5GB 2WHEA 3S1CA 2XI9A 4MM3B 2LEKA 1JRPA 2K4HA 3TEWA 1MG4A 4H4RA 4DN1A 2I1JA 2QVHA 2KN7A 1NKBA 2KZZA 1J2MA 5L1LA 2O6VA 2Z0EB 1S7MA 4EBEA 3FW7A 2PKOA 1V85A 3L08A 3APCA 1ED1A 3RNBC 2PJHA 5T8IA 4RU9A 3QU9A 3PV8A 5DGBA 1XC9A 2J4XA 1FHVA 3MR3A 1JWSD 3HUIA 4EZJA 1MDRA 4Z6CA 4FZNA 3UXKA 5ALEA 4LLGM 3RJJA 1FXTB 1KBUA 2ZIVA 1I35A 3SN4A 4QW9A 2WX1A 2OVLA 3VCBA 4PGQA 3ORYA 2KC2A 3NUHB 4KSKC 1Z4OA 4QZAA 1JMLA 2W9BB 1XCTL 2ZPNA 4C7ZA 5BMGA 3ZJUA 2LYBA 4IQVA 3C2MA 3WK4A 2MWSB 3MC0B 2MQJA 4TQ0A 2ZZBA 2L3ZA 2BB6A 2GR1A 4QZGA 3K75D 4IM0A 2F8KA 1XF5L 3VUYA 1NK8A 4RUCA 1PGBA 3L13A 1EM7A 1XPYA 4PVKA 4G3IA 3KJMA 5CTRC 4ZHPA 4DFMA 4HDQA 3MP9A 4Q8FA 4MEMA 4C8OA 1V2YA 2WPCA 2XGZA 3DBRI 2LI5A 2RDIA 4DDGD 3F2CA 2FJ6A 4DXAB 1V1PB 3LXFA 4PZFA 5EWFA 1WMHA 2A5UA 4FI4A 2EMSA 4IT1A 5ALDA 3F2DA 4H83A 5HNKA 1ACCA 1CRXA 1HE8A 2WXNA 2PTLA 1SJAA 1N62A 2MRPA 1ET9A 2ASJA 4KPLA 4DL2A 3S1FA 4LNIA 1MHXA 3N9YC 1AN8A 3MGVA 4BCAA 3PX6A 4PH5A 1UF0A 2PMZF 1F8WA 2NO5A 4AUQC 1GRHA 2IGDA 4K7ZA 2OHFA 3LLBA 1ZDLA 2Y5BB 4EEKA 3JPNA 1TKYA 4M0WA 1F52A 9ICBA 1IG6A 4RQ5A 2W0HA 2D11A 4K4HA 1T0SC 4PS8A 2F2AB 5AIBA 3NJTA 3ZVHB 1H4RA 1Q1RA 3R2IA 2VKQA 4ZRKA 3VTEA 3MFHA 7ICIA 4M8NA 4GXIA 4F91B 3V6CB 4A6GA 1KH0A 5J0UA 1TY0A 2ZJAA 4E4UA 4C0ZA 4RNOA 4F92B 1J7AA 2I9GA 5H92C 2Q0ZX 1YZ6A 3WK6A 3T5JA 3Q8FA 2JRIB 3EANA 3B0YA 4BBYA 3AE9B 4KT2A 1ZQQA 2YVCA 2ZC8A 1X1MA 1KEJA 1SE9A 2K8HA 4HK2A 3R7QA 4W9HA 3SU8X 1KW4A 3QFAA 4LK0M 3PO5A 2EELA 3MR6A 4A90A 3UJEA 1P1AA 3NY5A 4GYPC 3DDMA 4KLEA 1N2XA 4UAUA 1SBBB 3PWIA 2WDTB 2PGEA 4XUSA 1T0RC 1FFUA 2LKYA 4KLMA 2JQRB 1E8HA 1JPDX 5KFPA 3HX0A 3Q8BA 5IN7A 1WZ0A 2JYTA 1NYQA 5JHAA 2GRIA 4JIOU 3KTQA 4O3NA 1WVEA 1FCCC 4MSMB 3PSFA 2HXUA 3N20C 2L0TA 3KH0A 1FEAA 5JCNA 2K39A 2BC0A 3TMPB 5J2BA 1ZKHA 1GG3A 2FAZA 1AQ6A 2ZXIA 1J2NA 3KOOA 3QU2A 1L6VA 3AN1A 2BGFA 4P1CC 4C4RA 2G4SA 3PZ8A 4RT2A 1R6WA 3TEYA 1WXMA 2D3GA 2KV2A 1WVFA 5KT7A 3QC8B 1ZQVA 2WLBA 4NLCA 2WXOA 5ALMA 3Q8PB 1JWBD 4HWIB 1T3NA 1OQYA 5J17A 1RXWA 2AKMA 2XCPA 4QWBA 1DOIA 1JN3A 4EZLA 1KOTA 3SN0A 2MBQA 3C28A 3GRSA 3OJ4B 5ALRA 4ED3A 2WXLA 3MHZA 3ZW3A 5FR3A 2FIFA 5CHGA 4J57A 2KZRA 2JEIA 1TTNA 1M6IA 1X9SA 1M4VA 8ICYA 2ODGA 2VZKB 1HTQA 3VCNA 3E2EA 2NVUI 2AU0A 1SEBD 4DFJA 2M17A 2HHUA 8ICAA 3C1ZA 1OGWA 2I2YA 4UBBA 1TIFA 4FZMA 2KT7A 2PFPA 2BWFA 4QZ8A 3AEDB 2XH2A 3I4KA 1FEHA 1Q10A 4DLGA 3U7ZA 2WF7A 1WCNA 5KTQA 2K22A 1D8BA 4FXCA 4YSZB 2GGEA 1B22A 4JQ9A 4ZA0A 3W8ZA 3CYJA 1U4BA 4B9TA 1TK0A 3PHWB 1RWSA 4P16A 4DNSA 1R4NB 1HJPA 1ZD2P 3ZI4A 1VR9A 3DK9A 5AKKA 1OQQA 7ICNA 1E8ZA 1BPEA 1X2IA 1JMSA 3CW2C 3PW2A 4WAAA 2PP3A 2PU0A 8ICUA 3ENLA 3B08A 1TE6A 3OPXA 2CN1A 2DX5B 1Z00A 4NNJB 3RTVA 1X2HA 1U9LA 4TUPA 3QUTA 2W04A 5ALNA 2EKEC 1GO3F 2VJ4A 3C2LA 2K25A 4DYEA 4CRXA 1VQZA 3A9KA 1P7EA 3TWAA 2R2QA 1MN8A 3RJFA 4IM3A 3MGHA 3LK9A 1ZYQA 2XICA 5DB7A 4GXBA 1YNTE 4DHZE 2Y9TA 3Q2AC 4I6PA 2KD1A 4F2SA 4EBCA 3V61A 5EBKA 2CR5A 1QLNA 2Q4TA 1N56A 2M56B 4JQWC 4P0PB 5BMHA 3OP2A 1PUZA 1EC9A 1ONEA 4ZOHB 2MA9B 3SR6B 2GL5A 4A9AA 1WXQA 3P4RB 5KFMA 1VCBA 1MBTA 3EAOA 4R66A 1SJHD 3QZ8A 2KACA 3NO1A 4G7FA 2NVKX 2DENB 1D7YA 3WU2U 2TPRA 1GRBA 4P0QA 3R8BA 4OCZA 3R10A 1FPYA 1WGGA 3QK0A 4NJ6A 1SV0C 4DK5A 3HP6A 5DQHA 3RRGA 3PS6A 4RF0A 3HKZF 4F8RA 2V1YA 1OEYA 3T6CA 4F4RA 3MJWA 1MRAA 3PW4A 5KFVA 1L6NA 2WDWA 4H4XA 5ALXA 5IIIA 3C8YA 3OAWA 5KL1B 2DZIA 8ICKA 3THUA 1A0PA 4J56A 2KJ9A 1ZPSA 3ZDDA 4NLKA 1IV8A 3L5OA 1L7NA 4UB8U 1XCQL 2G3QB 4CF4A 4UAYA 2JVCA 3RJ8A 1RYUA 5AM5A 4R8UA 3SI8A 3ZTDA 4CQNA 4PVJA 2PLIA 2P3ZA 4Y2PA 1S0NA 3AUOA 1WJ6A 3TSJA 1NK6A 5D6JB 3GP7A 5AK5A 1JALA 4RUAA 3P3BA 4US9A 5KG3A 3SZ2A 5KG2A 2NPXA 4JWMA 2KX0A 2XBBC 5ALIA 4F5PA 2O6VD 3DBLB 4K3BA 4DDID 1XANA 3M6KA 4DWDA 9ICVA 2YVFA 5ER0A 2GBRA 5CEHA 5CJ7A 2WXJA 4WURA 2R8DA 5D4BA 2WP5A 2EXRA 2Y4GA 1CMXB 2XGQA 2Y3RA 2CU3A 2OQYA 2ZIWB 5ADZA 4BUGA 4NLGA 1B0XA 4ZHOA 4OD0A 1Z1BA 1F2RC 1PQSA 2V9HA 3SQPA 1JRUA 2H3QA 4YMNA 1FRDA 5AI6A 1WUEA 3T5HA 4DSLA 4EBDA 2NYVA 3P2BA 4EM4A 1D8LA 5E79U 1KLNA 7ICQA 4MGIE 1UBQA 1D8YA 2LGSA 2N1VA 1JPMA 2WAQF 1F3PA 2PS2A 1SB3C 2BPCA 5KFHA 3PLVA 1F0ZA 4A3RA 3ZNZB 2KXJA 4GDLA 2DAJA 4LVSA 4GDKA 5KAIU 4JN8A 2JEFA 4GRTA 1FEZA 5KT5A 3PR4A 5ALOA 1ZDXA 2ZTCA 5BYQA 3I3TB 2HBLA 4KN7A 1SJED 2IO3B 2R8GA 1PDYA 3PO4A 2N9KA 3BOXA 2DKZA 3N28A 1VZ8A 4L2YA 5GXGB 3SEBA 1C9FA 1COOA 4DSFA 5LNK1 2P35A 4K8GA 5DBCA 5HMLA 2CDUA 1NYRA 1IP9A 4O0IA 1XEEA 2FI1A 3DV9A 2AQ0A 2WDVB 2ZIUB 3MGIA 1MG8A 3G6VA 3RAQA 1ZQTA 1L8LA 4DNAA 3ONNA 3AE8B 2JMGA 3TACB 4KLHA 3HVDA 2BVFA 8ICNA 3FILA 1WGYA 3EKGA 3AE5B 3CGCA 1RFKA 2IHNA 1TS3A 2MW5A 5AE2A 2FE9A 3EPGA 2UVUA 4BWMA 4H4UA 2WU5B 5J2GA 2GOLA 3QX7A 1QQ5A 3B0XA 4I2CA 3IXSA 3NHEB 1L7YA 2DYOA 3PREA 2UVVA 1I4QA 2BF8B 2E8PA 4EEYA 2TSSA 4E3CA 1W1JA 1JDFA 4II2B 4JN7A 1F1HA 2DW7A 4ED0A 1Q0WB 2Z59B 1F9CA 1KTKA 5ALPA 1YJJA 1YOVB 1EWYC 1QH9A 4HCHA 2RR9A 1DOXA 5DQGA 4FP1A 4KWSA 1VJ5A 2PP0A 3IN5A 3RB6A 3H8AA 2AL3A 3ZLGA 2DF4B 4Y2XA 8ICGA 4QNLA 3QEAZ 1UT5A 2NBUA 1RM6C 2Q5WD 4O5KA 1WJUA 4E0DA 1XLNA 3KHRA 2QC8A 1NOMA 1NJYA 9ICNA 4I6NB 3PVXA 1GESA 4RQMA 4QZDA 3TQPA 5ALTA 2YMMA 1GC6A 5AKJA 5L1JA 1RG6A 1WR6E 2G1EA 1SV4A 2HJ8A 2UU7A 4NQLB 3OW1A 3HM6X 5DPRA 4OJPA 3F2BA 4FBTA 5HG2A 3H7PA 3MR2A 2MA1A 4G0NB 1N63A 1P7FA 3H12A 3ISBA 4Q2JA 2AWTA 2AEHA 5AI8A 2QHOA 3B2GA 1DRGA 4KLOA 4ANUA 2KTFA 3GIIA 5FJOA 3CMMB 4RMAA 4FADA 4OJLA 2KE7A 3D2DA 1H38A 3EGRA 1T8EA 5ENLA 3UINB 2AQ4A 2YY6A 5L1KA 1NEKB 3D2NA 2EKIA 3PTFC 1D5ZC 4M6UA 3I6EA 4E4FA 2JEJA 3ES7A 2LPEA 3FW9A 2GSHA 3Q3OC 2C2DA 2WXKA 2POZA 3Q8RB 1ZQYA 3TIXA 4ZRJA 1L7MA 2M0NA 2WF9A 1SL0A 2HOFA 1JCKB 5JXVA 3MQTA 5L6GA 4RF1A 1HUOA 1O03A 1SE2A 5IO9A 2J6TA 5EDSA 1XLOA 2E3TA 5ALYA 4IG7B 5J8YC 3OPSA 3LDZE 1UD7A 2WOIA 1KFSA 1ZR6A 4B95A 4EQWA 5IKCM 9ICFA 1NK4A 2D3DA 1BPDA 5KFOA 2LZ6A 5HP4A 2KNJA 4JV0A 3CB3A 3DGHA 4DOCA 3ZDTA 5ALLA 1PZNA 3I57A 3S6JA 4B6JA 2K4PA 2ZUBA 1SJBA 1TY2A 2L0FA 3AE6B 1BUIC 1ZP0B 2PODA 3SBFA 3UQAA 4O3PA 1PVPA 1ZQGA 4AJYB 2WOWA 4IHCA 3PO0A 4ECVA 1TKDA 2ZTDA 2MP2B 4XWWA 1SV0A 1GREA 4A6QA 1C1YB 2BYVE 2JZPA 3VR9B 1P48A 3GV8B 2PFQA 2HOIA 2KD0A 3RF9A 2ZADA 2KC1A 2CU1A 1KN5A 4AP9A 5D2MB 3SQIA 4BBNF 4EQSA 2KO3A 3RR1A 5IIKA 4DFPA 3PT2B 2G5HB 2PPGA 2PMVA 1XT9B 3Q69A 3GIJA 1VLBA 2AL2B 4IWPA 4JV2A 1I7HA 4HNLA 5ALWA 3HM3A 5KNIA 4KLDA 4W9JA 1VZ6A 4M52A 3GD6A 4RM8A 4M01A 1FIQA 1ZQMA 2K6QA 1WFYA 2KVRA 3ZRCA 3H8HA 4RGNA 3P1MA 4OO1J 4IW0A 2E5SA 2UUUA 2JY6A 1V97A 4PHAA 4W9IA 5A0LA 1LV5A 8ICLA 2GGJA 2D5GA 3O65B 1XLPA 4IRKA 1MJDA 3RAXA 4GFIA 1RPLA 4DOBA 5FXDA 4NEWA 5AKGA 5FJPA 4MHVA 1HIWA 1UWXA 3NS8A 2EZZA 1RRBA 1ZXHA 3QN3A 4YMOA 2HE7A 1L6UA 1ZD3A 5ALZA 1I42A 5BYRA 4J9KA 7ICMA 2NBVB 5KFFA 4S17A 3QUQA 2MUCA 5DCNA 2PGWA 2PW9A 2GR3A 3DGZA 3FAHA 2EH9A 3IAS1 4NY0A 3HRDC 1YX5B 4DHGA 4IKGA 3PV1A 5CR0A 1T6BX 5JU5A 1ZW7A 3OJSA 3K1RB 3AU2A 4B9KA 2VAOA 4FO6A 4ZRQA 2IJ0A 3MABA 5AI9A 1NK0A 1V6EA 3AEFB 1MVKA 2VFVA 1ZMCA 3DESA 2LRUA 3RGTA 3NGDA 3RO6A 4JAYA 9ICXA 3DBHI 2REXA 4JB1A 3FJ4A 1JUDA 4DL3A 1EBHA 1XU4A 3QZ7A 1UA1A 1NHPA 1AOGA 4I6LB 5TISU 4RQ0A 2LVPA 3R0KA 3POPA 2BS3B 5G55A 5JUMA 2J6UA 3UMCA 2YLMA 4F5NA 2K4IA 1TS4A 5IP4D 3DVNV 1L0VB 4KVGB 3BWUD 2FKPA 1P3QU 3KZIU 1UA0A 1V86A 4PS7A 4JGHB 4KZ0A 2V3SA 4IQUA 3OZMA 2KHVA 5KFXA 1YZ7A 4NM2A 5KG5A 2V6OA 4RQNA 5GTHU 1QSLA 3H70A 2GWSA 3UCCA 4GR1A 3VC5A 1NI2A 1QTMA 2ISPA 1E8XA 4B0MA 1ZY8A 4Q8EA 4DXGA 4WJPA 3IJLA 2WB1C 3ENEA 3UJ2A 4I2DA 2XO7A 3SAGA 1YJ1A 1FHUA 5FS9A 2KTQA 2OEDA 3AE7B 2ES6A 3BQTA 4PL1A 5JTIA 2ICIA 1VRAB 4HPNA 1LKYA 3AH7A 1NU5A 3SYZA 1XNSA 3NVVB 2OO6A 4HROA 1SE4A 1NZPA 4O9MA 3PPAA 3A1QA 4RQ7A 1DYQA 3EUB3 6ENLA 4QWCA 1C4AA 4LTUA 1GV4A 2B76B 4F8CB 4B6WA 2P4PA 2LJIA 1BZLA 3SV3A 1YQ3B 4XQ8A 2NR2A 3Q3FA 2WOVA 3LADA 5D79A 3RN9C 8ICHA 4B9VA 3EHVA 3WAOA 1NVID 1FEBA 3CYMA 4GGQA 1ZQUA 3N1YC 5IOIA 3P0WA 1WM2A 2F8LA 3MC1A 5AK4A 3MFIA 3WA0A 1CUKA 3VC8A 5KFUA 3W1SC 2L5YA 1ZQSA 2V9WA 3H40A 1RQNA 1WUFA 1O08A 3UXNA 4M0XA 2ZJ5A 2JZZA 4UASA 4UARA 3C5GA 5HR7A 4FHJA 1ZD4A 1CK1A 3DVGX 4WJQA 3AECB 2GGIA 5CWRA 4QWEA 3L5KA 5TR3A 4O3RA 3P4QB 4KDLB 4H4WA 3PMLA 3OSNA 4K2SA 4EMWA 5JRBA 1SE3A 4BOSC 2NRWA 2QARA 4C80A 3AE2B 3TAPA 5EE0A 9ICPA 2CPRA 5TSSA 3C2KA 4HDOA 3T9LA 3I99A 4H50A 2WDQB 4XC2A 2OLAA 5KG4A 2WGSA 4IL6U 3EFUA 2IOFA 1YN5A 4CO7A 4M9JA 2NTTA 2PVGC 2PA6A 3BDPA 4UDUC 3UIPB 5AM0A 3NVZA 2WBAA 4ARCA 3L4PA 3DIPA 4YXJA 4H19A 3QYPA 3THVA 4Q43A 1LXDA 3BVZA 2HHXA 1Z5SB 1EC8A 2UYZB 3D6JA 1R0MA 1HUZA 2QB0B 5ALFA 4GXKA 1U45A 8ICZA 2GB1A 3HIZA 1MFWA 3W1YA 3GE3C 2QJJA 3TCAA 1SIFA 4MT5A 3F53A 1ZQFA 5E6PA 3NS1A 5EE9A 4GXJA 3ZDAA 3HW2A 3DHHC 1Z19A 4D2KA 4GIRA 4W9FA 2N7DA 2K8CB 2ZNVB 2ZZ0A 5BOMA 1NPXA 5J0PA 2Y0SC 5J8YA 4KLUA 1ZQIA 3BW7A 4EMIA 4E5TA 5KVHA 1K52A 4BXOB 4F2RA 1QQ6A 4M47A 1WYWB 5FMHA 2V4RA 5F9NA 4Q44A 3J81j 3NOBA 2PTZA 3RH4A 4Y2UA 4KIKA 1URJA 2A1JB 2CJNA 2PKEA 4UB3A 3IT6B 2F77X 2LHTA 2Z7JA 1ZUD2 9ICQA 2I1QA 1YN3A 4ZCWA 3ED5A 3V7KA 4ITKA 2ZPYA 3GD3A 4TMAB 2WYQA 2C5LC 2KDBA 2D3AA 3DOWA 1E0YA 4Z6FA 3T9PA 3OGUA 1KF6B 5JRTA 4WQMA 2C7NB 3ISCA 3CF6E 1L4DB 1NBFC 1E7UA 2L52A 1GEUA 2JPHA 3ZJTA 3RRHA 2WPEA 1SJDA 5DGAA 5F3XB 7ICFA 4DQIA 2CJOA 2BKRB 5KT3A 2MHJA 3A9JB 3KUDB 4ZOHC 9ICTA 4UBCA 5J0XA 2BPSA 5AM3A 2JZBB 2MUTA 4MFFA 1VAOA 2YMQA 2AQ2B 8ICPA 4CE6A 3FG2P 4M9LA 7ICRA 1N60C 4WH4A 1UUPA 1TKEA 2EAPA 8ICVA 3DQVA 4F7ZA 3EJDB 4B9UA 1BQGA 5IAAC 1A77A 4MACA 3U4EG 1WI0A 1UHUA 4ML8A 3R3MA 4IP4A 2EAOA 3K9OB 1UXYA 3NVYB 2V4QA 1J19A 3EZ5A 7ICJA 2CKHB 3L54A 1GRFA 2PP1A 1TBEA 1YQBA 4TV3A 1MDLA 9ICSA 1YT3A 3PX0A 4QW8A 2J6SA 2GRTA 2YB1A 3KLSX 5J0WA 2PEAA 3ZGZA 2NS5A 4ROPA 3H0MB 3VUWA 4IL0A 3VFCA 3Q8EA 4J9LA 1E7PB 3M3JA 1WRIA 3K1GA 3T8QA 4DWFA 4TURA 3ETRA 3UXOA 4F4XA 2RPQA 2F1HA 4ZYNA 1SKRA 4EOYA 2Y3AA 4OALA 2PU1A 5BOFA 1V9PA 5K4LA 2Z0DB 4I2IA 1GNUA 1GAQB 3FDSA 3B2FA 5C5JA 4UB1A 3RMKC 2KVZA 3C21A 2BCPA 2EANA 2NTSA 2V0GA 5FKAC 4ELTA 3ZKJC 4MLAA 1QOAA 1OQRA
chains in the Genus database with same CATH topology
1QLBB 1JW9D 1E8FA 1DGJA 1SJHD 2KACA 3J9CA 3WCQA 2LHEA 1N5XA 3R8BA 3LB8C 1L5PA 1V1PA 5BMIA 4N6EB 2M0AA 2BYTA 1IGDA 1TZOA 2VZKD 2Q85A 1GB4A 2HTME 4YXDB 2KN4A 2WXFA 4RF0A 1B1ZA 2IPKD 2MBRA 3P42A 1SXTA 2LMCA 3W5VB 2WDWA 2SAKA 3NVWB 5FXEA 5K8EA 1E9MA 3C8YA 4A55A 1IBXA 1FNVA 4HG0A 2UUVA 4KGTA 4MH8A 2PLPA 2M19A 1ZPSA 4O1NA 2BVGA 1FXIA 4L23A 1XCQL 2QSDA 1ZXIA 2E5AA 1W1MA 1ESFA 1PFDA 2PLIA 4PVJA 4CQNA 3CWIA 2QKNA 2Y5PA 3IT4B 1DZNA 4NAMA 1FFUC 4OZAA 3TSJA 2MJEA 1DIQA 3GP7A 4OZCA 1JALA 1KRHA 1I4HA 1TKGA 4L1BA 3U52E 5HQXA 3C0PA 4US9A 2V3PA 1QLTA 2BS4B 4JE3B 1D5MC 1SSNA 4KGSA 1JWMD 3TEXA 2XN9C 2WXHA 3AE3B 3SFDB 5AUIA 2WNMA 2LUMA 2WXJA 4WURA 5AUKA 2R8DA 2Y3RA 3R2TA 2EXRA 1HXYD 2Y4GA 2BBCA 1PYWD 2CU3A 5ADZA 3VR8B 4JX1C 3B9JB 4ZHOA 2FUG1 1F2RC 3DWMA 2N7JA 2QILA 2K5PA 3S1DA 2WQYB 1FRDA 4YTMB 3TSHA 3ZJVA 2KAJA 1L0YB 1E8GA 2I0KA 2KDMA 5C2TB 4ZYSA 3BIID 1IUEA 1SB3C 4USAA 3VRBB 1GPXA 4EE2A 4KX6B 1F0ZA 2WDRB 3GSYA 4C56C 3GB1A 1I4XA 5FXFA 3NRZB 5E6JA 4DXFA 1ZDXA 1FIQB 1PGAA 1TJEA 5I4DA 5BYQA 5HMRA 3T3OA 3D2JA 1SJED 3KWVA 2O3GA 1C77A 3RPFC 4TVWA 2N9KA 4O95A 5MPOA 5GXGB 3AEGB 1VZ8A 4L2YA 3SEBA 1C9FA 1K50A 5G5HA 5LNK1 1NYRA 1XEEA 4HEA1 2WXGA 1E10A 1C4PA 1MI0A 2WDVB 4JWUC 1N61A 1MBTA 2RDGA 4UD8A 3A7RA 2Y3SA 1JROA 4PWCA 5G5GA 1EWCA 2INPE 3AE8B 3HVDA 4HKQA 1E0ZA 1QT9A 2BVFA 3W8XA 3FILA 1I4GA 2W54A 3AE1B 3AE5B 4YTPB 1QQRA 5EE1A 1XXGA 1RFKA 3BVGA 3URYA 1FNUA 3BYYB 2VFRA 1TS3A 3ZYYX 3TX1A 5AE2A 1AW7A 2HDEA 2WXIA 3GS2A 3A7UA 2WU5B 2W3RA 4JWSC 1TS2A 1K53A 3IXSA 2RDHA 1A70A 2DYOA 4PVHA 1I4QA 2TSSA 1N5WC 1W1JA 5AE1A 2JU6X 3IAM1 1SB3B 4BC9A 1D5XC 2R2ZA 1F2RI 1KTKA 1YJJA 5HHZA 1EWYC 2AQ3B 1FNWA 1K51A 1DOXA 1FFVA 3AE4B 3HSUA 2GI9A 1ET6A 3NVVA 3VQIA 2E6XA 4WWMA 1FRRA 4BCAA 1T5XD 2J42A 2ZW0A 1RM6C 4OZBA 2Q5WD 3AEEB 1XLNA 1FO4A 4R3DA 1L0XB 1QF6A 2MH7A 2W3SA 2G1EA 5FK9C 1GB1A 3AB5A 3T3NA 1D4BA 5HG2A 1BXTA 3TUOA 2J52A 4XE0A 1N60A 1N63A 1P7FA 3ETRB 4TVYA 2P3HA 4Q2JA 2Q4WA 4ZRPA 2LFIA 3B2GA 1KLGD 2QEJC 4PVEA 4HKZE 3FWAA 2PVOD 3P4SB 4NZLB 3D2DA 3NVWA 3EGRA 4OW0A 3W5UB 4KKJA 2EKIA 1NEKB 4YSXB 2IPIA 2SEBD 4J3OD 1D5ZC 2IGGA 1ENFA 4RGTA 3PM9A 3FW9A 4RCOA 2MJ3A 2WXKA 2JXTA 3PZ7A 5JXVA 1JCKB 1NENB 3FW8A 5L6GA 4RF1A 1SE2A 1XLOA 2E3TA 3NZ3A 1HSKA 5AWVA 1PDXA 3AM9A 1ZR6A 1W1RA 3RJAA 2LGIA 1RM6B 3V05A 2J53A 1C78A 3AV8A 3BK1A 2WU2B 4XDDA 2IGHA 2FE8A 2XNAC 2N0SB 3I57A 2AX5A 2LHDA 4DQOC 1CQVA 1TY2A 2BVHA 3AE6B 1TYGB 3BK2A 2BS2B 1BUIC 1ZP0B 3OWEB 1JQ4A 4RGMA 5D7GA 1NI3A 3Q8AA 4N59A 4NJCA 3PO0A 4REZA 3MJ5A 2QPMA 4XWWA 2Y08A 4TSSA 4A6QA 3W1SA 1T3QC 2JZPA 3VR9B 3NVZB 3P63A 3KQ4A 4BC7A 2P13A 1D6EC 2WXPA 3BYTB 2W82A 3P4PB 2WP9B 1KLUD 4TQ1A 3D2HA 3R07C 1FMAD 2PIAA 2PMVA 3Q69A 4PWBA 2N9LA 2V3NA 1Y56A 1WYGA 1VLBA 1QOBA 3S1EA 1I7HA 4AS1A 3NS1B 5C3JB 1DOYA 2NQWA 4ARIA 5EE3A 3NRZA 1VZ6A 2K3UA 2WXQA 2L83A 1HZ5A 4XWTA 2JYEA 1FIQA 4GLSC 4HJGE 3H8HA 2K0PA 4RGNA 3UI3A 3P1MA 4RNAA 2UUUA 3MFGA 1V97A 1W1KA 1TS5A 1XO3A 2D5GA 2QMTA 2DLBA 1XLPA 3KWLA 4JPSA 1QKZA 1YJIA 2ONQA 5FXDA 2ON8A 4OHJA 2WXRA 4RFBA 1UWXA 4PT5A 1ZXHA 3JS8A 2YEPF 1L6UA 2X38A 1EU4A 2AQ1B 3LYYA 2GQUA 1FFVC 5BYRA 1I4PA 1J7BA 2PW9A 5AE3A 3DEDA 3FAHA 1MBBA 3IAS1 3HRDC 5G5HB 4IKGA 2OAIA 2ACZB 1T6BX 2VAOA 1YN4A 2V4IB 3NVYA 4ZRQA 2IJ0A 3CIRB 3AEFB 3SR6B 1QLUA 1MVKA 2QJLA 1PGXA 2ZW1A 2VFVA 2KMMA 1C79A 4RGOS 4JAYA 4PYTA 5BYSA 2QIEB 3HVZA 4JB1A 5G5GB 4A9AA 1XLQA 3S1CA 2FBWB 4MM3B 4WIPA 2LEKA 1JRPA 1AWDA 3POPA 3AEBB 3TEWA 1ZDVA 2BS3B 1N63C 1TS4A 5L6FA 1L0VB 3BWUD 3FW7A 2PKOA 1I4RA 4YTNB 5T8IA 2NMQA 1LO5D 1E6EB 1FM0D 2J4XA 2BT6A 1JWSD 3EA6A 3HUIA 1VJKA 2JWUA 4LLGM 4B0MA 1ZXIC 1W1OA 3SR6A 4DXGA 2PLSA 1C4CA 3NUHB 1XCTL 1JMLA 5BMGA 4C7ZA 3ZJUA 3PQBA 3A7AA 2OEDA 3AE7B 2ICIA 3MC0B 1VRAB 3AH7A 4TQ0A 5HHDG 3NVVB 4HROA 1HQRD 1UNSA 1SE4A 1ZOYB 2BB6A 4NAWB 5I1VA 1XF5L 1VZ7A 2R61A 3FC4A 1C76A 1PGBA 1DYQA 2BB5A 3EUB3 1EM7A 4YSYB 1C4AA 4LTUA 3W9CB 3KJMA 1ZE3D 2B76B 4PVKA 2P4PA 2LJIA 4ZHPA 1YQ3B 3MP9A 4KGRA 2Z8LA 4KKIA 2W55A 1N5WA 5D79A 1X2GA 2H88B 1EU3A 3I9V1 1NVID 1V1PB 3LXFA 2Y5CA 4PZFA 1DIIA 1HA5A 1ACCA 1L4ZB 1SIJA 1W1QA 2WXNA 2PTLA 2JX5A 1N62A 1ET9A 2H89B 2KWDA 3S1FA 1KFYB 3LAEA 1CK1A 1MHXA 1AN8A 3ABVB 3AECB 3N9YC 3W2DA 1IBXB 3W8WA 3P4QB 3LLBA 4OVZA 3V3XA 2IGDA 2OHFA 2AXRA 5FXPA 1SE3A 4IOIE 1TKYA 4M0WA 2VFTA 4C80A 3AE2B 5D3IB 5EE0A 4A8XC 5TSSA 2GQTA 2INNE 3AEAB 5HI1A 4C7YA 3RFZB 3I99A 4HRSA 1UWMA 2WDQB 3AMZA 4XLOA 2RK5A 3R2IA 3VTEA 3B9JA 1GOZA 1KH0A 3TSSA 1TY0A 1AHUA 1OFFA 1YN5A 1QILA 2NTTA 1J7AA 2PVGC 2DYMA 4UDUC 5H92C 3NVZA 4ARCA 3L4PA 3Q8FA 1FXAA 1MHHE 1MPEA 1HEZE 3BVZA 4BBYA 2KQ4X 3AE9B 3HRDD 2WXMA 1N61C 2GB1A 4LK0M 2EELA 1J7CA 4A90A 3BVMA 4MT5A 2YVSA 2IDYA 1SBBB 3NS1A 2I38A 5EE9A 4D2KA 1AHZA 4P6VF 1FFUA 1F77A 2JQRB 1E8HA 3Q8BA 2JYTA 4RH6A 4EC3A 1HZ6A 1NYQA 4IDIA 2GRIA 3BW7A 1K52A 1WVEA 1FCCC 1IGCA 1RYJA 1R7SA 3SFEB 1FCLA 3P4RB 3VRAB 1SF0A 1JWAD 1QOFA 1STEA 2CJNA 3IT6B 4GDLB 4GDKB 1W1SA 1L6VA 3AN1A 1QOGA 1V8CA 1ZUD2 3E56A 4H2AA 3TEZA 3PZ8A 3TEYA 1YN3A 1WVFA 1ROEA 2WLBA 4ITKA 2WXOA 4TMAB 1JWBD 1E0YA 5I1WA 1OQRA 1CZPA 2DBYA 1KF6B 1DOIA 1T3QA 3EUB2 4WQMA 4WAFA 4N58A 3RJ8A 1L4DB 2L52A 1W1LA 2G9HD 3ZJTA 2WXLA 3BZDB 3MHZA 5FR3A 1B9RA 1I19A 2CJOA 2VFUA 1M4VA 4ZOHC 1F0XA 2VZKB 2RMMA 1WGKA 1VAOA 1SEBD 2AQ2B 2JSVX 2I2YA 3U2SC 3FILB 1N60C 3AEDB 4AQ7A 1FEHA 1Q10A 1UUPA 1TKEA 4WH4A 3U7ZA 1FD6A 1AHVA 2DWQA 2K22A 4MACA 3DWGC 4FXCA 3U4EG 4YSZB 2BTEA 1BMLC 3W8ZA 4ML8A 1VDVA 4B0EA 1RWSA 4P16A 1UGJA 1UXYA 3DQ0A 4DNSA 1PUTA 1VR9A 3NVYB 3ZQ4A 1OQQA 1YQ4B 4YT0B 2RPVA 2MEKA 1YMHE 3KLSX 3ZGZA 1X2HA 1WSPA 3Q8EA 4US8A 1AYFA 1E7PB 1WRIA 5D3DA 4YWGG 1CJEA 2L1AA 1VQZA 1P7EA 1N62C 3ETRA 3E9SA 4OALA 4XDCA 1YNTE 2YEPB 2Y3AA 1JWUD 2L32A 5H8YE 1GAQB 2M56B 2K9XA 3B2FA 1WWTA 2BW2A 3O13A 5BMHA 1V1OA 2NTSA 5HFYA 5FKAC 2V0GA 2VFSA 3Q8CA 4MLAA 1QOAA 2MJDA 1WXQA 2WS3B 4ZOHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLB B;  1JW9 D;  1E8F A;  1DGJ A;  3WCQ A;  1N5X A;  3LB8 C;  1L5P A;  4N6E B;  2Q85 A;  2HTM E;  4YXD B;  2MBR A;  3W5V B;  3NVW B;  1E9M A;  4HG0 A;  2M19 A;  2BVG A;  1FXI A;  1ZXI A;  2E5A A;  1W1M A;  1PFD A;  2PLI A;  4PVJ A;  2QKN A;  3CWI A;  1DZN A;  1FFU C;  3TSJ A;  2MJE A;  1DIQ A;  1JAL A;  1KRH A;  1TKG A;  5HQX A;  3C0P A;  4US9 A;  1QLT A;  2BS4 B;  3AE3 B;  3SFD B;  5AUI A;  5AUK A;  2R8D A;  2EXR A;  2CU3 A;  5ADZ A;  3VR8 B;  4JX1 C;  3B9J B;  4ZHO A;  3DWM A;  2K5P A;  3S1D A;  2WQY B;  1FRD A;  4YTM B;  3TSH A;  2KAJ A;  1E8G A;  2I0K A;  5C2T B;  3BII D;  1IUE A;  1SB3 C;  4USA A;  3VRB B;  1GPX A;  4KX6 B;  1F0Z A;  2WDR B;  3GSY A;  5FXF A;  3NRZ B;  1FIQ B;  1TJE A;  5HMR A;  3D2J A;  2O3G A;  3RPF C;  4TVW A;  4O95 A;  5MPO A;  5GXG B;  3AEG B;  5G5H A;  1NYR A;  1E10 A;  4JWU C;  2WDV B;  1N61 A;  4UD8 A;  3A7R A;  1JRO A;  4PWC A;  5G5G A;  3AE8 B;  1E0Z A;  3W8X A;  1QT9 A;  2BVF A;  2W54 A;  3AE1 B;  3AE5 B;  4YTP B;  5EE1 A;  1RFK A;  2VFR A;  3ZYY X;  3TX1 A;  5AE2 A;  3A7U A;  2WU5 B;  2W3R A;  4JWS C;  1A70 A;  4PVH A;  1N5W C;  1W1J A;  5AE1 A;  1SB3 B;  1YJJ A;  5HHZ A;  1EWY C;  1DOX A;  1FFV A;  3AE4 B;  3NVV A;  4WWM A;  1FRR A;  1RM6 C;  2Q5W D;  3AEE B;  1XLN A;  1FO4 A;  1QF6 A;  2MH7 A;  2W3S A;  2G1E A;  3AB5 A;  2P3H A;  1N60 A;  1N63 A;  3ETR B;  4TVY A;  2Q4W A;  3B2G A;  4PVE A;  3FWA A;  2PVO D;  3P4S B;  3D2D A;  3NVW A;  3W5U B;  2EKI A;  1NEK B;  4YSX B;  3PM9 A;  3FW9 A;  2MJ3 A;  1NEN B;  3FW8 A;  1XLO A;  2E3T A;  1HSK A;  1PDX A;  3AM9 A;  1ZR6 A;  1W1R A;  1RM6 B;  3AV8 A;  2WU2 B;  2N0S B;  2AX5 A;  2BVH A;  3AE6 B;  1TYG B;  5FXE A;  2BS2 B;  1JQ4 A;  1ZP0 B;  1NI3 A;  4N59 A;  3PO0 A;  2QPM A;  1T3Q C;  3VR9 B;  3NVZ B;  3P63 A;  4BC7 A;  2P13 A;  3P4P B;  2WP9 B;  3D2H A;  3R07 C;  1FMA D;  2PIA A;  4PWB A;  1WYG A;  1VLB A;  1QOB A;  3S1E A;  1I7H A;  3NS1 B;  5C3J B;  1DOY A;  2NQW A;  5EE3 A;  3NRZ A;  2L83 A;  1FIQ A;  3P1M A;  1V97 A;  1W1K A;  1XO3 A;  1XLP A;  3KWL A;  1YJI A;  5FXD A;  3JS8 A;  1L6U A;  2GQU A;  1FFV C;  1J7B A;  5AE3 A;  3DED A;  3FAH A;  1MBB A;  3HRD C;  5G5H B;  2OAI A;  2ACZ B;  2VAO A;  3NVY A;  3CIR B;  3AEF B;  1QLU A;  2QJL A;  2VFV A;  2KMM A;  4JAY A;  4PYT A;  2QIE B;  3HVZ A;  4JB1 A;  5G5G B;  1XLQ A;  3S1C A;  2FBW B;  2LEK A;  1JRP A;  1AWD A;  3AEB B;  2BS3 B;  1N63 C;  1L0V B;  3FW7 A;  2PKO A;  4YTN B;  1E6E B;  1FM0 D;  2BT6 A;  3HUI A;  1VJK A;  1ZXI C;  1W1O A;  3SR6 A;  2PLS A;  4C7Z A;  3A7A A;  3AE7 B;  3AH7 A;  3NVV B;  4HRO A;  1ZOY B;  3FC4 A;  3EUB 3;  4YSY B;  4LTU A;  3W9C B;  3KJM A;  2B76 B;  4PVK A;  2P4P A;  4ZHP A;  1YQ3 B;  2WS3 B;  1X2G A;  2W55 A;  1N5W A;  5D79 A;  2H88 B;  1NVI D;  3LXF A;  2Y5C A;  4PZF A;  1DII A;  1W1Q A;  1SIJ A;  2JX5 A;  1N62 A;  2H89 B;  3S1F A;  1KFY B;  3LAE A;  4BC9 A;  3ABV B;  4BCA A;  3AEC B;  3W8W A;  3P4Q B;  3LLB A;  2OHF A;  2AXR A;  5FXP A;  1TKY A;  2VFT A;  4C80 A;  3AE2 B;  5EE0 A;  2GQT A;  3AEA B;  4C7Y A;  3I99 A;  4HRS A;  2WDQ B;  1UWM A;  3AMZ A;  4XLO A;  2RK5 A;  3VTE A;  3B9J A;  1AHU A;  1OFF A;  2PVG C;  1J7A A;  5H92 C;  3NVZ A;  3L4P A;  1FXA A;  4BBY A;  3AE9 B;  3HRD D;  1N61 C;  1J7C A;  2YVS A;  3NS1 A;  5EE9 A;  1AHZ A;  4P6V F;  1FFU A;  2JQR B;  1E8H A;  4EC3 A;  1NYQ A;  4IDI A;  3BW7 A;  1WVE A;  1RYJ A;  1R7S A;  3SFE B;  3P4R B;  3VRA B;  1SF0 A;  1JWA D;  1QOF A;  2CJN A;  1W1S A;  1L6V A;  3AN1 A;  1QOG A;  1V8C A;  1ZUD 2;  1WVF A;  1ROE A;  2WLB A;  4ITK A;  1JWB D;  1E0Y A;  1OQR A;  1CZP A;  2DBY A;  1KF6 B;  1DOI A;  1T3Q A;  3EUB 2;  4WQM A;  4N58 A;  2L52 A;  1W1L A;  1B9R A;  1I19 A;  2CJO A;  2VFU A;  1F0X A;  4ZOH C;  1WGK A;  1VAO A;  1N60 C;  3AED B;  1TKE A;  1AHV A;  2DWQ A;  2K22 A;  4YSZ B;  3DWG C;  4FXC A;  3W8Z A;  4ML8 A;  1VDV A;  2MJD A;  1RWS A;  1UXY A;  3DQ0 A;  4DNS A;  1PUT A;  3NVY B;  1OQQ A;  1YQ4 B;  4YT0 B;  1X2H A;  4US8 A;  1AYF A;  1E7P B;  1WRI A;  1CJE A;  1VQZ A;  1N62 C;  3ETR A;  4OAL A;  5H8Y E;  1GAQ B;  2M56 B;  2K9X A;  3B2F A;  1WWT A;  2VFS A;  4MLA A;  4ZOH B;  3SR6 B;  2R2Z A;  1QOA A;  4A9A A;  1WXQ A;  1MBT A; 
#chains in the Genus database with same CATH topology
 3QE9 Y;  3BS5 B;  2PI5 A;  1GRG A;  2OCE A;  2VIX A;  5IA7 A;  1N5X A;  4A8E A;  3LB8 C;  1V1P A;  2HHQ A;  4TKN A;  5DG8 A;  4IL2 A;  2ZTE A;  4N6E B;  2BYT A;  2FMQ A;  1IGD A;  2Q85 A;  4GGH A;  4ZH4 A;  1WH3 A;  3G6X A;  9ICW A;  1K1S A;  2OYY A;  5IIL A;  2WXF A;  5F9L A;  4EZK A;  1GB4 A;  3Q45 A;  1B1Z A;  3ZD9 A;  2BCU A;  4IZG A;  4LA1 A;  2MAX A;  4RQ2 A;  8ICR A;  1BVS A;  3P42 A;  5JCL A;  1PVR A;  2DZM A;  2QDF A;  3ZNG C;  4H4Z A;  2BDU A;  4LNK A;  3VUX A;  4M6W B;  1E9M A;  3N4F A;  4HG0 A;  1X6J A;  3M6Z A;  3GIM A;  3PZP A;  2PLP A;  3MDA A;  4MDK E;  1S8O A;  2BVG A;  1FXI A;  5JCM A;  4YD1 A;  2HBM A;  4MSQ B;  4X5V A;  3ECI A;  4O3M A;  4LZG A;  2KKC A;  3CWI A;  2XGP A;  2BKF A;  2B3A A;  3IT4 B;  3X23 A;  2LVO A;  4NAM A;  2CXY A;  5DPW A;  4OZA A;  1DZN A;  3ONS A;  3L10 B;  4DQR A;  1DIQ A;  1Z3E B;  2LXC A;  4GIB A;  1TKG A;  4L1B A;  4WJO A;  4IUM B;  5FR6 A;  4Z1Y A;  4KEM A;  2V3P A;  3H8S A;  1WG8 A;  4JE3 B;  2KG5 A;  1SSN A;  4KGS A;  3DK8 A;  3ZVH A;  2YMP A;  3KKA C;  1S0M A;  2A4Z A;  4KV2 A;  1F5S A;  5DLG A;  4RQ4 A;  2DZJ A;  1BPB A;  5AUI A;  4EUT A;  1MQ2 A;  1WX8 A;  5AUK A;  2M4N A;  3PMN A;  3H7S A;  3R2T A;  2GBM A;  2G5I B;  1B4F A;  3FXG A;  3M63 B;  2PI4 A;  3ISD A;  4M9G A;  9ICI A;  3IBE A;  1X42 A;  2ZXH A;  2IY1 B;  4HJK A;  4ZRI A;  5J2D A;  9ICR A;  2MU2 A;  3ZJV A;  1EC7 A;  1JEH A;  4K8D A;  4C8K A;  2C7H A;  1RXV A;  5IIJ A;  3C23 A;  1WGR A;  2KDM A;  5C2T B;  3EEZ A;  2OZ8 A;  4DXK A;  3WAL A;  4G8T A;  1PK1 A;  3ETL A;  3WKC A;  1JX4 A;  2WDR B;  3N6H A;  2GMI C;  4C56 C;  3AQE A;  4RQ8 A;  5AM4 A;  2GDQ A;  5FXF A;  4RT3 A;  3M1Y A;  2LAS A;  3OG5 A;  3UQB A;  2Y1J A;  1TKK A;  3FCP A;  7ENL A;  4DXF A;  1PGA A;  4QZB A;  1OTR B;  3TAD C;  2AGO A;  3RPF C;  4HAI A;  4HNC A;  8ICO A;  3AEG B;  2IND C;  1KKR A;  4EEW A;  1K50 A;  3RZF A;  4F5O A;  2FUH B;  2IY0 B;  3JVA A;  1TAM A;  1DGS A;  5FP0 A;  1KM7 A;  1MUC A;  3QXG A;  3NZU A;  4JWU C;  5KL8 B;  3X0W A;  2I5H A;  2Y3S A;  3KZX A;  2INP E;  4HKQ A;  3QKE A;  4PZN A;  1QT9 A;  3H0R B;  2W54 A;  3JPT A;  2EZX A;  4YTP B;  1QQR A;  3QNM A;  4DEZ A;  1IPG A;  3BVG A;  1FNU A;  2W9A A;  3BYY B;  1JIH A;  1OUQ A;  2HDE A;  2RP5 A;  3DJG X;  3MC8 A;  2J0M A;  3A7U A;  2AYO B;  3R25 A;  1BGX T;  3BY4 B;  4TQS A;  5AI4 A;  3T8M A;  2K6D B;  3QAR A;  4EX6 A;  2NRT A;  4ED2 A;  1M6Y A;  1X9X A;  4ECR A;  1A70 A;  3H8M A;  3Q3M C;  2PFO A;  1D9D A;  3V6K A;  1S0V A;  2L7R A;  3A33 B;  1Z4N A;  2JU6 X;  1N5W C;  1ZX9 A;  1LQB A;  1F2R I;  4K1R B;  4C4V B;  4GGB A;  1XDI A;  1F9J A;  3M9M B;  4K7S A;  3DBS A;  1YEY A;  1X9W A;  1K51 A;  4MF2 A;  8ICW A;  3TAQ A;  1FFV A;  2H5X A;  3HSU A;  1ET6 A;  4MF8 A;  4HVB A;  2E8O A;  5J2A A;  1T5X D;  1V5T A;  4NAW A;  2DYB A;  2ISO A;  3SAH A;  5AHX A;  4OZB A;  3CGE A;  2RDB C;  4F4K A;  3B1L X;  4P0P A;  3D9X A;  1Q1W A;  3QIJ A;  2OOB B;  2W3S A;  2YVJ A;  1WJ4 A;  3KD3 A;  1GB1 A;  2GO7 A;  3I28 A;  3DK4 A;  3A9K B;  1N60 A;  4TVY A;  3JVZ X;  3M95 A;  3GQC A;  4KLQ A;  4URK A;  4ZRP A;  5KG6 A;  3RNA C;  3NAS A;  2LFI A;  2KSO B;  1XO1 A;  3V6J A;  3IDW A;  5KFK A;  2QEJ C;  3PK7 A;  2PVO D;  3R1Z A;  2IO0 B;  1SGH A;  2G06 A;  2ASD A;  4OW0 A;  3HKZ C;  1LVH A;  4PGX A;  4NLB A;  2SEB D;  3CNH A;  3HPO A;  5J2E A;  4J3O D;  3TJP A;  1SJC A;  3V7L A;  1ENF A;  4PHE A;  4RGT A;  3PM9 A;  2JH1 A;  3DHI C;  4H4V A;  1T7P A;  3EC8 A;  3Q6J A;  1QSS A;  3PZ7 A;  1P9D U;  1ZJN A;  3ZIM A;  1HEK A;  3FW8 A;  1WXS A;  3Q4D A;  4CNQ A;  1Y88 A;  2IYD B;  3NZ3 A;  9ICA A;  1HSK A;  1PDX A;  3M8R A;  3WK8 A;  3TAR A;  2BPG A;  3DCG A;  2KFJ A;  1W1R A;  3II4 A;  3NFU A;  3RJA A;  3GZN I;  2J53 A;  5J0S A;  3DEQ A;  4EQX A;  4QZC A;  3JPR A;  3AV8 A;  1LGR A;  2WTF A;  3MSY A;  1S76 D;  4I2J A;  2WU2 B;  4XDD A;  2IGH A;  1JXL A;  4CHK A;  4DHJ D;  3IC9 A;  1UQV A;  4EEL A;  2IHM A;  2JK6 A;  4KTQ A;  4QWA A;  2KNB A;  1CQV A;  2BVH A;  5DB6 A;  1ZQP A;  1TYG B;  3PRP B;  1JQ4 A;  4C00 A;  1NI3 A;  3C1Y A;  3WKA A;  2KX3 A;  2JV3 A;  4JUZ A;  1SXD A;  2K8B B;  2ZIW A;  9ICL A;  4N59 A;  1KJT A;  4YQW A;  3WAN A;  3LB8 A;  5KFI A;  3ALB A;  4REZ A;  4WJ3 B;  3ZVV A;  1T3Q C;  2J0K A;  1DXS A;  3PFR A;  1K1Q A;  4G11 A;  3PR5 B;  3ALR A;  2KHW B;  3IJQ A;  4PGY A;  2P13 A;  4KPR A;  1WX7 A;  4IWO A;  1BT0 A;  3BYT B;  4U6P A;  4P4O A;  4R64 A;  2WP9 B;  5KFA A;  4LZD A;  2MRL A;  3AQF A;  5BPC A;  3H6N A;  3KUM A;  2PTX A;  1Y56 A;  4NPN A;  2KZM A;  1ZQK A;  2C3D A;  2W9C B;  2HHS A;  5C3J B;  1DOY A;  2NQW A;  3I1Y A;  5AIA A;  2JR5 A;  5EE3 A;  4ARI A;  2L83 A;  1HZ5 A;  4X57 B;  4XWT A;  4GLS C;  4J3Z A;  8ICS A;  4HJG E;  3UI3 A;  5DB9 A;  2YVG A;  3LWM A;  3VH3 B;  3LVW A;  2LWP A;  2GR2 A;  3AU6 A;  2D2Q A;  3GC2 A;  3QUC A;  7ICV A;  2W11 A;  2QMT A;  4NQK E;  5JCK A;  1L8O A;  1RVK A;  3DG3 A;  2BC1 A;  4FJY A;  4JPS A;  1YJI A;  2ONQ A;  3P93 A;  1T94 A;  4Y2J A;  4RFB A;  4ICV A;  4YCX A;  2KIV A;  4A3O A;  4LNF A;  5AKX A;  4PT5 A;  1TYP A;  3SD7 A;  2ZIU A;  2YEP F;  4DQP A;  4YR3 A;  4HCL A;  2W43 A;  1EU4 A;  1LVL A;  3LYY A;  2GQU A;  4GYP A;  1P7D A;  4DLE A;  5H2F U;  2KJ6 A;  2OJR A;  4II3 B;  2GGG A;  7ICO A;  2OXO A;  1PDZ A;  2YQU A;  1KN0 A;  2QCZ A;  4ICU A;  4OJO A;  2FCM A;  2UVW A;  4ELU A;  2KTR B;  2LRW A;  1ELS A;  2ACZ B;  2GH5 A;  4BOZ B;  1TZ1 A;  2XK5 A;  4GSW A;  3BSM A;  1PVQ A;  1KKX A;  1YN4 A;  3N3K B;  4DL5 A;  3T79 A;  4EM3 A;  2HHT A;  3WAM A;  3TWB A;  4RGO S;  3JYU A;  4Z17 A;  2C60 A;  2DQN B;  5L9X A;  1SGG A;  2M1M A;  4JWN A;  3SAF A;  2JGA A;  4HPL B;  1AWD A;  2OG9 A;  4ENL A;  4W9K A;  5KHO A;  4UAW A;  2JF5 A;  5L6F A;  3DVG Y;  2HHW A;  3D2S A;  4AYB C;  1PK3 A;  5AM1 A;  5DLF A;  2HTH A;  4OVV A;  1I4R A;  3TAD A;  4YTN B;  4JB3 A;  9ICC A;  1LO5 D;  1E6E B;  1FM0 D;  4XGA B;  5KFQ A;  3WAP A;  3ZXR A;  2F5Z A;  2LMR A;  2RRD A;  4NJ8 A;  3EA6 A;  2XY6 A;  4IM2 A;  4M02 A;  4MJS A;  3KLJ A;  1ZXI C;  5CRX A;  2PLS A;  1C4C A;  3RI7 C;  1WCL A;  3RH5 A;  3A0B U;  4Z6D A;  2FMP A;  3UCD A;  3DBR B;  3TQ1 A;  5J2H A;  4MGZ E;  1WUD A;  3QUB A;  4RQ6 A;  1L7P A;  1HQR D;  1UNS A;  1ZOY B;  2M0X A;  3ZVI A;  4DO9 A;  1VZ7 A;  3KYD D;  3Q6B A;  3FV9 A;  3FC4 A;  2L76 A;  1RZT A;  1C76 A;  4F3O A;  1ZQB A;  1HTO A;  4QZI A;  4QWD A;  4MGY E;  3W9C B;  3HJE A;  5CHV C;  3MKC A;  4KGR A;  3SQS A;  2Z8L A;  3N7S C;  1X2G A;  2W55 A;  1N5W A;  2NBW B;  4ECT A;  2N9P C;  2DGZ A;  1A76 A;  2BHN A;  1MC8 A;  5ALG A;  1L2N A;  1TV9 A;  3RBE A;  2VA2 A;  2YTU A;  2Y5C A;  2BYE A;  3V62 A;  3QEB Z;  4ECS A;  4BWJ A;  8ICB A;  1DII A;  1OW5 A;  1HA5 A;  1L3T A;  1OXJ A;  3QU4 A;  1SIJ A;  2HVI A;  1W1Q A;  4HXD A;  3HIL A;  2ZNV C;  4DX3 A;  2RLT A;  4B9M A;  2ZZC A;  4FDC B;  4BKT A;  5IIO A;  5C0Y A;  1V9J A;  1IBX B;  4OVZ A;  4JMU A;  1TK8 A;  2ONE A;  4J9O A;  2VA8 A;  5FXP A;  4IOI E;  2WF5 A;  4A3P A;  2VFT A;  5D3I B;  4UB6 U;  4A8X C;  3RUI B;  2HDO A;  5HI1 A;  3RFZ B;  1J97 A;  4HRS A;  2C7M B;  4XLO A;  2RK5 A;  4F72 A;  3R9K A;  4DSJ A;  3B9J A;  3KFU F;  1RFA A;  4QAY A;  2F76 X;  4F71 A;  3KUZ A;  1GOZ A;  1T0Y A;  1AHU A;  2MP2 A;  3OC4 A;  1OFF A;  4YMM A;  1QIL A;  1X40 A;  3ZLH A;  2G45 B;  4GC7 A;  2W9M A;  2L00 B;  1WJN A;  1FXA A;  1HEZ E;  4I2E A;  1U47 A;  2QLT A;  4J9N A;  2KMD A;  2KQ4 X;  3MTN B;  1T0Q C;  3N7R C;  3BJS A;  2FDR A;  2WXM A;  2ZJD A;  3N1Z C;  3RFA A;  1N61 C;  2K4E A;  2ZIX A;  3NRW A;  4MKS A;  2XC9 A;  3BVM A;  4DHZ B;  5KAF U;  2AL2 A;  1XSP A;  4JHM A;  3UPQ A;  2IDY A;  3GFK B;  2I38 A;  5DBA A;  4GFJ A;  2W03 A;  1AHZ A;  2YX8 A;  1TE2 A;  2IBI B;  3WIM A;  1K8R B;  4RPX A;  5KFB A;  1QSY A;  1WGD A;  4Y2T A;  4IDI A;  4RH6 A;  5L95 C;  4EC3 A;  4NL9 C;  2PMQ A;  4JK1 A;  2F1J A;  3AI5 A;  3NZS A;  3U8Z A;  2BR0 A;  1IGC A;  1RYJ A;  2PSN A;  3SFE B;  3APF A;  5IIN A;  5AK3 A;  1FCL A;  1SF0 A;  3PW0 A;  1RYS A;  2QB1 A;  4JV1 A;  5J0T A;  2FCQ A;  1W1S A;  4H2A A;  3GIL A;  5J2I A;  2BQQ A;  3E56 A;  3UMG A;  4I2H A;  3TEZ A;  3ZD8 A;  4C8L A;  2HZG A;  3T5L A;  2N4F A;  5KT2 A;  1UZX B;  3PGE A;  3UJR A;  4F5Q A;  5I1W A;  3OLM D;  2D10 A;  3QAQ A;  1CZP A;  4RM9 A;  2DBY A;  2KMA A;  3NTU A;  1T3Q A;  9ICU A;  3EUB 2;  3T5K A;  2LYA A;  4S0R A;  3GU3 A;  4WAF A;  4N58 A;  4F5R A;  1JOA A;  2RDX A;  2R8H A;  2CHW A;  2F3N A;  2OKT A;  2AL6 A;  4X2P A;  1B9R A;  3BZD B;  1I19 A;  3D2Q A;  3GV5 B;  2KWU B;  2VFU A;  4KIT B;  1Q46 A;  2E1E A;  2FPK A;  3H4D A;  1BPX A;  1WGK A;  5KG0 A;  3PRZ A;  4AJW A;  3RJK A;  4ECY A;  2JSV X;  4B9S A;  5J2F A;  2LUE A;  3IHP C;  4PYZ A;  3U2S C;  9ICJ A;  3RT3 B;  2KDE B;  3N7P D;  2IMW P;  5J18 A;  5HHH A;  4AQ7 A;  3BQ1 A;  4F4Z A;  2DWQ A;  2BTE A;  4ANX A;  4BFR A;  2DAF A;  4LII A;  2DZK A;  1BML C;  3JSV B;  4O3Q A;  3GOE A;  1ZQD A;  3B0A A;  3DQ0 A;  1XQQ A;  3UMB A;  2QQ6 A;  4YT0 B;  1DTN A;  3RJH A;  3RZW C;  2KFZ A;  4DL7 A;  1Q3U A;  3GZF A;  3LXD A;  3QFB A;  3T4W A;  3MR5 A;  2B6G A;  4QZF A;  2RPV A;  1Y8R C;  3ML9 A;  1YMH E;  3VDZ A;  5AKH A;  3UIO B;  1SWW A;  2ASL A;  1NKC A;  2XID A;  1KFT A;  1WSP A;  2AJQ A;  4BKG A;  1AYF A;  3L16 A;  5C1Z A;  5D3D A;  4J6I A;  4IC7 B;  2KN5 A;  4YWG G;  2L1A A;  7ICE A;  2XH4 A;  1R4N I;  5KFZ A;  1N62 C;  2D8C A;  1H6V A;  1Z1V A;  3E9S A;  2CFY A;  3N30 A;  4XDC A;  5J0O A;  1S97 A;  2YEP B;  3FKY A;  4R65 A;  1JWU D;  2WB1 F;  2L32 A;  5H8Y E;  3RJE A;  2EAM A;  3H8J A;  4Y2Q A;  2BW2 A;  3RYT A;  4UB4 A;  4QIW F;  1LB2 B;  4OJ5 A;  3DEE A;  1V1O A;  2VFS A;  4IRC A;  3MC9 A;  2R2Z A;  2ZCB A;  4ED6 A;  1KFD A;  4RNN A;  4E6M A;  3I6T A;  5AK6 A;  5KFL A;  3WKE A;  4I28 A;  3FYH A;  5DPS A;  4B9N A;  3WCQ A;  2LHE A;  2C28 A;  1L5P A;  1LKY B;  1L8P A;  3IG3 A;  3KW5 B;  5BMI A;  2LM4 A;  5JZE B;  5CB1 A;  1TZO A;  3R11 A;  1BNP A;  1NDA A;  1JI7 A;  2HTM E;  2KN4 A;  4NWI A;  2VH2 A;  5C23 A;  2JRH A;  2OJW A;  5CX3 A;  4GIS A;  4J9P A;  4RQ1 A;  4KN4 A;  2IPK D;  3HK0 A;  3W5V B;  2G09 A;  5J2R A;  1EXN A;  1K5O A;  2VA3 A;  3GE8 C;  3NVW B;  1BKH A;  2HMX A;  2W7P A;  1NKE A;  1FNV A;  5U25 A;  2OH2 A;  3WKD A;  2M19 A;  5TR5 A;  3VC6 A;  4O1N A;  4K81 A;  4I2G A;  4L23 A;  1XSN A;  3H8W A;  4H2H A;  3GIK A;  4DS4 A;  1ZXI A;  3VH4 B;  5DG9 A;  1PFD A;  2EDU A;  3PWG A;  4UQG A;  2FLP A;  4YG2 A;  2Y5P A;  2ZG6 A;  1FFU C;  3ZDB A;  4YR0 A;  2WHI A;  1QZE A;  8ICX A;  2H3F A;  1KRH A;  4BVU C;  1I4H A;  3WK5 A;  3VDG A;  4DSE A;  2JXJ A;  5HQX A;  1WIA A;  1AAR A;  4WWP A;  2MSN A;  1QLT A;  4BGD A;  2KOB A;  5U1O A;  1D5M C;  5BOE A;  2XN9 C;  2L8J A;  2LJ5 A;  2WXH A;  3AE3 B;  1NK7 A;  4U7C A;  1QQ7 A;  3BZK A;  2LUM A;  2WNM A;  1J8C A;  1IYX A;  2AAQ A;  2E8N A;  1SL1 A;  1HXY D;  1MQ3 A;  2H3V A;  1PYW D;  2BBC A;  4J9M A;  3VR8 B;  4M9N A;  2KFK B;  1S1Q B;  4E74 A;  1ZET A;  2FUG 1;  3SHQ A;  2N7J A;  3C29 A;  3EFC A;  4LJO B;  2K5P A;  2HBJ A;  3KHH A;  1V59 A;  4K1W A;  3DBL I;  5J0Q A;  3S1D A;  5KFG A;  2CHX A;  2JXX A;  2WQY B;  3TSH A;  3DG7 A;  2K8C A;  4DWI A;  1MNS A;  1L0Y B;  3EW9 A;  5KG7 A;  2N7E A;  2HJ1 A;  1E8G A;  4LDT D;  4BXO A;  2EQY A;  4EYI B;  2BQR A;  1YD8 U;  4CF5 A;  2NPT A;  3BII D;  1IUE A;  4USA A;  4EMJ A;  4PPX A;  2PFN A;  4EE2 A;  1GPX A;  3PLU A;  2OX4 A;  3GB1 A;  2Y0S F;  3NRZ B;  2O2V B;  1WX9 A;  4PHD A;  5E6J A;  4RZR A;  2WF8 A;  3VFK A;  1TJE A;  2NQL A;  4XX5 A;  5DBB A;  3KWV A;  2O3G A;  1C77 A;  2CHZ A;  4TVW A;  5J0R A;  3R7R A;  4O95 A;  5ALQ A;  2Y1I A;  2DW6 A;  3EEC A;  5LXI B;  5G5H A;  2OM6 A;  4P4M A;  2FNJ B;  4H4T A;  1TZZ A;  3DDH A;  5AM2 A;  1LFD A;  4KIK B;  1S9F A;  2DNF A;  1E10 A;  1ARO P;  3A9J A;  4RQ3 A;  1N61 A;  3QCA A;  2PE6 B;  2RDG A;  3ZNI D;  1YQZ A;  3A7R A;  1JRO A;  2JZB A;  4MEY A;  5AIC A;  5G5G A;  1M94 A;  2KLC A;  3PY8 A;  4FJV B;  4W9C A;  4MM3 A;  1E0Z A;  3W8X A;  1MO9 A;  2BCR A;  5GRT A;  1X66 A;  3RR8 A;  1UEL A;  1EUV B;  1NHR A;  5EE1 A;  2BGW A;  1RLF A;  1XXG A;  4QZ9 A;  3PW7 A;  3URY A;  8ICM A;  3QQ8 B;  3ZYY X;  3TX1 A;  1AW7 A;  2GLE A;  2WXI A;  3H9D A;  4JWS C;  1TS2 A;  1KSP A;  2RD0 A;  3DDC B;  4Y2R A;  4CGZ A;  2RDH A;  4PHP A;  1EBD A;  5KFR A;  3IV6 A;  4ACO A;  4Z6E A;  3IAM 1;  1OJT A;  2KJ8 A;  2BPF A;  2YML A;  1TAU A;  1Z2M A;  4W9L A;  4RPZ A;  2W9B A;  5AZG A;  2X8G A;  5J2K A;  5HR6 A;  3MHS D;  1ZQW A;  3TOY A;  3TFR A;  2LD9 A;  2O6V B;  8ICJ A;  4WWM A;  4DHJ B;  1FRR A;  2ZVO A;  2J3N A;  2J42 A;  2MSE D;  1NDD A;  3UF8 A;  3GO2 A;  1ISN A;  5EOZ A;  1TT5 B;  3RB4 A;  1L5U A;  1NEL A;  2CHR A;  1RQL A;  1L0X B;  2ZIV B;  2MLB A;  3HW8 A;  1UBI A;  2KDI A;  5G2N A;  1ZRM A;  3RNG C;  4EEN A;  5FK9 C;  2NV3 A;  3KUC B;  3GD4 A;  3BS5 A;  3AB5 A;  1D4B A;  5KFY A;  4ED1 A;  3CXO A;  4WQO B;  5CP2 A;  1BXT A;  4ECZ A;  2J52 A;  2BCQ A;  5AI5 A;  1EO6 A;  4M8M A;  2BQ3 A;  2N9E B;  3ETR B;  2Q4W A;  4MFA A;  2K8A A;  4C4T A;  1NHS A;  2DL0 A;  2KKP A;  3M8S A;  3M62 B;  4EYH B;  4PVE A;  3OZY A;  2RQ5 A;  3A0H U;  4UB2 A;  3P4S B;  3FWA A;  5FJT A;  3SN1 A;  4RPY A;  4YR2 A;  3HHM A;  4M6W A;  1ONF A;  3W5U B;  4KKJ A;  3VTV A;  1XO0 A;  5GMV A;  4K4I A;  4TUQ A;  3QJZ A;  4YSX B;  1JCT A;  2IGG A;  4FBU A;  2YN4 A;  4K3C A;  4KLS A;  2KVC A;  1WMH B;  2PMZ C;  3MBY A;  4RCO A;  2IO2 B;  3RRA A;  3V5C A;  2I6X A;  2JXT A;  8ICQ A;  2HSZ A;  4A35 A;  2P88 A;  1NK9 A;  1ZQZ A;  2R8J A;  1ZQ1 C;  2R2O A;  3TFS A;  3SD5 A;  2C2R A;  1IYF A;  2LGX A;  4F93 B;  4ANV A;  3AM9 A;  2QJM A;  5AWV A;  1WXV A;  2PPH A;  4EKU A;  3IG8 A;  4Y2V A;  3L8K A;  1IM4 A;  2LBO A;  4HCD A;  2BVC A;  2GH1 A;  1S5L U;  3AXC A;  4M0W B;  4XZ4 A;  3BK1 A;  2CRX A;  4FLH A;  2P8C A;  3U30 A;  4H4P A;  2FE8 A;  3IRU A;  1GC7 A;  4NEV A;  2AX5 A;  4I2F A;  3SSZ A;  3PSI A;  5FXE A;  2O56 A;  3BK2 A;  2BCS A;  2BS2 B;  4GIV A;  4RGM A;  5D7G A;  1D3Z A;  2HOQ A;  9ICE A;  4UAV A;  1JXE A;  4KX5 A;  3ZDC A;  2GBN A;  1U48 A;  4O3S A;  2N1R A;  2LM1 A;  5AZH A;  1P0R A;  1X6I A;  4UAT A;  2RAB A;  2V3B A;  3W1S A;  4J9R A;  1NJX A;  4AWJ A;  3ZLF A;  4MGG A;  3RBD A;  7ICS A;  3KQ4 A;  4K7W A;  2X8H A;  4C4S A;  4IS7 A;  2WP6 A;  2WXP A;  2OQH A;  3ZRF A;  2BCV A;  4HYR A;  2J0J A;  2A3V A;  2W82 A;  3P4P B;  2P8B A;  3UJF A;  4MH0 E;  2KIC A;  3WK7 A;  4LJX A;  5HMM A;  4BZA A;  3NXL A;  3R07 C;  4LNN A;  1ZGU B;  2PIA A;  1BNO A;  2C3C A;  1WYG A;  2ZZP B;  1A6S A;  1C3T A;  1QOB A;  2GBK A;  3S1E A;  3D47 A;  2K89 A;  3PST A;  2JZ3 B;  3H7V A;  4J1O A;  2WXQ A;  4HN8 A;  3U9I A;  3MDC A;  4F50 A;  2RGF A;  3MUC A;  3N1X C;  1ZQC A;  1V38 A;  2K0P A;  2LI6 A;  4P4P A;  4RNA A;  5KT4 A;  3MFG A;  2MX2 A;  1W1K A;  4MMW A;  1TS5 A;  4ADW A;  2W8K A;  1ZQR A;  1ECW A;  1UCV A;  1C20 A;  3PZD A;  4DQS A;  1PK1 B;  2R18 A;  3KWL A;  4WJN A;  3PX4 A;  3I5J C;  4OHJ A;  2WXR A;  2I5Q A;  5KFJ A;  3TJ4 A;  3JS8 A;  2G07 A;  4DBG A;  1Q1O A;  4DF8 A;  1L3S A;  2X38 A;  4NJ7 A;  4YL8 A;  2E8M A;  3DER A;  5J2J A;  4PL2 A;  1WWU A;  3HWT A;  1ZQL A;  3K1Z A;  2VJ5 A;  3EWA A;  2IBK A;  3ICX A;  2FCS A;  1MSW D;  3DBH B;  4LJP B;  3DED A;  3DPD A;  5IIM A;  1SL2 A;  5L1M A;  1IXR A;  4H1Z A;  1ZQX A;  4JL9 A;  2PE9 A;  3S2A A;  4ECQ A;  1MOK A;  4YVZ A;  3GRT A;  2AH5 A;  2V4I B;  1GRA A;  3K9P B;  3C0R B;  3TBL D;  3KYC D;  2QJL A;  2JH7 A;  1PGX A;  2ZW1 A;  3Q3J A;  1NJW A;  1C79 A;  2KMM A;  1QLU A;  3Q8K A;  2R9Z A;  2HCF A;  4PYT A;  3HVZ A;  1XLQ A;  4C4V A;  2FBW B;  4KLL A;  4WIP A;  3KHL A;  4CF3 A;  3AEB B;  4BUR A;  1ZDV A;  1N63 C;  4J9Q A;  2UWQ A;  5KFT A;  2KK8 A;  2WPF A;  3ZTC A;  3VXW A;  4K4G A;  2KQS A;  3O0H A;  4QZE A;  3V72 A;  2BQU A;  3LVV A;  4UW9 A;  3WK9 A;  3ML8 A;  1XHC A;  2NMQ A;  4ANW A;  2A8X A;  5EWE A;  3QU5 A;  4W9D A;  3VCC A;  2BT6 A;  5J04 A;  2V3A A;  1VJK A;  1Z00 B;  2JT4 B;  2JWU A;  4J9S A;  1ZK7 A;  1W1O A;  3SR6 A;  1S0O A;  2JWZ A;  3ZDM C;  2JRZ A;  5ALS A;  3PQB A;  2XY5 A;  2ZEQ A;  3A7A A;  3V6E B;  1SZH A;  4XA5 A;  2KWC A;  4M2Y A;  5HHD G;  5FS8 A;  2LXA A;  1V81 A;  1S3S G;  2D3B A;  4NAW B;  1VD2 A;  5I1V A;  2F1I A;  4Y2Y A;  7ICP A;  2R61 A;  1GJZ A;  2AGP A;  2MNR A;  4EZ9 A;  2BB5 A;  4YSY B;  2KSO A;  2KZ3 A;  1ZE3 D;  2EQ6 A;  2E1F A;  1V80 A;  4Q45 A;  4IR9 A;  3CSF A;  3QU7 A;  1W6T A;  4KKI A;  2H88 B;  1EU3 A;  3I9V 1;  4BKS A;  4P0Q B;  1BPY A;  3H1U A;  5JHB A;  2IZV B;  1FIQ B;  5KFC A;  4GOC A;  3UXP A;  5D94 A;  2KMC A;  4UAZ A;  2UVR A;  5L83 A;  3ZNH B;  3MWC A;  1L4Z B;  4JDR A;  3L0W B;  8ICC A;  4DSK A;  4DF4 A;  1MA7 A;  2JX5 A;  4HPM B;  5ALH A;  4LCD E;  4P7I A;  2H89 B;  3RNF C;  2KWD A;  3QX1 A;  1KFY B;  3LAE A;  1BWC A;  4BC9 A;  3ABV B;  4HPP A;  3W2D A;  4AP4 C;  4KMO B;  2QGY A;  3W8W A;  1ZRN A;  3V3X A;  2AXR A;  1GET A;  3BZC A;  2NRX A;  2NRV A;  2HBK A;  2WWZ A;  3JPQ A;  3PG6 A;  2GQT A;  3AL0 B;  4ECU A;  2X8X X;  4R8U B;  2INN E;  2KOX A;  3AEA B;  4FA6 A;  4C7Y A;  1UWM A;  3AMZ A;  3OSP A;  1RYR A;  3OHA A;  3DVN U;  4TQR A;  8ICI A;  2K8B A;  5HKH A;  4FZL A;  2EMT A;  4A20 A;  3TJI A;  4ECW A;  3TSS A;  2KJR A;  3JW7 A;  1UGM A;  1XSL A;  3APD A;  2DYM A;  5CHF A;  1TVA A;  4E71 A;  2B21 A;  3L3F X;  1MHH E;  1MPE A;  1WR1 A;  1DOQ A;  5AKE A;  2W8L A;  3UXL A;  4APN A;  1ZQA A;  3RJI A;  2ATL A;  3HRD D;  2DPI A;  4IR1 A;  4GC6 A;  2MBH A;  5EU9 A;  4M0A A;  2RHF A;  1OEP A;  3H4B A;  4W9E A;  4GLX A;  1J7C A;  1KCZ A;  3RCY A;  3QPE A;  1A5R A;  2PTW A;  2YVS A;  2WAQ C;  3G6Y A;  2W9C A;  2KIW A;  3MZN A;  4P6V F;  1F77 A;  1UH6 A;  2ALZ A;  2N1W A;  2FCN A;  4CCH A;  4GMV A;  3UQ0 A;  1HZ6 A;  2AKZ A;  3H0L B;  2IOF K;  4MEL A;  3EYZ A;  5DPT A;  3BS7 A;  3H7I A;  1R7S A;  4NXZ A;  1QCK A;  2L05 A;  4JLC A;  3ZUN A;  3KKA A;  3VRA B;  3K4G A;  4W9G A;  2EZY A;  3L17 A;  9ICH A;  2M9N A;  5AKZ A;  3M9O B;  1JWA D;  1QOF A;  1STE A;  4GDL B;  4GDK B;  4EFO A;  4NV0 A;  4ECX A;  1ZQH A;  1QOG A;  1V8C A;  3IFW B;  4YWS A;  2MBO A;  2OZT A;  3IJI A;  3H4K A;  3V5F A;  1NNL A;  4OJ6 A;  5ALV A;  2KYW A;  3BIN A;  4YD2 A;  1ROE A;  2W7O A;  2PCE A;  1ZQE A;  4IRD A;  4MFC A;  3N6J A;  3UGV A;  3SMV A;  3PW5 A;  1XS9 D;  8ICF A;  3IP4 B;  2AL1 A;  2HNE A;  1R4M I;  3LWL A;  4O5C A;  1TGZ B;  5L1I A;  2KTR A;  3PVL A;  5B5E U;  1W1L A;  3SV4 A;  4YN4 A;  2XY7 A;  2CS4 A;  2G9H D;  3JZU A;  4MEX A;  3AU4 A;  2BYF A;  3I76 A;  3N4M B;  1F0X A;  1B43 A;  2DUY A;  3EPI A;  2RMM A;  5KHQ A;  2QDE A;  2HHV A;  2C9W B;  5BOL A;  2RSU A;  1E7V A;  4PS3 A;  3FIL B;  1L7O A;  3Q8S B;  3CGD A;  2HXT A;  5FS6 A;  3DFY A;  1KTQ A;  1KL9 A;  1FD6 A;  1AHV A;  2EQ8 A;  3RNE C;  2FMS A;  3DWG C;  4KX3 A;  4M04 A;  1E5W A;  1VDV A;  4B0E A;  2XK5 B;  1PUT A;  2IO1 B;  1YQ4 B;  3ZQ4 A;  3DGB A;  4TUU A;  2K1F A;  1TAQ A;  1N48 A;  1E9I A;  2OPJ A;  3FYY A;  2MEK A;  4WWO A;  1C7Y A;  2DKX A;  3GDX A;  2R8K A;  2OWO A;  2D3C A;  3KBB A;  5EWG A;  4AYB F;  2KWV B;  2EQ7 A;  4US8 A;  2LGY A;  2GLS A;  1SXE A;  5D49 A;  1CJE A;  3N97 B;  5CHW A;  5DKW A;  3DG6 A;  2X99 A;  1ZD5 A;  2J7Q B;  4BJQ A;  4QZH A;  1UT8 A;  4BDP A;  2QJN A;  2JUO A;  1ECQ A;  4DS5 A;  1Q5W B;  1WF9 A;  4WWN A;  5E6N A;  1DK3 A;  3WKB A;  2K9X A;  1KRP A;  5GTI U;  2HI0 A;  1WWT A;  3O13 A;  3PRM B;  4MJS B;  4R63 A;  4EQR A;  3C5F A;  4DFK A;  9ICM A;  4XYC A;  5HFY A;  4KLJ A;  3I63 C;  2LGD A;  2MJD A;  1UGJ A;  2WS3 B;  3Q8C A;  4ACF A;  1QLB B;  1JW9 D;  1E8F A;  2BDP A;  1DGJ A;  3J9C A;  5AKL A;  4M9H A;  3VHT C;  1CEZ A;  4KLT A;  3H7P B;  3KHG A;  4GN1 A;  2M0A A;  2VZK D;  3IVF A;  4LDT B;  4IQT A;  3RCZ A;  4YXD B;  4ICA A;  4KLI A;  5ALU A;  3V3W A;  3TL5 A;  4BAX A;  3OTR A;  4FS1 A;  3PSE B;  2MBR A;  1SXT A;  2LMC A;  4DL4 A;  1KQQ A;  2SAK A;  1IIP A;  5AEK B;  4FJZ A;  5J2C A;  1ZKQ A;  4A55 A;  1IBX A;  5K8E A;  3TI0 A;  2UUV A;  4KGT A;  2NO4 A;  4C8M A;  3PHX B;  4MH8 A;  3BQ7 A;  3JPP A;  2NCN A;  3CT2 A;  5DDY A;  2QSD A;  2PXI A;  1GUA B;  2G08 A;  4FS2 A;  5ALJ A;  1ESF A;  1H8C A;  1W1M A;  2E5A A;  4CYE A;  2KEY A;  2QKN A;  4E8G A;  3VAW A;  3AEV A;  2DFL A;  4FHK A;  1WZ3 A;  2MJE A;  4DQQ A;  2HW3 A;  4IC9 A;  1LPF A;  4QJF B;  4OZC A;  5FJR A;  4PYU A;  5LLI A;  2W9N A;  2OEH A;  2VAN A;  1XWL A;  5ALK A;  3N32 A;  2D07 B;  3QHT A;  3U52 E;  3C0P A;  1ZOL A;  2ZUD A;  2XH7 A;  3V4B A;  2BS4 B;  2HVH A;  3LDA A;  2MBE A;  4G50 A;  4KZC A;  2FLL A;  1L3V A;  1JWM D;  3TEX A;  2DPJ A;  2EQ9 A;  2QKQ A;  1ZMD A;  3O0F A;  3JPS A;  3S5S A;  3SFD B;  4DCC A;  7ICH A;  2I1K A;  3TTE A;  4FBJ B;  2BZF A;  4F4Y A;  3U26 A;  1WGH A;  5FS7 A;  4BBN C;  5KFE A;  4TUS A;  5CA7 A;  4IQW A;  4P2H A;  4JX1 C;  3B9J B;  3HPF A;  4K7U A;  3QLD A;  3IHQ B;  3DWM A;  3FM9 A;  2LVQ A;  2QIL A;  1TK5 A;  1KD0 A;  4H4S A;  7ICG A;  3VA8 A;  3V7J A;  4YTM B;  3UJS A;  3B97 A;  2KAJ A;  2G4D B;  3ZO5 B;  1NJZ A;  4HYK A;  4EZ6 A;  2KFN A;  3CXB A;  3OJU A;  2I0K A;  2GQW A;  1WWV A;  2WFA A;  2FPM A;  4Y2S A;  2H3Z A;  2ZIX B;  1WRD B;  3AUL A;  3R66 C;  3NUQ A;  5KG1 A;  3VRB B;  4ZYS A;  2NRZ A;  1XS2 A;  4KX6 B;  3F5E A;  3GSY A;  2JEG A;  2GBJ A;  2P6R A;  1I4X A;  1S10 A;  3EF6 A;  1T4G A;  4G3X B;  1F44 A;  2V4L A;  1F0M A;  2XVT A;  4I27 A;  3UQ2 A;  4F4W A;  7ICU A;  1EF1 A;  4BKS D;  5AKY A;  4AOF A;  1ZQO A;  1Q3V A;  1ZQN A;  5I4D A;  5HMR A;  4H4Y A;  3T3O A;  3D2J A;  2F44 A;  3EJB B;  3FVD A;  3TCS A;  5JCI A;  5MPO A;  1S77 D;  2IA6 A;  3CRX A;  4O5E A;  2BWE S;  3VTW A;  1WE7 A;  3BJY A;  2ZVN A;  3UGB B;  3QWZ B;  4HEA 1;  2WXG A;  1C4P A;  1MI0 A;  2ASQ A;  5TZV A;  1E8Y A;  3OJ3 A;  2YAU A;  2KK0 A;  3T3F A;  4UD8 A;  3PNC A;  3RUL A;  4PWC A;  4LNO A;  4M00 A;  1GER A;  1EWC A;  3UM9 A;  4KLF A;  3RIT A;  2XH0 A;  3E0F A;  1I4G A;  3NG0 A;  2ZJ8 A;  1SKW A;  1NZB A;  4O3O A;  3AE1 B;  5BO4 B;  3V60 A;  5T14 A;  2VFR A;  4KDI C;  1DNC A;  1FEC A;  4P1B C;  3GS2 A;  3U7D A;  5B66 U;  3JSV A;  2KHQ A;  2W3R A;  1EF5 A;  3BQ0 A;  5FJU A;  3F5A A;  4GB9 A;  4N9F 4;  1K53 A;  2D6F C;  4PVH A;  1LM8 B;  4NM1 A;  1UPH A;  3A4R A;  5AE1 A;  2WF6 A;  3VTU A;  4PJ0 U;  1D5X C;  1SB3 B;  5KVI A;  4J03 A;  1KKO A;  4DL6 A;  3CAW A;  2GOW A;  5HHZ A;  2JHD A;  2AQ3 B;  1FNW A;  5KT6 A;  5DQI A;  2M8S A;  1WXA A;  2AHO B;  2KDF B;  2KQ7 A;  3Q3N C;  3AE4 B;  2GI9 A;  3NVV A;  3VQI A;  5AKI A;  2E6X A;  2YB4 A;  3ZDE A;  2P6U A;  2ZW0 A;  2XCA A;  4XRH A;  2OZ3 A;  5DG7 A;  3AEE B;  3TW9 A;  3RB0 A;  3U4F A;  2KVS A;  3RD2 A;  1GXF A;  3ZLZ A;  1RAX A;  1FO4 A;  4R3D A;  4YFK A;  5KFS A;  7ICT A;  2HD5 B;  1QF6 A;  2MH7 A;  3D32 A;  1TYT A;  1N6Z A;  1DXL A;  5DDM A;  3T3N A;  3E58 A;  4HCP B;  2FYM A;  3JPO A;  2R8I A;  9ICG A;  1Q8K A;  1CI4 A;  4QIW C;  3STP A;  3TUO A;  4XE0 A;  5HHI A;  4EWJ A;  4B9L A;  4CDG A;  1L3U A;  2P3H A;  2AGQ A;  2FLN A;  7ICL A;  2KLG A;  1YIW A;  3JW0 X;  5IDZ A;  3A1Q B;  2LYH A;  2Y9U A;  4OVU A;  1KLG D;  1ZQJ A;  2KKV A;  1COK A;  4HCN B;  4HKZ E;  3TKA A;  4NZL B;  3NVW A;  2C2E A;  3PSP A;  3DFH A;  3SDL C;  1KDH A;  4YP3 A;  2KJ5 A;  2P0I A;  2IPI A;  4EX7 A;  3GZN B;  3VVW B;  5J29 A;  2RDJ A;  4YXM A;  2FPL A;  1P43 A;  4DSI A;  2MJ3 A;  3CK5 A;  4FE3 A;  3GV7 B;  3C19 A;  4YWO A;  3URH A;  4KLG A;  5DB8 A;  1WY8 A;  4BX9 C;  1NEN B;  3ZXV A;  4MGK E;  2IOH A;  3IK4 A;  8ICT A;  2A19 A;  3OHB A;  2B0C A;  1RDF A;  3KVF B;  2QDD A;  1P98 A;  7ICK A;  2KAN A;  4HLE A;  2LGI A;  1RM6 B;  3M9N B;  3RJG A;  3V05 A;  4ZDV A;  2MCN B;  2KJH B;  1C78 A;  9ICO A;  4UB5 A;  2QAR B;  1BPZ A;  2WX0 A;  1KLV A;  4IWQ A;  2X50 A;  4RNM A;  2XEW A;  2XNA C;  2N0S B;  4KSL C;  2LHD A;  4DQO C;  2X8C A;  2QB0 A;  3Q8M A;  3OWE B;  9ICK A;  5E6O A;  3Q8A A;  4PK1 A;  4NJC A;  3EJE B;  2KFK A;  2PTY A;  4PZO A;  3SEN A;  4I2B A;  3MJ5 A;  2QPM A;  2G0A A;  4ED7 A;  5KFN A;  2O6K A;  4C8N A;  1DK2 A;  1XD3 B;  3CP8 A;  3Q14 C;  1D9F A;  4TSS A;  3NZG A;  2Y08 A;  3OTQ A;  2INC C;  3NVZ B;  3P63 A;  1TFR A;  4FN2 A;  3RB3 A;  4BC7 A;  2ZUC A;  1D6E C;  1J0G A;  2FID A;  2QAE A;  4F1S A;  2GGH A;  1K4Q A;  1KLU D;  4TQ1 A;  1YX6 B;  3D2H A;  1FMA D;  1OEY J;  4G9B A;  4PWB A;  4I29 A;  2P66 A;  2N9L A;  2V3N A;  4FUL A;  4FFD A;  1NK5 A;  2A1J A;  1GRT A;  3QTP A;  3TAN A;  3Q8L A;  4AS1 A;  3DH9 A;  2XSX A;  3NS1 B;  3CGB A;  3NRZ A;  2K3U A;  2O2V A;  1H2I A;  4ASW C;  1WE6 A;  3N4E A;  2JYE A;  3LJ3 A;  1ZJM A;  4NY8 A;  2BKE A;  4ED8 A;  5JH5 C;  5J0Y A;  2MBB B;  1SWV A;  4GME A;  3Q8Q B;  4KMU A;  5KFD A;  3RNM A;  5AI0 A;  1XO3 A;  3BQ2 A;  2DLB A;  2KP7 A;  3SEI A;  4GU2 A;  1EBG A;  2OFJ A;  4H4Q A;  3IM1 A;  4DOA A;  2NPT B;  5D46 A;  3A4S C;  1X9M A;  1QKZ A;  3M7D A;  2ON8 A;  3DJJ A;  1R4M B;  3AU5 A;  5KFW A;  4NLZ A;  2C22 A;  2HQM A;  3IG5 A;  2ESE A;  1V5O A;  2ZCC A;  1U49 A;  2DHZ A;  1STZ A;  4I2A A;  2AQ1 B;  3CST A;  2YQE A;  3RNC C;  1FFV C;  4DFD A;  1SKS A;  1I4P A;  5LXH A;  1E8W A;  1J7B A;  5AZF A;  3RR7 A;  2VH1 A;  2A1A A;  1V49 A;  5AE3 A;  1G6J A;  3ES8 A;  1MBB A;  3MY9 A;  4IP5 A;  2K60 A;  3DHG C;  4FX9 A;  5G5H B;  1E90 A;  1NHQ A;  3RH6 A;  2OAI A;  4NL9 A;  1SZP A;  8ICE A;  3QA8 A;  3NVY A;  3R0U A;  3HT3 A;  3LYS A;  4NLN A;  4ELV A;  2VRR B;  3CIR B;  3SJN A;  1WM3 A;  3S47 A;  1GSN A;  2MUT B;  4BV6 A;  3D46 A;  2AXT U;  3V6H A;  2H3I A;  1U4A A;  2N9X A;  2QIE B;  5BYS A;  2GR0 A;  3GY1 A;  5G5G B;  2WHE A;  3S1C A;  2XI9 A;  4MM3 B;  2LEK A;  1JRP A;  2K4H A;  3TEW A;  1MG4 A;  4H4R A;  4DN1 A;  2I1J A;  2QVH A;  2KN7 A;  1NKB A;  2KZZ A;  1J2M A;  5L1L A;  2O6V A;  2Z0E B;  1S7M A;  4EBE A;  3FW7 A;  2PKO A;  1V85 A;  3L08 A;  3APC A;  1ED1 A;  3RNB C;  2PJH A;  5T8I A;  4RU9 A;  3QU9 A;  3PV8 A;  5DGB A;  1XC9 A;  2J4X A;  1FHV A;  3MR3 A;  1JWS D;  3HUI A;  4EZJ A;  1MDR A;  4Z6C A;  4FZN A;  3UXK A;  5ALE A;  4LLG M;  3RJJ A;  1FXT B;  1KBU A;  2ZIV A;  1I35 A;  3SN4 A;  4QW9 A;  2WX1 A;  2OVL A;  3VCB A;  4PGQ A;  3ORY A;  2KC2 A;  3NUH B;  4KSK C;  1Z4O A;  4QZA A;  1JML A;  2W9B B;  1XCT L;  2ZPN A;  4C7Z A;  5BMG A;  3ZJU A;  2LYB A;  4IQV A;  3C2M A;  3WK4 A;  2MWS B;  3MC0 B;  2MQJ A;  4TQ0 A;  2ZZB A;  2L3Z A;  2BB6 A;  2GR1 A;  4QZG A;  3K75 D;  4IM0 A;  2F8K A;  1XF5 L;  3VUY A;  1NK8 A;  4RUC A;  1PGB A;  3L13 A;  1EM7 A;  1XPY A;  4PVK A;  4G3I A;  3KJM A;  5CTR C;  4ZHP A;  4DFM A;  4HDQ A;  3MP9 A;  4Q8F A;  4MEM A;  4C8O A;  1V2Y A;  2WPC A;  2XGZ A;  3DBR I;  2LI5 A;  2RDI A;  4DDG D;  3F2C A;  2FJ6 A;  4DXA B;  1V1P B;  3LXF A;  4PZF A;  5EWF A;  1WMH A;  2A5U A;  4FI4 A;  2EMS A;  4IT1 A;  5ALD A;  3F2D A;  4H83 A;  5HNK A;  1ACC A;  1CRX A;  1HE8 A;  2WXN A;  2PTL A;  1SJA A;  1N62 A;  2MRP A;  1ET9 A;  2ASJ A;  4KPL A;  4DL2 A;  3S1F A;  4LNI A;  1MHX A;  3N9Y C;  1AN8 A;  3MGV A;  4BCA A;  3PX6 A;  4PH5 A;  1UF0 A;  2PMZ F;  1F8W A;  2NO5 A;  4AUQ C;  1GRH A;  2IGD A;  4K7Z A;  2OHF A;  3LLB A;  1ZDL A;  2Y5B B;  4EEK A;  3JPN A;  1TKY A;  4M0W A;  1F52 A;  9ICB A;  1IG6 A;  4RQ5 A;  2W0H A;  2D11 A;  4K4H A;  1T0S C;  4PS8 A;  2F2A B;  5AIB A;  3NJT A;  3ZVH B;  1H4R A;  1Q1R A;  3R2I A;  2VKQ A;  4ZRK A;  3VTE A;  3MFH A;  7ICI A;  4M8N A;  4GXI A;  4F91 B;  3V6C B;  4A6G A;  1KH0 A;  5J0U A;  1TY0 A;  2ZJA A;  4E4U A;  4C0Z A;  4RNO A;  4F92 B;  1J7A A;  2I9G A;  5H92 C;  2Q0Z X;  1YZ6 A;  3WK6 A;  3T5J A;  3Q8F A;  2JRI B;  3EAN A;  3B0Y A;  4BBY A;  3AE9 B;  4KT2 A;  1ZQQ A;  2YVC A;  2ZC8 A;  1X1M A;  1KEJ A;  1SE9 A;  2K8H A;  4HK2 A;  3R7Q A;  4W9H A;  3SU8 X;  1KW4 A;  3QFA A;  4LK0 M;  3PO5 A;  2EEL A;  3MR6 A;  4A90 A;  3UJE A;  1P1A A;  3NY5 A;  4GYP C;  3DDM A;  4KLE A;  1N2X A;  4UAU A;  1SBB B;  3PWI A;  2WDT B;  2PGE A;  4XUS A;  1T0R C;  1FFU A;  2LKY A;  4KLM A;  2JQR B;  1E8H A;  1JPD X;  5KFP A;  3HX0 A;  3Q8B A;  5IN7 A;  1WZ0 A;  2JYT A;  1NYQ A;  5JHA A;  2GRI A;  4JIO U;  3KTQ A;  4O3N A;  1WVE A;  1FCC C;  4MSM B;  3PSF A;  2HXU A;  3N20 C;  2L0T A;  3KH0 A;  1FEA A;  5JCN A;  2K39 A;  2BC0 A;  3TMP B;  5J2B A;  1ZKH A;  1GG3 A;  2FAZ A;  1AQ6 A;  2ZXI A;  1J2N A;  3KOO A;  3QU2 A;  1L6V A;  3AN1 A;  2BGF A;  4P1C C;  4C4R A;  2G4S A;  3PZ8 A;  4RT2 A;  1R6W A;  3TEY A;  1WXM A;  2D3G A;  2KV2 A;  1WVF A;  5KT7 A;  3QC8 B;  1ZQV A;  2WLB A;  4NLC A;  2WXO A;  5ALM A;  3Q8P B;  1JWB D;  4HWI B;  1T3N A;  1OQY A;  5J17 A;  1RXW A;  2AKM A;  2XCP A;  4QWB A;  1DOI A;  1JN3 A;  4EZL A;  1KOT A;  3SN0 A;  2MBQ A;  3C28 A;  3GRS A;  3OJ4 B;  5ALR A;  4ED3 A;  2WXL A;  3MHZ A;  3ZW3 A;  5FR3 A;  2FIF A;  5CHG A;  4J57 A;  2KZR A;  2JEI A;  1TTN A;  1M6I A;  1X9S A;  1M4V A;  8ICY A;  2ODG A;  2VZK B;  1HTQ A;  3VCN A;  3E2E A;  2NVU I;  2AU0 A;  1SEB D;  4DFJ A;  2M17 A;  2HHU A;  8ICA A;  3C1Z A;  1OGW A;  2I2Y A;  4UBB A;  1TIF A;  4FZM A;  2KT7 A;  2PFP A;  2BWF A;  4QZ8 A;  3AED B;  2XH2 A;  3I4K A;  1FEH A;  1Q10 A;  4DLG A;  3U7Z A;  2WF7 A;  1WCN A;  5KTQ A;  2K22 A;  1D8B A;  4FXC A;  4YSZ B;  2GGE A;  1B22 A;  4JQ9 A;  4ZA0 A;  3W8Z A;  3CYJ A;  1U4B A;  4B9T A;  1TK0 A;  3PHW B;  1RWS A;  4P16 A;  4DNS A;  1R4N B;  1HJP A;  1ZD2 P;  3ZI4 A;  1VR9 A;  3DK9 A;  5AKK A;  1OQQ A;  7ICN A;  1E8Z A;  1BPE A;  1X2I A;  1JMS A;  3CW2 C;  3PW2 A;  4WAA A;  2PP3 A;  2PU0 A;  8ICU A;  3ENL A;  3B08 A;  1TE6 A;  3OPX A;  2CN1 A;  2DX5 B;  1Z00 A;  4NNJ B;  3RTV A;  1X2H A;  1U9L A;  4TUP A;  3QUT A;  2W04 A;  5ALN A;  2EKE C;  1GO3 F;  2VJ4 A;  3C2L A;  2K25 A;  4DYE A;  4CRX A;  1VQZ A;  3A9K A;  1P7E A;  3TWA A;  2R2Q A;  1MN8 A;  3RJF A;  4IM3 A;  3MGH A;  3LK9 A;  1ZYQ A;  2XIC A;  5DB7 A;  4GXB A;  1YNT E;  4DHZ E;  2Y9T A;  3Q2A C;  4I6P A;  2KD1 A;  4F2S A;  4EBC A;  3V61 A;  5EBK A;  2CR5 A;  1QLN A;  2Q4T A;  1N56 A;  2M56 B;  4JQW C;  4P0P B;  5BMH A;  3OP2 A;  1PUZ A;  1EC9 A;  1ONE A;  4ZOH B;  2MA9 B;  3SR6 B;  2GL5 A;  4A9A A;  1WXQ A;  3P4R B;  5KFM A;  1VCB A;  1MBT A;  3EAO A;  4R66 A;  1SJH D;  3QZ8 A;  2KAC A;  3NO1 A;  4G7F A;  2NVK X;  2DEN B;  1D7Y A;  3WU2 U;  2TPR A;  1GRB A;  4P0Q A;  3R8B A;  4OCZ A;  3R10 A;  1FPY A;  1WGG A;  3QK0 A;  4NJ6 A;  1SV0 C;  4DK5 A;  3HP6 A;  5DQH A;  3RRG A;  3PS6 A;  4RF0 A;  3HKZ F;  4F8R A;  2V1Y A;  1OEY A;  3T6C A;  4F4R A;  3MJW A;  1MRA A;  3PW4 A;  5KFV A;  1L6N A;  2WDW A;  4H4X A;  5ALX A;  5III A;  3C8Y A;  3OAW A;  5KL1 B;  2DZI A;  8ICK A;  3THU A;  1A0P A;  4J56 A;  2KJ9 A;  1ZPS A;  3ZDD A;  4NLK A;  1IV8 A;  3L5O A;  1L7N A;  4UB8 U;  1XCQ L;  2G3Q B;  4CF4 A;  4UAY A;  2JVC A;  3RJ8 A;  1RYU A;  5AM5 A;  4R8U A;  3SI8 A;  3ZTD A;  4CQN A;  4PVJ A;  2PLI A;  2P3Z A;  4Y2P A;  1S0N A;  3AUO A;  1WJ6 A;  3TSJ A;  1NK6 A;  5D6J B;  3GP7 A;  5AK5 A;  1JAL A;  4RUA A;  3P3B A;  4US9 A;  5KG3 A;  3SZ2 A;  5KG2 A;  2NPX A;  4JWM A;  2KX0 A;  2XBB C;  5ALI A;  4F5P A;  2O6V D;  3DBL B;  4K3B A;  4DDI D;  1XAN A;  3M6K A;  4DWD A;  9ICV A;  2YVF A;  5ER0 A;  2GBR A;  5CEH A;  5CJ7 A;  2WXJ A;  4WUR A;  2R8D A;  5D4B A;  2WP5 A;  2EXR A;  2Y4G A;  1CMX B;  2XGQ A;  2Y3R A;  2CU3 A;  2OQY A;  2ZIW B;  5ADZ A;  4BUG A;  4NLG A;  1B0X A;  4ZHO A;  4OD0 A;  1Z1B A;  1F2R C;  1PQS A;  2V9H A;  3SQP A;  1JRU A;  2H3Q A;  4YMN A;  1FRD A;  5AI6 A;  1WUE A;  3T5H A;  4DSL A;  4EBD A;  2NYV A;  3P2B A;  4EM4 A;  1D8L A;  5E79 U;  1KLN A;  7ICQ A;  4MGI E;  1UBQ A;  1D8Y A;  2LGS A;  2N1V A;  1JPM A;  2WAQ F;  1F3P A;  2PS2 A;  1SB3 C;  2BPC A;  5KFH A;  3PLV A;  1F0Z A;  4A3R A;  3ZNZ B;  2KXJ A;  4GDL A;  2DAJ A;  4LVS A;  4GDK A;  5KAI U;  4JN8 A;  2JEF A;  4GRT A;  1FEZ A;  5KT5 A;  3PR4 A;  5ALO A;  1ZDX A;  2ZTC A;  5BYQ A;  3I3T B;  2HBL A;  4KN7 A;  1SJE D;  2IO3 B;  2R8G A;  1PDY A;  3PO4 A;  2N9K A;  3BOX A;  2DKZ A;  3N28 A;  1VZ8 A;  4L2Y A;  5GXG B;  3SEB A;  1C9F A;  1COO A;  4DSF A;  5LNK 1;  2P35 A;  4K8G A;  5DBC A;  5HML A;  2CDU A;  1NYR A;  1IP9 A;  4O0I A;  1XEE A;  2FI1 A;  3DV9 A;  2AQ0 A;  2WDV B;  2ZIU B;  3MGI A;  1MG8 A;  3G6V A;  3RAQ A;  1ZQT A;  1L8L A;  4DNA A;  3ONN A;  3AE8 B;  2JMG A;  3TAC B;  4KLH A;  3HVD A;  2BVF A;  8ICN A;  3FIL A;  1WGY A;  3EKG A;  3AE5 B;  3CGC A;  1RFK A;  2IHN A;  1TS3 A;  2MW5 A;  5AE2 A;  2FE9 A;  3EPG A;  2UVU A;  4BWM A;  4H4U A;  2WU5 B;  5J2G A;  2GOL A;  3QX7 A;  1QQ5 A;  3B0X A;  4I2C A;  3IXS A;  3NHE B;  1L7Y A;  2DYO A;  3PRE A;  2UVV A;  1I4Q A;  2BF8 B;  2E8P A;  4EEY A;  2TSS A;  4E3C A;  1W1J A;  1JDF A;  4II2 B;  4JN7 A;  1F1H A;  2DW7 A;  4ED0 A;  1Q0W B;  2Z59 B;  1F9C A;  1KTK A;  5ALP A;  1YJJ A;  1YOV B;  1EWY C;  1QH9 A;  4HCH A;  2RR9 A;  1DOX A;  5DQG A;  4FP1 A;  4KWS A;  1VJ5 A;  2PP0 A;  3IN5 A;  3RB6 A;  3H8A A;  2AL3 A;  3ZLG A;  2DF4 B;  4Y2X A;  8ICG A;  4QNL A;  3QEA Z;  1UT5 A;  2NBU A;  1RM6 C;  2Q5W D;  4O5K A;  1WJU A;  4E0D A;  1XLN A;  3KHR A;  2QC8 A;  1NOM A;  1NJY A;  9ICN A;  4I6N B;  3PVX A;  1GES A;  4RQM A;  4QZD A;  3TQP A;  5ALT A;  2YMM A;  1GC6 A;  5AKJ A;  5L1J A;  1RG6 A;  1WR6 E;  2G1E A;  1SV4 A;  2HJ8 A;  2UU7 A;  4NQL B;  3OW1 A;  3HM6 X;  5DPR A;  4OJP A;  3F2B A;  4FBT A;  5HG2 A;  3H7P A;  3MR2 A;  2MA1 A;  4G0N B;  1N63 A;  1P7F A;  3H12 A;  3ISB A;  4Q2J A;  2AWT A;  2AEH A;  5AI8 A;  2QHO A;  3B2G A;  1DRG A;  4KLO A;  4ANU A;  2KTF A;  3GII A;  5FJO A;  3CMM B;  4RMA A;  4FAD A;  4OJL A;  2KE7 A;  3D2D A;  1H38 A;  3EGR A;  1T8E A;  5ENL A;  3UIN B;  2AQ4 A;  2YY6 A;  5L1K A;  1NEK B;  3D2N A;  2EKI A;  3PTF C;  1D5Z C;  4M6U A;  3I6E A;  4E4F A;  2JEJ A;  3ES7 A;  2LPE A;  3FW9 A;  2GSH A;  3Q3O C;  2C2D A;  2WXK A;  2POZ A;  3Q8R B;  1ZQY A;  3TIX A;  4ZRJ A;  1L7M A;  2M0N A;  2WF9 A;  1SL0 A;  2HOF A;  1JCK B;  5JXV A;  3MQT A;  5L6G A;  4RF1 A;  1HUO A;  1O03 A;  1SE2 A;  5IO9 A;  2J6T A;  5EDS A;  1XLO A;  2E3T A;  5ALY A;  4IG7 B;  5J8Y C;  3OPS A;  3LDZ E;  1UD7 A;  2WOI A;  1KFS A;  1ZR6 A;  4B95 A;  4EQW A;  5IKC M;  9ICF A;  1NK4 A;  2D3D A;  1BPD A;  5KFO A;  2LZ6 A;  5HP4 A;  2KNJ A;  4JV0 A;  3CB3 A;  3DGH A;  4DOC A;  3ZDT A;  5ALL A;  1PZN A;  3I57 A;  3S6J A;  4B6J A;  2K4P A;  2ZUB A;  1SJB A;  1TY2 A;  2L0F A;  3AE6 B;  1BUI C;  1ZP0 B;  2POD A;  3SBF A;  3UQA A;  4O3P A;  1PVP A;  1ZQG A;  4AJY B;  2WOW A;  4IHC A;  3PO0 A;  4ECV A;  1TKD A;  2ZTD A;  2MP2 B;  4XWW A;  1SV0 A;  1GRE A;  4A6Q A;  1C1Y B;  2BYV E;  2JZP A;  3VR9 B;  1P48 A;  3GV8 B;  2PFQ A;  2HOI A;  2KD0 A;  3RF9 A;  2ZAD A;  2KC1 A;  2CU1 A;  1KN5 A;  4AP9 A;  5D2M B;  3SQI A;  4BBN F;  4EQS A;  2KO3 A;  3RR1 A;  5IIK A;  4DFP A;  3PT2 B;  2G5H B;  2PPG A;  2PMV A;  1XT9 B;  3Q69 A;  3GIJ A;  1VLB A;  2AL2 B;  4IWP A;  4JV2 A;  1I7H A;  4HNL A;  5ALW A;  3HM3 A;  5KNI A;  4KLD A;  4W9J A;  1VZ6 A;  4M52 A;  3GD6 A;  4RM8 A;  4M01 A;  1FIQ A;  1ZQM A;  2K6Q A;  1WFY A;  2KVR A;  3ZRC A;  3H8H A;  4RGN A;  3P1M A;  4OO1 J;  4IW0 A;  2E5S A;  2UUU A;  2JY6 A;  1V97 A;  4PHA A;  4W9I A;  5A0L A;  1LV5 A;  8ICL A;  2GGJ A;  2D5G A;  3O65 B;  1XLP A;  4IRK A;  1MJD A;  3RAX A;  4GFI A;  1RPL A;  4DOB A;  5FXD A;  4NEW A;  5AKG A;  5FJP A;  4MHV A;  1HIW A;  1UWX A;  3NS8 A;  2EZZ A;  1RRB A;  1ZXH A;  3QN3 A;  4YMO A;  2HE7 A;  1L6U A;  1ZD3 A;  5ALZ A;  1I42 A;  5BYR A;  4J9K A;  7ICM A;  2NBV B;  5KFF A;  4S17 A;  3QUQ A;  2MUC A;  5DCN A;  2PGW A;  2PW9 A;  2GR3 A;  3DGZ A;  3FAH A;  2EH9 A;  3IAS 1;  4NY0 A;  3HRD C;  1YX5 B;  4DHG A;  4IKG A;  3PV1 A;  5CR0 A;  1T6B X;  5JU5 A;  1ZW7 A;  3OJS A;  3K1R B;  3AU2 A;  4B9K A;  2VAO A;  4FO6 A;  4ZRQ A;  2IJ0 A;  3MAB A;  5AI9 A;  1NK0 A;  1V6E A;  3AEF B;  1MVK A;  2VFV A;  1ZMC A;  3DES A;  2LRU A;  3RGT A;  3NGD A;  3RO6 A;  4JAY A;  9ICX A;  3DBH I;  2REX A;  4JB1 A;  3FJ4 A;  1JUD A;  4DL3 A;  1EBH A;  1XU4 A;  3QZ7 A;  1UA1 A;  1NHP A;  1AOG A;  4I6L B;  5TIS U;  4RQ0 A;  2LVP A;  3R0K A;  3POP A;  2BS3 B;  5G55 A;  5JUM A;  2J6U A;  3UMC A;  2YLM A;  4F5N A;  2K4I A;  1TS4 A;  5IP4 D;  3DVN V;  1L0V B;  4KVG B;  3BWU D;  2FKP A;  1P3Q U;  3KZI U;  1UA0 A;  1V86 A;  4PS7 A;  4JGH B;  4KZ0 A;  2V3S A;  4IQU A;  3OZM A;  2KHV A;  5KFX A;  1YZ7 A;  4NM2 A;  5KG5 A;  2V6O A;  4RQN A;  5GTH U;  1QSL A;  3H70 A;  2GWS A;  3UCC A;  4GR1 A;  3VC5 A;  1NI2 A;  1QTM A;  2ISP A;  1E8X A;  4B0M A;  1ZY8 A;  4Q8E A;  4DXG A;  4WJP A;  3IJL A;  2WB1 C;  3ENE A;  3UJ2 A;  4I2D A;  2XO7 A;  3SAG A;  1YJ1 A;  1FHU A;  5FS9 A;  2KTQ A;  2OED A;  3AE7 B;  2ES6 A;  3BQT A;  4PL1 A;  5JTI A;  2ICI A;  1VRA B;  4HPN A;  1LKY A;  3AH7 A;  1NU5 A;  3SYZ A;  1XNS A;  3NVV B;  2OO6 A;  4HRO A;  1SE4 A;  1NZP A;  4O9M A;  3PPA A;  3A1Q A;  4RQ7 A;  1DYQ A;  3EUB 3;  6ENL A;  4QWC A;  1C4A A;  4LTU A;  1GV4 A;  2B76 B;  4F8C B;  4B6W A;  2P4P A;  2LJI A;  1BZL A;  3SV3 A;  1YQ3 B;  4XQ8 A;  2NR2 A;  3Q3F A;  2WOV A;  3LAD A;  5D79 A;  3RN9 C;  8ICH A;  4B9V A;  3EHV A;  3WAO A;  1NVI D;  1FEB A;  3CYM A;  4GGQ A;  1ZQU A;  3N1Y C;  5IOI A;  3P0W A;  1WM2 A;  2F8L A;  3MC1 A;  5AK4 A;  3MFI A;  3WA0 A;  1CUK A;  3VC8 A;  5KFU A;  3W1S C;  2L5Y A;  1ZQS A;  2V9W A;  3H40 A;  1RQN A;  1WUF A;  1O08 A;  3UXN A;  4M0X A;  2ZJ5 A;  2JZZ A;  4UAS A;  4UAR A;  3C5G A;  5HR7 A;  4FHJ A;  1ZD4 A;  1CK1 A;  3DVG X;  4WJQ A;  3AEC B;  2GGI A;  5CWR A;  4QWE A;  3L5K A;  5TR3 A;  4O3R A;  3P4Q B;  4KDL B;  4H4W A;  3PML A;  3OSN A;  4K2S A;  4EMW A;  5JRB A;  1SE3 A;  4BOS C;  2NRW A;  2QAR A;  4C80 A;  3AE2 B;  3TAP A;  5EE0 A;  9ICP A;  2CPR A;  5TSS A;  3C2K A;  4HDO A;  3T9L A;  3I99 A;  4H50 A;  2WDQ B;  4XC2 A;  2OLA A;  5KG4 A;  2WGS A;  4IL6 U;  3EFU A;  2IOF A;  1YN5 A;  4CO7 A;  4M9J A;  2NTT A;  2PVG C;  2PA6 A;  3BDP A;  4UDU C;  3UIP B;  5AM0 A;  3NVZ A;  2WBA A;  4ARC A;  3L4P A;  3DIP A;  4YXJ A;  4H19 A;  3QYP A;  3THV A;  4Q43 A;  1LXD A;  3BVZ A;  2HHX A;  1Z5S B;  1EC8 A;  2UYZ B;  3D6J A;  1R0M A;  1HUZ A;  2QB0 B;  5ALF A;  4GXK A;  1U45 A;  8ICZ A;  2GB1 A;  3HIZ A;  1MFW A;  3W1Y A;  3GE3 C;  2QJJ A;  3TCA A;  1SIF A;  4MT5 A;  3F53 A;  1ZQF A;  5E6P A;  3NS1 A;  5EE9 A;  4GXJ A;  3ZDA A;  3HW2 A;  3DHH C;  1Z19 A;  4D2K A;  4GIR A;  4W9F A;  2N7D A;  2K8C B;  2ZNV B;  2ZZ0 A;  5BOM A;  1NPX A;  5J0P A;  2Y0S C;  5J8Y A;  4KLU A;  1ZQI A;  3BW7 A;  4EMI A;  4E5T A;  5KVH A;  1K52 A;  4BXO B;  4F2R A;  1QQ6 A;  4M47 A;  1WYW B;  5FMH A;  2V4R A;  5F9N A;  4Q44 A;  3J81 j;  3NOB A;  2PTZ A;  3RH4 A;  4Y2U A;  4KIK A;  1URJ A;  2A1J B;  2CJN A;  2PKE A;  4UB3 A;  3IT6 B;  2F77 X;  2LHT A;  2Z7J A;  1ZUD 2;  9ICQ A;  2I1Q A;  1YN3 A;  4ZCW A;  3ED5 A;  3V7K A;  4ITK A;  2ZPY A;  3GD3 A;  4TMA B;  2WYQ A;  2C5L C;  2KDB A;  2D3A A;  3DOW A;  1E0Y A;  4Z6F A;  3T9P A;  3OGU A;  1KF6 B;  5JRT A;  4WQM A;  2C7N B;  3ISC A;  3CF6 E;  1L4D B;  1NBF C;  1E7U A;  2L52 A;  1GEU A;  2JPH A;  3ZJT A;  3RRH A;  2WPE A;  1SJD A;  5DGA A;  5F3X B;  7ICF A;  4DQI A;  2CJO A;  2BKR B;  5KT3 A;  2MHJ A;  3A9J B;  3KUD B;  4ZOH C;  9ICT A;  4UBC A;  5J0X A;  2BPS A;  5AM3 A;  2JZB B;  2MUT A;  4MFF A;  1VAO A;  2YMQ A;  2AQ2 B;  8ICP A;  4CE6 A;  3FG2 P;  4M9L A;  7ICR A;  1N60 C;  4WH4 A;  1UUP A;  1TKE A;  2EAP A;  8ICV A;  3DQV A;  4F7Z A;  3EJD B;  4B9U A;  1BQG A;  5IAA C;  1A77 A;  4MAC A;  3U4E G;  1WI0 A;  1UHU A;  4ML8 A;  3R3M A;  4IP4 A;  2EAO A;  3K9O B;  1UXY A;  3NVY B;  2V4Q A;  1J19 A;  3EZ5 A;  7ICJ A;  2CKH B;  3L54 A;  1GRF A;  2PP1 A;  1TBE A;  1YQB A;  4TV3 A;  1MDL A;  9ICS A;  1YT3 A;  3PX0 A;  4QW8 A;  2J6S A;  2GRT A;  2YB1 A;  3KLS X;  5J0W A;  2PEA A;  3ZGZ A;  2NS5 A;  4ROP A;  3H0M B;  3VUW A;  4IL0 A;  3VFC A;  3Q8E A;  4J9L A;  1E7P B;  3M3J A;  1WRI A;  3K1G A;  3T8Q A;  4DWF A;  4TUR A;  3ETR A;  3UXO A;  4F4X A;  2RPQ A;  2F1H A;  4ZYN A;  1SKR A;  4EOY A;  2Y3A A;  4OAL A;  2PU1 A;  5BOF A;  1V9P A;  5K4L A;  2Z0D B;  4I2I A;  1GNU A;  1GAQ B;  3FDS A;  3B2F A;  5C5J A;  4UB1 A;  3RMK C;  2KVZ A;  3C21 A;  2BCP A;  2EAN A;  2NTS A;  2V0G A;  5FKA C;  4ELT A;  3ZKJ C;  4MLA A;  1QOA A;  1OQR A; 
#chains in the Genus database with same CATH homology
 1QLB B;  1JW9 D;  1E8F A;  1DGJ A;  1SJH D;  2KAC A;  3J9C A;  3WCQ A;  2LHE A;  1N5X A;  3R8B A;  3LB8 C;  1L5P A;  1V1P A;  5BMI A;  4N6E B;  2M0A A;  2BYT A;  1IGD A;  1TZO A;  2VZK D;  2Q85 A;  1GB4 A;  2HTM E;  4YXD B;  2KN4 A;  2WXF A;  4RF0 A;  1B1Z A;  2IPK D;  2MBR A;  3P42 A;  1SXT A;  2LMC A;  3W5V B;  2WDW A;  2SAK A;  3NVW B;  5FXE A;  5K8E A;  1E9M A;  3C8Y A;  4A55 A;  1IBX A;  1FNV A;  4HG0 A;  2UUV A;  4KGT A;  4MH8 A;  2PLP A;  2M19 A;  1ZPS A;  4O1N A;  2BVG A;  1FXI A;  4L23 A;  1XCQ L;  2QSD A;  1ZXI A;  2E5A A;  1W1M A;  1ESF A;  1PFD A;  2PLI A;  4PVJ A;  4CQN A;  3CWI A;  2QKN A;  2Y5P A;  3IT4 B;  1DZN A;  4NAM A;  1FFU C;  4OZA A;  3TSJ A;  2MJE A;  1DIQ A;  3GP7 A;  4OZC A;  1JAL A;  1KRH A;  1I4H A;  1TKG A;  4L1B A;  3U52 E;  5HQX A;  3C0P A;  4US9 A;  2V3P A;  1QLT A;  2BS4 B;  4JE3 B;  1D5M C;  1SSN A;  4KGS A;  1JWM D;  3TEX A;  2XN9 C;  2WXH A;  3AE3 B;  3SFD B;  5AUI A;  2WNM A;  2LUM A;  2WXJ A;  4WUR A;  5AUK A;  2R8D A;  2Y3R A;  3R2T A;  2EXR A;  1HXY D;  2Y4G A;  2BBC A;  1PYW D;  2CU3 A;  5ADZ A;  3VR8 B;  4JX1 C;  3B9J B;  4ZHO A;  2FUG 1;  1F2R C;  3DWM A;  2N7J A;  2QIL A;  2K5P A;  3S1D A;  2WQY B;  1FRD A;  4YTM B;  3TSH A;  3ZJV A;  2KAJ A;  1L0Y B;  1E8G A;  2I0K A;  2KDM A;  5C2T B;  4ZYS A;  3BII D;  1IUE A;  1SB3 C;  4USA A;  3VRB B;  1GPX A;  4EE2 A;  4KX6 B;  1F0Z A;  2WDR B;  3GSY A;  4C56 C;  3GB1 A;  1I4X A;  5FXF A;  3NRZ B;  5E6J A;  4DXF A;  1ZDX A;  1FIQ B;  1PGA A;  1TJE A;  5I4D A;  5BYQ A;  5HMR A;  3T3O A;  3D2J A;  1SJE D;  3KWV A;  2O3G A;  1C77 A;  3RPF C;  4TVW A;  2N9K A;  4O95 A;  5MPO A;  5GXG B;  3AEG B;  1VZ8 A;  4L2Y A;  3SEB A;  1C9F A;  1K50 A;  5G5H A;  5LNK 1;  1NYR A;  1XEE A;  4HEA 1;  2WXG A;  1E10 A;  1C4P A;  1MI0 A;  2WDV B;  4JWU C;  1N61 A;  1MBT A;  2RDG A;  4UD8 A;  3A7R A;  2Y3S A;  1JRO A;  4PWC A;  5G5G A;  1EWC A;  2INP E;  3AE8 B;  3HVD A;  4HKQ A;  1E0Z A;  1QT9 A;  2BVF A;  3W8X A;  3FIL A;  1I4G A;  2W54 A;  3AE1 B;  3AE5 B;  4YTP B;  1QQR A;  5EE1 A;  1XXG A;  1RFK A;  3BVG A;  3URY A;  1FNU A;  3BYY B;  2VFR A;  1TS3 A;  3ZYY X;  3TX1 A;  5AE2 A;  1AW7 A;  2HDE A;  2WXI A;  3GS2 A;  3A7U A;  2WU5 B;  2W3R A;  4JWS C;  1TS2 A;  1K53 A;  3IXS A;  2RDH A;  1A70 A;  2DYO A;  4PVH A;  1I4Q A;  2TSS A;  1N5W C;  1W1J A;  5AE1 A;  2JU6 X;  3IAM 1;  1SB3 B;  4BC9 A;  1D5X C;  2R2Z A;  1F2R I;  1KTK A;  1YJJ A;  5HHZ A;  1EWY C;  2AQ3 B;  1FNW A;  1K51 A;  1DOX A;  1FFV A;  3AE4 B;  3HSU A;  2GI9 A;  1ET6 A;  3NVV A;  3VQI A;  2E6X A;  4WWM A;  1FRR A;  4BCA A;  1T5X D;  2J42 A;  2ZW0 A;  1RM6 C;  4OZB A;  2Q5W D;  3AEE B;  1XLN A;  1FO4 A;  4R3D A;  1L0X B;  1QF6 A;  2MH7 A;  2W3S A;  2G1E A;  5FK9 C;  1GB1 A;  3AB5 A;  3T3N A;  1D4B A;  5HG2 A;  1BXT A;  3TUO A;  2J52 A;  4XE0 A;  1N60 A;  1N63 A;  1P7F A;  3ETR B;  4TVY A;  2P3H A;  4Q2J A;  2Q4W A;  4ZRP A;  2LFI A;  3B2G A;  1KLG D;  2QEJ C;  4PVE A;  4HKZ E;  3FWA A;  2PVO D;  3P4S B;  4NZL B;  3D2D A;  3NVW A;  3EGR A;  4OW0 A;  3W5U B;  4KKJ A;  2EKI A;  1NEK B;  4YSX B;  2IPI A;  2SEB D;  4J3O D;  1D5Z C;  2IGG A;  1ENF A;  4RGT A;  3PM9 A;  3FW9 A;  4RCO A;  2MJ3 A;  2WXK A;  2JXT A;  3PZ7 A;  5JXV A;  1JCK B;  1NEN B;  3FW8 A;  5L6G A;  4RF1 A;  1SE2 A;  1XLO A;  2E3T A;  3NZ3 A;  1HSK A;  5AWV A;  1PDX A;  3AM9 A;  1ZR6 A;  1W1R A;  3RJA A;  2LGI A;  1RM6 B;  3V05 A;  2J53 A;  1C78 A;  3AV8 A;  3BK1 A;  2WU2 B;  4XDD A;  2IGH A;  2FE8 A;  2XNA C;  2N0S B;  3I57 A;  2AX5 A;  2LHD A;  4DQO C;  1CQV A;  1TY2 A;  2BVH A;  3AE6 B;  1TYG B;  3BK2 A;  2BS2 B;  1BUI C;  1ZP0 B;  3OWE B;  1JQ4 A;  4RGM A;  5D7G A;  1NI3 A;  3Q8A A;  4N59 A;  4NJC A;  3PO0 A;  4REZ A;  3MJ5 A;  2QPM A;  4XWW A;  2Y08 A;  4TSS A;  4A6Q A;  3W1S A;  1T3Q C;  2JZP A;  3VR9 B;  3NVZ B;  3P63 A;  3KQ4 A;  4BC7 A;  2P13 A;  1D6E C;  2WXP A;  3BYT B;  2W82 A;  3P4P B;  2WP9 B;  1KLU D;  4TQ1 A;  3D2H A;  3R07 C;  1FMA D;  2PIA A;  2PMV A;  3Q69 A;  4PWB A;  2N9L A;  2V3N A;  1Y56 A;  1WYG A;  1VLB A;  1QOB A;  3S1E A;  1I7H A;  4AS1 A;  3NS1 B;  5C3J B;  1DOY A;  2NQW A;  4ARI A;  5EE3 A;  3NRZ A;  1VZ6 A;  2K3U A;  2WXQ A;  2L83 A;  1HZ5 A;  4XWT A;  2JYE A;  1FIQ A;  4GLS C;  4HJG E;  3H8H A;  2K0P A;  4RGN A;  3UI3 A;  3P1M A;  4RNA A;  2UUU A;  3MFG A;  1V97 A;  1W1K A;  1TS5 A;  1XO3 A;  2D5G A;  2QMT A;  2DLB A;  1XLP A;  3KWL A;  4JPS A;  1QKZ A;  1YJI A;  2ONQ A;  5FXD A;  2ON8 A;  4OHJ A;  2WXR A;  4RFB A;  1UWX A;  4PT5 A;  1ZXH A;  3JS8 A;  2YEP F;  1L6U A;  2X38 A;  1EU4 A;  2AQ1 B;  3LYY A;  2GQU A;  1FFV C;  5BYR A;  1I4P A;  1J7B A;  2PW9 A;  5AE3 A;  3DED A;  3FAH A;  1MBB A;  3IAS 1;  3HRD C;  5G5H B;  4IKG A;  2OAI A;  2ACZ B;  1T6B X;  2VAO A;  1YN4 A;  2V4I B;  3NVY A;  4ZRQ A;  2IJ0 A;  3CIR B;  3AEF B;  3SR6 B;  1QLU A;  1MVK A;  2QJL A;  1PGX A;  2ZW1 A;  2VFV A;  2KMM A;  1C79 A;  4RGO S;  4JAY A;  4PYT A;  5BYS A;  2QIE B;  3HVZ A;  4JB1 A;  5G5G B;  4A9A A;  1XLQ A;  3S1C A;  2FBW B;  4MM3 B;  4WIP A;  2LEK A;  1JRP A;  1AWD A;  3POP A;  3AEB B;  3TEW A;  1ZDV A;  2BS3 B;  1N63 C;  1TS4 A;  5L6F A;  1L0V B;  3BWU D;  3FW7 A;  2PKO A;  1I4R A;  4YTN B;  5T8I A;  2NMQ A;  1LO5 D;  1E6E B;  1FM0 D;  2J4X A;  2BT6 A;  1JWS D;  3EA6 A;  3HUI A;  1VJK A;  2JWU A;  4LLG M;  4B0M A;  1ZXI C;  1W1O A;  3SR6 A;  4DXG A;  2PLS A;  1C4C A;  3NUH B;  1XCT L;  1JML A;  5BMG A;  4C7Z A;  3ZJU A;  3PQB A;  3A7A A;  2OED A;  3AE7 B;  2ICI A;  3MC0 B;  1VRA B;  3AH7 A;  4TQ0 A;  5HHD G;  3NVV B;  4HRO A;  1HQR D;  1UNS A;  1SE4 A;  1ZOY B;  2BB6 A;  4NAW B;  5I1V A;  1XF5 L;  1VZ7 A;  2R61 A;  3FC4 A;  1C76 A;  1PGB A;  1DYQ A;  2BB5 A;  3EUB 3;  1EM7 A;  4YSY B;  1C4A A;  4LTU A;  3W9C B;  3KJM A;  1ZE3 D;  2B76 B;  4PVK A;  2P4P A;  2LJI A;  4ZHP A;  1YQ3 B;  3MP9 A;  4KGR A;  2Z8L A;  4KKI A;  2W55 A;  1N5W A;  5D79 A;  1X2G A;  2H88 B;  1EU3 A;  3I9V 1;  1NVI D;  1V1P B;  3LXF A;  2Y5C A;  4PZF A;  1DII A;  1HA5 A;  1ACC A;  1L4Z B;  1SIJ A;  1W1Q A;  2WXN A;  2PTL A;  2JX5 A;  1N62 A;  1ET9 A;  2H89 B;  2KWD A;  3S1F A;  1KFY B;  3LAE A;  1CK1 A;  1MHX A;  1AN8 A;  3ABV B;  3AEC B;  3N9Y C;  3W2D A;  1IBX B;  3W8W A;  3P4Q B;  3LLB A;  4OVZ A;  3V3X A;  2IGD A;  2OHF A;  2AXR A;  5FXP A;  1SE3 A;  4IOI E;  1TKY A;  4M0W A;  2VFT A;  4C80 A;  3AE2 B;  5D3I B;  5EE0 A;  4A8X C;  5TSS A;  2GQT A;  2INN E;  3AEA B;  5HI1 A;  4C7Y A;  3RFZ B;  3I99 A;  4HRS A;  1UWM A;  2WDQ B;  3AMZ A;  4XLO A;  2RK5 A;  3R2I A;  3VTE A;  3B9J A;  1GOZ A;  1KH0 A;  3TSS A;  1TY0 A;  1AHU A;  1OFF A;  1YN5 A;  1QIL A;  2NTT A;  1J7A A;  2PVG C;  2DYM A;  4UDU C;  5H92 C;  3NVZ A;  4ARC A;  3L4P A;  3Q8F A;  1FXA A;  1MHH E;  1MPE A;  1HEZ E;  3BVZ A;  4BBY A;  2KQ4 X;  3AE9 B;  3HRD D;  2WXM A;  1N61 C;  2GB1 A;  4LK0 M;  2EEL A;  1J7C A;  4A90 A;  3BVM A;  4MT5 A;  2YVS A;  2IDY A;  1SBB B;  3NS1 A;  2I38 A;  5EE9 A;  4D2K A;  1AHZ A;  4P6V F;  1FFU A;  1F77 A;  2JQR B;  1E8H A;  3Q8B A;  2JYT A;  4RH6 A;  4EC3 A;  1HZ6 A;  1NYQ A;  4IDI A;  2GRI A;  3BW7 A;  1K52 A;  1WVE A;  1FCC C;  1IGC A;  1RYJ A;  1R7S A;  3SFE B;  1FCL A;  3P4R B;  3VRA B;  1SF0 A;  1JWA D;  1QOF A;  1STE A;  2CJN A;  3IT6 B;  4GDL B;  4GDK B;  1W1S A;  1L6V A;  3AN1 A;  1QOG A;  1V8C A;  1ZUD 2;  3E56 A;  4H2A A;  3TEZ A;  3PZ8 A;  3TEY A;  1YN3 A;  1WVF A;  1ROE A;  2WLB A;  4ITK A;  2WXO A;  4TMA B;  1JWB D;  1E0Y A;  5I1W A;  1OQR A;  1CZP A;  2DBY A;  1KF6 B;  1DOI A;  1T3Q A;  3EUB 2;  4WQM A;  4WAF A;  4N58 A;  3RJ8 A;  1L4D B;  2L52 A;  1W1L A;  2G9H D;  3ZJT A;  2WXL A;  3BZD B;  3MHZ A;  5FR3 A;  1B9R A;  1I19 A;  2CJO A;  2VFU A;  1M4V A;  4ZOH C;  1F0X A;  2VZK B;  2RMM A;  1WGK A;  1VAO A;  1SEB D;  2AQ2 B;  2JSV X;  2I2Y A;  3U2S C;  3FIL B;  1N60 C;  3AED B;  4AQ7 A;  1FEH A;  1Q10 A;  1UUP A;  1TKE A;  4WH4 A;  3U7Z A;  1FD6 A;  1AHV A;  2DWQ A;  2K22 A;  4MAC A;  3DWG C;  4FXC A;  3U4E G;  4YSZ B;  2BTE A;  1BML C;  3W8Z A;  4ML8 A;  1VDV A;  4B0E A;  1RWS A;  4P16 A;  1UGJ A;  1UXY A;  3DQ0 A;  4DNS A;  1PUT A;  1VR9 A;  3NVY B;  3ZQ4 A;  1OQQ A;  1YQ4 B;  4YT0 B;  2RPV A;  2MEK A;  1YMH E;  3KLS X;  3ZGZ A;  1X2H A;  1WSP A;  3Q8E A;  4US8 A;  1AYF A;  1E7P B;  1WRI A;  5D3D A;  4YWG G;  1CJE A;  2L1A A;  1VQZ A;  1P7E A;  1N62 C;  3ETR A;  3E9S A;  4OAL A;  4XDC A;  1YNT E;  2YEP B;  2Y3A A;  1JWU D;  2L32 A;  5H8Y E;  1GAQ B;  2M56 B;  2K9X A;  3B2F A;  1WWT A;  2BW2 A;  3O13 A;  5BMH A;  1V1O A;  2NTS A;  5HFY A;  5FKA C;  2V0G A;  2VFS A;  3Q8C A;  4MLA A;  1QOA A;  2MJD A;  1WXQ A;  2WS3 B;  4ZOH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...