2W55A

Crystal structure of xanthine dehydrogenase (e232q variant) from rhodobacter capsulatus in complex with hypoxanthine
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords XANTHINE DEHYDROGENASE
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
total genus 114
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w55A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w55A01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w55A03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w55A05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w55A04
1J7BA 5GXGB 1SB3C 1DOXA 2O3GA 1XLQA 2LEKA 3NVZA 2H88B 4US8A 1RYJA 1VJKA 1W1LA 2PLSA 1KRHA 4PYTA 3B9JB 3DWMA 3BIID 4JX1C 1TJEA 1JWAD 2BVGA 5FXPA 2ACZB 3ZYYX 3SFDB 5FXFA 3D2JA 2Y5CA 3CIRB 1TKEA 1F0ZA 3W9CB 2H89B 4C7YA 1RWSA 1ZUD2 3TSHA 2BS3B 3CWIA 4YTPB 2BT6A 1AYFA 1PUTA 1FXAA 1RM6C 2BVHA 3AEFB 3HVZA 1FFUA 4BCAA 4YXDB 1J7AA 1E6EB 1E10A 2QPMA 1JW9D 4ZHOA 1TKGA 3HRDD 1N62A 1KF6B 1W1MA 4FXCA 4HROA 1JRPA 1X2HA 3W8XA 3NVWB 1OQRA 1HSKA 4US9A 3R07C 3EUB3 1QLUA 1N5XA 3ETRA 3NS1A 3NRZB 2VFVA 4C7ZA 2QJLA 4PVKA 3A7RA 2BS4B 4WWMA 1DIIA 4JWUC 3DWGC 4C80A 1JALA 5HQXA 1WVEA 3FWAA 3TX1A 2AX5A 2P3HA 4TVWA 1IUEA 2OAIA 2E3TA 2JX5A 1ZR6A 3L4PA 3VR9B 4BBYA 3C0PA 1WVFA 3NVYB 4ZOHB 3AN1A 2VAOA 1YQ3B 3AE8B 4MLAA 2KAJA 1QOBA 3WCQA 1QT9A 3VRBB 4A9AA 1OFFA 3FW7A 5G5HB 1DGJA 1YJIA 5AUKA 1SIJA 4JB1A 3W5UB 3NVZB 5C3JB 3AE4B 4PWCA 1JROA 2Q4WA 1JWBD 2K9XA 3EUB2 3AE2B 4PVJA 1SF0A 1MBBA 2VFRA 4YSXB 3VTEA 1NEKB 1FFVA 3AECB 1NI3A 3S1CA 5ADZA 1YJJA 1T3QC 2WDQB 4BC7A 2WU2B 1DIQA 2VFTA 2PLIA 1WXQA 5AUIA 3HRDC 1T3QA 2WQYB 2CJOA 3AE5B 3AEGB 5G5GB 2HTME 4BC9A 2YVSA 2W55A 4USAA 4WQMA 1W1SA 1VLBA 5AE2A 1FM0D 3AEBB 1OQQA 3AE9B 2EKIA 3DEDA 1XLNA 3ETRB 3S1DA 1JQ4A 2R8DA 1XLOA 5AE3A 1W1KA 3AEEB 1W1OA 2KMMA 1W1RA 1EWYC 2VFUA 1WGKA 5AE1A 1QOGA 2WLBA 2WS3B 1AHZA 1X2GA 2M56B 5EE0A 2QKNA 1I7HA 3P63A 1FXIA 4PWBA 2W54A 2M19A 4ZHPA 2BS2B 1WWTA 1N63C 4UD8A 1NYRA 2DWQA 1FRDA 1CZPA 4YT0B 3SR6A 5EE9A 1W1JA 2VFSA 2P13A 2NQWA 1E7PB 5D79A 3FAHA 1L6VA 1W1QA 2GQUA 3D2HA 3B2FA 3AM9A 2MJ3A 3FW9A 3NVVA 3LLBA 3PM9A 1WRIA 5MPOA 1AWDA 2WP9B 2JQRB 3VRAB 1QOAA 3TSJA 4P6VF 3FC4A 3P4SB 2QIEB 2P4PA 4ZOHC 1UXYA 1E8GA 1FRRA 4YTMB 1R7SA 3D2DA 1SB3B 1N5WC 1E8FA 2W3SA 1ZXIC 3AE3B 3W5VB 4O95A 2WDVB 4EC3A 1N5WA 2AXRA 2OHFA 4ML8A 4PZFA 1FIQA 1ZXIA 2L52A 2WDRB 2G1EA 1ZOYB 1PFDA 5G5HA 4N59A 4TVYA 2Q5WD 2MJEA 3S1FA 3W8ZA 5HMRA 1QOFA 3KWLA 1E0YA 1VQZA 1L0VB 2PKOA 1DZNA 1A70A 3LB8C 3LXFA 4N6EB 2K22A 1N61C 1L6UA 1B9RA 4N58A 5FXEA 3JS8A 2K5PA 1RM6B 3RPFC 1QLBB 3P1MA 3AMZA 2PVOD 1AHVA 1N61A 1I19A 1FO4A 3NS1B 3B2GA 2FBWB 1V97A 2WU5B 1NYQA 3PO0A 4YSYB 2W3RA 1FFUC 3AE6B 3B9JA 3AE7B 1TYGB 1ROEA 4OALA 3DQ0A 5H8YE 1N62C 2MJDA 5G5GA 1V8CA 3GSYA 4JWSC 3SR6B 3ABVB 2GQTA 2I0KA 1NVID 2BVFA 3P4QB 3AEDB 3FW8A 2E5AA 4JAYA 2MH7A 3BW7A 2CU3A 2RK5A 4ITKA 5HHZA 3NVVB 1F0XA 1E9MA 1RFKA 5EE3A 4YTNB 1N63A 3KJMA 3S1EA 1XO3A 3NVWA 4LTUA 2N0SB 1WYGA 1AHUA 3AH7A 3NRZA 3AB5A 1CJEA 1E0ZA 1GAQB 1DOIA 2PIAA 2EXRA 1N60C 1GPXA 1L5PA 1VAOA 5EE1A 1KFYB 3A7UA 3W8WA 1N60A 5FXDA 3A7AA 2Q85A 3P4RB 3AV8A 5C2TB 2DBYA 1TKYA 1MBTA 4KX6B 3P4PB 3SFEB 3VR8B 3HUIA 1FIQB 3AE1B 1QLTA 4PVEA 3NVYA 1YQ4B 1FMAD 2MBRA 3AEAB 2PVGC 3LAEA 4PVHA 2B76B 1XLPA 3I99A 5H92C 2L83A 1FFVC 1UWMA 2CJNA 1ZP0B 4IDIA 4HRSA 4DNSA 4YSZB 1E8HA 1NENB 1VDVA 4XLOA 1PDXA 1QF6A 2R2ZA 1DOYA 4HG0A 1J7CA
chains in the Genus database with same CATH superfamily
2JEFA 5C0YA 4E0DA 1F2RI 2M1MA 4M02A 5IILA 2MA1A 4MACA 4URKA 5KL1B 2E1FA 1ZQKA 1VZ6A 3NVZA 2JEJA 2R8JA 3KUMA 2JWUA 4GDKB 3RJJA 4ZCWA 5J0TA 2MBEA 5GMVA 2H88B 1EC7A 5KNIA 2QJJA 1RYJA 2KVRA 1W1LA 3DVNV 3SN4A 4PYTA 3V3WA 1XCTL 3B9JB 1TK0A 3DWMA 2G08A 1TJEA 3C5GA 2ZNVB 4FJZA 3FVDA 1EM7A 2K6QA 3MR5A 2AH5A 5KFSA 3ZVVA 4PS8A 4XWWA 1QSSA 3L3FX 2AQ0A 1QH9A 4NM1A 4KLTA 4Z6FA 2X8HA 4HJKA 5EBKA 4DXKA 5A0LA 3UQBA 3I6TA 5DQIA 1BGXT 2R8IA 3TACB 4ED3A 2KOXA 1RG6A 3CIRB 3U7ZA 2NTTA 2LVPA 2KJHB 3RTVA 3CK5A 1Q10A 2N9EB 3SAFA 2V4LA 5D46A 3GV8B 3PX4A 4JHMA 1PUTA 1JXEA 1FXAA 1JCTA 3JPNA 2PW9A 2FPLA 3HVZA 3QKEA 1FFUA 2I9GA 4KLGA 3BZCA 4TUPA 2KFKB 3V6KA 3THUA 4YXDB 4RUCA 2BGWA 2KMDA 1JW9D 5ALUA 3HRDD 1K53A 4DQSA 1CMXB 2NBUA 4G0NB 1NK7A 5FJOA 1NHQA 1SSNA 5AWVA 3DVGY 3QZ8A 5KAIU 5EOZA 4DOAA 3QAQA 4HROA 1JRPA 4Z6EA 4CF4A 1S0VA 3V3XA 1ZQIA 4JV2A 2KHVA 2WF9A 5IDZA 4FHKA 7ICJA 5ALVA 1I4QA 5ALLA 1LXDA 1WMHB 4KVGB 3NRZB 4C56C 1ECWA 2GH1A 3DPDA 5AM0A 3AU4A 3Q8FA 3VCCA 4RQNA 4EM4A 9ICJA 4HDOA 1TIFA 2BKEA 2IJ0A 3QQ8B 2G4SA 3H8JA 4NWIA 4YVZA 1LPFA 2DNFA 3UXOA 4BAXA 4WWMA 2D3DA 3M1YA 3PHXB 1WM3A 3Q8QB 1IYFA 2RABA 2LYHA 3NO1A 4GIBA 4NL9C 3Q3JA 3QUCA 2KTRB 1BWCA 1WSPA 5KFIA 4LLGM 1TS5A 3RH6A 3NY5A 1Z2MA 3IJIA 2PPGA 5ALJA 3FWAA 5IIJA 4I2GA 1HTQA 3Q3NC 3EECA 4K7WA 5AKGA 5ALXA 4ELUA 8ICKA 2CKHB 2KHWB 3BWUD 1R4MB 2LVQA 4K7UA 4PZNA 3Q6BA 4H4YA 2Y08A 2K6DB 1ZJNA 2N9LA 4MSQB 4ED7A 2E3TA 1U45A 4M6WA 3Q8LA 1LM8B 5DGBA 1WGHA 1P7FA 2KDBA 3H7SA 1ZR6A 2J0JA 4UB3A 1NHRA 1DGSA 5D2MB 3VR9B 2OPJA 3JPOA 1GB1A 2R8HA 4QZHA 2ZADA 5DLFA 3UGBB 1WZ3A 4O3QA 3I1YA 3EYZA 4RCOA 5AKKA 3IG3A 2MBOA 3JZUA 3UJRA 1BUIC 4WJPA 1TKKA 3C0RB 2XGPA 4B6JA 1P1AA 2QCZA 4PH5A 3URYA 3WCQA 1H2IA 4BOSC 3FILA 3VRBB 2JZZA 4KLDA 1SJED 4O3NA 2LMRA 1C77A 1L4ZB 2G45B 2KACA 4BXOA 1CEZA 5G5HB 5JCLA 4DCCA 2ON8A 4H2AA 2D11A 5DBBA 1MOKA 2AQ2B 2SEBD 1WJUA 3PW4A 1I35A 4E3CA 1ZMDA 2JRIB 5ENLA 3UI3A 5AKYA 5AUKA 3NZGA 3V5FA 4D2KA 2FLPA 4QZGA 2C7NB 2BCVA 2DHZA 9ICGA 4YL8A 1RDFA 3W5UB 4HCNB 4TV3A 3KYDD 4I2CA 1ZRMA 2MRPA 3DBHI 4A90A 4DL2A 5JTIA 3AE4B 3VQIA 4UW9A 5C3JB 4HCPB 5DPTA 4RQ8A 3R8BA 4ZYSA 4AYBF 2IGDA 4MELA 2YN4A 3EUB2 3CRXA 2HHWA 3MC0B 3ZJTA 2W11A 5ALQA 5U1OA 1MBBA 2MAXA 3VTEA 5ALGA 1IXRA 4ECRA 2OM6A 3LWLA 3AECB 1CQVA 3S1CA 3RD2A 1GO3F 4BURA 1YJJA 4ZRJA 5KFRA 4YFKA 2E8PA 1LO5D 2C7HA 3V7KA 3N7PD 2O6KA 3U9IA 1NK0A 3MP9A 3PY8A 1F8WA 4LZDA 1ZJMA 1DIQA 4G9BA 4HXDA 2ISPA 5LXHA 4ED8A 1WXAA 1C20A 2E8NA 5D49A 3SMVA 3N3KB 2JXJA 1WYWB 2W43A 3QE9Y 5AUIA 3TEZA 3HRDC 1V9JA 3NS8A 4B9TA 1GRTA 4PHAA 3QARA 4EWJA 4JLCA 3PHWB 2AGPA 2Y0SF 2ESEA 9ICMA 2QJMA 2ZUDA 3X0WA 4NY0A 4XWTA 5TR5A 5ALIA 2D3BA 2C9WB 7ICVA 2IYDB 2QB0A 2KT7A 4BC9A 5J04A 7ICHA 1V81A 3U7DA 5AI6A 4AWJA 3EA6A 4GOCA 4W9IA 1MO9A 2NV3A 1XPYA 3BS5B 3M9OB 4J9MA 3TFRA 3W1SA 4WQMA 2KXJA 3NFUA 5FR3A 1TYTA 3KTQA 5JCMA 2F44A 2BCRA 5ER0A 2J6TA 4LJOB 3C8YA 4BOZB 3MFHA 2HHTA 2R8GA 3MWCA 4IP5A 4Z17A 3RRHA 3F5EA 5DDYA 2EKIA 3IAM1 1ZQZA 3QEBZ 1Q0WB 2AL6A 1XLNA 8ICLA 3GDXA 2PFNA 1K1SA 3C5FA 5J0OA 4MGGA 2N1VA 2ZNVC 3HPFA 4XA5A 3BQ0A 4EEYA 2V3NA 3C1YA 5HP4A 3ISCA 4YWGG 4RNAA 2IO1B 2MCNB 4IM3A 5JUMA 3ZRCA 1K1QA 2ZW1A 4UATA 2P0IA 1A6SA 2KO3A 3OLMD 4Y2VA 2Z59B 2BB6A 3QWZB 1V5TA 4HCDA 2N7JA 4M9NA 1ZQBA 1ZD2P 2JZBA 4F5NA 3RRGA 2JU6X 3UM9A 1L3VA 2KLGA 1B1ZA 1D9FA 2A1JB 2HVIA 1X2GA 3P0WA 2NO5A 3A9JB 4P7IA 3JVAA 4F4KA 3A33B 1NJWA 1SE2A 4WAFA 3OC4A 3E56A 5C5JA 3JW7A 1MVKA 4FX9A 5EE0A 3NG0A 4O3PA 1I7HA 2LM4A 2EMSA 4XDCA 4DL7A 2FMQA 4JV1A 1FXIA 1UBIA 4FBJB 4I2JA 3KLJA 1MSWD 4ZHPA 4IL0A 3PLUA 5KT2A 2K89A 1EF1A 4WURA 4F2SA 1WI0A 4F5OA 3N1XC 2V3SA 2D07B 2Z0DB 3BQ1A 2ALZA 3Q3FA 2KANA 4F3OA 2DWQA 3OTRA 5KFVA 2XK5A 2IGGA 1TK5A 3ISBA 1Z4NA 2YY6A 2D3AA 4DN1A 1V1PB 3MUCA 3R2IA 2HE7A 4BWMA 4FS2A 4F93B 4NLNA 2OQYA 4BVUC 5JH5C 4KLSA 4CF3A 4LDTB 3GY1A 2O2VA 3TKAA 4PJ0U 3TCSA 3PR4A 2YVFA 4DXGA 4ELTA 2HHSA 1L6VA 3TJPA 1W1QA 4QJFB 3D2HA 1TAMA 3TJIA 1H38A 2LVOA 2YMLA 3IRUA 1P7EA 2XEWA 5DBCA 4ED0A 1OW5A 4LNOA 1OGWA 1SL0A 5KG1A 1E5WA 4JQWC 1YX6B 3TEXA 3RB3A 1SGHA 4M8MA 2L32A 4BBNC 3VC5A 4A8XC 3OJ3A 4EYHB 1V1OA 2AWTA 2OZ8A 1NI2A 1KKRA 3T5LA 1M94A 3A0BU 1QOAA 4RQ3A 3TSJA 1S77D 3RITA 2K8CB 4DL4A 5CEHA 3I3TB 3CGEA 3DVNU 3FJ4A 1E8YA 2K25A 5KFBA 2NPTA 2QHOA 2OO6A 2C3DA 2MU2A 4M9LA 3KFUF 4O3OA 4P1CC 5AM5A 5KFEA 3QYPA 1P9DU 2BB5A 1L7NA 4B0MA 1E8GA 2W0HA 1EO6A 3DHHC 1FRRA 3DESA 2ZG6A 2KDEB 2QDDA 3ZJVA 1SB3B 1XS2A 3AU6A 3BQ2A 2WWZA 3EKGA 3QUBA 1Z00B 4NAWA 3GZFA 4NZLB 5AEKB 4X2PA 1ZXIC 2ZJ8A 5L1JA 1XS9D 3KVFB 3AE3B 4P16A 4K4IA 2NBVB 2WDVB 1J2NA 4FADA 4EC3A 1K4QA 4EQRA 1N5WA 2OHFA 4JB3A 1ZE3D 4RT2A 3UJFA 4EQXA 2DKXA 1IP9A 4RFBA 2YVGA 1WGRA 5KG5A 1TY2A 4GR1A 1F9JA 2CDUA 3IV6A 1ET6A 3MR3A 4N59A 1D6EC 2Q5WD 2PXIA 2OEHA 2MJEA 3MABA 4BJQA 3S1FA 4GGBA 2X38A 9ICCA 3MR2A 4ECTA 4LDTD 4EOYA 2PP3A 2DW6A 2K4PA 3HPOA 1L0VB 4DFDA 4ECXA 2ONEA 5FS8A 3C19A 1MRAA 4C8OA 3RI7C 1FPYA 2KV2A 3H7PB 2MWSB 3V7JA 4GFJA 1ZQRA 4UASA 1XSLA 1B9RA 5AKHA 5KFOA 1L7MA 3I28A 1D5ZC 3V60A 3ZUNA 3TOYA 3QA8A 1ZRNA 1Q46A 4J9OA 1NKBA 1QQ5A 3GU3A 4K3BA 3TUOA 3DGBA 1P48A 3C1ZA 3PX6A 3JPTA 2XY6A 2PU0A 1OUQA 5CWRA 3ZNHB 4NQLB 2RHFA 4MEYA 2WU5B 3NUQA 4LNKA 4JV0A 1R4MI 4GDKA 4NLZA 2L8JA 2LGSA 3GIIA 4EFOA 2VKQA 2WPCA 2BYEA 3TMPB 4YSYB 4G8TA 2C22A 3MFGA 3T5JA 4UB4A 3B9JA 2KFZA 4WJNA 5C1ZA 1RXWA 3IJLA 3GE3C 4OALA 5FP0A 4PGXA 1N62C 3RH4A 2Y9UA 3QFBA 2MJDA 2J0KA 2DAJA 1E8ZA 4C4VB 2OCEA 9ICSA 2C5LC 1KN0A 1V8CA 2P8BA 1V9PA 3LVVA 4JDRA 2BPGA 2V4IB 2W9AA 1SJAA 3M63B 3FCPA 4IT1A 2WF8A 1JI7A 3P4QB 3T9LA 4IUMB 3RCYA 3DERA 1I42A 5J2DA 1NOMA 1N48A 1X9MA 3BVZA 3BYYB 2M4NA 3C29A 2DL0A 3S5SA 2JRHA 2UWQA 4RH6A 9ICVA 1UUPA 2MH7A 1GB4A 4FJYA 5EWFA 5AHXA 5D7GA 9ICNA 4GDLA 3IDWA 4DF4A 2KFKA 5HHZA 2PFQA 2HZGA 4EENA 3H40A 2WTFA 5JU5A 2WF6A 4IWQA 3NVVB 2VA3A 5BPCA 7ICOA 4MGIE 5IO9A 1S7MA 4MEXA 5EE3A 4ANXA 1YZ7A 4BXOB 4JN7A 5FJPA 4CDGA 1D8LA 2IY1B 5JRBA 3S1EA 2BR0A 4BV6A 3E0FA 2YMPA 3EANA 7ENLA 3C2MA 4KLFA 5AK5A 1WYGA 5L1MA 1D8BA 2EDUA 5G2NA 3WK5A 1X9XA 3NRZA 1I4HA 2PCEA 2WDWA 4PK1A 1E0ZA 3ED5A 1R4NI 3MHZA 2KZ3A 5GRTA 2R2QA 2KQ7A 3FKYA 4OZCA 1CUKA 5KT5A 9ICBA 3KYCD 2LYBA 1NJXA 3R7RA 2DFLA 2FNJB 2MX2A 4I2DA 1N56A 4P0PB 1BKHA 3V61A 3T3OA 2ZIUA 2C7MB 2Y5PA 3WK9A 2JV3A 2JPHA 1V38A 3EC8A 4LNNA 3CSTA 3SHQA 3PZ7A 5ALRA 1N60A 5FXDA 1GRHA 3A7AA 3V4BA 4CO7A 2ODGA 4IL6U 2GGEA 3RF9A 3RULA 2ICIA 2E6XA 3BOXA 3PFRA 2DBYA 2BCSA 2FAZA 1MC8A 8ICAA 1MBTA 2R18A 4DO9A 2P66A 5CX3A 1BQGA 3P4PB 4HPLB 2G07A 3VR8B 5JXVA 3HUIA 4DXAB 1FIQB 2GO7A 2P3ZA 3D2SA 3AE1B 3DEQA 1ZK7A 9ICKA 7ICLA 3KUDB 3DVGX 1GNUA 4IM0A 2MBRA 2OZTA 5BOFA 1FNUA 1TZ1A 4DQIA 5CHFA 3LVWA 2BC0A 3NXLA 4C4SA 3T5HA 2KVCA 3L5KA 1UA1A 2B76B 2GSHA 4H4TA 3IHQB 4I6NB 1C1YB 2L83A 5H92C 3EPIA 4MF2A 1UWMA 3KWVA 1FFVC 3I99A 1LKYA 5AI4A 1UA0A 1ZP0B 2KJ9A 3VC8A 1I4XA 7ICEA 3NZ3A 5AKXA 1LFDA 4KDIC 4A20A 3GB1A 3KQ4A 5HMLA 3KW5B 2EQ6A 1E8HA 3R0UA 8ICCA 3L17A 1COOA 3LWMA 2R2ZA 1DOYA 2RDBC 1NU5A 1J7CA 2KFNA 3QU7A 3UPQA 3DK4A 3M6KA 1WY8A 1SB3C 1Q8KA 4DQPA 2LBOA 3PW5A 2K4EA 5KVHA 2WXRA 5KHOA 1WR1A 2ZEQA 2X8XX 1D3ZA 1RYRA 5HR7A 4KLHA 2IA6A 3SAGA 1VJKA 2HVHA 2H3FA 4NAMA 5D6JB 3MTNB 8ICPA 4J9RA 5G55A 4JX1C 5BOEA 3JYUA 3V6EB 4M2YA 2NTSA 5KFAA 2I1QA 1U48A 3N7RC 1RRBA 2CHZA 3SFDB 4ADWA 2WXPA 1ENFA 4HDQA 4EM3A 4KLLA 2KEYA 3DEEA 5L83A 2PE9A 2K8HA 4M0XA 2MUCA 1SXEA 1FNVA 4F72A 8ICQA 3DBRB 4ZRPA 3VH3B 1ZUD2 5AZHA 1Z1BA 2BS3B 5HHIA 3MGVA 1S0NA 8ICZA 3E9SA 4EX6A 2FIFA 4NJ7A 3DBLB 3N20C 2E1EA 3OHBA 5FKAC 3IXSA 3D46A 7ICKA 2DZJA 5DQHA 2JXTA 2Y9TA 2RPVA 2D10A 1ZQOA 3WU2U 4ZHOA 1E10A 5ALFA 4H4PA 2RPQA 3TSSA 1N62A 3R7QA 4K2SA 1K5OA 1KF6B 1V80A 1W1MA 2MA9B 1YEYA 4FXCA 3M8SA 2NMQA 1F0MA 4RGNA 1OQRA 4OJPA 4DLEA 1KL9A 3W2DA 3S6JA 3V05A 4DLGA 2F3NA 4W9JA 2VFVA 3PG6A 1RPLA 4YWOA 5IP4D 2C2DA 4HWIB 2E8OA 3OZYA 2J3NA 2BPSA 4MGYE 3K75D 3AI5A 5K4LA 4PVKA 3ZDEA 3A7RA 1JIHA 4H4XA 3Q69A 1UGJA 3I57A 4X57B 1DIIA 1BPDA 3DWGC 4JWNA 1AARA 1GERA 3QCAA 1YJ1A 2YMQA 4LJXA 2NO4A 2PP1A 3ALRA 1WVEA 2KKVA 2ZIXB 1BMLC 2FUG1 3TX1A 3A9JA 3EFCA 2AX5A 1T3NA 4QWDA 2P3HA 1SKWA 4F4XA 2JZ3B 2BYFA 4NV0A 1IUEA 4JMUA 2JX5A 4X5VA 2LUMA 2HBMA 3Q45A 1A5RA 1X2IA 2AXTU 5KL8B 1ZQLA 3GIMA 5J2IA 1AW7A 3NVYB 3CYMA 2XCPA 4QZBA 2DYBA 2KK8A 3AN1A 4C4RA 1MQ3A 5IINA 1YQ3B 1A0PA 2OOBB 3SZ2A 2KNBA 1D7YA 1ZD5A 3G6XA 2KDFB 4RQ5A 1J0GA 4B9UA 1V1PA 4OCZA 4J9LA 2EQ8A 1T0SC 1SJBA 2WP5A 3NRWA 2CPRA 1NNLA 4RU9A 1OFFA 2GI9A 4F4YA 2LD9A 2R61A 2IPIA 1U9LA 3MSYA 2VANA 3IBEA 1DGJA 2WPEA 2Y3SA 2IO0B 3E58A 2W8KA 2KFJA 9ICXA 2J6UA 4U6PA 5FK9C 2LXAA 2QGYA 1YJIA 3DHGC 4IQTA 2IOFA 1MDRA 5AZFA 1IV8A 1DOQA 4MH0E 4JB1A 2CHRA 4F5RA 3MY9A 1UT8A 2Y1JA 2JEGA 1LQBA 2ZTEA 3D2QA 1NKEA 4W9FA 3ZNGC 4KX3A 5J2KA 2FLLA 2O56A 3TCAA 2QVHA 4OVZA 4NEVA 5KFTA 4KGSA 4XX5A 1JROA 3ZDCA 4W9LA 2LFIA 5AI8A 2YQUA 4PVJA 4GXKA 2M0AA 4IQUA 3OSPA 4RF1A 4YSXB 2K8CA 1NEKB 1FFVA 4NQKE 4TQ0A 1NI3A 3QUTA 4EBCA 1B22A 2W03A 4DWDA 2EAMA 1G6JA 2KG5A 2MBQA 2MW5A 2WDQB 3BJSA 4GXJA 4O5EA 2DZMA 3F2BA 2KX0A 1CK1A 1JMSA 2KE7A 3F53A 1EU3A 4LA1A 1ZD3A 4FLHA 4M0WB 5KFWA 1S0OA 4RNNA 1S0MA 2V9WA 4IRCA 1QQRA 1PGXA 4ED2A 1QZEA 2AL3A 2N9KA 3EGRA 2PLIA 1ZQUA 2HHQA 3SAHA 2W8LA 1SBBB 1UCVA 2M0XA 3IM1A 4CGZA 1LB2B 3KHGA 1T3QA 1Z00A 2WQYB 7ICQA 3VUWA 3W1SC 2HOIA 2CJOA 1IBXA 3M62B 1NHSA 2CU1A 3ISDA 3AEGB 3NZUA 3R0KA 3JPSA 2G06A 4ED6A 2ZPYA 2HBJA 2ISOA 1P98A 3N97B 2HTME 4W9EA 2PTXA 4IW0A 2D3GA 5LLIA 3APFA 4USAA 2OVLA 2KZRA 1UHUA 3EJBB 1VLBA 1EBDA 5AE2A 3GILA 1R0MA 3N1YC 3AE9B 3KUZA 3PK7A 3BSMA 4RQ4A 2LI6A 3PVXA 4DSKA 5ALZA 1NK9A 3ETRB 2VZKD 2BYVE 3PS6A 4JE3B 4JL9A 4WAAA 4GDLB 3LXDA 3Q8MA 1D8YA 3H7PA 2R8DA 8ICOA 2TPRA 2QB1A 3RBEA 2BZFA 3AEEB 3Q8EA 1W1OA 2GB1A 1W1RA 1GRBA 1EWYC 1SKRA 4K4GA 4REZA 1WGKA 1JOAA 4LVSA 2P6UA 1C79A 3BDPA 5AE1A 2LPEA 1WJNA 5JCNA 5JHBA 1UPHA 3DH9A 4A3RA 1QOGA 3R66C 1ZX9A 4OJLA 5KFLA 2WNMA 1LGRA 2CN1A 4FZMA 2LRWA 3EZ5A 4JWMA 1XQQA 4R65A 2J6SA 4K3CA 4CQNA 1GJZA 1R6WA 1WE7A 3FXGA 4ICUA 1I4PA 1V2YA 1FCCC 2EH9A 4DSJA 1S9FA 1EUVB 4FBUA 4LCDE 5AK6A 3P63A 2QKNA 4DHJB 3O13A 3N6JA 3UMBA 4YCXA 4DS5A 2XY7A 2XY5A 1TZOA 4A35A 4F8CB 4L23A 2ZIUB 5KFCA 5DPRA 1DTNA 2FE8A 3SN0A 2WYQA 3T8MA 1ESFA 3S2AA 2NVUI 2XCAA 2BS2B 2Y5BB 2HHVA 3K9OB 3APCA 3AQFA 4KLEA 4C4VA 4UD8A 5DB8A 1CZPA 9ICAA 3GRSA 1JWSD 1UH6A 2Y3AA 4NJ8A 5EE9A 3Q2AC 2QDFA 3R11A 3QU2A 2LHDA 3IFWB 2AKZA 3WALA 1E9IA 1XD3B 3R3MA 4ENLA 2ZIVA 4Y2YA 4EEKA 4TUQA 4DFKA 3IT4B 1E7PB 3RNCC 5DDMA 3DG6A 7ICIA 4R63A 3AUOA 3KOOA 2ASQA 3PSFA 3H4KA 2IOFK 1TS3A 1VD2A 3CGBA 2IBKA 3UCCA 1CI4A 5KFMA 2KJ6A 2I2YA 2LJIA 2M0NA 3IN5A 3IJQA 3NVVA 4TQRA 1L0YB 1LKYB 3FYYA 5CTRC 1T0RC 2QKQA 4H4RA 2HHXA 5J2HA 4H4VA 4IP4A 3I4KA 4OZBA 1KN5A 1RFAA 5E6OA 3RRAA 3B97A 1A77A 2BCUA 5KFUA 3ZD9A 4F4ZA 1PYWD 3H9DA 4DSFA 3P4SB 2QC8A 3RAXA 4R3DA 2P4PA 3ZDAA 4B9KA 3PSPA 3M8RA 4F7ZA 1XWLA 3RJIA 2VH1A 4K8GA 3MC1A 3ES8A 1KFSA 4FE3A 5KFHA 2W9NA 1UXYA 1GEUA 4IR9A 2WHEA 1KFTA 4IKGA 1EWCA 2FPMA 2DX5B 2WXJA 2ZXHA 3OWEB 2WX1A 3SI8A 7ICGA 4YTMB 4P0PA 4DHJD 2F1HA 1N5WC 2BCQA 2LJ5A 3DBRI 5KG4A 1BT0A 3L8KA 2W3SA 3A4RA 5KFNA 1MDLA 2PFOA 4Y2SA 3F2DA 5IIKA 4JPSA 3R10A 3DBLI 1JPMA 1ZQNA 5KFGA 1R4NB 1HQRD 4MLAA 4DDGD 2DPJA 4E4FA 4IM2A 1HE8A 2J42A 4ECUA 4MM3A 4DQOC 5F9NA 1WE6A 2F2AB 2I1KA 1FIQA 4HAIA 9ICOA 3DQVA 4BBNF 4UAVA 1YZ6A 3HWTA 5AKLA 1V86A 4KX5A 3GE8C 3ZJUA 2GR0A 2JRZA 5J0RA 2D8CA 2M17A 3W8ZA 5ALHA 1QOFA 1E0YA 4ACFA 4FDCB 3CP8A 1SE4A 2W7OA 4OZAA 5HFYA 2K8AA 3UINB 3TJ4A 3LB8C 2JUOA 3LXFA 4N6EB 2K22A 3RT3B 2POZA 2V4RA 1H4RA 4Q2JA 2IHMA 1QLNA 2DYOA 3Q3OC 1EBHA 4C8MA 3CAWA 2UVWA 2KZMA 1XXGA 2FJ6A 2KVSA 2XN9C 4N58A 3UXNA 3NTUA 1PQSA 3Q3MC 5CP2A 5J0XA 5J2CA 5TSSA 5FXEA 1RM6B 1PVRA 4M9HA 2LRUA 1HEKA 1T0QC 4DS4A 4GGQA 2GWSA 4JGHB 3V62A 3AMZA 3SEIA 3QNMA 1N61A 4KSLC 4RGOS 2GGJA 4G7FA 2FBWB 4AUQC 2XH7A 3EF6A 2K4IA 4DFJA 1VJ5A 3RR8A 4KGRA 1NYQA 3ZGZA 2W82A 3L13A 3PO0A 4HKQA 3QEAZ 1T8EA 1GRFA 4C8KA 1STZA 1D5MC 2AGOA 2GGHA 3QJZA 4F50A 3WK7A 7ICMA 4Q43A 3OPSA 1O08A 2Y3RA 1ROEA 4S17A 1TY0A 2HJ1A 3PQBA 5HNKA 1Z1VA 2PGEA 4GISA 2H3QA 5BMIA 1TVAA 2PTZA 7ICFA 1YNTE 4M04A 4IQWA 8ICGA 5G5GA 3Q8AA 1KQQA 1GESA 4EQSA 3QX1A 1DRGA 4AP9A 1TGZB 2LASA 3ABVB 3SR6B 3NASA 1URJA 5T14A 4I2AA 2QSDA 5KVIA 2OYYA 4F8RA 4DSIA 4C8LA 1ZD4A 2ZTCA 4W9GA 2V4QA 1NK6A 3N1ZC 4KZCA 3P93A 2N1RA 1SL1A 5DG8A 2PLPA 3AEDB 1XC9A 3R9KA 3Q8PB 2XI9A 4KTQA 4OO1J 4Y2UA 2HXUA 2PEAA 8ICVA 5E6NA 5KT7A 2BWFA 2CHXA 4G50A 2CU3A 3BZDB 4BKGA 1HA5A 3ZVHB 5DB6A 1ZDXA 3MHSD 1N2XA 4TUSA 2QMTA 4UB8U 3PRMB 4OJOA 5L1IA 1MN8A 4C8NA 3RAQA 8ICXA 3BVGA 2ES6A 4HEA1 5E6PA 1J8CA 4MSMB 3T8QA 3KJMA 4EZKA 2IPKD 5KG0A 1WM2A 1L7YA 3GFKB 2ASDA 4FULA 2JHDA 4BFRA 3AH7A 3BQTA 3GD6A 1BVSA 1S8OA 4YN4A 2KOBA 2KHQA 4P2HA 2PIAA 4MJSA 2GBMA 1L7PA 5KFQA 1LVHA 3ZDBA 2L1AA 3V6HA 3MC8A 3Q8BA 4ANVA 4GXIA 1N60C 4A3PA 3U4FA 2HOQA 1XSPA 3HP6A 2PTYA 2L0FA 4BKSD 1PVQA 1VAOA 3IAS1 3C2KA 9ICFA 4EQWA 2PSNA 2F1JA 4BWJA 5DLGA 1DK3A 1KFYB 4IRKA 1ZDVA 4KSKC 5FS7A 9ICQA 1MHXA 2UVVA 3K9PB 4UQGA 4B9MA 3ENEA 2ZIXA 1KLVA 1TE6A 1KD0A 3RNMA 2MHJA 3RUIB 2Q85A 4FS1A 5J0SA 3P4RB 3KZIU 5AK4A 3IG8A 2W7PA 4F4WA 3ZDTA 5BYSA 2A19A 4P4PA 2W9MA 1RXVA 1TKYA 4XC2A 4KX6B 1FHUA 1ZQXA 2W04A 7ICPA 2QJNA 4F1SA 4UAWA 2FMSA 4YWSA 3B0AA 3AU2A 1NKCA 4RGMA 4K7ZA 2ZC8A 2EQYA 4PHPA 2ZJAA 2XH2A 2XO7A 3N28A 3NVYA 5KFYA 2LGIA 4DQRA 4NJ6A 1IBXB 3Q8CA 1FMAD 4E5TA 3JPPA 4HPPA 3ZW3A 5F3XB 4E4UA 8ICIA 1VZ7A 3RJ8A 3ZI4A 4UBCA 2PVGC 5IN7A 3DJJA 4JQ9A 4DHGA 3LAEA 3H4BA 1WH3A 3H8HA 1ZKHA 2WXKA 2XGZA 1PK1A 7ICNA 1WFYA 2JY6A 1HEZE 2BQ3A 2RDXA 4H4UA 3KBBA 4O9MA 2LMCA 2KMAA 4FN2A 5D3DA 4HRSA 1WJ4A 5FS6A 3P3BA 1NENB 4XLOA 2DGZA 1QF6A 4JUZA 2ZTDA 3UQAA 4HG0A 4UB5A 5AM4A 4ZDVA 3UJEA 1T6BX 2BF8B 5J18A 2GR1A 2ZVNA 2WX0A 2O3GA 2PTWA 1CRXA 1EC9A 1ZQ1C 2LEKA 1L8PA 3DG7A 1C4CA 1ZKQA 4ZH4A 4P0QB 2MBHA 4W9KA 1EBGA 1L2NA 2PLSA 2HSZA 5J17A 1ZQAA 1YD8U 3HW8A 2B6GA 1MQ2A 3U26A 3GOEA 1ECQA 2KWDA 4QZFA 2BPCA 2MP2B 1JEHA 3LB8A 4ECVA 1ZQWA 4OHJA 3TIXA 3W1YA 2BVGA 2FCNA 5FJRA 4QWAA 4KPLA 2L7RA 2PGWA 3ZYYX 4RZRA 1L6NA 2UYZB 4QZAA 4XGAB 5FXFA 1T0YA 4AJYB 3HJEA 2KWCA 3SDLC 3MQTA 4M0WA 2PMZC 8ICUA 4QZ8A 8ICJA 2RDIA 3W9CB 2H89B 2O6VB 3TADA 4RNMA 4C7YA 4E8GA 4B0EA 4L2YA 1JMLA 2ZZCA 3WKAA 3TSHA 3DIPA 1SGGA 3P42A 4MGZE 4YXMA 3WKBA 4Q8FA 3AQEA 3ORYA 1M6IA 4Q8EA 1RM6C 2RDJA 3QZ7A 1T5XD 3AEFB 3DHIC 3P2BA 3L10B 2AEHA 3ZLFA 4DX3A 4EZ6A 3DDMA 3QLDA 4IWPA 1J7AA 1E6EB 1V6EA 3GV7B 5HR6A 2QPMA 3S47A 4PHDA 3AEVA 1Q1RA 5LXIB 4PT5A 3MKCA 3O0HA 4J9KA 3NOBA 2ZIVB 2HQMA 3V6CB 3VFKA 5GTHU 3M9MB 2ZJ5A 3PMLA 3DDHA 1GOZA 3Q8KA 1DYQA 1VR9A 2KN5A 2CXYA 2KSOA 4ACOA 1C4AA 3WANA 1JWUD 4IC9A 1N5XA 1WCNA 3ETRA 2JVCA 4ANWA 4OJ5A 1DXLA 1J19A 2AGQA 9ICTA 2Q0ZX 2I1JA 3IK4A 4PS7A 3HT3A 4NM2A 3LK9A 2QJLA 2F5ZA 5KT3A 5ALKA 3KLSX 1JPDX 4LZGA 2GL5A 3H12A 3IC9A 1Z4OA 4UAYA 3BYTB 4JWUC 2ZCBA 4YD1A 1PZNA 2MSNA 3TQ1A 3T3NA 2INNE 2WBAA 3QU4A 4C80A 1JALA 4CNQA 5HHDG 5HQXA 2PE6B 3JVZX 4HPMB 2R8KA 5BMGA 3L54A 4A6GA 1WX9A 2KK0A 4ELVA 1BPZA 1P0RA 5ALYA 4M01A 4EX7A 4KIKB 1K50A 4QZCA 1UF0A 2KN4A 1OEYJ 2X99A 2UVRA 4Y2PA 3M9NB 3SYZA 2QARB 2HDOA 4RQ0A 2OAIA 3QHTA 2D2QA 1VRAB 3SQPA 4ARCA 3L4PA 3A1QA 3H8MA 3PW2A 1RVKA 2O6VD 5IKCM 4J56A 4O5KA 1TT5B 3C0PA 1WVFA 4N9F4 4H4ZA 3OGUA 2V9HA 2EZXA 2AQ1B 4II2B 2MLBA 2WXHA 2L5YA 2LGYA 1F5SA 4O3RA 2KC2A 3AE8B 2KAJA 2ZZPB 3J9CA 1X6JA 2L3ZA 5HI1A 4YMMA 4MM3B 2RGFA 5KG2A 1PGBA 4A9AA 1BPEA 1GRGA 2G5HB 4DDID 5H2FU 3JPRA 3NZSA 4KGTA 2BHNA 1WGYA 2PI5A 5J2BA 3RJAA 5AKEA 1GUAB 2NCNA 1F9CA 2JYTA 2J7QB 5CR0A 2WXLA 1JX4A 2MBBB 4DL6A 1GREA 1S97A 5IIMA 3KUCB 5TZVA 2FCQA 1SIJA 2WB1F 3URHA 2KICA 3ZD8A 4ZRQA 3IT6B 4ECQA 3QU5A 4QWEA 4NLGA 4FZNA 5DCNA 1XO0A 4CHKA 1S5LU 1K8RB 1D9DA 4I6PA 3EJDB 4H83A 1L3UA 4PWCA 4ECSA 4XZ4A 3I5JC 4KN4A 1JWBD 2BQQA 2Q4WA 3AE2B 3VCBA 1IYXA 5HMMA 3MC9A 2WOWA 5KFKA 2HD5B 1ZQTA 3RR1A 4NJCA 1H8CA 3RGTA 5ADZA 1S76D 4TMAB 4QZDA 2L00B 1T3QC 3CGDA 2VRRB 4RM8A 3IVFA 4BC7A 3ETLA 7ICRA 2WU2B 4U7CA 3O65B 3RYTA 3BQ7A 2HOFA 1OEYA 3VCNA 2VFTA 3UGVA 4P4OA 1TV9A 2AHOB 5L9XA 1WXQA 1I4GA 4KKIA 3TWAA 5DBAA 2PI4A 3DK9A 4RQ1A 3N4EA 1ZGUB 8ICEA 3AE5B 4Y2RA 1RZTA 9ICRA 1ZQHA 5J0PA 2X8GA 5G5GB 4YG2A 1SIFA 3QTPA 3H70A 5CHWA 4OD0A 3D32A 4QIWC 5BO4B 2HCFA 1Z19A 1U49A 2MQJA 1JUDA 3RJKA 1ZPSA 1P3QU 1NBFC 4WQOB 3GRTA 3CYJA 2W55A 4KITB 1HZ6A 5D3IB 1W1SA 1Y88A 1W6TA 4FZLA 2KJ5A 3JSVB 3ML8A 3SSZA 3B1LX 3SV3A 2UVUA 4ZRIA 5KFDA 3DEDA 2HXTA 4PGQA 2DENB 5CB1A 2YLMA 1D5XC 4KT2A 3A0HU 1TFRA 3CT2A 3RNFC 3SQSA 2GOLA 5ALTA 1QKZA 1XLOA 4RNOA 3PV1A 1W1KA 2KLCA 5AE3A 4A8EA 9ICUA 2AJQA 1WJ6A 2KMMA 3ONSA 3Q6JA 1WXMA 2J52A 2VFUA 1KKOA 3RJFA 1HTOA 3CW2C 3IG5A 3OG5A 2H3VA 5JCKA 2DF4B 1D4BA 2ZJDA 3N7SC 2FIDA 1AHZA 2W9BA 1XHCA 3PMNA 3K1RB 2M56B 1KBUA 2JGAA 3BY4B 4MJSB 3L0WB 4ICVA 2YEPB 3U30A 2LM1A 4K8DA 1BPXA 4BKSA 2ZZ0A 1J97A 2V6OA 3TAQA 2GRTA 4J03A 1UZXB 3ZDMC 1ET9A 2W54A 2JH7A 1KCZA 2JK6A 3BJYA 1U4BA 3VTVA 3AL0B 3LDZE 5LNK1 5J0WA 4UB1A 1WR6E 5KFXA 2REXA 2FE9A 3RCZA 2KKPA 2KTFA 3R1ZA 1WGDA 2HHUA 4KZ0A 1B4FA 3Q4DA 4JK1A 3RJGA 1NYRA 1SE9A 2WB1C 4RUAA 1FRDA 2BKFA 4YT0B 3PRPB 1M6YA 3PGEA 2OLAA 4R8UB 1UBQA 3SR6A 2KN7A 4HYRA 2I5HA 5KG3A 5J8YC 1FEZA 3EFUA 3VUYA 1SKSA 2VFSA 4HCHA 2P13A 1TS4A 4L1BA 2P8CA 1WUEA 2Y1IA 3OPXA 3AU5A 2V3BA 1C9FA 1GV4A 1X66A 2GBNA 4BKTA 4HNLA 1FD6A 2EAPA 4E71A 4J9SA 3M95A 1NELA 4J1OA 5ALDA 1NK4A 2WXIA 3B2FA 2XICA 3AM9A 4W9CA 1PK1B 3CXBA 1RYSA 3ZVHA 4XQ8A 3DDCB 3ZLGA 1X6IA 2UU7A 3HX0A 1T7PA 2C3CA 3GZNB 5J2RA 3RFAA 3UQ2A 2HW3A 3C23A 2R2OA 5EWEA 4RPXA 2IMWP 2N4FA 2WP9B 2JQRB 4UB2A 2VZKB 3ZXVA 3OJUA 5C23A 3EW9A 2OKTA 1FECA 1YT3A 2EAOA 3M7DA 5KAFU 1XANA 4QAYA 2BBCA 3PTFC 4K1WA 1WF9A 3PREA 3WIMA 5AM2A 2QIEB 1ZQQA 4Z6DA 3H0MB 4AJWA 4TURA 2G4DB 1K52A 2GGGA 2G0AA 2YQEA 3T9PA 4BZAA 1FHVA 1ZQMA 2EELA 2IY0B 3DBSA 4F2RA 2XSXA 5HKHA 4EMJA 1L0XB 2GBKA 2AAQA 3H8AA 2B0CA 1R7SA 2YEPF 2NRVA 2VJ5A 1KW4A 5J2GA 1SZPA 1XCQL 3NHEB 4DQQA 4DHZE 1Q1OA 3N9YC 5ALWA 4NLKA 2B21A 2I6XA 4O95A 1XO1A 4LNFA 3RNEC 4DSEA 1KTKA 3I9V1 1ZXHA 2LYAA 2KTQA 5IOIA 2JWZA 4B6WA 2KQSA 3RJHA 2L52A 1QILA 2JEIA 1KLNA 1ZOYB 1PFDA 3PX0A 1HXYD 3ZRFA 1SXDA 3ZKJC 2ZUBA 2P6RA 3RB0A 5HMRA 2QAEA 3KWLA 5IIIA 4UAZA 2MEKA 2PKOA 1SE3A 3RR7A 5IA7A 1A70A 2QQ6A 2CRXA 4DL3A 4MH8A 1MG4A 3GP7A 2X8CA 4IWOA 1N61C 4H4SA 5KFFA 5I4DA 3D47A 1MA7A 1L6UA 1WRDB 3LYSA 1E7UA 3SQIA 2HBLA 3M6ZA 1QQ7A 2MUTA 5U25A 3GO2A 4ASWC 1L3TA 2RD0A 2PVOD 1YX5B 1Z5SB 2PJHA 2KSOB 1AHVA 2LZ6A 1I19A 4FI4A 2UUUA 4KMOB 2EKEC 2DZKA 1S1QB 2G3QB 3V5CA 2A1AA 4MEMA 4CYEA 4O3MA 4P4MA 1V97A 2CR5A 3RB6A 1PUZA 5D4BA 3HKZF 1KKXA 4P0QA 5IIOA 5BYQA 4I28A 5KHQA 5KG7A 1ZQFA 3QX7A 3AE7B 3GS2A 1TYGB 2HNEA 2MP2A 1COKA 1F3PA 3C28A 2PP0A 2VH2A 2D5GA 2JYEA 3DQ0A 5H8YE 1XU4A 3H0RB 3N4FA 4DFPA 3PLVA 4MFCA 3BK1A 4KDLB 1V5OA 5TR3A 4F4RA 4YMOA 2KVZA 4XUSA 3H7IA 4HNCA 3N30A 5ALEA 9ICPA 2M8SA 3HSUA 3RZWC 1MUCA 2I0KA 2GQTA 2DUYA 1TZZA 4OJ6A 4Q44A 4WWNA 2KD0A 4DWFA 2NPXA 2AYOB 3A1QB 3RH5A 2YB1A 4KLIA 2INPE 2O6VA 3L08A 2AKMA 3PNCA 3TW9A 9ICEA 1WWUA 1KSPA 2C2EA 3QIJA 4H2HA 4PYZA 1YMHE 3CSFA 3OHAA 1WUDA 3D2NA 4Y2JA 3FW8A 1GXFA 2E5AA 3RB4A 8ICFA 4JAYA 8ICHA 5KFJA 3CB3A 3BW7A 4XRHA 2RK5A 2GH5A 4QZIA 2DAFA 2E8MA 3I76A 2BQRA 3DV9A 5DPWA 3UF8A 2X50A 2GR2A 2PFPA 1F0XA 3TL5A 4FBTA 4YTNB 2PU1A 1ZYQA 3PZDA 2XH4A 4O3SA 1XO3A 3II4A 4LTUA 4LJPB 4WH4A 3DFYA 2FPKA 1ZQSA 4H4QA 2RLTA 4OVUA 5B66U 5BYRA 1O03A 2BPFA 4I2FA 4G3IA 1AHUA 2OG9A 3AB5A 1CJEA 5J8YA 3GC2A 1GAQB 3T3FA 2V1YA 2PMVA 5J2EA 2PKEA 4Z1YA 1WX7A 1FCLA 3A4SC 1PDZA 1GPXA 1L5PA 4B9VA 1H6VA 1IIPA 1WWVA 8ICRA 3RBDA 2KYWA 4CCHA 4M0AA 3IHPC 5CHVC 4QW8A 5CJ7A 3EJEB 3A7UA 4J9QA 4GN1A 2AQ4A 1ZQEA 7ICSA 1YQBA 4KIKA 1Y56A 3AV8A 4HJGE 4J6IA 2LGXA 4IZGA 3KD3A 4QWBA 3V72A 3L5OA 3TBLD 3ZNID 2QARA 4BX9C 4NEWA 4NXZA 1T4GA 2KNJA 1SJHD 3SFEB 2XNAC 3EAOA 2VIXA 4ROPA 4OW0A 3KZXA 3OJ4B 3WKDA 1FEBA 3G6YA 3V6JA 2GR3A 1QLTA 2N9PC 4AP4C 4YP3A 2Z8LA 3C2LA 4IRDA 3K1GA 2BYTA 1MI0A 1NDDA 3SBFA 2EZZA 1ZQCA 2C60A 2JR5A 2UUVA 2WXGA 3RZFA 2GQWA 1FNWA 1T94A 5ALNA 3ZQ4A 4QNLA 1OEPA 2LHEA 3T79A 3O0FA 1V59A 1ACCA 4QZEA 1KFDA 1XLPA 4EMIA 5AKJA 4A3OA 3H1UA 2VJ4A 3HKZC 4K81A 4DWIA 5BOMA 2OWOA 1ZQPA 1EF5A 1VZ8A 2FCSA 2OEDA 5D94A 4RF0A 3MJ5A 2L05A 2N7EA 1BPYA 2ZPNA 3WKEA 2IOHA 4NLBA 1PDXA 3RMKC 1SV0C 4NY8A 1F44A 3A9KB 4EKUA 9ICIA 3ZO5B 4EBEA 3QC8B 1J7BA 4KLUA 5GXGB 1X9WA 1KRPA 4MHVA 1DOXA 3CMMB 1UQVA 4ZYNA 2F76X 3QXGA 4I2HA 3SD5A 1XLQA 2GLSA 2LI5A 5ALOA 3RO6A 4EE2A 5DQGA 3OW1A 4IOIE 1ZMCA 2GLEA 2H3ZA 4LNIA 4M52A 2DZIA 3ECIA 4US8A 4YR2A 1KRHA 2ASLA 5AI5A 5CA7A 1BNPA 3BIID 2CS4A 3K4GA 2F1IA 4Y2TA 5J2JA 3OP2A 4Y2QA 7ICUA 3EPGA 1JWAD 4BDPA 3U8ZA 5FXPA 2ACZB 2FYMA 1MG8A 1UGMA 3MGHA 3TADC 4UAUA 4IS7A 2W9BB 4GXBA 1V85A 2JSVX 4UARA 4B9NA 3VH4B 3EEZA 1C7YA 1IG6A 1NK5A 4TKNA 1JN3A 3D2JA 5K8EA 2WXOA 1HZ5A 5L6FA 2Y5CA 2ZW0A 2C28A 3NJTA 5GTIU 1TKEA 1F0ZA 3KH0A 1TYPA 3B0XA 1X40A 1PGAA 2YVJA 2A3VA 4J3OD 2XC9A 5AKZA 5F9LA 1RWSA 4HN8A 3CWIA 2LXCA 4YTPB 5DPSA 5E6JA 2BT6A 1KTQA 4BGDA 5J0UA 1AYFA 4PPXA 3QN3A 1RYUA 4RPYA 1ZQGA 2BVHA 4NLCA 1WG8A 3DK8A 4I2IA 1XF5L 4TUUA 1QSYA 3MGIA 1V49A 4J57A 2EMTA 2K1FA 4BCAA 3PSEB 3ZVIA 1BPBA 5L6GA 4GIVA 2AL2B 2QLTA 4YXJA 2IGHA 1TKGA 2PODA 6ENLA 4DEZA 3GZNI 2DQNB 3JW0X 4FA6A 4YQWA 5E79U 3H4DA 2JZPA 3JSVA 5B5EU 1EU4A 3NVWB 1X2HA 3W8XA 2V3PA 4WWOA 5J2AA 2K8BA 4R66A 2VA8A 4US9A 1HSKA 2OQHA 3R07C 2WXFA 5AICA 3APDA 4KLQA 1QLUA 3EUB3 3NS1A 3LYYA 4S0RA 4PL2A 1HJPA 3Q14C 2EQ9A 4JN8A 4C7ZA 2NS5A 1P43A 4ECWA 2BVCA 3R25A 2BS4B 2PMZF 2HBKA 3UXPA 4A55A 3U2SC 2ZIWA 1IGDA 1SJCA 2F77X 3K1ZA 2OH2A 2KDMA 1UT5A 3JPQA 2LWPA 3ZTDA 2KD1A 3UMCA 4W9DA 1SWWA 3E2EA 3VA8A 3VC6A 2YMMA 3PVLA 1Q5WB 1L3SA 1ZQJA 3ZNZB 4M47A 3ZLHA 4NL9A 3MFIA 3J81j 4II3B 3EWAA 4TVWA 2RDGA 4ZA0A 3RNBC 3UIPB 2H5XA 4CF5A 3F5AA 2RDHA 1TKDA 2PA6A 1WGGA 1X9SA 2NYVA 3GD4A 4AYBC 2W9CB 4IR1A 4BBYA 1YN4A 3HM3A 4C0ZA 1RAXA 5AIBA 2N9XA 4DF8A 3MJWA 4ZOHB 2K39A 4K4HA 2IO2B 3UCDA 4F71A 3OZMA 4EYIB 2J0MA 2VAOA 4KLMA 1FEHA 3DJGX 2WF5A 2Z7JA 2FMPA 1DK2A 4W9HA 5L95C 1ONFA 1QOBA 4HKZE 2BDUA 3NGDA 1SV4A 4R8UA 1QT9A 2KIVA 4DYEA 3WK4A 4RQ7A 3H8WA 2L76A 4UBBA 1L4DB 2JT4B 4RM9A 3ZIMA 5I1VA 3PT2B 2KWUB 3VVWB 3FW7A 1WX8A 3MDAA 2ZZBA 4DSLA 5I1WA 4RQ2A 4FO6A 2J53A 4Y2XA 1UNSA 2OZ3A 2WP6A 4EZLA 5DB7A 2HMXA 2R9ZA 4KLJA 4AS1A 2Y0SC 2DKZA 3Q8RB 4J9PA 1HIWA 1GC6A 5JRTA 2GRIA 3LJ3A 1DNCA 4OVVA 2KJ8A 4M9JA 1PVPA 1ED1A 3NVZB 3VFCA 3BK2A 2YB4A 4MFFA 2ATLA 2MUTB 4BUGA 1GG3A 3UQ0A 3FG2P 2K9XA 4J3ZA 3WK8A 3PRZA 4GC6A 2Q4TA 2J4XA 1SF0A 4MFAA 4MGKE 2VFRA 1FEAA 1QSLA 3HM6X 4TSSA 5AI9A 4DOBA 3UXLA 4NPNA 1AQ6A 2RP5A 2AU0A 8ICWA 4CE6A 4DBGA 3FV9A 1IGCA 5ALMA 1GRAA 2EANA 4GC7A 4KMUA 2Y4GA 4GYPC 2XH0A 3QK0A 4B9SA 1Y8RC 1TBEA 1SV0A 2F8LA 2YX8A 5DKWA 4DK5A 1XDIA 3SJNA 3N4MB 1MHHE 1L8OA 3ZXRA 2WAQF 5KG6A 1GC7A 2CHWA 2JF5A 2KWVB 2WDTB 4MMWA 4ICAA 2PPHA 3D6JA 5AM3A 5KT4A 2A4ZA 3RFZB 2GMIC 4PZOA 2G9HD 3GQCA 2BKRB 1ZDLA 3EHVA 2JH1A 1MFWA 2D6FC 1QTMA 3HHMA 3VDZA 4FP1A 4YD2A 5DB9A 4J9NA 2FLNA 4EZ9A 5KT6A 4M9GA 3CXOA 2JXXA 1NJZA 3TFSA 2WPFA 2NRTA 5CRXA 1X1MA 4JIOU 1OJTA 4G3XB 2FCMA 1K51A 2ONQA 1NK8A 2M9NA 2YVSA 1HUOA 2OJWA 4AOFA 9ICWA 3DGZA 1RLFA 1FM0D 3AEBB 4PHEA 1C4PA 1OQQA 2K0PA 4G11A 4MDKE 1UD7A 1NDAA 1SL2A 2MNRA 1ZQDA 1STEA 4M8NA 4DXFA 2WFAA 3CF6E 2LHTA 1NJYA 3BZKA 4C00A 3S1DA 2K60A 4O5CA 5J29A 1UWXA 4R64A 2KX3A 1JQ4A 3U52E 4K1RB 2N1WA 3HK0A 4KLOA 1DXSA 3N32A 2INDC 1X42A 4YR0A 1TS2A 3T6CA 5DG7A 4UDUC 1WZ0A 4E6MA 2IZVB 4KV2A 4Q45A 5DGAA 2FUHB 4H1ZA 1N6ZA 1L7OA 4EEWA 4IHCA 2BDPA 2WLBA 2WS3B 2KDIA 2XIDA 4QIWF 3GIJA 2HI0A 1Q3UA 2KKCA 2OJRA 1F1HA 2OX4A 5KFZA 4EELA 3X23A 4LK0M 3FDSA 1E8WA 1ELSA 4M6WB 2OFJA 2WOVA 2KIWA 1ONEA 2D3CA 4PWBA 3ZTCA 4F91B 1RQNA 1TK8A 2M19A 5AI0A 2HTHA 4IL2A 1KLGD 4O0IA 3ML9A 4KEMA 4DNAA 3UMGA 4PGYA 4PS3A 4HLEA 4GFIA 1WWTA 3PW7A 1N63C 3T4WA 3UJSA 2RMMA 3B0YA 5J0QA 3PV8A 3F2CA 3QU9A 1AN8A 4F92B 1HUZA 2YTUA 9ICHA 2DLBA 2LUEA 3I63C 7ICTA 1YOVB 3MR6A 3FYHA 3FILB 4RQ6A 4CRXA 1ZY8A 2XBBC 3MBYA 2BWES 1W1JA 1WXSA 3RNGC 1MPEA 1JRUA 3TTEA 3MZNA 2NQWA 2F8KA 1M4VA 2PMQA 4DOCA 5D79A 1QCKA 4DL5A 3FAHA 3PO4A 3PSIA 1WMHA 1L8LA 1ZQYA 4YMNA 3DOWA 3VUXA 4FJVB 1PK3A 4GMVA 2GQUA 2K3UA 4IQVA 2PS2A 4KPRA 2WF7A 2FDRA 2MJ3A 3FW9A 4I27A 1OXJA 2FI1A 1XSNA 3PM9A 1AOGA 3DCGA 4P1BC 1I4RA 4HCLA 3UJ2A 3SV4A 1LV5A 2LGDA 3QPEA 1WRIA 4QZ9A 2NBWB 1F52A 5MPOA 1JWMD 2WAQC 1AWDA 2DPIA 3B08A 1ZETA 1P7DA 5AK3A 3AULA 3L16A 3NUHB 4M00A 1ZQVA 3VRAB 2EQ7A 4MF8A 4A6QA 2KTRA 2KJRA 3QUQA 3HIZA 3MDCA 4IG7B 4WJQA 4P6VF 3FC4A 1OQYA 3VHTC 3VXWA 2P88A 4MT5A 8ICTA 1E7VA 4I6LB 3BVMA 3OJSA 3H6NA 3SEBA 2K4HA 1SEBD 1TTNA 4HPNA 4HYKA 4DFMA 4ZRKA 3D9XA 3GD3A 4ZOHC 2HJ8A 3H0LB 3M3JA 5HG2A 1A76A 2IDYA 4F5PA 2A5UA 2BC1A 4I2EA 3D2DA 2ZUCA 2BQUA 5FR6A 1E8FA 3GV5B 4O1NA 2BTEA 3BS7A 3R2TA 4F5QA 2MSED 1BXTA 4NNJB 2GBRA 3C21A 3KKAC 1E90A 4XE0A 3I6EA 1S3SG 5J2FA 1J2MA 2ZXIA 8ICSA 3W5VB 3TEWA 2QB0B 1F77A 4ED1A 3OTQA 2BGFA 3VTUA 4QW9A 1C76A 2DW7A 3UXKA 2AXRA 4ML8A 2WXMA 3ICXA 2ZCCA 5IAAC 4PZFA 5AIAA 4EUTA 1ZXIA 2WDRB 4WWPA 1BNOA 2G1EA 1KJTA 8ICNA 3SD7A 3ONNA 2SAKA 1WXVA 5G5HA 1ISNA 3H7VA 4TVYA 4KWSA 1EXNA 3V7LA 4GYPA 4Z6CA 2RR9A 1KLUD 5BOLA 1VQZA 1MJDA 4HK2A 3RJEA 2XVTA 1YIWA 2AL1A 1DZNA 4TQ1A 2B3AA 2KC1A 4KN7A 4IC7B 4AQ7A 3STPA 2C2RA 1GETA 2GOWA 4EMWA 2NRWA 3JS8A 2K5PA 1WUFA 2NRZA 1SZHA 2Z0EB 2YAUA 3RPFC 5L1KA 4RQMA 2DYMA 5ALPA 1QLBB 3P1MA 2I38A 2IBIB 2JZBB 2K8BB 3ENLA 1KEJA 2KMCA 3A9KA 3HW2A 4MKSA 1VCBA 1FO4A 4WJ3B 3NS1B 4I2BA 8ICMA 3B2GA 2TSSA 2QDEA 2WXQA 5JCIA 4YR3A 1LVLA 2GDQA 5AM1A 1NZPA 3KHHA 4GSWA 5JZEB 8ICBA 1Z3EB 2ZIWB 3DBHB 4FHJA 2WOIA 4GLXA 2W3RA 1TE2A 4B9LA 1FFUC 3AE6B 5FJTA 4WJOA 5EWGA 4QWCA 3PZ8A 4H4WA 3U4EG 1YN3A 4B95A 3THVA 4DHZB 2VA2A 1U4AA 5FMHA 1TAUA 1IM4A 2P35A 3GSYA 4JWSC 4EBDA 4XDDA 2XK5B 1NHPA 3ZDDA 1XEEA 3IP4B 1BZLA 1YN5A 1EC8A 3BS5A 1NVID 2BVFA 2G09A 2XGQA 4C4TA 5TISU 3TARA 2ASJA 2KZZA 3ES7A 2IO3B 3QFAA 5AKIA 2KQ4X 3WAPA 1XT9B 5CHGA 5T8IA 3KHRA 2O2VB 5ALSA 3GIKA 2RQ5A 1KOTA 3SENA 5FJUA 3DFHA 1ZOLA 1JDFA 3CGCA 1QQ6A 1S10A 3VAWA 3PWIA 4TQSA 5J0YA 1ZW7A 4ITKA 1KM7A 1B0XA 2N7DA 3FM9A 4K7SA 2AL2A 1F2RC 3TEYA 2RSUA 3WA0A 1TAQA 1Q1WA 1WCLA 4ECZA 1E9MA 1RFKA 3LADA 3TWBA 3G6VA 1FXTB 4RT3A 1AROP 2KP7A 1N63A 2E5SA 2RRDA 5L1LA 3TAPA 5BMHA 2WHIA 3NVWA 3TANA 3LDAA 1KH0A 4WIPA 2N0SB 1UELA 4GB9A 4H19A 5DG9A 3HVDA 4RMAA 3WAOA 2A1JA 3PZPA 1C78A 1OTRB 3DGHA 2NPTB 3SU8X 2GGIA 3RN9C 3HILA 2HDEA 2V0GA 1DOIA 4HVBA 2AQ3B 2NQLA 3PR5B 3VDGA 1U47A 4RPZA 1WIAA 4PYUA 2EXRA 1SXTA 3Q8SB 2YVCA 2ZVOA 1JCKB 3ZLZA 2H3IA 2NRXA 3WKCA 2PTLA 2EZYA 4ARIA 4XYCA 1E8XA 3TI0A 1JXLA 2A8XA 5EE1A 3PPAA 3OSNA 2LKYA 1YQZA 4EZJA 4NAWB 4M6UA 2IHNA 3RNAC 2BW2A 2NR2A 5FS9A 3W8WA 3WAMA 3UIOB 1B43A 4FFDA 1GSNA 5KTQA 3PW0A 2FKPA 2MRLA 4GMEA 4RGTA 4H50A 4UB6U 4E74A 2BCPA 2JMGA 5C2TB 2INCC 2L0TA 5KFPA 3AXCA 2OXOA 3BINA 4KKJA 1L5UA 1SJDA 4GGHA 2NVKX 3KHLA 3LLBA 5HHHA 1Q3VA 2GBJA 5JHAA 1KDHA 5EDSA 4APNA 2W9CA 4PVEA 4GLSC 1SWVA 4GIRA 8ICYA 3POPA 1XNSA 1YQ4B 3H8SA 3SN1A 3CNHA 1IPGA 2QEJC 4GRTA 4ECYA 1NZBA 2WXNA 3AEAB 1MNSA 3DG3A 4LIIA 3VTWA 3WK6A 3T5KA 9ICLA 4PVHA 3PWGA 4PL1A 3TQPA 4GU2A 2CJNA 2QILA 2CFYA 1RQLA 3OAWA 2I5QA 3PSTA 4IDIA 3N6HA 3KKAA 4I29A 3ALBA 4DNSA 4YSZB 5EU9A 3PO5A 1VDVA 2WGSA 4ANUA 2G5IB 1PDYA 1C3TA 2V3AA 5AZGA 1NPXA
chains in the Genus database with same CATH topology
1J7BA 1F2RI 5GXGB 4MACA 1T6BX 1SB3C 1DOXA 2O3GA 1VZ6A 1XLQA 2WXRA 2LEKA 3NVZA 2JWUA 1C4CA 4GDKB 4EE2A 4IOIE 2H88B 4US8A 1RYJA 1VJKA 1W1LA 2PLSA 1KRHA 4NAMA 4PYTA 1XCTL 3B9JB 3DWMA 3BIID 4JX1C 1TJEA 2KWDA 4OHJA 1JWAD 1EM7A 2BVGA 2NTSA 5FXPA 2ACZB 3ZYYX 3SFDB 2JSVX 4XWWA 5FXFA 2WXPA 1ENFA 3D2JA 5K8EA 2WXOA 1HZ5A 5L6FA 2Y5CA 2ZW0A 3CIRB 1TKEA 4M0WA 3U7ZA 1F0ZA 3W9CB 2NTTA 2H89B 1PGAA 1FNVA 4C7YA 1Q10A 4J3OD 4ZRPA 1RWSA 1JMLA 4L2YA 1ZUD2 4B0EA 3TSHA 2BS3B 3CWIA 4YTPB 5E6JA 3P42A 2BT6A 1AYFA 1PUTA 3E9SA 1FXAA 1RM6C 2BVHA 1XF5L 1T5XD 2PW9A 3AEFB 5FKAC 3HVZA 3IXSA 1FFUA 4BCAA 5L6GA 4YXDB 1J7AA 1E6EB 2JXTA 2IGHA 2RPVA 1E10A 1JW9D 4ZHOA 2QPMA 1TKGA 3TSSA 3HRDD 1N62A 1K53A 4PT5A 1KF6B 1W1MA 1SSNA 5AWVA 4FXCA 2NMQA 2JZPA 1EU4A 1JRPA 4HROA 4RGNA 2V3PA 3W8XA 1GOZA 1DYQA 1VR9A 1X2HA 3NVWB 1OQRA 3V3XA 1HSKA 3W2DA 4US9A 3V05A 1C4AA 2WXFA 1I4QA 1JWUD 1N5XA 1QLUA 3ETRA 3NS1A 3LYYA 4C56C 3Q8FA 2VFVA 3NRZB 4C7ZA 2QJLA 2IJ0A 4PVKA 3KLSX 3A7RA 2BS4B 3Q69A 1UGJA 3BYTB 3I57A 4A55A 4WWMA 3U2SC 1DIIA 4JWUC 1IGDA 3DWGC 3T3NA 2INNE 4C80A 1JALA 5HHDG 2KDMA 5HQXA 1WSPA 5BMGA 4LLGM 1TS5A 1WVEA 2FUG1 1BMLC 3FWAA 3TX1A 2AX5A 1K50A 2P3HA 2KN4A 3BWUD 2Y08A 2N9LA 4TVWA 1IUEA 2OAIA 2E3TA 2JX5A 1VRAB 2RDGA 2LUMA 1P7FA 2RDHA 1ZR6A 4ARCA 3L4PA 3VR9B 4BBYA 1YN4A 1GB1A 1AW7A 3C0PA 1WVFA 3NVYB 4ZOHB 4RCOA 3AN1A 2VAOA 1FEHA 2AQ1B 2WXHA 1BUIC 1YQ3B 3AE8B 4MLAA 2KAJA 1QOBA 3J9CA 4HKZE 5HI1A 3WCQA 3URYA 1V1PA 1QT9A 3FILA 4MM3B 3VRBB 4A9AA 1PGBA 1SJED 1L4DB 1OFFA 5I1VA 1C77A 1L4ZB 2GI9A 2R61A 4KGTA 2KACA 2IPIA 3FW7A 5G5HB 2ON8A 4H2AA 1DGJA 5I1WA 3RJAA 2AQ2B 2J53A 2SEBD 1UNSA 2Y3SA 2JYTA 2WXLA 3UI3A 5FK9C 1YJIA 5AUKA 4AS1A 4D2KA 1SIJA 3R07C 2GRIA 4ZRQA 4JB1A 3W5UB 3IT6B 3EUB3 3NVZB 3BK2A 4OVZA 4A90A 5C3JB 3AE4B 3VQIA 4KGSA 4PWCA 4ZYSA 1JROA 3R8BA 2Q4WA 2IGDA 1JWBD 2K9XA 2LFIA 3EUB2 3AE2B 3ZJTA 3MC0B 4PVJA 2J4XA 1SF0A 2M0AA 1MBBA 2VFRA 4RF1A 4YSXB 3VTEA 4TSSA 1NEKB 1FFVA 4NJCA 3AECB 4TQ0A 1NI3A 1CQVA 5ADZA 3S1CA 4TMAB 1YJJA 1IGCA 1T3QC 2WDQB 1LO5D 4BC7A 2WU2B 2Y4GA 1CK1A 3MP9A 1EU3A 1DIQA 4WURA 3ZGZA 1QQRA 1MHHE 1PGXA 3EGRA 2N9KA 2VFTA 2PLIA 1SBBB 1WXQA 5AUIA 3TEZA 1I4GA 4KKIA 3HRDC 3RFZB 1T3QA 2WQYB 2G9HD 1IBXA 2CJOA 3AE5B 3AEGB 4XWTA 5G5GB 2HTME 4BC9A 1ZPSA 3EA6A 1K51A 2ONQA 2YVSA 2W55A 4USAA 1HZ6A 4WQMA 5D3IB 3W1SA 5FR3A 1W1SA 1VLBA 5AE2A 3C8YA 1FM0D 3AEBB 1C4PA 1OQQA 2K0PA 3AE9B 2EKIA 3IAM1 1STEA 3DEDA 1XLNA 4DXFA 3ETRB 2VZKD 1D5XC 4JE3B 3S1DA 4GDLB 1UWXA 4YWGG 2V3NA 1QKZA 3U52E 1JQ4A 1XLOA 2R8DA 4RNAA 5AE3A 1W1KA 3AEEB 2ZW1A 3Q8EA 1W1OA 2GB1A 2KMMA 1W1RA 1TS2A 1EWYC 2J52A 2VFUA 4REZA 1WGKA 2BB6A 1C79A 4UDUC 5AE1A 2N7JA 2JU6X 1QOGA 1D4BA 2WNMA 1B1ZA 2WLBA 2WS3B 1AHZA 1X2GA 2M56B 4CQNA 1SE2A 2YEPB 4WAFA 1I4PA 3E56A 1FCCC 1MVKA 4LK0M 5EE0A 2QKNA 4XDCA 1I7HA 3P63A 3O13A 1FXIA 1TZOA 4PWBA 1ET9A 2W54A 2M19A 4L23A 4ZHPA 2FE8A 1KLGD 1ESFA 5LNK1 2BS2B 1WWTA 1N63C 4UD8A 1NYRA 2RMMA 2DWQA 1FRDA 1CZPA 1JWSD 1AN8A 2IGGA 2DLBA 2Y3AA 4YT0B 3SR6A 1V1PB 5EE9A 2LHDA 3FILB 3R2IA 1W1JA 2VFSA 2P13A 3IT4B 1MPEA 1TS4A 1E7PB 4L1BA 2NQWA 1M4VA 5D79A 1C9FA 3FAHA 4DXGA 1FD6A 1TS3A 1L6VA 1W1QA 2GQUA 2WXIA 2K3UA 3D2HA 2I2YA 3B2FA 1P7EA 3AM9A 2LJIA 2MJ3A 3FW9A 3NVVA 1L0YB 3PM9A 3LLBA 1I4RA 3TEXA 1WRIA 2L32A 4A8XC 5MPOA 1JWMD 4OZBA 1V1OA 1AWDA 3NUHB 2WP9B 2JQRB 2VZKB 1QOAA 3VRAB 3TSJA 4A6QA 4P6VF 3FC4A 1PYWD 4MT5A 2BBCA 3P4SB 4R3DA 3BVMA 2QIEB 2P4PA 3SEBA 1SEBD 1K52A 4ZOHC 1UXYA 2BB5A 4B0MA 2EELA 1EWCA 4IKGA 5HG2A 1E8GA 2WXJA 2IDYA 1FRRA 1L0XB 3OWEB 4YTMB 1R7SA 2YEPF 3ZJVA 3D2DA 1SB3B 1N5WC 1E8FA 4O1NA 2BTEA 3R2TA 2W3SA 4NZLB 1XCQL 1BXTA 1ZXIC 4JPSA 4XE0A 3AE3B 3N9YC 4P16A 1HQRD 3W5VB 3TEWA 4O95A 2WDVB 1F77A 4EC3A 1N5WA 1C76A 1KTKA 2OHFA 1ZE3D 2J42A 2WXMA 3I9V1 1ZXHA 4DQOC 2AXRA 4ML8A 4PZFA 1FIQA 1ZXIA 2L52A 2WDRB 1QILA 2G1EA 1TY2A 4RFBA 1ZOYB 2SAKA 1PFDA 1HXYD 5G5HA 1ET6A 4N59A 3ZJUA 1D6EC 2Q5WD 4TVYA 2MJEA 3S1FA 3W8ZA 2X38A 1QOFA 3KWLA 1KLUD 1E0YA 5HMRA 1VQZA 1SE4A 1L0VB 2MEKA 2PKOA 1SE3A 4OZAA 5HFYA 1A70A 4TQ1A 1DZNA 4MH8A 4AQ7A 3LB8C 3GP7A 3LXFA 4N6EB 2K22A 1N61C 4Q2JA 5I4DA 2DYOA 1L6UA 1XXGA 1B9RA 2XN9C 4N58A 5FXEA 5TSSA 3JS8A 2K5PA 1D5ZC 1RM6B 3RPFC 2DYMA 3TUOA 1QLBB 3P1MA 2I38A 3AMZA 2PVOD 1AHVA 1N61A 2UUUA 1I19A 1FO4A 4RGOS 3NS1B 3B2GA 2TSSA 2WXQA 2FBWB 1V97A 2WU5B 4KGRA 1NYQA 2W82A 3PO0A 5BYQA 4HKQA 4YSYB 2W3RA 1D5MC 1FFUC 3AE6B 3MFGA 3B9JA 3AE7B 3GS2A 1TYGB 2Y3RA 3PQBA 1ROEA 3PZ8A 1TY0A 4OALA 2D5GA 2JYEA 3U4EG 3DQ0A 1YN3A 5H8YE 1N62C 5BMIA 2MJDA 3BK1A 1YNTE 5G5GA 3Q8AA 1V8CA 3GSYA 4JWSC 4XDDA 3HSUA 2V4IB 3ABVB 2GQTA 2I0KA 1XEEA 2QSDA 3SR6B 1YN5A 1NVID 2BVFA 2INPE 3P4QB 2KQ4X 5T8IA 2PLPA 3AEDB 3BYYB 1YMHE 3BVZA 3FW8A 4RH6A 2E5AA 1UUPA 4JAYA 2MH7A 1GB4A 3BW7A 5D7GA 2CU3A 2RK5A 3BZDB 4ITKA 1HA5A 5HHZA 3NVVB 1ZDXA 1F2RC 3TEYA 2QMTA 1F0XA 1E9MA 1RFKA 3BVGA 4HEA1 4YTNB 5EE3A 1N63A 5BMHA 3KJMA 3S1EA 1XO3A 3NVWA 1KH0A 4LTUA 4WH4A 2IPKD 2N0SB 4WIPA 5BYRA 1WYGA 1AHUA 3AH7A 3HVDA 3NRZA 1C78A 1I4HA 1CJEA 3AB5A 2WDWA 1E0ZA 2HDEA 2V0GA 1DOIA 1GAQB 2AQ3B 2PIAA 2PMVA 3MHZA 2L1AA 2EXRA 3Q8BA 4OZCA 1N60C 1SXTA 1FCLA 1JCKB 1GPXA 1L5PA 2PTLA 1VAOA 3IAS1 4ARIA 5EE1A 3T3OA 1KFYB 1ZDVA 2Y5PA 4NAWB 1MHXA 2BW2A 3A7UA 3PZ7A 3W8WA 1N60A 5FXDA 3A7AA 2Q85A 3P4RB 1Y56A 3AV8A 4RGTA 4HJGE 2ICIA 5BYSA 2E6XA 5C2TB 2DBYA 1TKYA 4KKJA 1MBTA 4KX6B 3P4PB 1SJHD 3SFEB 2XNAC 3VR8B 5JXVA 3HUIA 1FIQB 4OW0A 4RGMA 3AE1B 1QLTA 4PVEA 4GLSC 3POPA 1IBXB 3NVYA 1YQ4B 2LGIA 2Z8LA 3Q8CA 1FMAD 2QEJC 1MI0A 2BYTA 2MBRA 3AEAB 1VZ7A 2WXNA 3RJ8A 1FNUA 2UUVA 2PVGC 2WXGA 3LAEA 1FNWA 3H8HA 3ZQ4A 2WXKA 4PVHA 2LHEA 2B76B 1ACCA 1XLPA 1HEZE 5H92C 2L83A 1FFVC 1UWMA 3KWVA 3I99A 2CJNA 2LMCA 2QILA 1ZP0B 1I4XA 2OEDA 1VZ8A 3NZ3A 5D3DA 4IDIA 4HRSA 4RF0A 3GB1A 3MJ5A 3KQ4A 4DNSA 4YSZB 1E8HA 1NENB 1VDVA 4XLOA 1PDXA 1QF6A 2R2ZA 1DOYA 4HG0A 1J7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7B A;  5GXG B;  1SB3 C;  1DOX A;  2O3G A;  1XLQ A;  2LEK A;  3NVZ A;  2H88 B;  4US8 A;  1RYJ A;  1VJK A;  1W1L A;  2PLS A;  1KRH A;  4PYT A;  3B9J B;  3DWM A;  3BII D;  4JX1 C;  1TJE A;  1JWA D;  2BVG A;  5FXP A;  2ACZ B;  3ZYY X;  3SFD B;  5FXF A;  3D2J A;  2Y5C A;  3CIR B;  1TKE A;  1F0Z A;  3W9C B;  2H89 B;  4C7Y A;  1RWS A;  1ZUD 2;  3TSH A;  2BS3 B;  3CWI A;  4YTP B;  2BT6 A;  1AYF A;  1PUT A;  1FXA A;  1RM6 C;  2BVH A;  3AEF B;  3HVZ A;  1FFU A;  4BCA A;  4YXD B;  1J7A A;  1E6E B;  1E10 A;  2QPM A;  1JW9 D;  4ZHO A;  1TKG A;  3HRD D;  1N62 A;  1KF6 B;  1W1M A;  4FXC A;  4HRO A;  1JRP A;  1X2H A;  3W8X A;  3NVW B;  1OQR A;  1HSK A;  4US9 A;  3R07 C;  3EUB 3;  1QLU A;  1N5X A;  3ETR A;  3NS1 A;  3NRZ B;  2VFV A;  4C7Z A;  2QJL A;  4PVK A;  3A7R A;  2BS4 B;  4WWM A;  1DII A;  4JWU C;  3DWG C;  4C80 A;  1JAL A;  5HQX A;  1WVE A;  3FWA A;  3TX1 A;  2AX5 A;  2P3H A;  4TVW A;  1IUE A;  2OAI A;  2E3T A;  2JX5 A;  1ZR6 A;  3L4P A;  3VR9 B;  4BBY A;  3C0P A;  1WVF A;  3NVY B;  4ZOH B;  3AN1 A;  2VAO A;  1YQ3 B;  3AE8 B;  4MLA A;  2KAJ A;  1QOB A;  3WCQ A;  1QT9 A;  3VRB B;  4A9A A;  1OFF A;  3FW7 A;  5G5H B;  1DGJ A;  1YJI A;  5AUK A;  1SIJ A;  4JB1 A;  3W5U B;  3NVZ B;  5C3J B;  3AE4 B;  4PWC A;  1JRO A;  2Q4W A;  1JWB D;  2K9X A;  3EUB 2;  3AE2 B;  4PVJ A;  1SF0 A;  1MBB A;  2VFR A;  4YSX B;  3VTE A;  1NEK B;  1FFV A;  3AEC B;  1NI3 A;  3S1C A;  5ADZ A;  1YJJ A;  1T3Q C;  2WDQ B;  4BC7 A;  2WU2 B;  1DIQ A;  2VFT A;  2PLI A;  1WXQ A;  5AUI A;  3HRD C;  1T3Q A;  2WQY B;  2CJO A;  3AE5 B;  3AEG B;  5G5G B;  2HTM E;  4BC9 A;  2YVS A;  2W55 A;  4USA A;  4WQM A;  1W1S A;  1VLB A;  5AE2 A;  1FM0 D;  3AEB B;  1OQQ A;  3AE9 B;  2EKI A;  3DED A;  1XLN A;  3ETR B;  3S1D A;  1JQ4 A;  2R8D A;  1XLO A;  5AE3 A;  1W1K A;  3AEE B;  1W1O A;  2KMM A;  1W1R A;  1EWY C;  2VFU A;  1WGK A;  5AE1 A;  1QOG A;  2WLB A;  2WS3 B;  1AHZ A;  1X2G A;  2M56 B;  5EE0 A;  2QKN A;  1I7H A;  3P63 A;  1FXI A;  4PWB A;  2W54 A;  2M19 A;  4ZHP A;  2BS2 B;  1WWT A;  1N63 C;  4UD8 A;  1NYR A;  2DWQ A;  1FRD A;  1CZP A;  4YT0 B;  3SR6 A;  5EE9 A;  1W1J A;  2VFS A;  2P13 A;  2NQW A;  1E7P B;  5D79 A;  3FAH A;  1L6V A;  1W1Q A;  2GQU A;  3D2H A;  3B2F A;  3AM9 A;  2MJ3 A;  3FW9 A;  3NVV A;  3LLB A;  3PM9 A;  1WRI A;  5MPO A;  1AWD A;  2WP9 B;  2JQR B;  3VRA B;  1QOA A;  3TSJ A;  4P6V F;  3FC4 A;  3P4S B;  2QIE B;  2P4P A;  4ZOH C;  1UXY A;  1E8G A;  1FRR A;  4YTM B;  1R7S A;  3D2D A;  1SB3 B;  1N5W C;  1E8F A;  2W3S A;  1ZXI C;  3AE3 B;  3W5V B;  4O95 A;  2WDV B;  4EC3 A;  1N5W A;  2AXR A;  2OHF A;  4ML8 A;  4PZF A;  1FIQ A;  1ZXI A;  2L52 A;  2WDR B;  2G1E A;  1ZOY B;  1PFD A;  5G5H A;  4N59 A;  4TVY A;  2Q5W D;  2MJE A;  3S1F A;  3W8Z A;  5HMR A;  1QOF A;  3KWL A;  1E0Y A;  1VQZ A;  1L0V B;  2PKO A;  1DZN A;  1A70 A;  3LB8 C;  3LXF A;  4N6E B;  2K22 A;  1N61 C;  1L6U A;  1B9R A;  4N58 A;  5FXE A;  3JS8 A;  2K5P A;  1RM6 B;  3RPF C;  1QLB B;  3P1M A;  3AMZ A;  2PVO D;  1AHV A;  1N61 A;  1I19 A;  1FO4 A;  3NS1 B;  3B2G A;  2FBW B;  1V97 A;  2WU5 B;  1NYQ A;  3PO0 A;  4YSY B;  2W3R A;  1FFU C;  3AE6 B;  3B9J A;  3AE7 B;  1TYG B;  1ROE A;  4OAL A;  3DQ0 A;  5H8Y E;  1N62 C;  2MJD A;  5G5G A;  1V8C A;  3GSY A;  4JWS C;  3SR6 B;  3ABV B;  2GQT A;  2I0K A;  1NVI D;  2BVF A;  3P4Q B;  3AED B;  3FW8 A;  2E5A A;  4JAY A;  2MH7 A;  3BW7 A;  2CU3 A;  2RK5 A;  4ITK A;  5HHZ A;  3NVV B;  1F0X A;  1E9M A;  1RFK A;  5EE3 A;  4YTN B;  1N63 A;  3KJM A;  3S1E A;  1XO3 A;  3NVW A;  4LTU A;  2N0S B;  1WYG A;  1AHU A;  3AH7 A;  3NRZ A;  3AB5 A;  1CJE A;  1E0Z A;  1GAQ B;  1DOI A;  2PIA A;  2EXR A;  1N60 C;  1GPX A;  1L5P A;  1VAO A;  5EE1 A;  1KFY B;  3A7U A;  3W8W A;  1N60 A;  5FXD A;  3A7A A;  2Q85 A;  3P4R B;  3AV8 A;  5C2T B;  2DBY A;  1TKY A;  1MBT A;  4KX6 B;  3P4P B;  3SFE B;  3VR8 B;  3HUI A;  1FIQ B;  3AE1 B;  1QLT A;  4PVE A;  3NVY A;  1YQ4 B;  1FMA D;  2MBR A;  3AEA B;  2PVG C;  3LAE A;  4PVH A;  2B76 B;  1XLP A;  3I99 A;  5H92 C;  2L83 A;  1FFV C;  1UWM A;  2CJN A;  1ZP0 B;  4IDI A;  4HRS A;  4DNS A;  4YSZ B;  1E8H A;  1NEN B;  1VDV A;  4XLO A;  1PDX A;  1QF6 A;  2R2Z A;  1DOY A;  4HG0 A;  1J7C A; 
#chains in the Genus database with same CATH topology
 2JEF A;  5C0Y A;  4E0D A;  1F2R I;  2M1M A;  4M02 A;  5IIL A;  2MA1 A;  4MAC A;  4URK A;  5KL1 B;  2E1F A;  1ZQK A;  1VZ6 A;  3NVZ A;  2JEJ A;  2R8J A;  3KUM A;  2JWU A;  4GDK B;  3RJJ A;  4ZCW A;  5J0T A;  2MBE A;  5GMV A;  2H88 B;  1EC7 A;  5KNI A;  2QJJ A;  1RYJ A;  2KVR A;  1W1L A;  3DVN V;  3SN4 A;  4PYT A;  3V3W A;  1XCT L;  3B9J B;  1TK0 A;  3DWM A;  2G08 A;  1TJE A;  3C5G A;  2ZNV B;  4FJZ A;  3FVD A;  1EM7 A;  2K6Q A;  3MR5 A;  2AH5 A;  5KFS A;  3ZVV A;  4PS8 A;  4XWW A;  1QSS A;  3L3F X;  2AQ0 A;  1QH9 A;  4NM1 A;  4KLT A;  4Z6F A;  2X8H A;  4HJK A;  5EBK A;  4DXK A;  5A0L A;  3UQB A;  3I6T A;  5DQI A;  1BGX T;  2R8I A;  3TAC B;  4ED3 A;  2KOX A;  1RG6 A;  3CIR B;  3U7Z A;  2NTT A;  2LVP A;  2KJH B;  3RTV A;  3CK5 A;  1Q10 A;  2N9E B;  3SAF A;  2V4L A;  5D46 A;  3GV8 B;  3PX4 A;  4JHM A;  1PUT A;  1JXE A;  1FXA A;  1JCT A;  3JPN A;  2PW9 A;  2FPL A;  3HVZ A;  3QKE A;  1FFU A;  2I9G A;  4KLG A;  3BZC A;  4TUP A;  2KFK B;  3V6K A;  3THU A;  4YXD B;  4RUC A;  2BGW A;  2KMD A;  1JW9 D;  5ALU A;  3HRD D;  1K53 A;  4DQS A;  1CMX B;  2NBU A;  4G0N B;  1NK7 A;  5FJO A;  1NHQ A;  1SSN A;  5AWV A;  3DVG Y;  3QZ8 A;  5KAI U;  5EOZ A;  4DOA A;  3QAQ A;  4HRO A;  1JRP A;  4Z6E A;  4CF4 A;  1S0V A;  3V3X A;  1ZQI A;  4JV2 A;  2KHV A;  2WF9 A;  5IDZ A;  4FHK A;  7ICJ A;  5ALV A;  1I4Q A;  5ALL A;  1LXD A;  1WMH B;  4KVG B;  3NRZ B;  4C56 C;  1ECW A;  2GH1 A;  3DPD A;  5AM0 A;  3AU4 A;  3Q8F A;  3VCC A;  4RQN A;  4EM4 A;  9ICJ A;  4HDO A;  1TIF A;  2BKE A;  2IJ0 A;  3QQ8 B;  2G4S A;  3H8J A;  4NWI A;  4YVZ A;  1LPF A;  2DNF A;  3UXO A;  4BAX A;  4WWM A;  2D3D A;  3M1Y A;  3PHX B;  1WM3 A;  3Q8Q B;  1IYF A;  2RAB A;  2LYH A;  3NO1 A;  4GIB A;  4NL9 C;  3Q3J A;  3QUC A;  2KTR B;  1BWC A;  1WSP A;  5KFI A;  4LLG M;  1TS5 A;  3RH6 A;  3NY5 A;  1Z2M A;  3IJI A;  2PPG A;  5ALJ A;  3FWA A;  5IIJ A;  4I2G A;  1HTQ A;  3Q3N C;  3EEC A;  4K7W A;  5AKG A;  5ALX A;  4ELU A;  8ICK A;  2CKH B;  2KHW B;  3BWU D;  1R4M B;  2LVQ A;  4K7U A;  4PZN A;  3Q6B A;  4H4Y A;  2Y08 A;  2K6D B;  1ZJN A;  2N9L A;  4MSQ B;  4ED7 A;  2E3T A;  1U45 A;  4M6W A;  3Q8L A;  1LM8 B;  5DGB A;  1WGH A;  1P7F A;  2KDB A;  3H7S A;  1ZR6 A;  2J0J A;  4UB3 A;  1NHR A;  1DGS A;  5D2M B;  3VR9 B;  2OPJ A;  3JPO A;  1GB1 A;  2R8H A;  4QZH A;  2ZAD A;  5DLF A;  3UGB B;  1WZ3 A;  4O3Q A;  3I1Y A;  3EYZ A;  4RCO A;  5AKK A;  3IG3 A;  2MBO A;  3JZU A;  3UJR A;  1BUI C;  4WJP A;  1TKK A;  3C0R B;  2XGP A;  4B6J A;  1P1A A;  2QCZ A;  4PH5 A;  3URY A;  3WCQ A;  1H2I A;  4BOS C;  3FIL A;  3VRB B;  2JZZ A;  4KLD A;  1SJE D;  4O3N A;  2LMR A;  1C77 A;  1L4Z B;  2G45 B;  2KAC A;  4BXO A;  1CEZ A;  5G5H B;  5JCL A;  4DCC A;  2ON8 A;  4H2A A;  2D11 A;  5DBB A;  1MOK A;  2AQ2 B;  2SEB D;  1WJU A;  3PW4 A;  1I35 A;  4E3C A;  1ZMD A;  2JRI B;  5ENL A;  3UI3 A;  5AKY A;  5AUK A;  3NZG A;  3V5F A;  4D2K A;  2FLP A;  4QZG A;  2C7N B;  2BCV A;  2DHZ A;  9ICG A;  4YL8 A;  1RDF A;  3W5U B;  4HCN B;  4TV3 A;  3KYD D;  4I2C A;  1ZRM A;  2MRP A;  3DBH I;  4A90 A;  4DL2 A;  5JTI A;  3AE4 B;  3VQI A;  4UW9 A;  5C3J B;  4HCP B;  5DPT A;  4RQ8 A;  3R8B A;  4ZYS A;  4AYB F;  2IGD A;  4MEL A;  2YN4 A;  3EUB 2;  3CRX A;  2HHW A;  3MC0 B;  3ZJT A;  2W11 A;  5ALQ A;  5U1O A;  1MBB A;  2MAX A;  3VTE A;  5ALG A;  1IXR A;  4ECR A;  2OM6 A;  3LWL A;  3AEC B;  1CQV A;  3S1C A;  3RD2 A;  1GO3 F;  4BUR A;  1YJJ A;  4ZRJ A;  5KFR A;  4YFK A;  2E8P A;  1LO5 D;  2C7H A;  3V7K A;  3N7P D;  2O6K A;  3U9I A;  1NK0 A;  3MP9 A;  3PY8 A;  1F8W A;  4LZD A;  1ZJM A;  1DIQ A;  4G9B A;  4HXD A;  2ISP A;  5LXH A;  4ED8 A;  1WXA A;  1C20 A;  2E8N A;  5D49 A;  3SMV A;  3N3K B;  2JXJ A;  1WYW B;  2W43 A;  3QE9 Y;  5AUI A;  3TEZ A;  3HRD C;  1V9J A;  3NS8 A;  4B9T A;  1GRT A;  4PHA A;  3QAR A;  4EWJ A;  4JLC A;  3PHW B;  2AGP A;  2Y0S F;  2ESE A;  9ICM A;  2QJM A;  2ZUD A;  3X0W A;  4NY0 A;  4XWT A;  5TR5 A;  5ALI A;  2D3B A;  2C9W B;  7ICV A;  2IYD B;  2QB0 A;  2KT7 A;  4BC9 A;  5J04 A;  7ICH A;  1V81 A;  3U7D A;  5AI6 A;  4AWJ A;  3EA6 A;  4GOC A;  4W9I A;  1MO9 A;  2NV3 A;  1XPY A;  3BS5 B;  3M9O B;  4J9M A;  3TFR A;  3W1S A;  4WQM A;  2KXJ A;  3NFU A;  5FR3 A;  1TYT A;  3KTQ A;  5JCM A;  2F44 A;  2BCR A;  5ER0 A;  2J6T A;  4LJO B;  3C8Y A;  4BOZ B;  3MFH A;  2HHT A;  2R8G A;  3MWC A;  4IP5 A;  4Z17 A;  3RRH A;  3F5E A;  5DDY A;  2EKI A;  3IAM 1;  1ZQZ A;  3QEB Z;  1Q0W B;  2AL6 A;  1XLN A;  8ICL A;  3GDX A;  2PFN A;  1K1S A;  3C5F A;  5J0O A;  4MGG A;  2N1V A;  2ZNV C;  3HPF A;  4XA5 A;  3BQ0 A;  4EEY A;  2V3N A;  3C1Y A;  5HP4 A;  3ISC A;  4YWG G;  4RNA A;  2IO1 B;  2MCN B;  4IM3 A;  5JUM A;  3ZRC A;  1K1Q A;  2ZW1 A;  4UAT A;  2P0I A;  1A6S A;  2KO3 A;  3OLM D;  4Y2V A;  2Z59 B;  2BB6 A;  3QWZ B;  1V5T A;  4HCD A;  2N7J A;  4M9N A;  1ZQB A;  1ZD2 P;  2JZB A;  4F5N A;  3RRG A;  2JU6 X;  3UM9 A;  1L3V A;  2KLG A;  1B1Z A;  1D9F A;  2A1J B;  2HVI A;  1X2G A;  3P0W A;  2NO5 A;  3A9J B;  4P7I A;  3JVA A;  4F4K A;  3A33 B;  1NJW A;  1SE2 A;  4WAF A;  3OC4 A;  3E56 A;  5C5J A;  3JW7 A;  1MVK A;  4FX9 A;  5EE0 A;  3NG0 A;  4O3P A;  1I7H A;  2LM4 A;  2EMS A;  4XDC A;  4DL7 A;  2FMQ A;  4JV1 A;  1FXI A;  1UBI A;  4FBJ B;  4I2J A;  3KLJ A;  1MSW D;  4ZHP A;  4IL0 A;  3PLU A;  5KT2 A;  2K89 A;  1EF1 A;  4WUR A;  4F2S A;  1WI0 A;  4F5O A;  3N1X C;  2V3S A;  2D07 B;  2Z0D B;  3BQ1 A;  2ALZ A;  3Q3F A;  2KAN A;  4F3O A;  2DWQ A;  3OTR A;  5KFV A;  2XK5 A;  2IGG A;  1TK5 A;  3ISB A;  1Z4N A;  2YY6 A;  2D3A A;  4DN1 A;  1V1P B;  3MUC A;  3R2I A;  2HE7 A;  4BWM A;  4FS2 A;  4F93 B;  4NLN A;  2OQY A;  4BVU C;  5JH5 C;  4KLS A;  4CF3 A;  4LDT B;  3GY1 A;  2O2V A;  3TKA A;  4PJ0 U;  3TCS A;  3PR4 A;  2YVF A;  4DXG A;  4ELT A;  2HHS A;  1L6V A;  3TJP A;  1W1Q A;  4QJF B;  3D2H A;  1TAM A;  3TJI A;  1H38 A;  2LVO A;  2YML A;  3IRU A;  1P7E A;  2XEW A;  5DBC A;  4ED0 A;  1OW5 A;  4LNO A;  1OGW A;  1SL0 A;  5KG1 A;  1E5W A;  4JQW C;  1YX6 B;  3TEX A;  3RB3 A;  1SGH A;  4M8M A;  2L32 A;  4BBN C;  3VC5 A;  4A8X C;  3OJ3 A;  4EYH B;  1V1O A;  2AWT A;  2OZ8 A;  1NI2 A;  1KKR A;  3T5L A;  1M94 A;  3A0B U;  1QOA A;  4RQ3 A;  3TSJ A;  1S77 D;  3RIT A;  2K8C B;  4DL4 A;  5CEH A;  3I3T B;  3CGE A;  3DVN U;  3FJ4 A;  1E8Y A;  2K25 A;  5KFB A;  2NPT A;  2QHO A;  2OO6 A;  2C3D A;  2MU2 A;  4M9L A;  3KFU F;  4O3O A;  4P1C C;  5AM5 A;  5KFE A;  3QYP A;  1P9D U;  2BB5 A;  1L7N A;  4B0M A;  1E8G A;  2W0H A;  1EO6 A;  3DHH C;  1FRR A;  3DES A;  2ZG6 A;  2KDE B;  2QDD A;  3ZJV A;  1SB3 B;  1XS2 A;  3AU6 A;  3BQ2 A;  2WWZ A;  3EKG A;  3QUB A;  1Z00 B;  4NAW A;  3GZF A;  4NZL B;  5AEK B;  4X2P A;  1ZXI C;  2ZJ8 A;  5L1J A;  1XS9 D;  3KVF B;  3AE3 B;  4P16 A;  4K4I A;  2NBV B;  2WDV B;  1J2N A;  4FAD A;  4EC3 A;  1K4Q A;  4EQR A;  1N5W A;  2OHF A;  4JB3 A;  1ZE3 D;  4RT2 A;  3UJF A;  4EQX A;  2DKX A;  1IP9 A;  4RFB A;  2YVG A;  1WGR A;  5KG5 A;  1TY2 A;  4GR1 A;  1F9J A;  2CDU A;  3IV6 A;  1ET6 A;  3MR3 A;  4N59 A;  1D6E C;  2Q5W D;  2PXI A;  2OEH A;  2MJE A;  3MAB A;  4BJQ A;  3S1F A;  4GGB A;  2X38 A;  9ICC A;  3MR2 A;  4ECT A;  4LDT D;  4EOY A;  2PP3 A;  2DW6 A;  2K4P A;  3HPO A;  1L0V B;  4DFD A;  4ECX A;  2ONE A;  5FS8 A;  3C19 A;  1MRA A;  4C8O A;  3RI7 C;  1FPY A;  2KV2 A;  3H7P B;  2MWS B;  3V7J A;  4GFJ A;  1ZQR A;  4UAS A;  1XSL A;  1B9R A;  5AKH A;  5KFO A;  1L7M A;  3I28 A;  1D5Z C;  3V60 A;  3ZUN A;  3TOY A;  3QA8 A;  1ZRN A;  1Q46 A;  4J9O A;  1NKB A;  1QQ5 A;  3GU3 A;  4K3B A;  3TUO A;  3DGB A;  1P48 A;  3C1Z A;  3PX6 A;  3JPT A;  2XY6 A;  2PU0 A;  1OUQ A;  5CWR A;  3ZNH B;  4NQL B;  2RHF A;  4MEY A;  2WU5 B;  3NUQ A;  4LNK A;  4JV0 A;  1R4M I;  4GDK A;  4NLZ A;  2L8J A;  2LGS A;  3GII A;  4EFO A;  2VKQ A;  2WPC A;  2BYE A;  3TMP B;  4YSY B;  4G8T A;  2C22 A;  3MFG A;  3T5J A;  4UB4 A;  3B9J A;  2KFZ A;  4WJN A;  5C1Z A;  1RXW A;  3IJL A;  3GE3 C;  4OAL A;  5FP0 A;  4PGX A;  1N62 C;  3RH4 A;  2Y9U A;  3QFB A;  2MJD A;  2J0K A;  2DAJ A;  1E8Z A;  4C4V B;  2OCE A;  9ICS A;  2C5L C;  1KN0 A;  1V8C A;  2P8B A;  1V9P A;  3LVV A;  4JDR A;  2BPG A;  2V4I B;  2W9A A;  1SJA A;  3M63 B;  3FCP A;  4IT1 A;  2WF8 A;  1JI7 A;  3P4Q B;  3T9L A;  4IUM B;  3RCY A;  3DER A;  1I42 A;  5J2D A;  1NOM A;  1N48 A;  1X9M A;  3BVZ A;  3BYY B;  2M4N A;  3C29 A;  2DL0 A;  3S5S A;  2JRH A;  2UWQ A;  4RH6 A;  9ICV A;  1UUP A;  2MH7 A;  1GB4 A;  4FJY A;  5EWF A;  5AHX A;  5D7G A;  9ICN A;  4GDL A;  3IDW A;  4DF4 A;  2KFK A;  5HHZ A;  2PFQ A;  2HZG A;  4EEN A;  3H40 A;  2WTF A;  5JU5 A;  2WF6 A;  4IWQ A;  3NVV B;  2VA3 A;  5BPC A;  7ICO A;  4MGI E;  5IO9 A;  1S7M A;  4MEX A;  5EE3 A;  4ANX A;  1YZ7 A;  4BXO B;  4JN7 A;  5FJP A;  4CDG A;  1D8L A;  2IY1 B;  5JRB A;  3S1E A;  2BR0 A;  4BV6 A;  3E0F A;  2YMP A;  3EAN A;  7ENL A;  3C2M A;  4KLF A;  5AK5 A;  1WYG A;  5L1M A;  1D8B A;  2EDU A;  5G2N A;  3WK5 A;  1X9X A;  3NRZ A;  1I4H A;  2PCE A;  2WDW A;  4PK1 A;  1E0Z A;  3ED5 A;  1R4N I;  3MHZ A;  2KZ3 A;  5GRT A;  2R2Q A;  2KQ7 A;  3FKY A;  4OZC A;  1CUK A;  5KT5 A;  9ICB A;  3KYC D;  2LYB A;  1NJX A;  3R7R A;  2DFL A;  2FNJ B;  2MX2 A;  4I2D A;  1N56 A;  4P0P B;  1BKH A;  3V61 A;  3T3O A;  2ZIU A;  2C7M B;  2Y5P A;  3WK9 A;  2JV3 A;  2JPH A;  1V38 A;  3EC8 A;  4LNN A;  3CST A;  3SHQ A;  3PZ7 A;  5ALR A;  1N60 A;  5FXD A;  1GRH A;  3A7A A;  3V4B A;  4CO7 A;  2ODG A;  4IL6 U;  2GGE A;  3RF9 A;  3RUL A;  2ICI A;  2E6X A;  3BOX A;  3PFR A;  2DBY A;  2BCS A;  2FAZ A;  1MC8 A;  8ICA A;  1MBT A;  2R18 A;  4DO9 A;  2P66 A;  5CX3 A;  1BQG A;  3P4P B;  4HPL B;  2G07 A;  3VR8 B;  5JXV A;  3HUI A;  4DXA B;  1FIQ B;  2GO7 A;  2P3Z A;  3D2S A;  3AE1 B;  3DEQ A;  1ZK7 A;  9ICK A;  7ICL A;  3KUD B;  3DVG X;  1GNU A;  4IM0 A;  2MBR A;  2OZT A;  5BOF A;  1FNU A;  1TZ1 A;  4DQI A;  5CHF A;  3LVW A;  2BC0 A;  3NXL A;  4C4S A;  3T5H A;  2KVC A;  3L5K A;  1UA1 A;  2B76 B;  2GSH A;  4H4T A;  3IHQ B;  4I6N B;  1C1Y B;  2L83 A;  5H92 C;  3EPI A;  4MF2 A;  1UWM A;  3KWV A;  1FFV C;  3I99 A;  1LKY A;  5AI4 A;  1UA0 A;  1ZP0 B;  2KJ9 A;  3VC8 A;  1I4X A;  7ICE A;  3NZ3 A;  5AKX A;  1LFD A;  4KDI C;  4A20 A;  3GB1 A;  3KQ4 A;  5HML A;  3KW5 B;  2EQ6 A;  1E8H A;  3R0U A;  8ICC A;  3L17 A;  1COO A;  3LWM A;  2R2Z A;  1DOY A;  2RDB C;  1NU5 A;  1J7C A;  2KFN A;  3QU7 A;  3UPQ A;  3DK4 A;  3M6K A;  1WY8 A;  1SB3 C;  1Q8K A;  4DQP A;  2LBO A;  3PW5 A;  2K4E A;  5KVH A;  2WXR A;  5KHO A;  1WR1 A;  2ZEQ A;  2X8X X;  1D3Z A;  1RYR A;  5HR7 A;  4KLH A;  2IA6 A;  3SAG A;  1VJK A;  2HVH A;  2H3F A;  4NAM A;  5D6J B;  3MTN B;  8ICP A;  4J9R A;  5G55 A;  4JX1 C;  5BOE A;  3JYU A;  3V6E B;  4M2Y A;  2NTS A;  5KFA A;  2I1Q A;  1U48 A;  3N7R C;  1RRB A;  2CHZ A;  3SFD B;  4ADW A;  2WXP A;  1ENF A;  4HDQ A;  4EM3 A;  4KLL A;  2KEY A;  3DEE A;  5L83 A;  2PE9 A;  2K8H A;  4M0X A;  2MUC A;  1SXE A;  1FNV A;  4F72 A;  8ICQ A;  3DBR B;  4ZRP A;  3VH3 B;  1ZUD 2;  5AZH A;  1Z1B A;  2BS3 B;  5HHI A;  3MGV A;  1S0N A;  8ICZ A;  3E9S A;  4EX6 A;  2FIF A;  4NJ7 A;  3DBL B;  3N20 C;  2E1E A;  3OHB A;  5FKA C;  3IXS A;  3D46 A;  7ICK A;  2DZJ A;  5DQH A;  2JXT A;  2Y9T A;  2RPV A;  2D10 A;  1ZQO A;  3WU2 U;  4ZHO A;  1E10 A;  5ALF A;  4H4P A;  2RPQ A;  3TSS A;  1N62 A;  3R7Q A;  4K2S A;  1K5O A;  1KF6 B;  1V80 A;  1W1M A;  2MA9 B;  1YEY A;  4FXC A;  3M8S A;  2NMQ A;  1F0M A;  4RGN A;  1OQR A;  4OJP A;  4DLE A;  1KL9 A;  3W2D A;  3S6J A;  3V05 A;  4DLG A;  2F3N A;  4W9J A;  2VFV A;  3PG6 A;  1RPL A;  4YWO A;  5IP4 D;  2C2D A;  4HWI B;  2E8O A;  3OZY A;  2J3N A;  2BPS A;  4MGY E;  3K75 D;  3AI5 A;  5K4L A;  4PVK A;  3ZDE A;  3A7R A;  1JIH A;  4H4X A;  3Q69 A;  1UGJ A;  3I57 A;  4X57 B;  1DII A;  1BPD A;  3DWG C;  4JWN A;  1AAR A;  1GER A;  3QCA A;  1YJ1 A;  2YMQ A;  4LJX A;  2NO4 A;  2PP1 A;  3ALR A;  1WVE A;  2KKV A;  2ZIX B;  1BML C;  2FUG 1;  3TX1 A;  3A9J A;  3EFC A;  2AX5 A;  1T3N A;  4QWD A;  2P3H A;  1SKW A;  4F4X A;  2JZ3 B;  2BYF A;  4NV0 A;  1IUE A;  4JMU A;  2JX5 A;  4X5V A;  2LUM A;  2HBM A;  3Q45 A;  1A5R A;  1X2I A;  2AXT U;  5KL8 B;  1ZQL A;  3GIM A;  5J2I A;  1AW7 A;  3NVY B;  3CYM A;  2XCP A;  4QZB A;  2DYB A;  2KK8 A;  3AN1 A;  4C4R A;  1MQ3 A;  5IIN A;  1YQ3 B;  1A0P A;  2OOB B;  3SZ2 A;  2KNB A;  1D7Y A;  1ZD5 A;  3G6X A;  2KDF B;  4RQ5 A;  1J0G A;  4B9U A;  1V1P A;  4OCZ A;  4J9L A;  2EQ8 A;  1T0S C;  1SJB A;  2WP5 A;  3NRW A;  2CPR A;  1NNL A;  4RU9 A;  1OFF A;  2GI9 A;  4F4Y A;  2LD9 A;  2R61 A;  2IPI A;  1U9L A;  3MSY A;  2VAN A;  3IBE A;  1DGJ A;  2WPE A;  2Y3S A;  2IO0 B;  3E58 A;  2W8K A;  2KFJ A;  9ICX A;  2J6U A;  4U6P A;  5FK9 C;  2LXA A;  2QGY A;  1YJI A;  3DHG C;  4IQT A;  2IOF A;  1MDR A;  5AZF A;  1IV8 A;  1DOQ A;  4MH0 E;  4JB1 A;  2CHR A;  4F5R A;  3MY9 A;  1UT8 A;  2Y1J A;  2JEG A;  1LQB A;  2ZTE A;  3D2Q A;  1NKE A;  4W9F A;  3ZNG C;  4KX3 A;  5J2K A;  2FLL A;  2O56 A;  3TCA A;  2QVH A;  4OVZ A;  4NEV A;  5KFT A;  4KGS A;  4XX5 A;  1JRO A;  3ZDC A;  4W9L A;  2LFI A;  5AI8 A;  2YQU A;  4PVJ A;  4GXK A;  2M0A A;  4IQU A;  3OSP A;  4RF1 A;  4YSX B;  2K8C A;  1NEK B;  1FFV A;  4NQK E;  4TQ0 A;  1NI3 A;  3QUT A;  4EBC A;  1B22 A;  2W03 A;  4DWD A;  2EAM A;  1G6J A;  2KG5 A;  2MBQ A;  2MW5 A;  2WDQ B;  3BJS A;  4GXJ A;  4O5E A;  2DZM A;  3F2B A;  2KX0 A;  1CK1 A;  1JMS A;  2KE7 A;  3F53 A;  1EU3 A;  4LA1 A;  1ZD3 A;  4FLH A;  4M0W B;  5KFW A;  1S0O A;  4RNN A;  1S0M A;  2V9W A;  4IRC A;  1QQR A;  1PGX A;  4ED2 A;  1QZE A;  2AL3 A;  2N9K A;  3EGR A;  2PLI A;  1ZQU A;  2HHQ A;  3SAH A;  2W8L A;  1SBB B;  1UCV A;  2M0X A;  3IM1 A;  4CGZ A;  1LB2 B;  3KHG A;  1T3Q A;  1Z00 A;  2WQY B;  7ICQ A;  3VUW A;  3W1S C;  2HOI A;  2CJO A;  1IBX A;  3M62 B;  1NHS A;  2CU1 A;  3ISD A;  3AEG B;  3NZU A;  3R0K A;  3JPS A;  2G06 A;  4ED6 A;  2ZPY A;  2HBJ A;  2ISO A;  1P98 A;  3N97 B;  2HTM E;  4W9E A;  2PTX A;  4IW0 A;  2D3G A;  5LLI A;  3APF A;  4USA A;  2OVL A;  2KZR A;  1UHU A;  3EJB B;  1VLB A;  1EBD A;  5AE2 A;  3GIL A;  1R0M A;  3N1Y C;  3AE9 B;  3KUZ A;  3PK7 A;  3BSM A;  4RQ4 A;  2LI6 A;  3PVX A;  4DSK A;  5ALZ A;  1NK9 A;  3ETR B;  2VZK D;  2BYV E;  3PS6 A;  4JE3 B;  4JL9 A;  4WAA A;  4GDL B;  3LXD A;  3Q8M A;  1D8Y A;  3H7P A;  2R8D A;  8ICO A;  2TPR A;  2QB1 A;  3RBE A;  2BZF A;  3AEE B;  3Q8E A;  1W1O A;  2GB1 A;  1W1R A;  1GRB A;  1EWY C;  1SKR A;  4K4G A;  4REZ A;  1WGK A;  1JOA A;  4LVS A;  2P6U A;  1C79 A;  3BDP A;  5AE1 A;  2LPE A;  1WJN A;  5JCN A;  5JHB A;  1UPH A;  3DH9 A;  4A3R A;  1QOG A;  3R66 C;  1ZX9 A;  4OJL A;  5KFL A;  2WNM A;  1LGR A;  2CN1 A;  4FZM A;  2LRW A;  3EZ5 A;  4JWM A;  1XQQ A;  4R65 A;  2J6S A;  4K3C A;  4CQN A;  1GJZ A;  1R6W A;  1WE7 A;  3FXG A;  4ICU A;  1I4P A;  1V2Y A;  1FCC C;  2EH9 A;  4DSJ A;  1S9F A;  1EUV B;  4FBU A;  4LCD E;  5AK6 A;  3P63 A;  2QKN A;  4DHJ B;  3O13 A;  3N6J A;  3UMB A;  4YCX A;  4DS5 A;  2XY7 A;  2XY5 A;  1TZO A;  4A35 A;  4F8C B;  4L23 A;  2ZIU B;  5KFC A;  5DPR A;  1DTN A;  2FE8 A;  3SN0 A;  2WYQ A;  3T8M A;  1ESF A;  3S2A A;  2NVU I;  2XCA A;  2BS2 B;  2Y5B B;  2HHV A;  3K9O B;  3APC A;  3AQF A;  4KLE A;  4C4V A;  4UD8 A;  5DB8 A;  1CZP A;  9ICA A;  3GRS A;  1JWS D;  1UH6 A;  2Y3A A;  4NJ8 A;  5EE9 A;  3Q2A C;  2QDF A;  3R11 A;  3QU2 A;  2LHD A;  3IFW B;  2AKZ A;  3WAL A;  1E9I A;  1XD3 B;  3R3M A;  4ENL A;  2ZIV A;  4Y2Y A;  4EEK A;  4TUQ A;  4DFK A;  3IT4 B;  1E7P B;  3RNC C;  5DDM A;  3DG6 A;  7ICI A;  4R63 A;  3AUO A;  3KOO A;  2ASQ A;  3PSF A;  3H4K A;  2IOF K;  1TS3 A;  1VD2 A;  3CGB A;  2IBK A;  3UCC A;  1CI4 A;  5KFM A;  2KJ6 A;  2I2Y A;  2LJI A;  2M0N A;  3IN5 A;  3IJQ A;  3NVV A;  4TQR A;  1L0Y B;  1LKY B;  3FYY A;  5CTR C;  1T0R C;  2QKQ A;  4H4R A;  2HHX A;  5J2H A;  4H4V A;  4IP4 A;  3I4K A;  4OZB A;  1KN5 A;  1RFA A;  5E6O A;  3RRA A;  3B97 A;  1A77 A;  2BCU A;  5KFU A;  3ZD9 A;  4F4Z A;  1PYW D;  3H9D A;  4DSF A;  3P4S B;  2QC8 A;  3RAX A;  4R3D A;  2P4P A;  3ZDA A;  4B9K A;  3PSP A;  3M8R A;  4F7Z A;  1XWL A;  3RJI A;  2VH1 A;  4K8G A;  3MC1 A;  3ES8 A;  1KFS A;  4FE3 A;  5KFH A;  2W9N A;  1UXY A;  1GEU A;  4IR9 A;  2WHE A;  1KFT A;  4IKG A;  1EWC A;  2FPM A;  2DX5 B;  2WXJ A;  2ZXH A;  3OWE B;  2WX1 A;  3SI8 A;  7ICG A;  4YTM B;  4P0P A;  4DHJ D;  2F1H A;  1N5W C;  2BCQ A;  2LJ5 A;  3DBR I;  5KG4 A;  1BT0 A;  3L8K A;  2W3S A;  3A4R A;  5KFN A;  1MDL A;  2PFO A;  4Y2S A;  3F2D A;  5IIK A;  4JPS A;  3R10 A;  3DBL I;  1JPM A;  1ZQN A;  5KFG A;  1R4N B;  1HQR D;  4MLA A;  4DDG D;  2DPJ A;  4E4F A;  4IM2 A;  1HE8 A;  2J42 A;  4ECU A;  4MM3 A;  4DQO C;  5F9N A;  1WE6 A;  2F2A B;  2I1K A;  1FIQ A;  4HAI A;  9ICO A;  3DQV A;  4BBN F;  4UAV A;  1YZ6 A;  3HWT A;  5AKL A;  1V86 A;  4KX5 A;  3GE8 C;  3ZJU A;  2GR0 A;  2JRZ A;  5J0R A;  2D8C A;  2M17 A;  3W8Z A;  5ALH A;  1QOF A;  1E0Y A;  4ACF A;  4FDC B;  3CP8 A;  1SE4 A;  2W7O A;  4OZA A;  5HFY A;  2K8A A;  3UIN B;  3TJ4 A;  3LB8 C;  2JUO A;  3LXF A;  4N6E B;  2K22 A;  3RT3 B;  2POZ A;  2V4R A;  1H4R A;  4Q2J A;  2IHM A;  1QLN A;  2DYO A;  3Q3O C;  1EBH A;  4C8M A;  3CAW A;  2UVW A;  2KZM A;  1XXG A;  2FJ6 A;  2KVS A;  2XN9 C;  4N58 A;  3UXN A;  3NTU A;  1PQS A;  3Q3M C;  5CP2 A;  5J0X A;  5J2C A;  5TSS A;  5FXE A;  1RM6 B;  1PVR A;  4M9H A;  2LRU A;  1HEK A;  1T0Q C;  4DS4 A;  4GGQ A;  2GWS A;  4JGH B;  3V62 A;  3AMZ A;  3SEI A;  3QNM A;  1N61 A;  4KSL C;  4RGO S;  2GGJ A;  4G7F A;  2FBW B;  4AUQ C;  2XH7 A;  3EF6 A;  2K4I A;  4DFJ A;  1VJ5 A;  3RR8 A;  4KGR A;  1NYQ A;  3ZGZ A;  2W82 A;  3L13 A;  3PO0 A;  4HKQ A;  3QEA Z;  1T8E A;  1GRF A;  4C8K A;  1STZ A;  1D5M C;  2AGO A;  2GGH A;  3QJZ A;  4F50 A;  3WK7 A;  7ICM A;  4Q43 A;  3OPS A;  1O08 A;  2Y3R A;  1ROE A;  4S17 A;  1TY0 A;  2HJ1 A;  3PQB A;  5HNK A;  1Z1V A;  2PGE A;  4GIS A;  2H3Q A;  5BMI A;  1TVA A;  2PTZ A;  7ICF A;  1YNT E;  4M04 A;  4IQW A;  8ICG A;  5G5G A;  3Q8A A;  1KQQ A;  1GES A;  4EQS A;  3QX1 A;  1DRG A;  4AP9 A;  1TGZ B;  2LAS A;  3ABV B;  3SR6 B;  3NAS A;  1URJ A;  5T14 A;  4I2A A;  2QSD A;  5KVI A;  2OYY A;  4F8R A;  4DSI A;  4C8L A;  1ZD4 A;  2ZTC A;  4W9G A;  2V4Q A;  1NK6 A;  3N1Z C;  4KZC A;  3P93 A;  2N1R A;  1SL1 A;  5DG8 A;  2PLP A;  3AED B;  1XC9 A;  3R9K A;  3Q8P B;  2XI9 A;  4KTQ A;  4OO1 J;  4Y2U A;  2HXU A;  2PEA A;  8ICV A;  5E6N A;  5KT7 A;  2BWF A;  2CHX A;  4G50 A;  2CU3 A;  3BZD B;  4BKG A;  1HA5 A;  3ZVH B;  5DB6 A;  1ZDX A;  3MHS D;  1N2X A;  4TUS A;  2QMT A;  4UB8 U;  3PRM B;  4OJO A;  5L1I A;  1MN8 A;  4C8N A;  3RAQ A;  8ICX A;  3BVG A;  2ES6 A;  4HEA 1;  5E6P A;  1J8C A;  4MSM B;  3T8Q A;  3KJM A;  4EZK A;  2IPK D;  5KG0 A;  1WM2 A;  1L7Y A;  3GFK B;  2ASD A;  4FUL A;  2JHD A;  4BFR A;  3AH7 A;  3BQT A;  3GD6 A;  1BVS A;  1S8O A;  4YN4 A;  2KOB A;  2KHQ A;  4P2H A;  2PIA A;  4MJS A;  2GBM A;  1L7P A;  5KFQ A;  1LVH A;  3ZDB A;  2L1A A;  3V6H A;  3MC8 A;  3Q8B A;  4ANV A;  4GXI A;  1N60 C;  4A3P A;  3U4F A;  2HOQ A;  1XSP A;  3HP6 A;  2PTY A;  2L0F A;  4BKS D;  1PVQ A;  1VAO A;  3IAS 1;  3C2K A;  9ICF A;  4EQW A;  2PSN A;  2F1J A;  4BWJ A;  5DLG A;  1DK3 A;  1KFY B;  4IRK A;  1ZDV A;  4KSK C;  5FS7 A;  9ICQ A;  1MHX A;  2UVV A;  3K9P B;  4UQG A;  4B9M A;  3ENE A;  2ZIX A;  1KLV A;  1TE6 A;  1KD0 A;  3RNM A;  2MHJ A;  3RUI B;  2Q85 A;  4FS1 A;  5J0S A;  3P4R B;  3KZI U;  5AK4 A;  3IG8 A;  2W7P A;  4F4W A;  3ZDT A;  5BYS A;  2A19 A;  4P4P A;  2W9M A;  1RXV A;  1TKY A;  4XC2 A;  4KX6 B;  1FHU A;  1ZQX A;  2W04 A;  7ICP A;  2QJN A;  4F1S A;  4UAW A;  2FMS A;  4YWS A;  3B0A A;  3AU2 A;  1NKC A;  4RGM A;  4K7Z A;  2ZC8 A;  2EQY A;  4PHP A;  2ZJA A;  2XH2 A;  2XO7 A;  3N28 A;  3NVY A;  5KFY A;  2LGI A;  4DQR A;  4NJ6 A;  1IBX B;  3Q8C A;  1FMA D;  4E5T A;  3JPP A;  4HPP A;  3ZW3 A;  5F3X B;  4E4U A;  8ICI A;  1VZ7 A;  3RJ8 A;  3ZI4 A;  4UBC A;  2PVG C;  5IN7 A;  3DJJ A;  4JQ9 A;  4DHG A;  3LAE A;  3H4B A;  1WH3 A;  3H8H A;  1ZKH A;  2WXK A;  2XGZ A;  1PK1 A;  7ICN A;  1WFY A;  2JY6 A;  1HEZ E;  2BQ3 A;  2RDX A;  4H4U A;  3KBB A;  4O9M A;  2LMC A;  2KMA A;  4FN2 A;  5D3D A;  4HRS A;  1WJ4 A;  5FS6 A;  3P3B A;  1NEN B;  4XLO A;  2DGZ A;  1QF6 A;  4JUZ A;  2ZTD A;  3UQA A;  4HG0 A;  4UB5 A;  5AM4 A;  4ZDV A;  3UJE A;  1T6B X;  2BF8 B;  5J18 A;  2GR1 A;  2ZVN A;  2WX0 A;  2O3G A;  2PTW A;  1CRX A;  1EC9 A;  1ZQ1 C;  2LEK A;  1L8P A;  3DG7 A;  1C4C A;  1ZKQ A;  4ZH4 A;  4P0Q B;  2MBH A;  4W9K A;  1EBG A;  1L2N A;  2PLS A;  2HSZ A;  5J17 A;  1ZQA A;  1YD8 U;  3HW8 A;  2B6G A;  1MQ2 A;  3U26 A;  3GOE A;  1ECQ A;  2KWD A;  4QZF A;  2BPC A;  2MP2 B;  1JEH A;  3LB8 A;  4ECV A;  1ZQW A;  4OHJ A;  3TIX A;  3W1Y A;  2BVG A;  2FCN A;  5FJR A;  4QWA A;  4KPL A;  2L7R A;  2PGW A;  3ZYY X;  4RZR A;  1L6N A;  2UYZ B;  4QZA A;  4XGA B;  5FXF A;  1T0Y A;  4AJY B;  3HJE A;  2KWC A;  3SDL C;  3MQT A;  4M0W A;  2PMZ C;  8ICU A;  4QZ8 A;  8ICJ A;  2RDI A;  3W9C B;  2H89 B;  2O6V B;  3TAD A;  4RNM A;  4C7Y A;  4E8G A;  4B0E A;  4L2Y A;  1JML A;  2ZZC A;  3WKA A;  3TSH A;  3DIP A;  1SGG A;  3P42 A;  4MGZ E;  4YXM A;  3WKB A;  4Q8F A;  3AQE A;  3ORY A;  1M6I A;  4Q8E A;  1RM6 C;  2RDJ A;  3QZ7 A;  1T5X D;  3AEF B;  3DHI C;  3P2B A;  3L10 B;  2AEH A;  3ZLF A;  4DX3 A;  4EZ6 A;  3DDM A;  3QLD A;  4IWP A;  1J7A A;  1E6E B;  1V6E A;  3GV7 B;  5HR6 A;  2QPM A;  3S47 A;  4PHD A;  3AEV A;  1Q1R A;  5LXI B;  4PT5 A;  3MKC A;  3O0H A;  4J9K A;  3NOB A;  2ZIV B;  2HQM A;  3V6C B;  3VFK A;  5GTH U;  3M9M B;  2ZJ5 A;  3PML A;  3DDH A;  1GOZ A;  3Q8K A;  1DYQ A;  1VR9 A;  2KN5 A;  2CXY A;  2KSO A;  4ACO A;  1C4A A;  3WAN A;  1JWU D;  4IC9 A;  1N5X A;  1WCN A;  3ETR A;  2JVC A;  4ANW A;  4OJ5 A;  1DXL A;  1J19 A;  2AGQ A;  9ICT A;  2Q0Z X;  2I1J A;  3IK4 A;  4PS7 A;  3HT3 A;  4NM2 A;  3LK9 A;  2QJL A;  2F5Z A;  5KT3 A;  5ALK A;  3KLS X;  1JPD X;  4LZG A;  2GL5 A;  3H12 A;  3IC9 A;  1Z4O A;  4UAY A;  3BYT B;  4JWU C;  2ZCB A;  4YD1 A;  1PZN A;  2MSN A;  3TQ1 A;  3T3N A;  2INN E;  2WBA A;  3QU4 A;  4C80 A;  1JAL A;  4CNQ A;  5HHD G;  5HQX A;  2PE6 B;  3JVZ X;  4HPM B;  2R8K A;  5BMG A;  3L54 A;  4A6G A;  1WX9 A;  2KK0 A;  4ELV A;  1BPZ A;  1P0R A;  5ALY A;  4M01 A;  4EX7 A;  4KIK B;  1K50 A;  4QZC A;  1UF0 A;  2KN4 A;  1OEY J;  2X99 A;  2UVR A;  4Y2P A;  3M9N B;  3SYZ A;  2QAR B;  2HDO A;  4RQ0 A;  2OAI A;  3QHT A;  2D2Q A;  1VRA B;  3SQP A;  4ARC A;  3L4P A;  3A1Q A;  3H8M A;  3PW2 A;  1RVK A;  2O6V D;  5IKC M;  4J56 A;  4O5K A;  1TT5 B;  3C0P A;  1WVF A;  4N9F 4;  4H4Z A;  3OGU A;  2V9H A;  2EZX A;  2AQ1 B;  4II2 B;  2MLB A;  2WXH A;  2L5Y A;  2LGY A;  1F5S A;  4O3R A;  2KC2 A;  3AE8 B;  2KAJ A;  2ZZP B;  3J9C A;  1X6J A;  2L3Z A;  5HI1 A;  4YMM A;  4MM3 B;  2RGF A;  5KG2 A;  1PGB A;  4A9A A;  1BPE A;  1GRG A;  2G5H B;  4DDI D;  5H2F U;  3JPR A;  3NZS A;  4KGT A;  2BHN A;  1WGY A;  2PI5 A;  5J2B A;  3RJA A;  5AKE A;  1GUA B;  2NCN A;  1F9C A;  2JYT A;  2J7Q B;  5CR0 A;  2WXL A;  1JX4 A;  2MBB B;  4DL6 A;  1GRE A;  1S97 A;  5IIM A;  3KUC B;  5TZV A;  2FCQ A;  1SIJ A;  2WB1 F;  3URH A;  2KIC A;  3ZD8 A;  4ZRQ A;  3IT6 B;  4ECQ A;  3QU5 A;  4QWE A;  4NLG A;  4FZN A;  5DCN A;  1XO0 A;  4CHK A;  1S5L U;  1K8R B;  1D9D A;  4I6P A;  3EJD B;  4H83 A;  1L3U A;  4PWC A;  4ECS A;  4XZ4 A;  3I5J C;  4KN4 A;  1JWB D;  2BQQ A;  2Q4W A;  3AE2 B;  3VCB A;  1IYX A;  5HMM A;  3MC9 A;  2WOW A;  5KFK A;  2HD5 B;  1ZQT A;  3RR1 A;  4NJC A;  1H8C A;  3RGT A;  5ADZ A;  1S76 D;  4TMA B;  4QZD A;  2L00 B;  1T3Q C;  3CGD A;  2VRR B;  4RM8 A;  3IVF A;  4BC7 A;  3ETL A;  7ICR A;  2WU2 B;  4U7C A;  3O65 B;  3RYT A;  3BQ7 A;  2HOF A;  1OEY A;  3VCN A;  2VFT A;  3UGV A;  4P4O A;  1TV9 A;  2AHO B;  5L9X A;  1WXQ A;  1I4G A;  4KKI A;  3TWA A;  5DBA A;  2PI4 A;  3DK9 A;  4RQ1 A;  3N4E A;  1ZGU B;  8ICE A;  3AE5 B;  4Y2R A;  1RZT A;  9ICR A;  1ZQH A;  5J0P A;  2X8G A;  5G5G B;  4YG2 A;  1SIF A;  3QTP A;  3H70 A;  5CHW A;  4OD0 A;  3D32 A;  4QIW C;  5BO4 B;  2HCF A;  1Z19 A;  1U49 A;  2MQJ A;  1JUD A;  3RJK A;  1ZPS A;  1P3Q U;  1NBF C;  4WQO B;  3GRT A;  3CYJ A;  2W55 A;  4KIT B;  1HZ6 A;  5D3I B;  1W1S A;  1Y88 A;  1W6T A;  4FZL A;  2KJ5 A;  3JSV B;  3ML8 A;  3SSZ A;  3B1L X;  3SV3 A;  2UVU A;  4ZRI A;  5KFD A;  3DED A;  2HXT A;  4PGQ A;  2DEN B;  5CB1 A;  2YLM A;  1D5X C;  4KT2 A;  3A0H U;  1TFR A;  3CT2 A;  3RNF C;  3SQS A;  2GOL A;  5ALT A;  1QKZ A;  1XLO A;  4RNO A;  3PV1 A;  1W1K A;  2KLC A;  5AE3 A;  4A8E A;  9ICU A;  2AJQ A;  1WJ6 A;  2KMM A;  3ONS A;  3Q6J A;  1WXM A;  2J52 A;  2VFU A;  1KKO A;  3RJF A;  1HTO A;  3CW2 C;  3IG5 A;  3OG5 A;  2H3V A;  5JCK A;  2DF4 B;  1D4B A;  2ZJD A;  3N7S C;  2FID A;  1AHZ A;  2W9B A;  1XHC A;  3PMN A;  3K1R B;  2M56 B;  1KBU A;  2JGA A;  3BY4 B;  4MJS B;  3L0W B;  4ICV A;  2YEP B;  3U30 A;  2LM1 A;  4K8D A;  1BPX A;  4BKS A;  2ZZ0 A;  1J97 A;  2V6O A;  3TAQ A;  2GRT A;  4J03 A;  1UZX B;  3ZDM C;  1ET9 A;  2W54 A;  2JH7 A;  1KCZ A;  2JK6 A;  3BJY A;  1U4B A;  3VTV A;  3AL0 B;  3LDZ E;  5LNK 1;  5J0W A;  4UB1 A;  1WR6 E;  5KFX A;  2REX A;  2FE9 A;  3RCZ A;  2KKP A;  2KTF A;  3R1Z A;  1WGD A;  2HHU A;  4KZ0 A;  1B4F A;  3Q4D A;  4JK1 A;  3RJG A;  1NYR A;  1SE9 A;  2WB1 C;  4RUA A;  1FRD A;  2BKF A;  4YT0 B;  3PRP B;  1M6Y A;  3PGE A;  2OLA A;  4R8U B;  1UBQ A;  3SR6 A;  2KN7 A;  4HYR A;  2I5H A;  5KG3 A;  5J8Y C;  1FEZ A;  3EFU A;  3VUY A;  1SKS A;  2VFS A;  4HCH A;  2P13 A;  1TS4 A;  4L1B A;  2P8C A;  1WUE A;  2Y1I A;  3OPX A;  3AU5 A;  2V3B A;  1C9F A;  1GV4 A;  1X66 A;  2GBN A;  4BKT A;  4HNL A;  1FD6 A;  2EAP A;  4E71 A;  4J9S A;  3M95 A;  1NEL A;  4J1O A;  5ALD A;  1NK4 A;  2WXI A;  3B2F A;  2XIC A;  3AM9 A;  4W9C A;  1PK1 B;  3CXB A;  1RYS A;  3ZVH A;  4XQ8 A;  3DDC B;  3ZLG A;  1X6I A;  2UU7 A;  3HX0 A;  1T7P A;  2C3C A;  3GZN B;  5J2R A;  3RFA A;  3UQ2 A;  2HW3 A;  3C23 A;  2R2O A;  5EWE A;  4RPX A;  2IMW P;  2N4F A;  2WP9 B;  2JQR B;  4UB2 A;  2VZK B;  3ZXV A;  3OJU A;  5C23 A;  3EW9 A;  2OKT A;  1FEC A;  1YT3 A;  2EAO A;  3M7D A;  5KAF U;  1XAN A;  4QAY A;  2BBC A;  3PTF C;  4K1W A;  1WF9 A;  3PRE A;  3WIM A;  5AM2 A;  2QIE B;  1ZQQ A;  4Z6D A;  3H0M B;  4AJW A;  4TUR A;  2G4D B;  1K52 A;  2GGG A;  2G0A A;  2YQE A;  3T9P A;  4BZA A;  1FHV A;  1ZQM A;  2EEL A;  2IY0 B;  3DBS A;  4F2R A;  2XSX A;  5HKH A;  4EMJ A;  1L0X B;  2GBK A;  2AAQ A;  3H8A A;  2B0C A;  1R7S A;  2YEP F;  2NRV A;  2VJ5 A;  1KW4 A;  5J2G A;  1SZP A;  1XCQ L;  3NHE B;  4DQQ A;  4DHZ E;  1Q1O A;  3N9Y C;  5ALW A;  4NLK A;  2B21 A;  2I6X A;  4O95 A;  1XO1 A;  4LNF A;  3RNE C;  4DSE A;  1KTK A;  3I9V 1;  1ZXH A;  2LYA A;  2KTQ A;  5IOI A;  2JWZ A;  4B6W A;  2KQS A;  3RJH A;  2L52 A;  1QIL A;  2JEI A;  1KLN A;  1ZOY B;  1PFD A;  3PX0 A;  1HXY D;  3ZRF A;  1SXD A;  3ZKJ C;  2ZUB A;  2P6R A;  3RB0 A;  5HMR A;  2QAE A;  3KWL A;  5III A;  4UAZ A;  2MEK A;  2PKO A;  1SE3 A;  3RR7 A;  5IA7 A;  1A70 A;  2QQ6 A;  2CRX A;  4DL3 A;  4MH8 A;  1MG4 A;  3GP7 A;  2X8C A;  4IWO A;  1N61 C;  4H4S A;  5KFF A;  5I4D A;  3D47 A;  1MA7 A;  1L6U A;  1WRD B;  3LYS A;  1E7U A;  3SQI A;  2HBL A;  3M6Z A;  1QQ7 A;  2MUT A;  5U25 A;  3GO2 A;  4ASW C;  1L3T A;  2RD0 A;  2PVO D;  1YX5 B;  1Z5S B;  2PJH A;  2KSO B;  1AHV A;  2LZ6 A;  1I19 A;  4FI4 A;  2UUU A;  4KMO B;  2EKE C;  2DZK A;  1S1Q B;  2G3Q B;  3V5C A;  2A1A A;  4MEM A;  4CYE A;  4O3M A;  4P4M A;  1V97 A;  2CR5 A;  3RB6 A;  1PUZ A;  5D4B A;  3HKZ F;  1KKX A;  4P0Q A;  5IIO A;  5BYQ A;  4I28 A;  5KHQ A;  5KG7 A;  1ZQF A;  3QX7 A;  3AE7 B;  3GS2 A;  1TYG B;  2HNE A;  2MP2 A;  1COK A;  1F3P A;  3C28 A;  2PP0 A;  2VH2 A;  2D5G A;  2JYE A;  3DQ0 A;  5H8Y E;  1XU4 A;  3H0R B;  3N4F A;  4DFP A;  3PLV A;  4MFC A;  3BK1 A;  4KDL B;  1V5O A;  5TR3 A;  4F4R A;  4YMO A;  2KVZ A;  4XUS A;  3H7I A;  4HNC A;  3N30 A;  5ALE A;  9ICP A;  2M8S A;  3HSU A;  3RZW C;  1MUC A;  2I0K A;  2GQT A;  2DUY A;  1TZZ A;  4OJ6 A;  4Q44 A;  4WWN A;  2KD0 A;  4DWF A;  2NPX A;  2AYO B;  3A1Q B;  3RH5 A;  2YB1 A;  4KLI A;  2INP E;  2O6V A;  3L08 A;  2AKM A;  3PNC A;  3TW9 A;  9ICE A;  1WWU A;  1KSP A;  2C2E A;  3QIJ A;  4H2H A;  4PYZ A;  1YMH E;  3CSF A;  3OHA A;  1WUD A;  3D2N A;  4Y2J A;  3FW8 A;  1GXF A;  2E5A A;  3RB4 A;  8ICF A;  4JAY A;  8ICH A;  5KFJ A;  3CB3 A;  3BW7 A;  4XRH A;  2RK5 A;  2GH5 A;  4QZI A;  2DAF A;  2E8M A;  3I76 A;  2BQR A;  3DV9 A;  5DPW A;  3UF8 A;  2X50 A;  2GR2 A;  2PFP A;  1F0X A;  3TL5 A;  4FBT A;  4YTN B;  2PU1 A;  1ZYQ A;  3PZD A;  2XH4 A;  4O3S A;  1XO3 A;  3II4 A;  4LTU A;  4LJP B;  4WH4 A;  3DFY A;  2FPK A;  1ZQS A;  4H4Q A;  2RLT A;  4OVU A;  5B66 U;  5BYR A;  1O03 A;  2BPF A;  4I2F A;  4G3I A;  1AHU A;  2OG9 A;  3AB5 A;  1CJE A;  5J8Y A;  3GC2 A;  1GAQ B;  3T3F A;  2V1Y A;  2PMV A;  5J2E A;  2PKE A;  4Z1Y A;  1WX7 A;  1FCL A;  3A4S C;  1PDZ A;  1GPX A;  1L5P A;  4B9V A;  1H6V A;  1IIP A;  1WWV A;  8ICR A;  3RBD A;  2KYW A;  4CCH A;  4M0A A;  3IHP C;  5CHV C;  4QW8 A;  5CJ7 A;  3EJE B;  3A7U A;  4J9Q A;  4GN1 A;  2AQ4 A;  1ZQE A;  7ICS A;  1YQB A;  4KIK A;  1Y56 A;  3AV8 A;  4HJG E;  4J6I A;  2LGX A;  4IZG A;  3KD3 A;  4QWB A;  3V72 A;  3L5O A;  3TBL D;  3ZNI D;  2QAR A;  4BX9 C;  4NEW A;  4NXZ A;  1T4G A;  2KNJ A;  1SJH D;  3SFE B;  2XNA C;  3EAO A;  2VIX A;  4ROP A;  4OW0 A;  3KZX A;  3OJ4 B;  3WKD A;  1FEB A;  3G6Y A;  3V6J A;  2GR3 A;  1QLT A;  2N9P C;  4AP4 C;  4YP3 A;  2Z8L A;  3C2L A;  4IRD A;  3K1G A;  2BYT A;  1MI0 A;  1NDD A;  3SBF A;  2EZZ A;  1ZQC A;  2C60 A;  2JR5 A;  2UUV A;  2WXG A;  3RZF A;  2GQW A;  1FNW A;  1T94 A;  5ALN A;  3ZQ4 A;  4QNL A;  1OEP A;  2LHE A;  3T79 A;  3O0F A;  1V59 A;  1ACC A;  4QZE A;  1KFD A;  1XLP A;  4EMI A;  5AKJ A;  4A3O A;  3H1U A;  2VJ4 A;  3HKZ C;  4K81 A;  4DWI A;  5BOM A;  2OWO A;  1ZQP A;  1EF5 A;  1VZ8 A;  2FCS A;  2OED A;  5D94 A;  4RF0 A;  3MJ5 A;  2L05 A;  2N7E A;  1BPY A;  2ZPN A;  3WKE A;  2IOH A;  4NLB A;  1PDX A;  3RMK C;  1SV0 C;  4NY8 A;  1F44 A;  3A9K B;  4EKU A;  9ICI A;  3ZO5 B;  4EBE A;  3QC8 B;  1J7B A;  4KLU A;  5GXG B;  1X9W A;  1KRP A;  4MHV A;  1DOX A;  3CMM B;  1UQV A;  4ZYN A;  2F76 X;  3QXG A;  4I2H A;  3SD5 A;  1XLQ A;  2GLS A;  2LI5 A;  5ALO A;  3RO6 A;  4EE2 A;  5DQG A;  3OW1 A;  4IOI E;  1ZMC A;  2GLE A;  2H3Z A;  4LNI A;  4M52 A;  2DZI A;  3ECI A;  4US8 A;  4YR2 A;  1KRH A;  2ASL A;  5AI5 A;  5CA7 A;  1BNP A;  3BII D;  2CS4 A;  3K4G A;  2F1I A;  4Y2T A;  5J2J A;  3OP2 A;  4Y2Q A;  7ICU A;  3EPG A;  1JWA D;  4BDP A;  3U8Z A;  5FXP A;  2ACZ B;  2FYM A;  1MG8 A;  1UGM A;  3MGH A;  3TAD C;  4UAU A;  4IS7 A;  2W9B B;  4GXB A;  1V85 A;  2JSV X;  4UAR A;  4B9N A;  3VH4 B;  3EEZ A;  1C7Y A;  1IG6 A;  1NK5 A;  4TKN A;  1JN3 A;  3D2J A;  5K8E A;  2WXO A;  1HZ5 A;  5L6F A;  2Y5C A;  2ZW0 A;  2C28 A;  3NJT A;  5GTI U;  1TKE A;  1F0Z A;  3KH0 A;  1TYP A;  3B0X A;  1X40 A;  1PGA A;  2YVJ A;  2A3V A;  4J3O D;  2XC9 A;  5AKZ A;  5F9L A;  1RWS A;  4HN8 A;  3CWI A;  2LXC A;  4YTP B;  5DPS A;  5E6J A;  2BT6 A;  1KTQ A;  4BGD A;  5J0U A;  1AYF A;  4PPX A;  3QN3 A;  1RYU A;  4RPY A;  1ZQG A;  2BVH A;  4NLC A;  1WG8 A;  3DK8 A;  4I2I A;  1XF5 L;  4TUU A;  1QSY A;  3MGI A;  1V49 A;  4J57 A;  2EMT A;  2K1F A;  4BCA A;  3PSE B;  3ZVI A;  1BPB A;  5L6G A;  4GIV A;  2AL2 B;  2QLT A;  4YXJ A;  2IGH A;  1TKG A;  2POD A;  6ENL A;  4DEZ A;  3GZN I;  2DQN B;  3JW0 X;  4FA6 A;  4YQW A;  5E79 U;  3H4D A;  2JZP A;  3JSV A;  5B5E U;  1EU4 A;  3NVW B;  1X2H A;  3W8X A;  2V3P A;  4WWO A;  5J2A A;  2K8B A;  4R66 A;  2VA8 A;  4US9 A;  1HSK A;  2OQH A;  3R07 C;  2WXF A;  5AIC A;  3APD A;  4KLQ A;  1QLU A;  3EUB 3;  3NS1 A;  3LYY A;  4S0R A;  4PL2 A;  1HJP A;  3Q14 C;  2EQ9 A;  4JN8 A;  4C7Z A;  2NS5 A;  1P43 A;  4ECW A;  2BVC A;  3R25 A;  2BS4 B;  2PMZ F;  2HBK A;  3UXP A;  4A55 A;  3U2S C;  2ZIW A;  1IGD A;  1SJC A;  2F77 X;  3K1Z A;  2OH2 A;  2KDM A;  1UT5 A;  3JPQ A;  2LWP A;  3ZTD A;  2KD1 A;  3UMC A;  4W9D A;  1SWW A;  3E2E A;  3VA8 A;  3VC6 A;  2YMM A;  3PVL A;  1Q5W B;  1L3S A;  1ZQJ A;  3ZNZ B;  4M47 A;  3ZLH A;  4NL9 A;  3MFI A;  3J81 j;  4II3 B;  3EWA A;  4TVW A;  2RDG A;  4ZA0 A;  3RNB C;  3UIP B;  2H5X A;  4CF5 A;  3F5A A;  2RDH A;  1TKD A;  2PA6 A;  1WGG A;  1X9S A;  2NYV A;  3GD4 A;  4AYB C;  2W9C B;  4IR1 A;  4BBY A;  1YN4 A;  3HM3 A;  4C0Z A;  1RAX A;  5AIB A;  2N9X A;  4DF8 A;  3MJW A;  4ZOH B;  2K39 A;  4K4H A;  2IO2 B;  3UCD A;  4F71 A;  3OZM A;  4EYI B;  2J0M A;  2VAO A;  4KLM A;  1FEH A;  3DJG X;  2WF5 A;  2Z7J A;  2FMP A;  1DK2 A;  4W9H A;  5L95 C;  1ONF A;  1QOB A;  4HKZ E;  2BDU A;  3NGD A;  1SV4 A;  4R8U A;  1QT9 A;  2KIV A;  4DYE A;  3WK4 A;  4RQ7 A;  3H8W A;  2L76 A;  4UBB A;  1L4D B;  2JT4 B;  4RM9 A;  3ZIM A;  5I1V A;  3PT2 B;  2KWU B;  3VVW B;  3FW7 A;  1WX8 A;  3MDA A;  2ZZB A;  4DSL A;  5I1W A;  4RQ2 A;  4FO6 A;  2J53 A;  4Y2X A;  1UNS A;  2OZ3 A;  2WP6 A;  4EZL A;  5DB7 A;  2HMX A;  2R9Z A;  4KLJ A;  4AS1 A;  2Y0S C;  2DKZ A;  3Q8R B;  4J9P A;  1HIW A;  1GC6 A;  5JRT A;  2GRI A;  3LJ3 A;  1DNC A;  4OVV A;  2KJ8 A;  4M9J A;  1PVP A;  1ED1 A;  3NVZ B;  3VFC A;  3BK2 A;  2YB4 A;  4MFF A;  2ATL A;  2MUT B;  4BUG A;  1GG3 A;  3UQ0 A;  3FG2 P;  2K9X A;  4J3Z A;  3WK8 A;  3PRZ A;  4GC6 A;  2Q4T A;  2J4X A;  1SF0 A;  4MFA A;  4MGK E;  2VFR A;  1FEA A;  1QSL A;  3HM6 X;  4TSS A;  5AI9 A;  4DOB A;  3UXL A;  4NPN A;  1AQ6 A;  2RP5 A;  2AU0 A;  8ICW A;  4CE6 A;  4DBG A;  3FV9 A;  1IGC A;  5ALM A;  1GRA A;  2EAN A;  4GC7 A;  4KMU A;  2Y4G A;  4GYP C;  2XH0 A;  3QK0 A;  4B9S A;  1Y8R C;  1TBE A;  1SV0 A;  2F8L A;  2YX8 A;  5DKW A;  4DK5 A;  1XDI A;  3SJN A;  3N4M B;  1MHH E;  1L8O A;  3ZXR A;  2WAQ F;  5KG6 A;  1GC7 A;  2CHW A;  2JF5 A;  2KWV B;  2WDT B;  4MMW A;  4ICA A;  2PPH A;  3D6J A;  5AM3 A;  5KT4 A;  2A4Z A;  3RFZ B;  2GMI C;  4PZO A;  2G9H D;  3GQC A;  2BKR B;  1ZDL A;  3EHV A;  2JH1 A;  1MFW A;  2D6F C;  1QTM A;  3HHM A;  3VDZ A;  4FP1 A;  4YD2 A;  5DB9 A;  4J9N A;  2FLN A;  4EZ9 A;  5KT6 A;  4M9G A;  3CXO A;  2JXX A;  1NJZ A;  3TFS A;  2WPF A;  2NRT A;  5CRX A;  1X1M A;  4JIO U;  1OJT A;  4G3X B;  2FCM A;  1K51 A;  2ONQ A;  1NK8 A;  2M9N A;  2YVS A;  1HUO A;  2OJW A;  4AOF A;  9ICW A;  3DGZ A;  1RLF A;  1FM0 D;  3AEB B;  4PHE A;  1C4P A;  1OQQ A;  2K0P A;  4G11 A;  4MDK E;  1UD7 A;  1NDA A;  1SL2 A;  2MNR A;  1ZQD A;  1STE A;  4M8N A;  4DXF A;  2WFA A;  3CF6 E;  2LHT A;  1NJY A;  3BZK A;  4C00 A;  3S1D A;  2K60 A;  4O5C A;  5J29 A;  1UWX A;  4R64 A;  2KX3 A;  1JQ4 A;  3U52 E;  4K1R B;  2N1W A;  3HK0 A;  4KLO A;  1DXS A;  3N32 A;  2IND C;  1X42 A;  4YR0 A;  1TS2 A;  3T6C A;  5DG7 A;  4UDU C;  1WZ0 A;  4E6M A;  2IZV B;  4KV2 A;  4Q45 A;  5DGA A;  2FUH B;  4H1Z A;  1N6Z A;  1L7O A;  4EEW A;  4IHC A;  2BDP A;  2WLB A;  2WS3 B;  2KDI A;  2XID A;  4QIW F;  3GIJ A;  2HI0 A;  1Q3U A;  2KKC A;  2OJR A;  1F1H A;  2OX4 A;  5KFZ A;  4EEL A;  3X23 A;  4LK0 M;  3FDS A;  1E8W A;  1ELS A;  4M6W B;  2OFJ A;  2WOV A;  2KIW A;  1ONE A;  2D3C A;  4PWB A;  3ZTC A;  4F91 B;  1RQN A;  1TK8 A;  2M19 A;  5AI0 A;  2HTH A;  4IL2 A;  1KLG D;  4O0I A;  3ML9 A;  4KEM A;  4DNA A;  3UMG A;  4PGY A;  4PS3 A;  4HLE A;  4GFI A;  1WWT A;  3PW7 A;  1N63 C;  3T4W A;  3UJS A;  2RMM A;  3B0Y A;  5J0Q A;  3PV8 A;  3F2C A;  3QU9 A;  1AN8 A;  4F92 B;  1HUZ A;  2YTU A;  9ICH A;  2DLB A;  2LUE A;  3I63 C;  7ICT A;  1YOV B;  3MR6 A;  3FYH A;  3FIL B;  4RQ6 A;  4CRX A;  1ZY8 A;  2XBB C;  3MBY A;  2BWE S;  1W1J A;  1WXS A;  3RNG C;  1MPE A;  1JRU A;  3TTE A;  3MZN A;  2NQW A;  2F8K A;  1M4V A;  2PMQ A;  4DOC A;  5D79 A;  1QCK A;  4DL5 A;  3FAH A;  3PO4 A;  3PSI A;  1WMH A;  1L8L A;  1ZQY A;  4YMN A;  3DOW A;  3VUX A;  4FJV B;  1PK3 A;  4GMV A;  2GQU A;  2K3U A;  4IQV A;  2PS2 A;  4KPR A;  2WF7 A;  2FDR A;  2MJ3 A;  3FW9 A;  4I27 A;  1OXJ A;  2FI1 A;  1XSN A;  3PM9 A;  1AOG A;  3DCG A;  4P1B C;  1I4R A;  4HCL A;  3UJ2 A;  3SV4 A;  1LV5 A;  2LGD A;  3QPE A;  1WRI A;  4QZ9 A;  2NBW B;  1F52 A;  5MPO A;  1JWM D;  2WAQ C;  1AWD A;  2DPI A;  3B08 A;  1ZET A;  1P7D A;  5AK3 A;  3AUL A;  3L16 A;  3NUH B;  4M00 A;  1ZQV A;  3VRA B;  2EQ7 A;  4MF8 A;  4A6Q A;  2KTR A;  2KJR A;  3QUQ A;  3HIZ A;  3MDC A;  4IG7 B;  4WJQ A;  4P6V F;  3FC4 A;  1OQY A;  3VHT C;  3VXW A;  2P88 A;  4MT5 A;  8ICT A;  1E7V A;  4I6L B;  3BVM A;  3OJS A;  3H6N A;  3SEB A;  2K4H A;  1SEB D;  1TTN A;  4HPN A;  4HYK A;  4DFM A;  4ZRK A;  3D9X A;  3GD3 A;  4ZOH C;  2HJ8 A;  3H0L B;  3M3J A;  5HG2 A;  1A76 A;  2IDY A;  4F5P A;  2A5U A;  2BC1 A;  4I2E A;  3D2D A;  2ZUC A;  2BQU A;  5FR6 A;  1E8F A;  3GV5 B;  4O1N A;  2BTE A;  3BS7 A;  3R2T A;  4F5Q A;  2MSE D;  1BXT A;  4NNJ B;  2GBR A;  3C21 A;  3KKA C;  1E90 A;  4XE0 A;  3I6E A;  1S3S G;  5J2F A;  1J2M A;  2ZXI A;  8ICS A;  3W5V B;  3TEW A;  2QB0 B;  1F77 A;  4ED1 A;  3OTQ A;  2BGF A;  3VTU A;  4QW9 A;  1C76 A;  2DW7 A;  3UXK A;  2AXR A;  4ML8 A;  2WXM A;  3ICX A;  2ZCC A;  5IAA C;  4PZF A;  5AIA A;  4EUT A;  1ZXI A;  2WDR B;  4WWP A;  1BNO A;  2G1E A;  1KJT A;  8ICN A;  3SD7 A;  3ONN A;  2SAK A;  1WXV A;  5G5H A;  1ISN A;  3H7V A;  4TVY A;  4KWS A;  1EXN A;  3V7L A;  4GYP A;  4Z6C A;  2RR9 A;  1KLU D;  5BOL A;  1VQZ A;  1MJD A;  4HK2 A;  3RJE A;  2XVT A;  1YIW A;  2AL1 A;  1DZN A;  4TQ1 A;  2B3A A;  2KC1 A;  4KN7 A;  4IC7 B;  4AQ7 A;  3STP A;  2C2R A;  1GET A;  2GOW A;  4EMW A;  2NRW A;  3JS8 A;  2K5P A;  1WUF A;  2NRZ A;  1SZH A;  2Z0E B;  2YAU A;  3RPF C;  5L1K A;  4RQM A;  2DYM A;  5ALP A;  1QLB B;  3P1M A;  2I38 A;  2IBI B;  2JZB B;  2K8B B;  3ENL A;  1KEJ A;  2KMC A;  3A9K A;  3HW2 A;  4MKS A;  1VCB A;  1FO4 A;  4WJ3 B;  3NS1 B;  4I2B A;  8ICM A;  3B2G A;  2TSS A;  2QDE A;  2WXQ A;  5JCI A;  4YR3 A;  1LVL A;  2GDQ A;  5AM1 A;  1NZP A;  3KHH A;  4GSW A;  5JZE B;  8ICB A;  1Z3E B;  2ZIW B;  3DBH B;  4FHJ A;  2WOI A;  4GLX A;  2W3R A;  1TE2 A;  4B9L A;  1FFU C;  3AE6 B;  5FJT A;  4WJO A;  5EWG A;  4QWC A;  3PZ8 A;  4H4W A;  3U4E G;  1YN3 A;  4B95 A;  3THV A;  4DHZ B;  2VA2 A;  1U4A A;  5FMH A;  1TAU A;  1IM4 A;  2P35 A;  3GSY A;  4JWS C;  4EBD A;  4XDD A;  2XK5 B;  1NHP A;  3ZDD A;  1XEE A;  3IP4 B;  1BZL A;  1YN5 A;  1EC8 A;  3BS5 A;  1NVI D;  2BVF A;  2G09 A;  2XGQ A;  4C4T A;  5TIS U;  3TAR A;  2ASJ A;  2KZZ A;  3ES7 A;  2IO3 B;  3QFA A;  5AKI A;  2KQ4 X;  3WAP A;  1XT9 B;  5CHG A;  5T8I A;  3KHR A;  2O2V B;  5ALS A;  3GIK A;  2RQ5 A;  1KOT A;  3SEN A;  5FJU A;  3DFH A;  1ZOL A;  1JDF A;  3CGC A;  1QQ6 A;  1S10 A;  3VAW A;  3PWI A;  4TQS A;  5J0Y A;  1ZW7 A;  4ITK A;  1KM7 A;  1B0X A;  2N7D A;  3FM9 A;  4K7S A;  2AL2 A;  1F2R C;  3TEY A;  2RSU A;  3WA0 A;  1TAQ A;  1Q1W A;  1WCL A;  4ECZ A;  1E9M A;  1RFK A;  3LAD A;  3TWB A;  3G6V A;  1FXT B;  4RT3 A;  1ARO P;  2KP7 A;  1N63 A;  2E5S A;  2RRD A;  5L1L A;  3TAP A;  5BMH A;  2WHI A;  3NVW A;  3TAN A;  3LDA A;  1KH0 A;  4WIP A;  2N0S B;  1UEL A;  4GB9 A;  4H19 A;  5DG9 A;  3HVD A;  4RMA A;  3WAO A;  2A1J A;  3PZP A;  1C78 A;  1OTR B;  3DGH A;  2NPT B;  3SU8 X;  2GGI A;  3RN9 C;  3HIL A;  2HDE A;  2V0G A;  1DOI A;  4HVB A;  2AQ3 B;  2NQL A;  3PR5 B;  3VDG A;  1U47 A;  4RPZ A;  1WIA A;  4PYU A;  2EXR A;  1SXT A;  3Q8S B;  2YVC A;  2ZVO A;  1JCK B;  3ZLZ A;  2H3I A;  2NRX A;  3WKC A;  2PTL A;  2EZY A;  4ARI A;  4XYC A;  1E8X A;  3TI0 A;  1JXL A;  2A8X A;  5EE1 A;  3PPA A;  3OSN A;  2LKY A;  1YQZ A;  4EZJ A;  4NAW B;  4M6U A;  2IHN A;  3RNA C;  2BW2 A;  2NR2 A;  5FS9 A;  3W8W A;  3WAM A;  3UIO B;  1B43 A;  4FFD A;  1GSN A;  5KTQ A;  3PW0 A;  2FKP A;  2MRL A;  4GME A;  4RGT A;  4H50 A;  4UB6 U;  4E74 A;  2BCP A;  2JMG A;  5C2T B;  2INC C;  2L0T A;  5KFP A;  3AXC A;  2OXO A;  3BIN A;  4KKJ A;  1L5U A;  1SJD A;  4GGH A;  2NVK X;  3KHL A;  3LLB A;  5HHH A;  1Q3V A;  2GBJ A;  5JHA A;  1KDH A;  5EDS A;  4APN A;  2W9C A;  4PVE A;  4GLS C;  1SWV A;  4GIR A;  8ICY A;  3POP A;  1XNS A;  1YQ4 B;  3H8S A;  3SN1 A;  3CNH A;  1IPG A;  2QEJ C;  4GRT A;  4ECY A;  1NZB A;  2WXN A;  3AEA B;  1MNS A;  3DG3 A;  4LII A;  3VTW A;  3WK6 A;  3T5K A;  9ICL A;  4PVH A;  3PWG A;  4PL1 A;  3TQP A;  4GU2 A;  2CJN A;  2QIL A;  2CFY A;  1RQL A;  3OAW A;  2I5Q A;  3PST A;  4IDI A;  3N6H A;  3KKA A;  4I29 A;  3ALB A;  4DNS A;  4YSZ B;  5EU9 A;  3PO5 A;  1VDV A;  2WGS A;  4ANU A;  2G5I B;  1PDY A;  1C3T A;  2V3A A;  5AZG A;  1NPX A; 
#chains in the Genus database with same CATH homology
 1J7B A;  1F2R I;  5GXG B;  4MAC A;  1T6B X;  1SB3 C;  1DOX A;  2O3G A;  1VZ6 A;  1XLQ A;  2WXR A;  2LEK A;  3NVZ A;  2JWU A;  1C4C A;  4GDK B;  4EE2 A;  4IOI E;  2H88 B;  4US8 A;  1RYJ A;  1VJK A;  1W1L A;  2PLS A;  1KRH A;  4NAM A;  4PYT A;  1XCT L;  3B9J B;  3DWM A;  3BII D;  4JX1 C;  1TJE A;  2KWD A;  4OHJ A;  1JWA D;  1EM7 A;  2BVG A;  2NTS A;  5FXP A;  2ACZ B;  3ZYY X;  3SFD B;  2JSV X;  4XWW A;  5FXF A;  2WXP A;  1ENF A;  3D2J A;  5K8E A;  2WXO A;  1HZ5 A;  5L6F A;  2Y5C A;  2ZW0 A;  3CIR B;  1TKE A;  4M0W A;  3U7Z A;  1F0Z A;  3W9C B;  2NTT A;  2H89 B;  1PGA A;  1FNV A;  4C7Y A;  1Q10 A;  4J3O D;  4ZRP A;  1RWS A;  1JML A;  4L2Y A;  1ZUD 2;  4B0E A;  3TSH A;  2BS3 B;  3CWI A;  4YTP B;  5E6J A;  3P42 A;  2BT6 A;  1AYF A;  1PUT A;  3E9S A;  1FXA A;  1RM6 C;  2BVH A;  1XF5 L;  1T5X D;  2PW9 A;  3AEF B;  5FKA C;  3HVZ A;  3IXS A;  1FFU A;  4BCA A;  5L6G A;  4YXD B;  1J7A A;  1E6E B;  2JXT A;  2IGH A;  2RPV A;  1E10 A;  1JW9 D;  4ZHO A;  2QPM A;  1TKG A;  3TSS A;  3HRD D;  1N62 A;  1K53 A;  4PT5 A;  1KF6 B;  1W1M A;  1SSN A;  5AWV A;  4FXC A;  2NMQ A;  2JZP A;  1EU4 A;  1JRP A;  4HRO A;  4RGN A;  2V3P A;  3W8X A;  1GOZ A;  1DYQ A;  1VR9 A;  1X2H A;  3NVW B;  1OQR A;  3V3X A;  1HSK A;  3W2D A;  4US9 A;  3V05 A;  1C4A A;  2WXF A;  1I4Q A;  1JWU D;  1N5X A;  1QLU A;  3ETR A;  3NS1 A;  3LYY A;  4C56 C;  3Q8F A;  2VFV A;  3NRZ B;  4C7Z A;  2QJL A;  2IJ0 A;  4PVK A;  3KLS X;  3A7R A;  2BS4 B;  3Q69 A;  1UGJ A;  3BYT B;  3I57 A;  4A55 A;  4WWM A;  3U2S C;  1DII A;  4JWU C;  1IGD A;  3DWG C;  3T3N A;  2INN E;  4C80 A;  1JAL A;  5HHD G;  2KDM A;  5HQX A;  1WSP A;  5BMG A;  4LLG M;  1TS5 A;  1WVE A;  2FUG 1;  1BML C;  3FWA A;  3TX1 A;  2AX5 A;  1K50 A;  2P3H A;  2KN4 A;  3BWU D;  2Y08 A;  2N9L A;  4TVW A;  1IUE A;  2OAI A;  2E3T A;  2JX5 A;  1VRA B;  2RDG A;  2LUM A;  1P7F A;  2RDH A;  1ZR6 A;  4ARC A;  3L4P A;  3VR9 B;  4BBY A;  1YN4 A;  1GB1 A;  1AW7 A;  3C0P A;  1WVF A;  3NVY B;  4ZOH B;  4RCO A;  3AN1 A;  2VAO A;  1FEH A;  2AQ1 B;  2WXH A;  1BUI C;  1YQ3 B;  3AE8 B;  4MLA A;  2KAJ A;  1QOB A;  3J9C A;  4HKZ E;  5HI1 A;  3WCQ A;  3URY A;  1V1P A;  1QT9 A;  3FIL A;  4MM3 B;  3VRB B;  4A9A A;  1PGB A;  1SJE D;  1L4D B;  1OFF A;  5I1V A;  1C77 A;  1L4Z B;  2GI9 A;  2R61 A;  4KGT A;  2KAC A;  2IPI A;  3FW7 A;  5G5H B;  2ON8 A;  4H2A A;  1DGJ A;  5I1W A;  3RJA A;  2AQ2 B;  2J53 A;  2SEB D;  1UNS A;  2Y3S A;  2JYT A;  2WXL A;  3UI3 A;  5FK9 C;  1YJI A;  5AUK A;  4AS1 A;  4D2K A;  1SIJ A;  3R07 C;  2GRI A;  4ZRQ A;  4JB1 A;  3W5U B;  3IT6 B;  3EUB 3;  3NVZ B;  3BK2 A;  4OVZ A;  4A90 A;  5C3J B;  3AE4 B;  3VQI A;  4KGS A;  4PWC A;  4ZYS A;  1JRO A;  3R8B A;  2Q4W A;  2IGD A;  1JWB D;  2K9X A;  2LFI A;  3EUB 2;  3AE2 B;  3ZJT A;  3MC0 B;  4PVJ A;  2J4X A;  1SF0 A;  2M0A A;  1MBB A;  2VFR A;  4RF1 A;  4YSX B;  3VTE A;  4TSS A;  1NEK B;  1FFV A;  4NJC A;  3AEC B;  4TQ0 A;  1NI3 A;  1CQV A;  5ADZ A;  3S1C A;  4TMA B;  1YJJ A;  1IGC A;  1T3Q C;  2WDQ B;  1LO5 D;  4BC7 A;  2WU2 B;  2Y4G A;  1CK1 A;  3MP9 A;  1EU3 A;  1DIQ A;  4WUR A;  3ZGZ A;  1QQR A;  1MHH E;  1PGX A;  3EGR A;  2N9K A;  2VFT A;  2PLI A;  1SBB B;  1WXQ A;  5AUI A;  3TEZ A;  1I4G A;  4KKI A;  3HRD C;  3RFZ B;  1T3Q A;  2WQY B;  2G9H D;  1IBX A;  2CJO A;  3AE5 B;  3AEG B;  4XWT A;  5G5G B;  2HTM E;  4BC9 A;  1ZPS A;  3EA6 A;  1K51 A;  2ONQ A;  2YVS A;  2W55 A;  4USA A;  1HZ6 A;  4WQM A;  5D3I B;  3W1S A;  5FR3 A;  1W1S A;  1VLB A;  5AE2 A;  3C8Y A;  1FM0 D;  3AEB B;  1C4P A;  1OQQ A;  2K0P A;  3AE9 B;  2EKI A;  3IAM 1;  1STE A;  3DED A;  1XLN A;  4DXF A;  3ETR B;  2VZK D;  1D5X C;  4JE3 B;  3S1D A;  4GDL B;  1UWX A;  4YWG G;  2V3N A;  1QKZ A;  3U52 E;  1JQ4 A;  1XLO A;  2R8D A;  4RNA A;  5AE3 A;  1W1K A;  3AEE B;  2ZW1 A;  3Q8E A;  1W1O A;  2GB1 A;  2KMM A;  1W1R A;  1TS2 A;  1EWY C;  2J52 A;  2VFU A;  4REZ A;  1WGK A;  2BB6 A;  1C79 A;  4UDU C;  5AE1 A;  2N7J A;  2JU6 X;  1QOG A;  1D4B A;  2WNM A;  1B1Z A;  2WLB A;  2WS3 B;  1AHZ A;  1X2G A;  2M56 B;  4CQN A;  1SE2 A;  2YEP B;  4WAF A;  1I4P A;  3E56 A;  1FCC C;  1MVK A;  4LK0 M;  5EE0 A;  2QKN A;  4XDC A;  1I7H A;  3P63 A;  3O13 A;  1FXI A;  1TZO A;  4PWB A;  1ET9 A;  2W54 A;  2M19 A;  4L23 A;  4ZHP A;  2FE8 A;  1KLG D;  1ESF A;  5LNK 1;  2BS2 B;  1WWT A;  1N63 C;  4UD8 A;  1NYR A;  2RMM A;  2DWQ A;  1FRD A;  1CZP A;  1JWS D;  1AN8 A;  2IGG A;  2DLB A;  2Y3A A;  4YT0 B;  3SR6 A;  1V1P B;  5EE9 A;  2LHD A;  3FIL B;  3R2I A;  1W1J A;  2VFS A;  2P13 A;  3IT4 B;  1MPE A;  1TS4 A;  1E7P B;  4L1B A;  2NQW A;  1M4V A;  5D79 A;  1C9F A;  3FAH A;  4DXG A;  1FD6 A;  1TS3 A;  1L6V A;  1W1Q A;  2GQU A;  2WXI A;  2K3U A;  3D2H A;  2I2Y A;  3B2F A;  1P7E A;  3AM9 A;  2LJI A;  2MJ3 A;  3FW9 A;  3NVV A;  1L0Y B;  3PM9 A;  3LLB A;  1I4R A;  3TEX A;  1WRI A;  2L32 A;  4A8X C;  5MPO A;  1JWM D;  4OZB A;  1V1O A;  1AWD A;  3NUH B;  2WP9 B;  2JQR B;  2VZK B;  1QOA A;  3VRA B;  3TSJ A;  4A6Q A;  4P6V F;  3FC4 A;  1PYW D;  4MT5 A;  2BBC A;  3P4S B;  4R3D A;  3BVM A;  2QIE B;  2P4P A;  3SEB A;  1SEB D;  1K52 A;  4ZOH C;  1UXY A;  2BB5 A;  4B0M A;  2EEL A;  1EWC A;  4IKG A;  5HG2 A;  1E8G A;  2WXJ A;  2IDY A;  1FRR A;  1L0X B;  3OWE B;  4YTM B;  1R7S A;  2YEP F;  3ZJV A;  3D2D A;  1SB3 B;  1N5W C;  1E8F A;  4O1N A;  2BTE A;  3R2T A;  2W3S A;  4NZL B;  1XCQ L;  1BXT A;  1ZXI C;  4JPS A;  4XE0 A;  3AE3 B;  3N9Y C;  4P16 A;  1HQR D;  3W5V B;  3TEW A;  4O95 A;  2WDV B;  1F77 A;  4EC3 A;  1N5W A;  1C76 A;  1KTK A;  2OHF A;  1ZE3 D;  2J42 A;  2WXM A;  3I9V 1;  1ZXH A;  4DQO C;  2AXR A;  4ML8 A;  4PZF A;  1FIQ A;  1ZXI A;  2L52 A;  2WDR B;  1QIL A;  2G1E A;  1TY2 A;  4RFB A;  1ZOY B;  2SAK A;  1PFD A;  1HXY D;  5G5H A;  1ET6 A;  4N59 A;  3ZJU A;  1D6E C;  2Q5W D;  4TVY A;  2MJE A;  3S1F A;  3W8Z A;  2X38 A;  1QOF A;  3KWL A;  1KLU D;  1E0Y A;  5HMR A;  1VQZ A;  1SE4 A;  1L0V B;  2MEK A;  2PKO A;  1SE3 A;  4OZA A;  5HFY A;  1A70 A;  4TQ1 A;  1DZN A;  4MH8 A;  4AQ7 A;  3LB8 C;  3GP7 A;  3LXF A;  4N6E B;  2K22 A;  1N61 C;  4Q2J A;  5I4D A;  2DYO A;  1L6U A;  1XXG A;  1B9R A;  2XN9 C;  4N58 A;  5FXE A;  5TSS A;  3JS8 A;  2K5P A;  1D5Z C;  1RM6 B;  3RPF C;  2DYM A;  3TUO A;  1QLB B;  3P1M A;  2I38 A;  3AMZ A;  2PVO D;  1AHV A;  1N61 A;  2UUU A;  1I19 A;  1FO4 A;  4RGO S;  3NS1 B;  3B2G A;  2TSS A;  2WXQ A;  2FBW B;  1V97 A;  2WU5 B;  4KGR A;  1NYQ A;  2W82 A;  3PO0 A;  5BYQ A;  4HKQ A;  4YSY B;  2W3R A;  1D5M C;  1FFU C;  3AE6 B;  3MFG A;  3B9J A;  3AE7 B;  3GS2 A;  1TYG B;  2Y3R A;  3PQB A;  1ROE A;  3PZ8 A;  1TY0 A;  4OAL A;  2D5G A;  2JYE A;  3U4E G;  3DQ0 A;  1YN3 A;  5H8Y E;  1N62 C;  5BMI A;  2MJD A;  3BK1 A;  1YNT E;  5G5G A;  3Q8A A;  1V8C A;  3GSY A;  4JWS C;  4XDD A;  3HSU A;  2V4I B;  3ABV B;  2GQT A;  2I0K A;  1XEE A;  2QSD A;  3SR6 B;  1YN5 A;  1NVI D;  2BVF A;  2INP E;  3P4Q B;  2KQ4 X;  5T8I A;  2PLP A;  3AED B;  3BYY B;  1YMH E;  3BVZ A;  3FW8 A;  4RH6 A;  2E5A A;  1UUP A;  4JAY A;  2MH7 A;  1GB4 A;  3BW7 A;  5D7G A;  2CU3 A;  2RK5 A;  3BZD B;  4ITK A;  1HA5 A;  5HHZ A;  3NVV B;  1ZDX A;  1F2R C;  3TEY A;  2QMT A;  1F0X A;  1E9M A;  1RFK A;  3BVG A;  4HEA 1;  4YTN B;  5EE3 A;  1N63 A;  5BMH A;  3KJM A;  3S1E A;  1XO3 A;  3NVW A;  1KH0 A;  4LTU A;  4WH4 A;  2IPK D;  2N0S B;  4WIP A;  5BYR A;  1WYG A;  1AHU A;  3AH7 A;  3HVD A;  3NRZ A;  1C78 A;  1I4H A;  1CJE A;  3AB5 A;  2WDW A;  1E0Z A;  2HDE A;  2V0G A;  1DOI A;  1GAQ B;  2AQ3 B;  2PIA A;  2PMV A;  3MHZ A;  2L1A A;  2EXR A;  3Q8B A;  4OZC A;  1N60 C;  1SXT A;  1FCL A;  1JCK B;  1GPX A;  1L5P A;  2PTL A;  1VAO A;  3IAS 1;  4ARI A;  5EE1 A;  3T3O A;  1KFY B;  1ZDV A;  2Y5P A;  4NAW B;  1MHX A;  2BW2 A;  3A7U A;  3PZ7 A;  3W8W A;  1N60 A;  5FXD A;  3A7A A;  2Q85 A;  3P4R B;  1Y56 A;  3AV8 A;  4RGT A;  4HJG E;  2ICI A;  5BYS A;  2E6X A;  5C2T B;  2DBY A;  1TKY A;  4KKJ A;  1MBT A;  4KX6 B;  3P4P B;  1SJH D;  3SFE B;  2XNA C;  3VR8 B;  5JXV A;  3HUI A;  1FIQ B;  4OW0 A;  4RGM A;  3AE1 B;  1QLT A;  4PVE A;  4GLS C;  3POP A;  1IBX B;  3NVY A;  1YQ4 B;  2LGI A;  2Z8L A;  3Q8C A;  1FMA D;  2QEJ C;  1MI0 A;  2BYT A;  2MBR A;  3AEA B;  1VZ7 A;  2WXN A;  3RJ8 A;  1FNU A;  2UUV A;  2PVG C;  2WXG A;  3LAE A;  1FNW A;  3H8H A;  3ZQ4 A;  2WXK A;  4PVH A;  2LHE A;  2B76 B;  1ACC A;  1XLP A;  1HEZ E;  5H92 C;  2L83 A;  1FFV C;  1UWM A;  3KWV A;  3I99 A;  2CJN A;  2LMC A;  2QIL A;  1ZP0 B;  1I4X A;  2OED A;  1VZ8 A;  3NZ3 A;  5D3D A;  4IDI A;  4HRS A;  4RF0 A;  3GB1 A;  3MJ5 A;  3KQ4 A;  4DNS A;  4YSZ B;  1E8H A;  1NEN B;  1VDV A;  4XLO A;  1PDX A;  1QF6 A;  2R2Z A;  1DOY A;  4HG0 A;  1J7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...