2W55A

Crystal structure of xanthine dehydrogenase (e232q variant) from rhodobacter capsulatus in complex with hypoxanthine
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE DEHYDROGENASE
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 114
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w55A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w55A01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w55A03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w55A05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w55A04
3AV8A 4XLOA 3NRZB 4PVEA 3B9JB 3W5VB 2E3TA 2W3RA 1YJJA 4TVWA 3ETRB 1N5WC 1QLBB 3P4RB 4PWBA 2W55A 5EE0A 4BC7A 3LLBA 4PVHA 1QOFA 1N5XA 4BC9A 4A9AA 1L0VB 2AX5A 1ZP0B 3HRDC 3NS1B 1ZOYB 2PVGC 5FXEA 1TYGB 2LEKA 3DWMA 3JS8A 3P4PB 1FM0D 3ZYYX 3FAHA 3B2GA 3DWGC 1VLBA 1WVEA 4USAA 1I7HA 4YTPB 1AHUA 4JB1A 4EC3A 2PVOD 4ML8A 1YJIA 1FXAA 1QOGA 5H8YE 2H89B 1PDXA 1N60C 2WU5B 1FFVA 3AE6B 4DNSA 1T3QC 2BT6A 2BVGA 5FXFA 1F0XA 2BVFA 2VAOA 3AEGB 2I0KA 3W8ZA 4C7ZA 3FWAA 1W1LA 3SFEB 2Q4WA 4PZFA 1E0YA 1QLUA 2HTME 3AE3B 1A70A 1RYJA 1DGJA 3HRDD 4US8A 3AEBB 2QKNA 3AM9A 5AE3A 1SF0A 1W1MA 1L6UA 2QJLA 3AEEB 5G5HA 5G5GA 2O3GA 1DOYA 1JROA 1FRDA 2VFVA 3VR9B 1I19A 2W3SA 1YQ3B 3W8WA 5AE1A 2KMMA 1TKEA 1V8CA 2JX5A 1W1RA 2OHFA 1KF6B 1FO4A 3A7RA 3KWLA 1MBBA 1YQ4B 4YSZB 3PO0A 1OQRA 1TKYA 3W8XA 4C7YA 4HG0A 3NVZA 2L83A 3AEAB 2CJOA 2KAJA 4UD8A 3FW8A 3AE5B 1UXYA 2MJDA 1TJEA 2EXRA 1XO3A 1ZXIA 1N63A 1GPXA 2AXRA 1WWTA 3AE1B 1WGKA 1N62A 3AE2B 1OQQA 5EE1A 3VTEA 1NENB 3NVVA 4ZHOA 5FXPA 2WU2B 4YSYB 5HMRA 3S1EA 3NVYA 3BW7A 1FIQB 2L52A 3A7AA 2P4PA 5AUIA 2NQWA 5AE2A 1E0ZA 2VFUA 1RWSA 1B9RA 5C3JB 1NEKB 1DOXA 2E5AA 2ACZB 1QOBA 1XLNA 2R8DA 5D79A 4JX1C 4N59A 4TVYA 3D2JA 3GSYA 3AH7A 5HHZA 1QF6A 5GXGB 2WS3B 3D2DA 3HVZA 4MLAA 2W54A 2VFRA 3NVWA 3DEDA 1SIJA 1VJKA 3AB5A 1R7SA 2K22A 1N61A 2Y5CA 3PM9A 3AEDB 1FFVC 1DIIA 1FXIA 3AE4B 1W1KA 4OALA 4O95A 1L5PA 2BS2B 4WQMA 2PLSA 3VRBB 2WLBA 1J7AA 1IUEA 2K5PA 1OFFA 3AN1A 2H88B 3VRAB 4N58A 4IDIA 1FRRA 1ZUD2 1GAQB 2WDVB 3EUB3 3S1DA 1CZPA 3S1FA 2MBRA 1DOIA 3KJMA 3AECB 4KX6B 2PLIA 1JWAD 2OAIA 3WCQA 2GQTA 3R07C 3SR6A 1AHVA 3NRZA 3CIRB 1NYRA 4BBYA 3B9JA 4US9A 3ETRA 2BS4B 1FFUA 2MH7A 3TSJA 1AWDA 4JWSC 2MJ3A 4C80A 5G5HB 1CJEA 3B2FA 2BVHA 1JALA 5G5GB 1FMAD 3AMZA 2R2ZA 3BIID 2FBWB 2PIAA 2WDQB 4PYTA 1XLPA 3NS1A 1UWMA 1ROEA 1N5WA 5MPOA 1QLTA 2CJNA 1DIQA 5AUKA 1X2GA 3W9CB 1MBTA 1W1OA 2MJEA 1N63C 1ZXIC 4LTUA 3FW7A 1NI3A 3SR6B 4ZOHB 3P4QB 1N62C 1NVID 4BCAA 4FXCA 1ZR6A 2CU3A 3S1CA 1KFYB 1V97A 1SB3C 2VFTA 3NVZB 4PVJA 1QOAA 3HUIA 1W1SA 5EE3A 2K9XA 1XLQA 1XLOA 2M56B 1E10A 4YTMB 2QIEB 3FW9A 2WQYB 1SB3B 1NYQA 2BS3B 1E8FA 1N60A 3NVVB 3AE9B 1WRIA 5FXDA 1JWBD 2DWQA 2EKIA 3CWIA 3TX1A 2G1EA 1AYFA 1T3QA 4ITKA 3AE8B 4JAYA 3NVYB 3AEFB 2DBYA 3I99A 1VDVA 1WVFA 4N6EB 2VFSA 1PUTA 3LXFA 3AE7B 2WDRB 1EWYC 1J7BA 4ZHPA 1X2HA 1JW9D 3L4PA 1TKGA 4YXDB 1WXQA 1HSKA 5ADZA 3P4SB 2QPMA 5HQXA 1E8GA 1KRHA 3C0PA 2RK5A 1N61C 1JRPA 1J7CA 2M19A 4PVKA 4YSXB 3LB8C 3P63A 2WP9B 3D2HA 3FC4A 1L6VA 3NVWB 4WWMA 3LAEA 3SFDB 2P13A 4HROA 1WYGA 3A7UA 1RFKA 3TSHA 3W5UB 2PKOA 4HRSA 1VQZA 3DQ0A 1VAOA 2GQUA 1E9MA 1DZNA 2JQRB 3P1MA 1E8HA 1W1QA 1RM6C 5H92C 3RPFC 1QT9A 1E6EB 1AHZA 2Q5WD 1JQ4A 1F0ZA 2N0SB 3VR8B 1E7PB 5C2TB 4PWCA 3ABVB 3EUB2 1W1JA 4YTNB 4ZOHC 1RM6B 1PFDA 1FIQA 2Q85A 4JWUC 4YT0B 2YVSA 2P3HA 1FFUC 2B76B 4P6VF 5EE9A
chains in the Genus database with same CATH superfamily
2KDIA 1RYUA 4R66A 4DXGA 3UJSA 5AEKB 4P2HA 9ICTA 3PV8A 4GISA 2KLGA 3IG3A 5D4BA 2QDFA 2WDTB 3C2KA 3ZXRA 3HP6A 3V72A 2DNFA 2AKZA 3IJIA 3N4FA 3Q8PB 3RULA 2W3RA 2LHDA 4GU2A 3FXGA 4ECQA 2O6VA 1RQLA 2JGAA 4IQWA 3MBYA 4KLQA 2D3AA 3ETRB 3R10A 2WOVA 4C8MA 3P4RB 3APFA 2WB1F 4NZLB 4PWBA 2EQ6A 2KLCA 1LO5D 2WF7A 3H70A 5CA7A 3HHMA 3LLBA 5HR7A 2R8HA 4BC9A 4Y2TA 2KSOB 3DEQA 3SV3A 1L3UA 2X50A 5AKZA 2KJ8A 2LKYA 4DQRA 4H4SA 5I1VA 2LHEA 4LJOB 4EZKA 3N7RC 3MUCA 5FS8A 2HDOA 2AX5A 1F3PA 1NHQA 2NCNA 8ICPA 3R8BA 1J8CA 3UMGA 3HRDC 2HDEA 1ZQ1C 2KKVA 8ICGA 1EBGA 5CX3A 4ECTA 1QZEA 2KJ6A 2PVGC 2L76A 4H4UA 5ENLA 3OJ4B 1ZQLA 4APNA 2QB1A 2PU1A 1ZPSA 3VUXA 4GDLA 2MWSB 3IG5A 2RRDA 3ZYYX 4QW9A 1FXTB 4JL9A 2JEGA 2YB4A 2JVCA 3U2SC 3HIZA 2QEJC 4USAA 3FG2P 4DQPA 3EJEB 3A4SC 2POZA 4YTPB 2IO2B 4EC3A 4ML8A 3C21A 3TJIA 1EUVB 3T5JA 1QOGA 5AK6A 7ICOA 2REXA 4B9MA 3CSTA 4KEMA 1N60C 4F7ZA 4EM4A 4HYRA 2DYMA 4NQLB 3WK9A 1UA1A 2WU5B 5J2JA 3AE6B 5CHWA 2HW3A 3Q8MA 4RH6A 2EANA 4Q43A 5DPSA 8ICYA 4NAWB 2VAOA 3O13A 1GERA 2HVIA 1DRGA 3RAQA 1PYWD 2X38A 3JSVB 5G2NA 2BYFA 5BMHA 2QDDA 3WAOA 2M0NA 3WK8A 3QXGA 2G07A 2JRHA 2I1JA 3RNEC 2WP5A 3H7IA 5J0UA 3LXDA 1F44A 1XHCA 3SBFA 1SV4A 1TE6A 2W7PA 1ZQMA 5KNIA 2KVZA 4BKTA 2GMIC 2AWTA 2YX8A 1C4AA 4M8MA 5J2GA 1RYJA 4EBEA 1DGJA 2QLTA 1L4DB 4DBGA 3DG7A 2JT4B 5U1OA 1E8YA 4QZEA 1IG6A 4DLEA 3NJTA 3EANA 3AM9A 1MQ3A 4A3PA 3VFKA 3IVFA 5ALWA 3OHBA 2ZCCA 4GOCA 2TPRA 4MF8A 2OXOA 2Y1JA 3QX1A 1R4NI 2TSSA 3ZVHA 2KWVB 2KZ3A 1R4MB 4MJSA 2WPEA 3Q69A 2L8JA 4K1RB 3U4FA 2HHQA 3QK0A 1T0YA 5DKWA 4O0IA 1JRUA 2EQ9A 4DOCA 4BDPA 2YMPA 4I28A 3TWBA 3T3NA 1WIAA 1GV4A 4NJ6A 1DOYA 2RD0A 3C2LA 2L3ZA 2OLAA 5J2BA 2AGOA 1B22A 4YWGG 3WU2U 2KHWB 3GP7A 3WKCA 3VR9B 5C1ZA 1NHPA 3W8WA 5CHGA 3M6KA 2KTQA 1GC7A 5J2HA 2KMMA 1P3QU 2A5UA 3BQ7A 4LJXA 1W1RA 1NELA 3SV4A 3WK4A 2DKZA 2YMLA 2OHFA 1RYSA 8ICHA 1P7EA 2P35A 2A3VA 1UD7A 1R0MA 3DG3A 2MA9B 4DN1A 3BVMA 3MZNA 3D6JA 4RGNA 4KT2A 1GJZA 3EFUA 3UQBA 3P93A 1HXYD 2F76X 1OQRA 3PHWB 2WXQA 3TJPA 3W8XA 3R3MA 4QJFB 1P98A 3NVZA 3MR5A 1WH3A 3O0FA 1WYWB 3E9SA 2JUOA 5DBBA 2KAJA 2CHRA 9ICEA 4UD8A 5HHIA 3FW8A 5HR6A 5KFVA 2XC9A 4U6PA 3AE5B 3OJ3A 4NEVA 5GRTA 3PR4A 4KLGA 1WJ4A 3PTFC 3TADC 3ML8A 1KD0A 3JW7A 3MGIA 8ICQA 2L32A 2RR9A 2Z0EB 5JCMA 1ZXIA 4BZAA 1F0MA 5HMMA 2ZIXA 1T3NA 3N28A 1NJXA 3AE1B 3B0AA 1O08A 2KD0A 3GB1A 4DSIA 4QAYA 4D2KA 1G6JA 4JDRA 5FS9A 4P0PB 2D3CA 2AKMA 4FO6A 4E4UA 3MR3A 2CXYA 3HWTA 5KFTA 1BQGA 3KLSX 4RQ4A 2GR1A 1QQ7A 3NVVA 2BZFA 1T7PA 8ICZA 4LNIA 5KT2A 4ZHOA 1X42A 1PUZA 1EO6A 5BOFA 5KT6A 2KFKA 2KNBA 4C4SA 3OTQA 4PK1A 3SQIA 4J6IA 1ZMDA 3GIKA 2MBBB 4GDKA 4MGYE 1ZQKA 4EKUA 1YX6B 3DGBA 5KG6A 5AK3A 4Y2PA 1YOVB 4KPRA 2MP2B 9ICVA 4M6WB 4KLUA 2L52A 2RGFA 3CT2A 3PGEA 3SJNA 2WXHA 5FKAC 5D2MB 3BQTA 3PWGA 4EQWA 4MHVA 4HCDA 1ZRMA 3WK7A 2GSHA 1KLVA 5AE2A 1E0ZA 3GD4A 2E5SA 1NJYA 4AOFA 3I63C 2MBOA 4RF1A 2FLLA 3VDZA 2C7MB 5J29A 4KGRA 4JB3A 1TS5A 3NZSA 2Y0SC 1D8LA 1IGCA 3DOWA 1WWUA 5KFFA 2ZPNA 1SSNA 4RNOA 4GGBA 3UXNA 1NKCA 3LDZE 2K3UA 2R8DA 1JWMD 2KX3A 4JWMA 4XDCA 2RDGA 5LLIA 3RB0A 2KWDA 3L5OA 4DFDA 1U49A 3FVDA 5GXGB 4L2YA 2MLBA 2N9LA 5D6JB 1OGWA 1H2IA 3SMVA 4QZCA 2WS3B 3H8MA 5D3IB 2R8KA 2QVHA 5CHFA 2RMMA 5A0LA 2XY6A 1V80A 1IBXA 3TJ4A 4Y2UA 1JIHA 4GXIA 4C0ZA 5KT4A 3ZDEA 2C3CA 2PMQA 3OPXA 1VJKA 2G08A 3BS5A 1X9MA 2OG9A 1GUAB 2LD9A 4IW0A 3V6KA 1WX7A 1LV5A 4M9NA 4H4WA 3RRAA 3B1LX 5KFMA 8ICVA 2OPJA 4EMIA 5KVHA 5KFDA 2ZXIA 2PJHA 2RPVA 3AE4B 2W9NA 2JRIB 2BS2B 4P0QA 2Y3RA 1WCLA 5KFIA 1NPXA 2P0IA 2N7JA 2AYOB 3KWVA 1V49A 4HNCA 1D5ZC 3BOXA 2WLBA 3MGHA 4RGTA 1UWXA 2LGYA 1J7AA 2FE8A 4F91B 3SN4A 2IGGA 4DFMA 1ZMCA 3QKEA 2K6QA 1XCQL 1QQRA 1UGMA 2BKEA 4I6PA 1X1MA 4HDQA 2O2VB 3DHGC 4X57B 2YVGA 4A6QA 3CXOA 3L54A 4IDIA 4M8NA 3QUQA 2BB6A 4M52A 5FS6A 3U26A 1U47A 5JCNA 8ICBA 2EAMA 3Q3MC 3IHPC 1E8WA 3T9PA 1HJPA 4II2B 3EUB3 3S1DA 3RI7C 4PL2A 5HHHA 4H4QA 1ET6A 4KMOB 3VDGA 1ZQRA 1ECWA 3SAGA 4F71A 5KG2A 5DB7A 4ED1A 3S1FA 3HSUA 4YXMA 2JH7A 1DOIA 2BYEA 1KLUD 4KX5A 4Y2RA 3KJMA 4OJLA 4MF2A 1E8ZA 2R2QA 4DLGA 1CK1A 2JWZA 2PLIA 2BDUA 2ESEA 3QFBA 5B5EU 4E5TA 1ZQGA 3WCQA 2UUUA 1MFWA 2PEAA 2IHMA 3SR6A 4R8UB 3RAXA 4DNAA 4R64A 1GRHA 1NYRA 4QZDA 2V6OA 2AL1A 3V4BA 3V3WA 4FJZA 3WKBA 3K75D 3ETRA 2XSXA 2ZPYA 2I9GA 2G3QB 1KM7A 5AKIA 2BWES 2MH7A 8ICKA 2I1QA 3CSFA 4KSLC 1AWDA 1XU4A 4GGHA 2LBOA 5KG5A 1D4BA 3KH0A 2BBCA 1XPYA 1Q10A 2D6FC 2PTWA 4L1BA 2KSOA 4GLXA 2FIDA 1UHUA 4RPZA 1ZGUB 2DPIA 2PIAA 1YEYA 4OD0A 2IO1B 5JZEB 2BKRB 4OVUA 3FYHA 1LPFA 3ZVIA 1PVPA 3SN1A 5KVIA 2AQ4A 4H83A 3LVWA 3UQ0A 4UB3A 3IXSA 3Q8SB 2M4NA 1Q46A 3RJHA 5MPOA 3MR2A 4KDIC 3KOOA 2CJNA 2PMZC 2C2EA 1T8EA 3AI5A 2JH1A 2DW6A 2HI0A 4BBNF 1TKKA 3QWZB 8ICUA 1MBTA 4C00A 1W1OA 1ONEA 1UCVA 4LDTB 1Q1WA 2PTYA 2VIXA 3DIPA 1COOA 4LTUA 2LGXA 1ZJNA 3D2QA 3R0UA 2GWSA 3DBSA 2JK6A 1KTKA 4E6MA 3IP4B 1UUPA 5ALEA 1SB3C 2GOWA 7ICUA 4LVSA 3JPNA 2FCSA 3L17A 3UJRA 3TAPA 4MFCA 2ASQA 2EKEC 4PJ0U 5ALSA 7ICTA 2RDIA 2QKQA 4ECRA 1XLQA 3PZ7A 4GB9A 4XWTA 1C4PA 3D9XA 5KT5A 4F92B 4NAWA 1SWVA 5AKGA 3N4MB 1WXMA 3JSVA 3B08A 2GO7A 3PW7A 3JVZX 1XS2A 2J42A 2QIEB 2WFAA 1SB3B 3TBLD 2HZGA 3N6HA 3ZIMA 1N60A 4L23A 3TUOA 3WAPA 2ALZA 4KPLA 5DG9A 2EKIA 2MRLA 2UVVA 1WUEA 4E74A 2KX0A 1AYFA 2RDXA 3DVGY 1IPGA 4ITKA 4J9NA 4F2SA 4A3RA 5K8EA 3PMLA 3NVYB 1JPDX 4DWIA 3CK5A 2J0MA 4XYCA 4GIVA 1ZQTA 1FD6A 2IY0B 3I99A 4BWMA 4M9JA 2JZZA 4N6EB 2VFSA 2R18A 2OO6A 4QZHA 1XNSA 4QZBA 1VZ7A 4F50A 3R9KA 4RNMA 3R7QA 1GOZA 2ZXHA 1TE2A 1EWYC 4UB4A 4NJCA 2YEPB 1J7BA 1JW9D 3M1YA 3L4PA 3BJYA 1SKRA 1Q0WB 4YXDB 3AXCA 1AW7A 2KMAA 5L6GA 3GRSA 3Q14C 4DXFA 4YD1A 4MDKE 4H1ZA 4NWIA 4K7ZA 3QX7A 2HHVA 2WXGA 2CHZA 4KKJA 5ADZA 4XGAB 3V7LA 2QPMA 3H8SA 4RPYA 1E8GA 3M63B 5HQXA 3ETLA 5TSSA 1NU5A 3T9LA 4Q2JA 3II4A 1HUOA 2VJ4A 1URJA 1N61C 4Y2VA 2PXIA 2M19A 4J9QA 1TZZA 7ICFA 4DQOC 1MPEA 1EWCA 4YSXB 2JZ3B 3PSPA 2E8PA 2KVSA 4DL5A 2MBQA 2WP9B 3NHEB 4A8XC 2PTLA 2XH4A 3FC4A 5ALLA 4DFPA 1ZQSA 5L1MA 3M8RA 4KN7A 8ICNA 1ISNA 3NZUA 3U30A 3ALBA 2AU0A 2ZADA 3CYJA 3BVZA 4JIOU 1XANA 2OJWA 1SE3A 2YTUA 1KBUA 1U45A 2VZKB 2WXPA 4WWMA 1BPEA 3SFDB 4ANVA 3VH4B 4I2EA 2WXKA 2W8KA 2BGWA 2AH5A 1TY0A 5L6FA 3QZ7A 3EHVA 1XS9D 4A6GA 3A7UA 1PQSA 3IFWB 1L7MA 3W5UB 4NL9C 1M4VA 8ICCA 5DGBA 3LWMA 4RQ8A 3NS8A 4HRSA 1VAOA 3DQ0A 1VQZA 2YAUA 3V5FA 3ZQ4A 3UGVA 1RDFA 4CGZA 4UAUA 3UMCA 3H40A 1E9MA 4RQMA 2XGPA 1GESA 2K60A 2PTXA 2NO5A 5KFZA 3VQIA 3OHAA 3QN3A 3OZYA 2A1JB 3C5GA 4IWOA 4P0PA 3QUTA 4ARIA 4LNOA 4NLKA 2VRRB 4ZCWA 2XK5B 3BYTB 1QT9A 1KEJA 3W1YA 2H3IA 4UDUC 3KHHA 4ZH4A 9ICLA 1SEBD 2XIDA 3NZGA 1Z4NA 3ZRCA 1VJ5A 1JQ4A 2N0SB 2HHXA 2LYAA 4OVZA 5DDYA 3TADA 5AZHA 4ZOHC 2F8LA 1FNUA 9ICKA 4ECUA 4OZAA 1NKEA 2GI9A 4ZRQA 1PFDA 1CRXA 3Q45A 1MRAA 2MP2A 5JUMA 4G11A 4M6WA 3ZW3A 2AL2B 3Q6JA 2HSZA 4OHJA 2EAOA 4Q8EA 3EFCA 2ZIVB 2ZG6A 2UVRA 1UBIA 4AUQC 2MSED 5KFOA 3KD3A 1AROP 5IIOA 2DZIA 1A77A 5TR5A 2XBBC 2FI1A 4ZRPA 3EGRA 1ED1A 4G7FA 4JQWC 3CYMA 4B0MA 3IDWA 2MU2A 3FCPA 1S8OA 3PRZA 1GXFA 4I2AA 2OEDA 2IZVB 3GIIA 1K1SA 1GRTA 2NBUA 3VAWA 4EX6A 1KOTA 3QNMA 1WGYA 3GIJA 3GOEA 2MNRA 2IA6A 2D07B 4E71A 4KGTA 1N5XA 4A9AA 3IHQB 3QA8A 1U4BA 3ZO5B 3BQ1A 1SXDA 2KOXA 2F1IA 5J0OA 3SI8A 1L0VB 2WXLA 2HQMA 3UXKA 3C2MA 2NPXA 2E8NA 1STZA 2PP0A 2JZPA 4IT1A 4XWWA 4CF5A 9ICUA 1ZOYB 4K7UA 4BJQA 4BURA 2XH7A 1AARA 4K1WA 2LJIA 3QZ8A 1TYGB 4G0NB 3H0MB 2AJQA 2LEKA 4GRTA 3PO4A 4Y2QA 2EQYA 3TACB 3U9IA 3TARA 1X9SA 3H0RB 2RHFA 2N7EA 4Z6EA 4CDGA 1FM0D 2WYQA 4ICVA 3DWGC 5CP2A 2CDUA 3PSTA 4H50A 2KQ4X 1I7HA 2NQLA 2KDBA 2K39A 1YT3A 3Q8CA 3RB3A 2H3FA 5KFKA 3URHA 4J3OD 2JXTA 3RT3B 2G0AA 5FJRA 3UJEA 1ZOLA 2WP6A 4EMWA 2O2VA 1FCLA 2N7DA 4WAFA 3OJSA 3C19A 3WKEA 3V5CA 4IP5A 1BZLA 1Q1RA 4DHGA 1SXTA 1F9JA 3IJQA 3RFZB 3R66C 1ZQAA 4AJWA 2BT6A 3F5EA 4UBBA 1TK8A 4NAMA 4M47A 4RGOS 2R8JA 1A5RA 1F0XA 4F4YA 2F2AB 1D9DA 1JXLA 1WWVA 3AEGB 1UT5A 3TI0A 5T14A 3VH3B 2I0KA 2GBNA 4C7ZA 2WGSA 2Y9UA 3M6ZA 1YX5B 2KYWA 1QLNA 2BTEA 1KSPA 3HILA 2JEJA 3HM3A 3ES8A 1IM4A 2XY7A 1S0NA 2Q4WA 2E8MA 4C56C 1E0YA 9ICPA 1QLUA 4ECVA 1DNCA 3OZMA 1UPHA 4G3XB 1TIFA 5AKEA 3WALA 4FA6A 1A70A 3BQ2A 2GDQA 5C23A 3DERA 2Y9TA 1D9FA 1V86A 2L00B 4W9KA 3DESA 3PG6A 4KLDA 4IRCA 2L5YA 1LM8B 4H4TA 4IQTA 4R8UA 2W7OA 1YZ7A 1UA0A 2RDBC 3U4EG 2QILA 4ACFA 3ZDMC 2HCFA 2N9XA 3MY9A 5AE3A 4ED8A 4MFAA 3H7SA 2OZTA 1L7YA 3X23A 2NRVA 1S9FA 2PP1A 2WF6A 3RJGA 4I27A 2ZCBA 3RN9C 4LIIA 4MH8A 3ZTDA 1C76A 2W43A 1X2IA 4UASA 1ZDXA 8ICXA 3I57A 2KV2A 2KN4A 1E5WA 1Z2MA 2KEYA 4MSMB 1SGGA 2DENB 2UYZB 3HT3A 2O3GA 3LYYA 3DGHA 3K1RB 4HVBA 2P3ZA 4EEKA 1JROA 2ISPA 1FRDA 2VFVA 4NLNA 4RNAA 2ASLA 5CEHA 4HWIB 4M00A 3TFRA 1I4XA 2W3SA 1YQ3B 4DS4A 3W2DA 4DF4A 2GOLA 1TK0A 3H8HA 2JX5A 5KFQA 1WZ3A 4Y2JA 2V4LA 2KXJA 3Q3OC 5ALVA 5J0TA 1KF6B 1WMHA 4ED7A 1WGDA 3ISBA 1AN8A 3RNCC 3UJ2A 2OKTA 4W9IA 4KLTA 2K8AA 4DL7A 4HNLA 4FHKA 4BVUC 3KWLA 2LI5A 3GZNI 1JUDA 1ZQXA 2KICA 5AIBA 3DDMA 1RLFA 2DF4B 3VCCA 1S3SG 3N4EA 3N7PD 2NRTA 2WNMA 1TKYA 4Q8FA 4C7YA 4YN4A 4HG0A 2LGIA 7ICKA 1ENFA 4CHKA 5F9LA 4DL4A 4JV1A 2L83A 4BOSC 4A90A 1T0RC 2YQUA 2EZXA 3GQCA 2PFOA 2NBWB 1UXYA 5HP4A 2ASJA 2AGQA 1TJEA 1WXVA 1YN5A 2MJDA 3I3TB 1RAXA 3MC9A 3T6CA 1XO3A 1GPXA 4KLMA 3F2CA 5DPWA 2AXRA 2GR2A 3SHQA 3PV1A 2R9ZA 2RP5A 5TR3A 2HOIA 5ALFA 7ICSA 3IT6B 2JHDA 3QU4A 3AE2B 2PW9A 3G6VA 1Z00B 1L7NA 5HFYA 2GGIA 1OQQA 5JCLA 2BB5A 3DK8A 1PDZA 4OW0A 3Q3JA 3TWAA 2RABA 5FXPA 2A19A 1K53A 4J9RA 4J03A 4GYPC 3P3BA 1HZ5A 1QQ5A 1NDDA 9ICRA 2JU6X 1IV8A 2G4SA 4PHPA 4WAAA 4YSYB 3RNBC 4KWSA 3EJBB 1TAMA 4TV3A 5DB8A 2PS2A 4K2SA 3NVYA 1C78A 2ZZ0A 4ED0A 4RGMA 3BW7A 2DZKA 4HPLB 3QHTA 1Z3EB 1XO0A 7ICNA 2V3SA 2XN9C 4I6LB 3RMKC 4YP3A 3WANA 2HHUA 2DZJA 3H4DA 1V1PA 3TQPA 2KD1A 2G06A 1B4FA 4BFRA 3GV5B 4I2CA 2ODGA 3N32A 4I2IA 5JXVA 5FJOA 5AUIA 4FE3A 3PPAA 3ZLZA 2VFUA 2GR3A 3QTPA 2WAQF 1KQQA 3QLDA 1X6JA 4B9VA 4M9LA 1RWSA 2MBEA 1MN8A 2WHEA 1V9JA 2JXXA 3L3FX 2PFPA 1B9RA 4F8CB 5C3JB 1NEKB 4UATA 1L3SA 2ZUCA 4KLFA 1WX9A 4YR0A 3DFYA 3SSZA 1MHXA 4NJ8A 3TANA 3SEBA 1P43A 3MC0B 3Q8RB 2N4FA 4LA1A 1CMXB 3UQAA 1D5MC 2R2OA 4JX1C 8ICTA 4N59A 2DL0A 5D79A 4J57A 4TVYA 5DDMA 5HHZA 1NZPA 3DBRI 2K8CB 2QARB 2NMQA 2C3DA 3EZ5A 4J9SA 4PYUA 3V6CB 1BPYA 2DYBA 3HVZA 1D8BA 3FV9A 4HXDA 2IDYA 3DJJA 3HK0A 1TBEA 2GGGA 5HI1A 3RH5A 1P9DU 3IAS1 3QEBZ 5KAIU 1Q3VA 2ZZPB 2V0GA 1KKXA 3S2AA 1R7SA 4XX5A 2K22A 1N61A 2VH1A 4KLLA 4DHZB 4F4RA 3DJGX 3ZJTA 2LUEA 3U8ZA 1BXTA 3A9KB 3AEDB 1PZNA 4MEMA 5TISU 4A20A 5IN7A 3PM9A 3A0HU 1NKBA 4O95A 1VR9A 3NZ3A 3DK4A 2ES6A 2C22A 3Q8KA 2WF8A 3GZFA 2OH2A 4WJNA 4H2HA 3PLVA 3QUCA 4EENA 4GXKA 2XEWA 4H2AA 2HTHA 3RH6A 4NQKE 1IUEA 5J0RA 4P7IA 3TQ1A 2A1JA 2K5PA 2DLBA 4M9HA 3VUWA 4DHJD 5I1WA 7ICPA 4OJPA 3POPA 3NOBA 2BQUA 3JW0X 2XK5A 5KTQA 3ONSA 4CQNA 2H88B 2GBMA 2G5HB 3NFUA 3T79A 3OSPA 1ZRNA 4NL9A 1ZUD2 3DK9A 1ZQVA 4HPNA 2AQ2B 1K1QA 5EWFA 1GAQB 5KHQA 2GL5A 3MABA 1MG4A 4ANWA 2D11A 2FNJB 2Y3SA 2QMTA 2I1KA 1CZPA 3H9DA 1A76A 2ZVNA 2NYVA 5KG1A 1NK7A 2D5GA 2AL2A 2VA3A 2KDMA 5CTRC 2NRWA 2I6XA 1TKDA 4LNKA 2ZIVA 4IKGA 1T5XD 4C4TA 2F1JA 3AEVA 3GY1A 1HIWA 4RUAA 1ZDVA 4KX6B 2P8BA 4W9CA 4FI4A 3NUHB 1XWLA 2GBRA 4K8DA 5L1IA 1JWAD 4I29A 2OAIA 4F4KA 3RJIA 1F9CA 4IL0A 2VH2A 2GR0A 1A0PA 4RQ7A 1AHVA 4IM2A 3GV7B 2XH0A 4DSFA 3SQPA 1JEHA 4AYBC 1RRBA 5KFNA 3GFKB 1HTQA 2FE9A 2BS4B 2OYYA 9ICMA 5J2IA 8ICIA 5D94A 3ZVVA 1ZQWA 4G50A 5G5HB 1BPZA 5F9NA 1JALA 5G5GB 2IOHA 3L8KA 3AMZA 1FEZA 1Z4OA 3UM9A 4BX9C 2DPJA 1WSPA 4Z6FA 4JV2A 4JUZA 4KN4A 2KOBA 3WKDA 5EWEA 2NTTA 4EZJA 2KT7A 1LXDA 1VZ6A 5KG0A 4PYTA 3RCYA 3H6NA 4KLEA 2ZJDA 4NLZA 4MGIE 9ICAA 1BNPA 1F2RI 1QLTA 3SZ2A 3C0RB 1RQNA 2KNJA 3TTEA 2WXFA 2F5ZA 1OW5A 3VA8A 2H3VA 3PRPB 5KFEA 1KFTA 1N63C 4DXAB 3SU8X 1GETA 5AKKA 2OM6A 1J0GA 2KIVA 1EBDA 3P4QB 2J0JA 4C8LA 2FJ6A 2IPKD 1S5LU 3K9PB 3PSIA 2WXRA 9ICFA 5GTIU 2KJHB 4FXCA 2BCVA 4EZLA 1ZR6A 1V97A 3JPTA 2OQYA 3JVAA 3APDA 4IUMB 5KFWA 2ZUBA 3RB4A 2VFTA 2W04A 3RITA 1QOAA 1WR1A 3KW5B 5AM5A 2KMCA 2E8OA 5AKHA 1W1SA 1YD8U 4OJOA 5EE3A 5AM3A 2Y08A 3DBHI 1L4ZB 4MGKE 5BMGA 1KFDA 3TEWA 3ZJVA 5IDZA 1ZQUA 5KFHA 3Q8FA 1Q5WB 5KFXA 3V60A 4AQ7A 1EC8A 1WCNA 3STPA 2ONEA 3C8YA 4MMWA 3SQSA 2N1WA 4MEXA 4DSEA 5E6JA 2WQYB 3FW9A 1GB1A 2F8KA 1Q3UA 5KL8B 5IIKA 5J0QA 1OTRB 1YNTE 3DVNU 5D46A 2HJ8A 4IC9A 5BOLA 1MG8A 1ZD3A 1WRIA 5FXDA 2VANA 1KKOA 1WRDB 1JWBD 2DWQA 4FLHA 3TEZA 1N2XA 2N1RA 1UQVA 2WF9A 4JMUA 4ZA0A 1V9PA 2JZBB 3QAQA 3WIMA 1SL1A 3T8MA 3EJDB 2WXNA 3Q8AA 3QQ8B 5IIIA 1WVFA 2C5LC 3H8JA 3RB6A 5ALJA 5AWVA 3N1XC 4QW8A 1PUTA 3TOYA 3DV9A 1FNVA 3AE7B 4FJVB 2WB1C 1BWCA 4GXJA 1MHHE 3MC1A 5KL1B 2FAZA 4ASWC 3T8QA 3OJUA 1OXJA 1DK2A 1GREA 3BVGA 5U25A 4K3CA 1SZHA 4QIWF 4ED2A 3H8AA 4F4XA 2K6DB 4ENLA 4EQXA 2HXTA 2M1MA 2XCPA 3P4SB 3RNAC 4WWPA 1PK3A 3D47A 5E79U 3ZDCA 2FPKA 1J7CA 1ECQA 3FJ4A 4P4OA 1MVKA 4HJKA 4O3QA 4LJPB 5DQGA 3U7DA 4M2YA 2BCQA 4MH0E 3P63A 3CNHA 3UXLA 2C2DA 4I2JA 4XRHA 2ZC8A 3M7DA 4RT2A 5BYQA 3OPSA 4IL6U 2L05A 2CN1A 1ZD5A 2UVUA 3V7KA 4TUUA 4UB6U 1Z1VA 4DL3A 4TQRA 2YVCA 4MGGA 1X9WA 3E2EA 5FJTA 3IN5A 1V5TA 1EU3A 4MELA 2X8HA 2K4IA 3NXLA 3TSHA 1WI0A 2LXAA 2PKOA 4DOBA 2GRTA 3CAWA 2MBHA 3ML9A 3EEZA 3DVNV 4HKZE 1C20A 1KCZA 2WF5A 3PX4A 1F1HA 3ISCA 2BR0A 1ZQCA 4Y2XA 4P4PA 4F72A 3KUDB 3PLUA 1WZ0A 1DZNA 8ICEA 3ZNHB 4DK5A 1K5OA 1RM6C 3RNGC 3PMNA 4G3IA 1QQ6A 4IC7B 3BQ0A 5H92C 5J8YC 2RQ5A 4I2DA 1TV9A 1UNSA 2V4IB 3BDPA 1I42A 4F3OA 2PMVA 3Q4DA 3AU6A 3QU5A 1Z00A 3EECA 3ZTCA 2M8SA 3VVWB 5JRBA 1E6EB 2DZMA 1AHZA 5IIMA 3PFRA 3IV6A 4O3NA 4JE3B 5CWRA 1F0ZA 5DLFA 3VR8B 3APCA 2BYTA 4C8KA 3MDAA 4K3BA 3QEAZ 3CGCA 1NNLA 4IL2A 3GIMA 2KJ9A 1SGHA 5CR0A 5HMLA 4PS3A 1L3TA 3C1YA 4YTNB 1KDHA 1PDYA 1RM6B 4CO7A 4W9LA 1ZQPA 3BINA 4PS8A 5DQIA 3DHIC 2Q85A 5AK5A 4JWUC 2BPFA 8ICAA 3BS7A 4J9LA 5IINA 2BPSA 2K1FA 3S5SA 3KZXA 1L8LA 4LZGA 2FMSA 1TGZB 9ICXA 2EMSA 3GE3C 5HNKA 3THVA 4KV2A 3PW2A 4GYPA 2W0HA 4QZFA 5J2RA 1AQ6A 2AL6A 3AV8A 3I6TA 4YG2A 2GGHA 4MM3B 3MJWA 3NRZB 4XLOA 9ICCA 1XD3B 3KHRA 3B9JB 4NLCA 1R4MI 5IO9A 4A3OA 4TVWA 2LPEA 4IR9A 1TZOA 2PE6B 4O5CA 3RUIB 3KKAC 2GGEA 2OX4A 1STEA 4QWEA 2KQ7A 2K8CA 4I2GA 1WUFA 4Q44A 3PZPA 2QARA 4BC7A 4PVHA 4WJPA 1L5UA 4ZRKA 1DOQA 2FPMA 8ICOA 3N1YC 4YMMA 1CUKA 4RF0A 4W9FA 2C7HA 4IP4A 2PI5A 2WOIA 1SE4A 1GRBA 1YQBA 3FM9A 1B1ZA 2WWZA 2AHOB 3BY4B 3I28A 1TS2A 3BK1A 3QARA 3NS1B 2PGEA 4LLGM 2PP3A 1XF5L 2K4HA 4PT5A 2HOQA 1ZQOA 3A9KA 1K51A 1KL9A 2W9MA 3N97B 2EELA 4FZNA 2OQHA 5FMHA 3VC8A 2N9KA 3DWMA 1T0SC 2DX5B 3JPRA 2LM4A 4R3DA 3IAM1 4ECYA 2FMPA 4KGSA 2IY1B 4YMNA 3TL5A 3FAHA 2NV3A 3B2GA 4DOAA 1V6EA 1WUDA 4FBTA 3EA6A 3V61A 2CPRA 2NVUI 2KTRB 1S0OA 2N9EB 1AHUA 4JB1A 1PGAA 5JTIA 5L1KA 1GRGA 4M9GA 4UW9A 1FXAA 1EM7A 5H8YE 2IGHA 2P66A 3R2IA 4FS1A 2KP7A 1PDXA 5ALHA 1ZQHA 4TSSA 2D3DA 2QC8A 8ICLA 3CW2C 9ICHA 2WX0A 3OAWA 1I4PA 4IM3A 4CRXA 3CGBA 3TFSA 2ZTCA 4TQ0A 1T3QC 3EF6A 2BVGA 2NBVB 1T94A 2B21A 4FADA 3K1ZA 5BOEA 3OSNA 4JK1A 3C28A 3JPPA 2M9NA 3KZIU 1GG3A 4DFKA 3M95A 4FHJA 3UGBB 3RZFA 4DDID 3F5AA 1ZQQA 2HHWA 3TEXA 2GQWA 3M62B 4C8NA 4WJQA 1QSYA 3RR1A 3FWAA 3NO1A 4AP4C 1SXEA 3GZNB 2IO3B 3H1UA 4RM8A 5J2FA 4GC6A 3SFEB 3VHTC 4QZIA 1BNOA 4PZFA 2E1EA 4EWJA 4DL2A 1XCTL 4NY0A 5AM2A 3ZDBA 4M0XA 1ZJMA 4IRDA 3C23A 3PSEB 1B0XA 2M0XA 4CNQA 2WPFA 1BVSA 2IOFA 4U7CA 3PR5B 4C4RA 3AEBB 8ICSA 1L8PA 1SF0A 3DDCB 1W1MA 3LK9A 4K7WA 4K81A 3QU7A 1L6UA 2QJLA 4REZA 3AQEA 1WFYA 3B0YA 4I2FA 5DPRA 1E8XA 4A35A 2KKPA 2KZZA 2ZIWB 3VUYA 5G5HA 5G5GA 5J2EA 4E8GA 2PLPA 2W9CB 4RM9A 3CRXA 1E7VA 3ZLHA 5AKJA 3G6YA 1E7UA 1BMLC 4EBCA 4QNLA 3KQ4A 3ZRFA 3TCSA 4ELTA 3MTNB 4DEZA 3UPQA 3GU3A 3NGDA 2J7QB 1Z5SB 1WXSA 1D5XC 1TKEA 1V8CA 5IOIA 1HE8A 2KG5A 3GRTA 2XVTA 1WM2A 4F4WA 3FDSA 3B0XA 1FO4A 3MWCA 3PVLA 5D3DA 4EZ6A 4K8GA 3G6XA 3HPFA 5BPCA 4HCNB 3L5KA 4Z1YA 2K8BB 4B0EA 4QWAA 1KH0A 1YQ4B 1BUIC 2J0KA 1NJWA 1L3VA 4YSZB 5JHBA 2BWFA 5KFJA 2MUTB 1ZQFA 1V59A 5ALGA 2DUYA 1I4HA 4RU9A 2MX2A 5DBAA 3LYSA 3NY5A 3GC2A 3AEAB 3ZVHB 2JV3A 3FKYA 4B95A 1IYFA 1KLNA 3R25A 4F5OA 1ZDLA 2B3AA 2OWOA 3C29A 3PSFA 4EZ9A 4IWQA 4C4VB 4I2HA 2EXRA 3I6EA 4DYEA 1N63A 1C1YB 3L16A 3DBRB 3ZNZB 2XO7A 2BKFA 1NK8A 4KIKB 4PS7A 1N62A 5BOMA 3ZJUA 1HUZA 1B43A 5EE1A 3VTEA 2ZJAA 2NO4A 1TK5A 4BWJA 5ALXA 4NLBA 4CF4A 5IKCM 1FHVA 5DB6A 1HEKA 4OO1J 3OC4A 2WU2B 1TYTA 1ET9A 2GGJA 2ZW0A 2EDUA 4H19A 4DSLA 1NDAA 3KYCD 5ALIA 2IYDB 1OEYA 5JHAA 1RXVA 3URYA 1L7PA 1GRAA 2JZBA 1PVQA 1DXSA 1GNUA 2KKCA 1PK1B 1Q8KA 2MSNA 4KITB 1SJCA 2YVFA 1FIQB 4TURA 4UB5A 2J4XA 4AP9A 2KDFB 3RGTA 3A7AA 2SEBD 5HKHA 4PYZA 3HPOA 2KZRA 5LXIB 4QWDA 5JU5A 1N6ZA 2P4PA 2C60A 3ZKJC 3GILA 4K4GA 4J3ZA 1QH9A 1DK3A 1UT8A 4DO9A 2GRIA 1R4NB 2KDEB 1GC6A 3PVXA 3ES7A 5BYRA 3V6EB 4EX7A 2V3NA 2KZMA 1V85A 2I38A 3GO2A 4GGQA 1DOXA 1KFSA 3RBEA 9ICGA 4P1CC 3A0BU 1WE6A 3IK4A 2XICA 2JYTA 3PZ8A 2ACZB 2OZ3A 2D3BA 2H5XA 3PRMB 3HKZC 3D2JA 3GSYA 4KVGB 1ZETA 1FCCC 1T4GA 4NNJB 5J2KA 7ICIA 1WE7A 4LDTD 4UARA 3TEYA 2XY5A 2AGPA 2G45B 1JMSA 2MAXA 1KJTA 5KT3A 4LCDE 3SD5A 4BBNC 4DHJB 1KN0A 2HNEA 2UWQA 2UUVA 3AULA 4HCPB 4YVZA 2HJ1A 3HX0A 2JEFA 5FR6A 3RJKA 1V5OA 3KTQA 2IJ0A 2M0AA 5T8IA 4X2PA 3RJAA 1L8OA 1K50A 1SIJA 4BKSD 4EFOA 3DEDA 2KVRA 5LNK1 4FS2A 2CS4A 2WXMA 4IZGA 3X0WA 4XA5A 3PW0A 2LASA 2Y5CA 4XDDA 5AKLA 2MRPA 3J9CA 3PW5A 3LVVA 3JZUA 1FFVC 2G4DB 4YL8A 1DIIA 4JV0A 4FN2A 1XSPA 5KFGA 1W1KA 4OALA 1L5PA 3EC8A 3SYZA 2K25A 4WQMA 5F3XB 2PLSA 2CR5A 3R2TA 1WG8A 1F2RC 2O6VD 3RBDA 4GFJA 4O3SA 1C79A 4YWSA 3E56A 4JN8A 2PODA 4Z17A 2DQNB 2IBKA 5AI0A 2KIWA 3V62A 1OFFA 4AYBF 4M02A 4J56A 1EC9A 2JXJA 4AS1A 1LQBA 3KFUF 2FUHB 3L0WB 4N58A 3ECIA 3VRAB 1E9IA 2HXUA 3RO6A 1FRRA 2P6UA 3I9V1 1GEUA 3SDLC 5ALTA 3RTVA 4W9HA 4KZCA 4UB2A 4B6WA 4E3CA 2C9WB 3WKAA 3HVDA 2WDVB 2LGSA 1Z1BA 2LHTA 1P48A 4OCZA 1CI4A 1R6WA 1S1QB 4XUSA 5J8YA 2G09A 1SBBB 1LGRA 5EWGA 1IXRA 3M3JA 1S77D 3VTUA 1U48A 2RDJA 2WXOA 1V38A 2MBRA 1WX8A 3DGZA 4H4YA 4TUPA 3F53A 5KFSA 1H38A 4RUCA 5AKXA 1NK4A 1J2NA 3DVGX 4CYEA 1I35A 2GBKA 5EOZA 3AU2A 4CE6A 4YMOA 4B9KA 4ZRIA 3S47A 3I1YA 4GMVA 4TMAB 1ZY8A 2MUCA 2YN4A 2HHTA 2CHWA 2V3BA 1ZQZA 2BPCA 3NRZA 3M9MB 3CIRB 4MM3A 2D8CA 3DBHB 2Q4TA 4RQ3A 2KC1A 3AQFA 3B9JA 1SJED 4ZYSA 2ZIUB 2KANA 4KZ0A 4IWPA 5J04A 2VKQA 2YMQA 1ZX9A 3TW9A 2MW5A 2DW7A 3TSJA 2LVQA 3RYTA 2WDWA 4AJYB 2MJ3A 4FBJB 4FDCB 4EQSA 1DGSA 3SD7A 2KHQA 2DGZA 1CJEA 3B2FA 2BVHA 2ATLA 2PGWA 3SN0A 4UB8U 1FMAD 4I6NB 2FPLA 1HQRD 2JSVX 3ZNGC 9ICWA 1L6NA 2R2ZA 3BIID 2FBWB 2Y0SF 2EAPA 4BOZB 5D49A 3ENLA 4PGXA 1MSWD 2YB1A 4GIRA 3Q8LA 3WA0A 3CXBA 3EAOA 4BGDA 4RCOA 4C8OA 4FZLA 3RCZA 4TQ1A 2K4PA 3NS1A 1P0RA 2WHIA 3ZLGA 3DQVA 1RPLA 1SWWA 2DAJA 3KKAA 2QJMA 1DIQA 5AI5A 2Y1IA 5AUKA 3PS6A 3GD3A 1CQVA 5IAAC 3LDAA 2INPE 3W9CB 2Y4GA 1YJ1A 1K4QA 6ENLA 2R8IA 2P8CA 1EF5A 1RFAA 2MJEA 4M0WB 3MSYA 2FYMA 5KFBA 3Q6BA 4EMJA 3SR6B 1T6BX 1NI3A 1C3TA 3D2SA 2KTRA 3DFHA 4BCAA 4CCHA 1FEHA 5G55A 3F2DA 3S1CA 1MA7A 3ZXVA 1TAUA 1SJDA 3CGEA 4DCCA 3ISDA 4JQ9A 4DQIA 2NRZA 4QZ8A 4OJ6A 4FX9A 1SV0C 4ECXA 3MJ5A 1SL2A 1JX4A 1LVLA 2PTZA 1JI7A 2V1YA 4MGZE 4O3RA 4R65A 5J0XA 4HYKA 4RMAA 4HPMB 5JCIA 4OZBA 2BC1A 3CGDA 1DXLA 4Y2SA 2KK0A 1XLOA 2M56B 2OVLA 4IHCA 4YTMB 4OJ5A 1PVRA 2FDRA 2RLTA 4URKA 3U52E 2I2YA 2H3ZA 2VA8A 1E8FA 2BS3B 5AI9A 5J2AA 5L1LA 4A8EA 4O1NA 2LMRA 4FFDA 1ZQDA 1S10A 4A55A 3J81j 1JXEA 3N1ZC 2PSNA 5IP4D 1T3QA 3Q3FA 3AE8B 4KX3A 4JAYA 1RYRA 5KFCA 2F77X 4Y2YA 1BPBA 3UI3A 3AEFB 4F5RA 3H7PB 4XE0A 3PT2B 2D10A 4YFKA 1NZBA 3RZWC 2P88A 3LXFA 2KACA 1GB4A 3LWLA 2BQ3A 1GSNA 4M6UA 4ECZA 2WDRB 3S6JA 3KUZA 3I76A 4YD2A 3ZNID 4GR1A 2ZIWA 4J9MA 1QSSA 5JCKA 7ICQA 3R1ZA 2F3NA 2W9CA 2ICIA 3PO5A 4RQ0A 5AK4A 3KHLA 2EMTA 1TAQA 4ZRJA 1FEBA 5ALPA 4PL1A 3QCAA 3ORYA 2GBJA 2QQ6A 1L2NA 3PNCA 3M8SA 1K8RB 2QGYA 1L0YB 1JRPA 3BSMA 3L08A 3O0HA 1WGGA 3T3FA 4B9NA 3BWUD 1ACCA 5ALQA 1NK9A 2PFQA 2GB1A 3LB8C 2CHXA 4YCXA 3DBLI 3D2HA 2HE7A 1Q1OA 2ZTEA 1MNSA 1RVKA 7ENLA 1QCKA 8ICRA 2K8HA 2ZW1A 4HJGE 2K8BA 2MEKA 4WIPA 4EE2A 3SENA 3NVWB 4JWNA 4W9DA 2IBIB 3MHZA 4BAXA 1GO3F 2P13A 2KMDA 2BQQA 2QB0B 4F5PA 4B9UA 2WXJA 2ZEQA 2WOWA 2MUTA 4LNNA 1IGDA 1TT5B 3W1SC 2E6XA 1I4GA 4EOYA 4B9TA 3VC5A 2PMZF 2PKEA 1RFKA 2GLSA 3IRUA 5DLGA 1D8YA 2LXCA 4RFBA 5I4DA 2QAEA 1MI0A 3MFIA 4ADWA 2J52A 2W11A 3OWEB 5ALRA 4MEYA 5AICA 4Q45A 1N48A 4FZMA 3RRHA 4C4VA 2RSUA 1D3ZA 3N6JA 2W9AA 2JQRB 1E8HA 2QJJA 7ICGA 2D2QA 4KIKA 3OP2A 3VXWA 1JOAA 2BCUA 4XZ4A 2KFJA 4DDGD 1S0VA 4JGHB 3MC8A 2Q5WD 1WM3A 5ALOA 1IIPA 3EWAA 5J0YA 4NM2A 2JPHA 4TUSA 5C2TB 2ZZCA 2YQEA 4PWCA 3ABVB 4W9JA 2K89A 3EUB2 4G9BA 2PFNA 2JWUA 5GMVA 1W1JA 2KJ5A 3PK7A 1U9LA 4H4RA 3TMPB 5EDSA 3D2NA 1PK1A 5J0WA 2ZJ5A 4EYHB 1FIQA 3HM6X 3KBBA 4HEA1 2LJ5A 2INCC 2BHNA 2YVSA 2P3HA 5KFLA 5J2DA 1D6EC 4KTQA 1TS4A 1FFUC 1GRFA 2WBAA 4ZYNA 4F8RA 2B76B 2YEPF 4P6VF 5IIJA 3H8WA 4GMEA 1U4AA 2LGDA 2Z59B 5AM0A 2FCNA 4KDLB 5BMIA 4S0RA 2A1AA 5ALMA 4RQ2A 1BPDA 1SJHD 4NLGA 2HVHA 1X40A 1MQ2A 3E58A 2VA2A 1DTNA 4BV6A 5ALDA 4PVEA 3TSSA 2E3TA 4KMUA 4ECWA 3W5VB 1YJJA 1JDFA 1N5WC 2DYOA 4DQQA 1QLBB 3VFCA 3MGVA 2BGFA 3AUOA 3PY8A 1K52A 2W55A 5EE0A 1QILA 4FULA 4PHEA 1LB2B 4DQSA 1WGHA 3RRGA 3QE9Y 7ICJA 4H4XA 3N9YC 2IO0B 4WURA 3V3XA 4ELUA 1QOFA 3FILB 3AU5A 1XSLA 4EM3A 2PPHA 4PGQA 2CFYA 3AL0B 1QTMA 3FYYA 1KRPA 1D7YA 1O03A 1ZP0B 2ON8A 2V3PA 2WX1A 4EEWA 1NHRA 2O56A 1J19A 2KJRA 5ALUA 4K4IA 3N30A 3KUCB 5FXEA 2ZVOA 3KUMA 2KN7A 3EW9A 2LUMA 1TYPA 5L95C 3JS8A 2DFLA 3P4PB 1IP9A 4W9EA 1XEEA 1H6VA 2LYHA 1KTQA 1VLBA 2WTFA 1WVEA 1BT0A 2AQ3B 4ROPA 5J0SA 3ALRA 1WGRA 3SAHA 7ICLA 1LVHA 2PVOD 1SJAA 4YXJA 1YJIA 5J2CA 2UVWA 3BYYB 1YZ6A 2AQ0A 3K9OB 2H89B 5KHOA 2FCQA 2L0FA 1ZKQA 3GD6A 1S76D 3ZGZA 4HCLA 2IMWP 3CF6E 4UAWA 2FMQA 1FFVA 5GTHU 3NG0A 3BZCA 5CRXA 1JN3A 3Q2AC 4DNSA 2X99A 4GIBA 1XXGA 1NOMA 2FIFA 3UIPB 1VD2A 2AAQA 1SKWA 4JN7A 3KHGA 2W9BB 1N56A 5FXFA 2PCEA 4H4PA 4HCHA 4O3OA 5FR3A 3DDHA 5ALNA 5CHVC 2BVFA 2LI6A 2GH1A 5KG7A 2MHJA 2ZTDA 2Y3AA 4ACOA 4YR2A 4ANUA 3W8ZA 1E90A 3IM1A 1W1LA 3RH4A 2LRWA 1CEZA 4GC7A 2D3GA 2OEHA 3V05A 4EYIB 3OLMD 2JMGA 2HTME 5AHXA 1EXNA 4DX3A 3AE3B 4HKQA 2G5IB 1OUQA 3RJEA 4HPPA 4WJOA 5E6NA 4KLHA 2V3AA 5DPTA 4JHMA 1YIWA 3HRDD 3ZDDA 2WAQC 4LK0M 1UGJA 2L7RA 3A1QB 2VJ5A 3UQ2A 3WK5A 1P1AA 2QHOA 4US8A 4NPNA 1EF1A 4M0AA 1W6TA 2L1AA 5EBKA 2G9HD 2Q0ZX 1S97A 4WWNA 4B6JA 3GE8C 2QKNA 3IJLA 3UINB 2K4EA 5FJPA 2ZIUA 4MT5A 2V4RA 4GN1A 2J53A 3N3KB 1QKZA 1TY2A 2EQ8A 3AEEB 3R0KA 2J6TA 4J9OA 4WH4A 2GH5A 2YMMA 4NEWA 4DSJA 3VTWA 2H3QA 3CP8A 5AZGA 1TTNA 1ZD4A 1EU4A 3P42A 5AZFA 1SE2A 4TQSA 3Q8QB 4RNNA 4KLJA 1LFDA 3H4KA 5E6PA 2ISOA 2LWPA 3NASA 4TUQA 2NPTB 4UAVA 1I19A 5IA7A 4F5NA 5DGAA 2OCEA 5AE1A 1P7FA 1ZK7A 1IYXA 3LADA 4O5EA 2W82A 3CB3A 4HDOA 1KW4A 2BQRA 2HOFA 9ICJA 3A9JB 2JYEA 2N9PC 1JCKB 3MP9A 4BXOB 4KLOA 3WK6A 4M0WA 3D46A 1M6YA 3MFGA 3EPIA 3A7RA 1MO9A 1MBBA 2X8GA 3T5LA 3QU9A 4O3PA 2LFIA 1WJNA 4IQVA 4ZDVA 9ICIA 3PO0A 4ELVA 4X5VA 2OZ8A 2KE7A 4H4VA 3EPGA 1MJDA 3F2BA 1JPMA 1P7DA 2XNAC 1MDLA 2JR5A 2CJOA 5K4LA 2CU1A 1F8WA 2IHNA 3C1ZA 1XDIA 4M01A 1HEZE 1F77A 3I4KA 5DQHA 1WWTA 1LKYB 4GXBA 5KFRA 1MC8A 3IBEA 5KFPA 1WGKA 2KWUB 2O6KA 1UZXB 5HHDG 1SZPA 4PPXA 4GSWA 4BUGA 1EC7A 4Z6DA 3HKZF 4UQGA 3RD2A 2F44A 5AM4A 4OVVA 1NENB 4XC2A 2EZZA 5AM1A 2IGDA 1SV0A 2K0PA 3ONNA 1ZQNA 1QSLA 3OGUA 3OTRA 3GV8B 5LXHA 1COKA 1F52A 4TKNA 4ICUA 4DHZE 1V81A 1WMHB 5JH5C 1V2YA 5HMRA 1ELSA 4KKIA 1XQQA 8ICFA 4IOIE 5D7GA 3ENEA 3HW2A 1UELA 3S1EA 1Y8RC 2I5HA 4HAIA 2ZJ8A 4NXZA 2DHZA 2PE9A 2Z0DB 2BW2A 1FEAA 1KKRA 3DHHC 4YQWA 3H7PA 5EU9A 1WR6E 4R63A 4FBUA 9ICNA 1FPYA 4DSKA 2KVCA 1PGXA 3AU4A 4DS5A 1RXWA 3RR8A 1YQZA 3DH9A 1VCBA 3KLJA 2NQWA 1BGXT 1MDRA 4WJ3B 4GFIA 1F5SA 5FP0A 5KFUA 4PHDA 3RJJA 1L0XB 4NV0A 4NY8A 2RDHA 5JRTA 4HLEA 3MQTA 4AWJA 2W03A 7ICHA 1ESFA 3ZDAA 1FECA 1DYQA 2E5AA 4FP1A 2O6VB 1QOBA 1XLNA 5FK9C 4J1OA 1RG6A 1KN5A 3AH7A 4OZCA 1HTOA 1QF6A 5AI4A 2HBKA 3DEEA 3BJSA 2C2RA 2SAKA 1WJUA 4EQRA 3D2DA 2J6UA 1X6IA 3NTUA 4PZNA 3IT4B 4MLAA 2W54A 2VFRA 2JRZA 3VTVA 3TAQA 2NRXA 2DAFA 2IOFK 1OEPA 3NVWA 2JF5A 4F93B 1YN4A 3T4WA 1NHSA 3ZD8A 1ZW7A 4F5QA 3AB5A 4K7SA 2QB0A 5AI6A 4FJYA 4JPSA 1V1PB 3N7SC 1WF9A 2MQJA 1SJBA 3PREA 4BKGA 2HHSA 1FXIA 4KLSA 2C7NB 2LM1A 4IRKA 1C77A 3PX0A 1JMLA 3LJ3A 5J18A 3LB8A 4GDLB 3VRBB 1OJTA 1EBHA 3QFAA 5CJ7A 3JYUA 1ZD2P 1I4QA 2KTFA 3DG6A 3ICXA 4DXKA 1WJ6A 1ZKHA 1UF0A 2V9HA 3BZDB 3V6HA 3AN1A 3MR6A 2N1VA 3W1SA 3SEIA 3QIJA 3TKAA 2AXTU 1N62C 2J6SA 4P4MA 3V6JA 9ICOA 3H7VA 1XT9B 1OQYA 1X9XA 2OFJA 4CF3A 3H12A 2P6RA 1TZ1A 2X8XX 3BK2A 2JY6A 3O65B 3PQBA 2QCZA 1C7YA 1AOGA 5E6OA 2EQ7A 1JWUD 4WQOB 4S17A 1TS3A 3AECB 3KVFB 2AL3A 4DF8A 3IG8A 2INNE 2PA6A 2KC2A 4K4HA 9ICQA 4UBCA 2XCAA 4RQ5A 1H8CA 3T5KA 2GQTA 4QIWC 3SAFA 3R07C 2NR2A 4PH5A 2ZNVC 2XGQA 1TFRA 5J0PA 2BF8B 4O5KA 1YN3A 2FKPA 5ER0A 3B97A 3UCDA 1UH6A 4BBYA 1XC9A 2GLEA 2ONQA 2HBLA 4US9A 2LYBA 3ZI4A 4KLIA 4O9MA 2MA1A 1FFUA 1L7OA 3P0WA 1HZ6A 4NM1A 4JWSC 4MJSB 3N20C 4W9GA 1ZXHA 2JEIA 1MUCA 4C80A 5AIAA 2KN5A 4RT3A 5AI8A 4DWDA 4J9PA 3FILA 1C4CA 3ZUNA 3UCCA 2BC0A 2FLNA 5TZVA 4QWCA 4QZAA 2ZNVB 2YY6A 4Z6CA 5KG3A 2NS5A 2WDQB 4ARCA 3UIOB 3NUQA 3KYDD 1XLPA 3MFHA 5ALZA 2HMXA 2OOBB 1NBFC 1NI2A 3K1GA 1UWMA 1V1OA 1ROEA 1N5WA 2WXIA 4I2BA 3ZLFA 4JLCA 4HN8A 3TIXA 4IR1A 1X2GA 1ZQJA 2LMCA 2IPIA 3RJ8A 3RNMA 1JWSD 5DBCA 3M9OB 4KSKC 5H2FU 3Q8BA 2R61A 5L9XA 1ONFA 1ZXIC 4WWOA 4PGYA 4MFFA 2PPGA 1J97A 2KK8A 2A4ZA 4NJ7A 1WY8A 3FW7A 4ZOHB 1NVID 1XO1A 5CB1A 2QJNA 3OW1A 4ECSA 2CU3A 3JPOA 1KFYB 5ALYA 1FNWA 5J17A 1SKSA 3P2BA 1WXAA 5IILA 2CRXA 3NVZB 4PVJA 3HUIA 1M6IA 1BPXA 3H4BA 2KFNA 4UAZA 3ZDTA 4B9LA 1YMHE 4LNFA 4QZGA 4EBDA 2K9XA 4F1SA 3ED5A 2BCSA 3DPDA 3WAMA 3PWIA 2QDEA 2W9BA 3R11A 1X66A 4UAYA 2W8LA 4XQ8A 1ZE3D 4YR3A 2ZIXB 3T3OA 1E10A 2J3NA 1NK0A 3V7JA 3H0LB 3DBLB 3A4RA 2MCNB 1KLGD 2PU0A 2YVJA 1FHUA 5DB9A 5L83A 3A33B 1NYQA 4MACA 3NVVB 3T5HA 3AE9B 2B6GA 3K4GA 3HJEA 5AKYA 7ICRA 1NK6A 4DFJA 2KFKB 3PZDA 4IG7B 4MSQB 3Q3NC 3CWIA 3TX1A 1PGBA 2G1EA 9ICBA 1C9FA 5FS7A 4P1BC 2LVOA 3EYZA 3UXPA 1M94A 2BPGA 3A1QA 3QJZA 4GDKB 2V4QA 1A6SA 4IM0A 3PW4A 3I5JC 4RZRA 2KO3A 1MOKA 5L1JA 3QC8B 3M9NB 2DBYA 3MDCA 2AQ1B 3DCGA 1VDVA 2ASDA 4IQUA 2ZZBA 3ZD9A 7ICVA 2EH9A 1H4RA 4GLSC 4F4ZA 3QUBA 4HK2A 2AEHA 2INDC 2KHVA 3OG5A 1SE9A 4P16A 3Q8EA 2PI4A 4ZHPA 1ZQIA 2KQSA 1X2HA 5C0YA 1TKGA 2HD5B 2XGZA 4RQ1A 2HBJA 2X8CA 4B9SA 2OJRA 3RF9A 3RJFA 3R7RA 4F2RA 4G8TA 1TVAA 3JPSA 3RNFC 3NRWA 1WXQA 5ALKA 1HSKA 2LVPA 2BYVE 5KT7A 4DWFA 8ICMA 1ZYQA 1KRHA 3EKGA 3QYPA 2E1FA 3C0PA 2NPTA 2RK5A 3JPQA 1T0QC 4E0DA 4PVKA 3QPEA 3MKCA 2Y5PA 5KG4A 5DG7A 4PZOA 1S0MA 1ZQEA 2BVCA 3GDXA 2BCPA 3VCNA 4M04A 2Y5BB 3MHSD 4ANXA 5BYSA 3A9JA 4UB1A 2LRUA 2KWCA 4BXOA 2YLMA 1SL0A 3RFAA 5C5JA 3E0FA 1IBXB 1L6VA 3HW8A 4II3B 3C5FA 1XSNA 2C28A 4YWOA 2EZYA 4LZDA 9ICSA 3BS5B 4E4FA 3LAEA 4EEYA 2BCRA 1Z19A 1VZ8A 4N9F4 4HROA 3VC6A 7ICEA 3VCBA 4QZ9A 1WYGA 1I4RA 2LZ6A 2ZUDA 5KAFU 1ZQBA 1ZQYA 2HBMA 4IS7A 2QSDA 4ED6A 4RQNA 2F1HA 1NK5A 2BDPA 5BO4B 4P0QB 2NTSA 3L13A 2CKHB 4EUTA 4EELA 2GQUA 5HG2A 3UMBA 2R8GA 2FCMA 3CMMB 1BKHA 1S7MA 2NVKX 1Y56A 4ED3A 3RR7A 7ICMA 1W1QA 2FLPA 1NJZA 3P1MA 3D32A 2KFZA 1LKYA 1SIFA 2B0CA 8ICWA 3L10B 2I5QA 1JCTA 1HA5A 4O3MA 3U7ZA 3RPFC 2V9WA 4PHAA 2L0TA 3UXOA 5KFAA 2WPCA 4J9KA 3PX6A 1UBQA 1VRAB 2VZKD 3TCAA 4MKSA 1E7PB 2DKXA 3BZKA 4ICAA 2XI9A 3UJFA 5DG8A 1OEYJ 3UF8A 2FUG1 2UU7A 5KFYA 8ICJA 3IC9A 5FJUA 3QU2A 2A8XA 1RZTA 1J2MA 3THUA 5DCNA 3PHXB 4RPXA 4RQ6A 4YT0B 2XH2A 2M17A 4H4ZA 4DL6A 5B66U 4BKSA 4QWBA 5EE9A 3GS2A 2Z8LA 2RPQA 2Z7JA 1Y88A
chains in the Genus database with same CATH topology
1SJHD 4DXGA 3AV8A 4ZRPA 3EGRA 4MM3B 4XLOA 3NRZB 4B0MA 4PVEA 3B9JB 3TSSA 2E3TA 3W5VB 2W3RA 2LHDA 1YJJA 4TVWA 3ETRB 1N5WC 1TZOA 2DYOA 1QLBB 2OEDA 3P4RB 1K52A 4NZLB 4PWBA 2W55A 1QILA 5EE0A 1LO5D 1STEA 4BC7A 3N9YC 3LLBA 4WURA 4PVHA 3V3XA 4KGTA 1QOFA 3FILB 1N5XA 4RF0A 4BC9A 4A9AA 5I1VA 2LHEA 1SE4A 1B1ZA 1L0VB 2AX5A 2WXLA 3R8BA 1TS2A 1ZP0B 2JZPA 2ON8A 2V3PA 3BK1A 4XWWA 3NS1B 2HDEA 3HRDC 1ZOYB 4LLGM 1XF5L 4PT5A 2LJIA 1K51A 2EELA 2PVGC 5FXEA 1TYGB 2LEKA 2N9KA 3DWMA 2LUMA 3JS8A 4R3DA 3P4PB 1ZPSA 3IAM1 1XEEA 1FM0D 4KGSA 3ZYYX 3FAHA 3B2GA 3DWGC 1VLBA 3EA6A 3U2SC 1WVEA 2QEJC 4USAA 2AQ3B 2KQ4X 1I7HA 4YTPB 1AHUA 4JB1A 1PGAA 3Q8CA 4EC3A 2PVOD 4ML8A 1YJIA 1FXAA 1EM7A 1QOGA 4J3OD 2JXTA 3BYYB 5H8YE 2IGHA 3R2IA 2H89B 1PDXA 1N60C 3ZGZA 4TSSA 2DYMA 1FCLA 2WU5B 4WAFA 1FFVA 3AE6B 1I4PA 4DNSA 1SXTA 3RFZB 1XXGA 4TQ0A 4RH6A 1T3QC 2BT6A 2BVGA 5FXFA 4NAMA 4RGOS 1F0XA 4NAWB 5FR3A 2BVFA 2VAOA 3O13A 2X38A 3AEGB 1PYWD 5BMHA 2I0KA 2Y3AA 3W8ZA 3TEXA 4C7ZA 3FWAA 1W1LA 2BTEA 3V05A 3SFEB 2Q4WA 4C56C 1E0YA 4PZFA 1QLUA 1XCTL 2HTME 3AE3B 4HKQA 1A70A 1C4AA 1RYJA 1L4DB 1DGJA 3HRDD 4LK0M 1UGJA 4US8A 3AEBB 3U4EG 2L1AA 2G9HD 2QILA 2QKNA 3AM9A 5AE3A 1SF0A 1W1MA 4MT5A 1L6UA 2J53A 2QJLA 1QKZA 1TY2A 4REZA 4MH8A 3AEEB 1C76A 2TSSA 4WH4A 3Q69A 1ZDXA 5G5HA 3I57A 2KN4A 5G5GA 2PLPA 3T3NA 2O3GA 1EU4A 3P42A 1DOYA 3LYYA 1SE2A 1JROA 1FRDA 4YWGG 1BMLC 2VFVA 3GP7A 4RNAA 3VR9B 3KQ4A 1I4XA 1I19A 2W3SA 1YQ3B 3W8WA 3W2DA 5AE1A 1P7FA 2KMMA 1D5XC 1TKEA 1V8CA 3H8HA 2JX5A 2W82A 1W1RA 2JYEA 1JCKB 2OHFA 1KF6B 1P7EA 1FO4A 3MP9A 1AN8A 5D3DA 4M0WA 3MFGA 3BVMA 3A7RA 3KWLA 1MBBA 4B0EA 1KH0A 1YQ4B 4RGNA 1BUIC 2LFIA 4YSZB 3PO0A 1HXYD 1OQRA 2WNMA 1TKYA 2WXQA 3W8XA 4C7YA 1I4HA 4HG0A 2LGIA 1ENFA 3NVZA 2L83A 2XNAC 3E9SA 3AEAB 2CJOA 2KAJA 4A90A 4UD8A 3FW8A 3AE5B 1UXYA 1YN5A 2MJDA 1TJEA 2EXRA 2L32A 1HEZE 1F77A 1XO3A 1ZXIA 1N63A 1GPXA 2AXRA 1WWTA 3AE1B 3GB1A 4D2KA 3IT6B 1WGKA 1N62A 3ZJUA 3AE2B 2PW9A 5HHDG 5HFYA 1OQQA 5EE1A 2BB5A 3KLSX 3VTEA 1NENB 3NVVA 2K0PA 4OW0A 4ZHOA 5FXPA 2WU2B 1K53A 1ET9A 2ZW0A 1HZ5A 2JU6X 4YSYB 5HMRA 4KKIA 5D7GA 4IOIE 3URYA 3S1EA 3NVYA 1C78A 4RGMA 3BW7A 2BW2A 1FIQB 2L52A 2XN9C 2J4XA 1V1PA 2SEBD 3A7AA 2WXHA 1PGXA 5FKAC 2P4PA 5JXVA 5AUIA 2NQWA 5AE2A 1E0ZA 2VFUA 2GRIA 4RF1A 1RWSA 4KGRA 5BYRA 1L0XB 2V3NA 1TS5A 1B9RA 2I38A 5C3JB 1NEKB 2RDHA 1IGCA 1DOXA 1ESFA 1MHXA 1SSNA 1DYQA 2JYTA 3PZ8A 3SEBA 2E5AA 2ACZB 3MC0B 1QOBA 1XLNA 2K3UA 5FK9C 1D5MC 4JX1C 5D79A 1JWMD 4N59A 4XDCA 3D2JA 3GSYA 4TVYA 3AH7A 4OZCA 5HHZA 1FCCC 2RDGA 2KWDA 1QF6A 3TEYA 5GXGB 4L2YA 2N9LA 2SAKA 2WS3B 3D2DA 2NMQA 2UUVA 3HVZA 3IT4B 4MLAA 5D3IB 2W54A 2IDYA 2VFRA 2RMMA 2IJ0A 5T8IA 1IBXA 2M0AA 5HI1A 3RJAA 3IAS1 3NVWA 1K50A 3DEDA 1SIJA 1VJKA 1YN4A 3AB5A 2V0GA 5LNK1 1R7SA 2K22A 2WXMA 1N61A 2Y5CA 1V1PB 4JPSA 4XDDA 3ZJTA 1BXTA 3AEDB 3J9CA 3PM9A 2RPVA 1DIIA 1FFVC 1FXIA 3AE4B 1W1KA 4OALA 1VR9A 1C77A 1L5PA 1JMLA 3NZ3A 2BS2B 4WQMA 4O95A 2PLSA 4GDLB 3VRBB 2Y3RA 3R2TA 1F2RC 2N7JA 3KWVA 1D5ZC 1C79A 2WLBA 3E56A 4H2AA 4RGTA 1UWXA 1J7AA 2FE8A 1IUEA 1I4QA 2K5PA 2DLBA 2IGGA 5I1WA 1OFFA 3POPA 1XCQL 1QQRA 3BZDB 3AN1A 4AS1A 4CQNA 2H88B 3W1SA 3VRAB 4N58A 4A6QA 4IDIA 1FRRA 3I9V1 1ZUD2 2AQ2B 2BB6A 1GAQB 3HVDA 2WDVB 2Y3SA 2QMTA 3EUB3 3S1DA 1CZPA 3BK2A 1ET6A 1SBBB 3PQBA 2D5GA 3S1FA 2KDMA 2WXOA 2MBRA 3HSUA 1DOIA 4IKGA 1T5XD 1JWUD 1KLUD 3KJMA 1ZDVA 1TS3A 3AECB 4KX6B 2INNE 1CK1A 2PLIA 3NUHB 1JWAD 2OAIA 3WCQA 4TMAB 2GQTA 3R07C 2UUUA 3SR6A 1AHVA 3NRZA 1YN3A 3CIRB 1NYRA 4BBYA 2ONQA 3B9JA 1SJED 4ZYSA 4US9A 3ETRA 2BS4B 1FFUA 2MH7A 1HZ6A 3TSJA 1AWDA 4JWSC 1ZXHA 2WDWA 2MJ3A 1D4BA 4C80A 5G5HB 1CJEA 3B2FA 2BBCA 2BVHA 1JALA 5G5GB 1Q10A 1FMAD 3AMZA 3FILA 1C4CA 1HQRD 2JSVX 4L1BA 2R2ZA 1WSPA 3BIID 2FBWB 2NTTA 2PIAA 2WDQB 1VZ6A 4ARCA 4PYTA 1XLPA 4RCOA 4TQ1A 3NS1A 1UWMA 1V1OA 1ROEA 1N5WA 2WXIA 3IXSA 1F2RI 5MPOA 1QLTA 2CJNA 1DIQA 5AUKA 2Y4GA 1X2GA 1CQVA 2WXFA 2INPE 2LMCA 3W9CB 2IPIA 3RJ8A 1JWSD 1MBTA 2R8DA 3Q8BA 2R61A 1W1OA 2MJEA 1N63C 1ZXIC 4LTUA 1T6BX 1NI3A 3FW7A 4ZOHB 3P4QB 3SR6B 2IPKD 1N62C 1NVID 4BCAA 2WXRA 1FEHA 1KTKA 4FXCA 1ZR6A 2CU3A 1UUPA 1KFYB 1V97A 3S1CA 1FNWA 1SB3C 2VFTA 3NVZB 4PVJA 1QOAA 3HUIA 3MJ5A 1W1SA 5EE3A 2Y08A 1YMHE 2K9XA 1L4ZB 5BMGA 1XLQA 3PZ7A 4XWTA 1C4PA 4OZBA 3TEWA 3ZJVA 3Q8FA 1ZE3D 4AQ7A 1XLOA 2M56B 3T3OA 1E10A 4YTMB 3C8YA 2J42A 2QIEB 5E6JA 2WQYB 3FW9A 1KLGD 3U52E 2I2YA 1GB1A 1SB3B 1YNTE 1NYQA 2BS3B 4O1NA 1E8FA 1N60A 4MACA 4L23A 3TUOA 3AE9B 3NVVB 1WRIA 5FXDA 1JWBD 4A55A 2DWQA 2EKIA 3CWIA 3TX1A 1PGBA 3TEZA 2G1EA 1AYFA 1T3QA 1C9FA 4ITKA 3AE8B 4GDKB 4JAYA 5K8EA 3NVYB 2WXNA 3Q8AA 3UI3A 3AEFB 1FD6A 2AQ1B 2DBYA 4XE0A 3I99A 1VDVA 1WVFA 4N6EB 2VFSA 5AWVA 4GLSC 1PUTA 1VZ7A 1FNVA 2KACA 3AE7B 3LXFA 1GB4A 1GOZA 2WDRB 1EWYC 4NJCA 4P16A 2YEPB 1MHHE 3Q8EA 1J7BA 4ZHPA 1X2HA 1JW9D 3L4PA 1TKGA 4YXDB 1AW7A 5L6GA 3BVGA 2ICIA 4DXFA 1WXQA 2WXGA 1HSKA 4KKJA 5ADZA 3P4SB 2QPMA 5HQXA 1E8GA 5TSSA 4Q2JA 1KRHA 3C0PA 2RK5A 1N61C 1L0YB 1JRPA 1J7CA 2M19A 4PVKA 2Y5PA 1MVKA 4DQOC 1MPEA 1EWCA 5EE9A 4YSXB 3BWUD 1ACCA 2GB1A 5BYSA 3LB8C 3P63A 2WP9B 4A8XC 2PTLA 3D2HA 3FC4A 1IBXB 1L6VA 4HJGE 2ZW1A 5BYQA 3BVZA 2MEKA 4WIPA 4EE2A 3NVWB 1SE3A 4WWMA 2VZKB 2WXPA 3MHZA 3LAEA 3SFDB 1VZ8A 2P13A 2WXKA 4HROA 2WXJA 1TY0A 5L6FA 1WYGA 1EU3A 1IGDA 1I4RA 2E6XA 1I4GA 3A7UA 4RFBA 1RFKA 3TSHA 5I4DA 2QSDA 3W5UB 1M4VA 2PKOA 1MI0A 4HRSA 1VQZA 2J52A 1VAOA 3DQ0A 2NTSA 4HKZE 3ZQ4A 3OWEB 2GQUA 5HG2A 1Y56A 1E9MA 1DZNA 2JQRB 3P1MA 1E8HA 1W1QA 1RM6C 3VQIA 5H92C 1UNSA 2V4IB 2PMVA 1HA5A 4ARIA 3U7ZA 3RPFC 3BYTB 1QT9A 1E6EB 4UDUC 1AHZA 1SEBD 2Q5WD 4JE3B 1F0ZA 1VRAB 1JQ4A 2N0SB 2VZKD 3VR8B 1E7PB 2BYTA 5C2TB 4PWCA 4OVZA 3ABVB 3EUB2 2JWUA 1W1JA 4YTNB 4ZOHC 2FUG1 1RM6B 1FNUA 4OZAA 4ZRQA 2GI9A 1PFDA 1FIQA 2Q85A 4HEA1 4JWUC 4OHJA 4YT0B 2YVSA 2P3HA 1D6EC 1FFUC 1TS4A 2B76B 2YEPF 4P6VF 3GS2A 2IGDA 2Z8LA 5BMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV8 A;  4XLO A;  3NRZ B;  4PVE A;  3B9J B;  3W5V B;  2E3T A;  2W3R A;  1YJJ A;  4TVW A;  3ETR B;  1N5W C;  1QLB B;  3P4R B;  4PWB A;  2W55 A;  5EE0 A;  4BC7 A;  3LLB A;  4PVH A;  1QOF A;  1N5X A;  4BC9 A;  4A9A A;  1L0V B;  2AX5 A;  1ZP0 B;  3HRD C;  3NS1 B;  1ZOY B;  2PVG C;  5FXE A;  1TYG B;  2LEK A;  3DWM A;  3JS8 A;  3P4P B;  1FM0 D;  3ZYY X;  3FAH A;  3B2G A;  3DWG C;  1VLB A;  1WVE A;  4USA A;  1I7H A;  4YTP B;  1AHU A;  4JB1 A;  4EC3 A;  2PVO D;  4ML8 A;  1YJI A;  1FXA A;  1QOG A;  5H8Y E;  2H89 B;  1PDX A;  1N60 C;  2WU5 B;  1FFV A;  3AE6 B;  4DNS A;  1T3Q C;  2BT6 A;  2BVG A;  5FXF A;  1F0X A;  2BVF A;  2VAO A;  3AEG B;  2I0K A;  3W8Z A;  4C7Z A;  3FWA A;  1W1L A;  3SFE B;  2Q4W A;  4PZF A;  1E0Y A;  1QLU A;  2HTM E;  3AE3 B;  1A70 A;  1RYJ A;  1DGJ A;  3HRD D;  4US8 A;  3AEB B;  2QKN A;  3AM9 A;  5AE3 A;  1SF0 A;  1W1M A;  1L6U A;  2QJL A;  3AEE B;  5G5H A;  5G5G A;  2O3G A;  1DOY A;  1JRO A;  1FRD A;  2VFV A;  3VR9 B;  1I19 A;  2W3S A;  1YQ3 B;  3W8W A;  5AE1 A;  2KMM A;  1TKE A;  1V8C A;  2JX5 A;  1W1R A;  2OHF A;  1KF6 B;  1FO4 A;  3A7R A;  3KWL A;  1MBB A;  1YQ4 B;  4YSZ B;  3PO0 A;  1OQR A;  1TKY A;  3W8X A;  4C7Y A;  4HG0 A;  3NVZ A;  2L83 A;  3AEA B;  2CJO A;  2KAJ A;  4UD8 A;  3FW8 A;  3AE5 B;  1UXY A;  2MJD A;  1TJE A;  2EXR A;  1XO3 A;  1ZXI A;  1N63 A;  1GPX A;  2AXR A;  1WWT A;  3AE1 B;  1WGK A;  1N62 A;  3AE2 B;  1OQQ A;  5EE1 A;  3VTE A;  1NEN B;  3NVV A;  4ZHO A;  5FXP A;  2WU2 B;  4YSY B;  5HMR A;  3S1E A;  3NVY A;  3BW7 A;  1FIQ B;  2L52 A;  3A7A A;  2P4P A;  5AUI A;  2NQW A;  5AE2 A;  1E0Z A;  2VFU A;  1RWS A;  1B9R A;  5C3J B;  1NEK B;  1DOX A;  2E5A A;  2ACZ B;  1QOB A;  1XLN A;  2R8D A;  5D79 A;  4JX1 C;  4N59 A;  4TVY A;  3D2J A;  3GSY A;  3AH7 A;  5HHZ A;  1QF6 A;  5GXG B;  2WS3 B;  3D2D A;  3HVZ A;  4MLA A;  2W54 A;  2VFR A;  3NVW A;  3DED A;  1SIJ A;  1VJK A;  3AB5 A;  1R7S A;  2K22 A;  1N61 A;  2Y5C A;  3PM9 A;  3AED B;  1FFV C;  1DII A;  1FXI A;  3AE4 B;  1W1K A;  4OAL A;  4O95 A;  1L5P A;  2BS2 B;  4WQM A;  2PLS A;  3VRB B;  2WLB A;  1J7A A;  1IUE A;  2K5P A;  1OFF A;  3AN1 A;  2H88 B;  3VRA B;  4N58 A;  4IDI A;  1FRR A;  1ZUD 2;  1GAQ B;  2WDV B;  3EUB 3;  3S1D A;  1CZP A;  3S1F A;  2MBR A;  1DOI A;  3KJM A;  3AEC B;  4KX6 B;  2PLI A;  1JWA D;  2OAI A;  3WCQ A;  2GQT A;  3R07 C;  3SR6 A;  1AHV A;  3NRZ A;  3CIR B;  1NYR A;  4BBY A;  3B9J A;  4US9 A;  3ETR A;  2BS4 B;  1FFU A;  2MH7 A;  3TSJ A;  1AWD A;  4JWS C;  2MJ3 A;  4C80 A;  5G5H B;  1CJE A;  3B2F A;  2BVH A;  1JAL A;  5G5G B;  1FMA D;  3AMZ A;  2R2Z A;  3BII D;  2FBW B;  2PIA A;  2WDQ B;  4PYT A;  1XLP A;  3NS1 A;  1UWM A;  1ROE A;  1N5W A;  5MPO A;  1QLT A;  2CJN A;  1DIQ A;  5AUK A;  1X2G A;  3W9C B;  1MBT A;  1W1O A;  2MJE A;  1N63 C;  1ZXI C;  4LTU A;  3FW7 A;  1NI3 A;  3SR6 B;  4ZOH B;  3P4Q B;  1N62 C;  1NVI D;  4BCA A;  4FXC A;  1ZR6 A;  2CU3 A;  3S1C A;  1KFY B;  1V97 A;  1SB3 C;  2VFT A;  3NVZ B;  4PVJ A;  1QOA A;  3HUI A;  1W1S A;  5EE3 A;  2K9X A;  1XLQ A;  1XLO A;  2M56 B;  1E10 A;  4YTM B;  2QIE B;  3FW9 A;  2WQY B;  1SB3 B;  1NYQ A;  2BS3 B;  1E8F A;  1N60 A;  3NVV B;  3AE9 B;  1WRI A;  5FXD A;  1JWB D;  2DWQ A;  2EKI A;  3CWI A;  3TX1 A;  2G1E A;  1AYF A;  1T3Q A;  4ITK A;  3AE8 B;  4JAY A;  3NVY B;  3AEF B;  2DBY A;  3I99 A;  1VDV A;  1WVF A;  4N6E B;  2VFS A;  1PUT A;  3LXF A;  3AE7 B;  2WDR B;  1EWY C;  1J7B A;  4ZHP A;  1X2H A;  1JW9 D;  3L4P A;  1TKG A;  4YXD B;  1WXQ A;  1HSK A;  5ADZ A;  3P4S B;  2QPM A;  5HQX A;  1E8G A;  1KRH A;  3C0P A;  2RK5 A;  1N61 C;  1JRP A;  1J7C A;  2M19 A;  4PVK A;  4YSX B;  3LB8 C;  3P63 A;  2WP9 B;  3D2H A;  3FC4 A;  1L6V A;  3NVW B;  4WWM A;  3LAE A;  3SFD B;  2P13 A;  4HRO A;  1WYG A;  3A7U A;  1RFK A;  3TSH A;  3W5U B;  2PKO A;  4HRS A;  1VQZ A;  3DQ0 A;  1VAO A;  2GQU A;  1E9M A;  1DZN A;  2JQR B;  3P1M A;  1E8H A;  1W1Q A;  1RM6 C;  5H92 C;  3RPF C;  1QT9 A;  1E6E B;  1AHZ A;  2Q5W D;  1JQ4 A;  1F0Z A;  2N0S B;  3VR8 B;  1E7P B;  5C2T B;  4PWC A;  3ABV B;  3EUB 2;  1W1J A;  4YTN B;  4ZOH C;  1RM6 B;  1PFD A;  1FIQ A;  2Q85 A;  4JWU C;  4YT0 B;  2YVS A;  2P3H A;  1FFU C;  2B76 B;  4P6V F;  5EE9 A; 
#chains in the Genus database with same CATH topology
 2KDI A;  1RYU A;  4R66 A;  4DXG A;  3UJS A;  5AEK B;  4P2H A;  9ICT A;  3PV8 A;  4GIS A;  2KLG A;  3IG3 A;  5D4B A;  2QDF A;  2WDT B;  3C2K A;  3ZXR A;  3HP6 A;  3V72 A;  2DNF A;  2AKZ A;  3IJI A;  3N4F A;  3Q8P B;  3RUL A;  2W3R A;  2LHD A;  4GU2 A;  3FXG A;  4ECQ A;  2O6V A;  1RQL A;  2JGA A;  4IQW A;  3MBY A;  4KLQ A;  2D3A A;  3ETR B;  3R10 A;  2WOV A;  4C8M A;  3P4R B;  3APF A;  2WB1 F;  4NZL B;  4PWB A;  2EQ6 A;  2KLC A;  1LO5 D;  2WF7 A;  3H70 A;  5CA7 A;  3HHM A;  3LLB A;  5HR7 A;  2R8H A;  4BC9 A;  4Y2T A;  2KSO B;  3DEQ A;  3SV3 A;  1L3U A;  2X50 A;  5AKZ A;  2KJ8 A;  2LKY A;  4DQR A;  4H4S A;  5I1V A;  2LHE A;  4LJO B;  4EZK A;  3N7R C;  3MUC A;  5FS8 A;  2HDO A;  2AX5 A;  1F3P A;  1NHQ A;  2NCN A;  8ICP A;  3R8B A;  1J8C A;  3UMG A;  3HRD C;  2HDE A;  1ZQ1 C;  2KKV A;  8ICG A;  1EBG A;  5CX3 A;  4ECT A;  1QZE A;  2KJ6 A;  2PVG C;  2L76 A;  4H4U A;  5ENL A;  3OJ4 B;  1ZQL A;  4APN A;  2QB1 A;  2PU1 A;  1ZPS A;  3VUX A;  4GDL A;  2MWS B;  3IG5 A;  2RRD A;  3ZYY X;  4QW9 A;  1FXT B;  4JL9 A;  2JEG A;  2YB4 A;  2JVC A;  3U2S C;  3HIZ A;  2QEJ C;  4USA A;  3FG2 P;  4DQP A;  3EJE B;  3A4S C;  2POZ A;  4YTP B;  2IO2 B;  4EC3 A;  4ML8 A;  3C21 A;  3TJI A;  1EUV B;  3T5J A;  1QOG A;  5AK6 A;  7ICO A;  2REX A;  4B9M A;  3CST A;  4KEM A;  1N60 C;  4F7Z A;  4EM4 A;  4HYR A;  2DYM A;  4NQL B;  3WK9 A;  1UA1 A;  2WU5 B;  5J2J A;  3AE6 B;  5CHW A;  2HW3 A;  3Q8M A;  4RH6 A;  2EAN A;  4Q43 A;  5DPS A;  8ICY A;  4NAW B;  2VAO A;  3O13 A;  1GER A;  2HVI A;  1DRG A;  3RAQ A;  1PYW D;  2X38 A;  3JSV B;  5G2N A;  2BYF A;  5BMH A;  2QDD A;  3WAO A;  2M0N A;  3WK8 A;  3QXG A;  2G07 A;  2JRH A;  2I1J A;  3RNE C;  2WP5 A;  3H7I A;  5J0U A;  3LXD A;  1F44 A;  1XHC A;  3SBF A;  1SV4 A;  1TE6 A;  2W7P A;  1ZQM A;  5KNI A;  2KVZ A;  4BKT A;  2GMI C;  2AWT A;  2YX8 A;  1C4A A;  4M8M A;  5J2G A;  1RYJ A;  4EBE A;  1DGJ A;  2QLT A;  1L4D B;  4DBG A;  3DG7 A;  2JT4 B;  5U1O A;  1E8Y A;  4QZE A;  1IG6 A;  4DLE A;  3NJT A;  3EAN A;  3AM9 A;  1MQ3 A;  4A3P A;  3VFK A;  3IVF A;  5ALW A;  3OHB A;  2ZCC A;  4GOC A;  2TPR A;  4MF8 A;  2OXO A;  2Y1J A;  3QX1 A;  1R4N I;  2TSS A;  3ZVH A;  2KWV B;  2KZ3 A;  1R4M B;  4MJS A;  2WPE A;  3Q69 A;  2L8J A;  4K1R B;  3U4F A;  2HHQ A;  3QK0 A;  1T0Y A;  5DKW A;  4O0I A;  1JRU A;  2EQ9 A;  4DOC A;  4BDP A;  2YMP A;  4I28 A;  3TWB A;  3T3N A;  1WIA A;  1GV4 A;  4NJ6 A;  1DOY A;  2RD0 A;  3C2L A;  2L3Z A;  2OLA A;  5J2B A;  2AGO A;  1B22 A;  4YWG G;  3WU2 U;  2KHW B;  3GP7 A;  3WKC A;  3VR9 B;  5C1Z A;  1NHP A;  3W8W A;  5CHG A;  3M6K A;  2KTQ A;  1GC7 A;  5J2H A;  2KMM A;  1P3Q U;  2A5U A;  3BQ7 A;  4LJX A;  1W1R A;  1NEL A;  3SV4 A;  3WK4 A;  2DKZ A;  2YML A;  2OHF A;  1RYS A;  8ICH A;  1P7E A;  2P35 A;  2A3V A;  1UD7 A;  1R0M A;  3DG3 A;  2MA9 B;  4DN1 A;  3BVM A;  3MZN A;  3D6J A;  4RGN A;  4KT2 A;  1GJZ A;  3EFU A;  3UQB A;  3P93 A;  1HXY D;  2F76 X;  1OQR A;  3PHW B;  2WXQ A;  3TJP A;  3W8X A;  3R3M A;  4QJF B;  1P98 A;  3NVZ A;  3MR5 A;  1WH3 A;  3O0F A;  1WYW B;  3E9S A;  2JUO A;  5DBB A;  2KAJ A;  2CHR A;  9ICE A;  4UD8 A;  5HHI A;  3FW8 A;  5HR6 A;  5KFV A;  2XC9 A;  4U6P A;  3AE5 B;  3OJ3 A;  4NEV A;  5GRT A;  3PR4 A;  4KLG A;  1WJ4 A;  3PTF C;  3TAD C;  3ML8 A;  1KD0 A;  3JW7 A;  3MGI A;  8ICQ A;  2L32 A;  2RR9 A;  2Z0E B;  5JCM A;  1ZXI A;  4BZA A;  1F0M A;  5HMM A;  2ZIX A;  1T3N A;  3N28 A;  1NJX A;  3AE1 B;  3B0A A;  1O08 A;  2KD0 A;  3GB1 A;  4DSI A;  4QAY A;  4D2K A;  1G6J A;  4JDR A;  5FS9 A;  4P0P B;  2D3C A;  2AKM A;  4FO6 A;  4E4U A;  3MR3 A;  2CXY A;  3HWT A;  5KFT A;  1BQG A;  3KLS X;  4RQ4 A;  2GR1 A;  1QQ7 A;  3NVV A;  2BZF A;  1T7P A;  8ICZ A;  4LNI A;  5KT2 A;  4ZHO A;  1X42 A;  1PUZ A;  1EO6 A;  5BOF A;  5KT6 A;  2KFK A;  2KNB A;  4C4S A;  3OTQ A;  4PK1 A;  3SQI A;  4J6I A;  1ZMD A;  3GIK A;  2MBB B;  4GDK A;  4MGY E;  1ZQK A;  4EKU A;  1YX6 B;  3DGB A;  5KG6 A;  5AK3 A;  4Y2P A;  1YOV B;  4KPR A;  2MP2 B;  9ICV A;  4M6W B;  4KLU A;  2L52 A;  2RGF A;  3CT2 A;  3PGE A;  3SJN A;  2WXH A;  5FKA C;  5D2M B;  3BQT A;  3PWG A;  4EQW A;  4MHV A;  4HCD A;  1ZRM A;  3WK7 A;  2GSH A;  1KLV A;  5AE2 A;  1E0Z A;  3GD4 A;  2E5S A;  1NJY A;  4AOF A;  3I63 C;  2MBO A;  4RF1 A;  2FLL A;  3VDZ A;  2C7M B;  5J29 A;  4KGR A;  4JB3 A;  1TS5 A;  3NZS A;  2Y0S C;  1D8L A;  1IGC A;  3DOW A;  1WWU A;  5KFF A;  2ZPN A;  1SSN A;  4RNO A;  4GGB A;  3UXN A;  1NKC A;  3LDZ E;  2K3U A;  2R8D A;  1JWM D;  2KX3 A;  4JWM A;  4XDC A;  2RDG A;  5LLI A;  3RB0 A;  2KWD A;  3L5O A;  4DFD A;  1U49 A;  3FVD A;  5GXG B;  4L2Y A;  2MLB A;  2N9L A;  5D6J B;  1OGW A;  1H2I A;  3SMV A;  4QZC A;  2WS3 B;  3H8M A;  5D3I B;  2R8K A;  2QVH A;  5CHF A;  2RMM A;  5A0L A;  2XY6 A;  1V80 A;  1IBX A;  3TJ4 A;  4Y2U A;  1JIH A;  4GXI A;  4C0Z A;  5KT4 A;  3ZDE A;  2C3C A;  2PMQ A;  3OPX A;  1VJK A;  2G08 A;  3BS5 A;  1X9M A;  2OG9 A;  1GUA B;  2LD9 A;  4IW0 A;  3V6K A;  1WX7 A;  1LV5 A;  4M9N A;  4H4W A;  3RRA A;  3B1L X;  5KFM A;  8ICV A;  2OPJ A;  4EMI A;  5KVH A;  5KFD A;  2ZXI A;  2PJH A;  2RPV A;  3AE4 B;  2W9N A;  2JRI B;  2BS2 B;  4P0Q A;  2Y3R A;  1WCL A;  5KFI A;  1NPX A;  2P0I A;  2N7J A;  2AYO B;  3KWV A;  1V49 A;  4HNC A;  1D5Z C;  3BOX A;  2WLB A;  3MGH A;  4RGT A;  1UWX A;  2LGY A;  1J7A A;  2FE8 A;  4F91 B;  3SN4 A;  2IGG A;  4DFM A;  1ZMC A;  3QKE A;  2K6Q A;  1XCQ L;  1QQR A;  1UGM A;  2BKE A;  4I6P A;  1X1M A;  4HDQ A;  2O2V B;  3DHG C;  4X57 B;  2YVG A;  4A6Q A;  3CXO A;  3L54 A;  4IDI A;  4M8N A;  3QUQ A;  2BB6 A;  4M52 A;  5FS6 A;  3U26 A;  1U47 A;  5JCN A;  8ICB A;  2EAM A;  3Q3M C;  3IHP C;  1E8W A;  3T9P A;  1HJP A;  4II2 B;  3EUB 3;  3S1D A;  3RI7 C;  4PL2 A;  5HHH A;  4H4Q A;  1ET6 A;  4KMO B;  3VDG A;  1ZQR A;  1ECW A;  3SAG A;  4F71 A;  5KG2 A;  5DB7 A;  4ED1 A;  3S1F A;  3HSU A;  4YXM A;  2JH7 A;  1DOI A;  2BYE A;  1KLU D;  4KX5 A;  4Y2R A;  3KJM A;  4OJL A;  4MF2 A;  1E8Z A;  2R2Q A;  4DLG A;  1CK1 A;  2JWZ A;  2PLI A;  2BDU A;  2ESE A;  3QFB A;  5B5E U;  4E5T A;  1ZQG A;  3WCQ A;  2UUU A;  1MFW A;  2PEA A;  2IHM A;  3SR6 A;  4R8U B;  3RAX A;  4DNA A;  4R64 A;  1GRH A;  1NYR A;  4QZD A;  2V6O A;  2AL1 A;  3V4B A;  3V3W A;  4FJZ A;  3WKB A;  3K75 D;  3ETR A;  2XSX A;  2ZPY A;  2I9G A;  2G3Q B;  1KM7 A;  5AKI A;  2BWE S;  2MH7 A;  8ICK A;  2I1Q A;  3CSF A;  4KSL C;  1AWD A;  1XU4 A;  4GGH A;  2LBO A;  5KG5 A;  1D4B A;  3KH0 A;  2BBC A;  1XPY A;  1Q10 A;  2D6F C;  2PTW A;  4L1B A;  2KSO A;  4GLX A;  2FID A;  1UHU A;  4RPZ A;  1ZGU B;  2DPI A;  2PIA A;  1YEY A;  4OD0 A;  2IO1 B;  5JZE B;  2BKR B;  4OVU A;  3FYH A;  1LPF A;  3ZVI A;  1PVP A;  3SN1 A;  5KVI A;  2AQ4 A;  4H83 A;  3LVW A;  3UQ0 A;  4UB3 A;  3IXS A;  3Q8S B;  2M4N A;  1Q46 A;  3RJH A;  5MPO A;  3MR2 A;  4KDI C;  3KOO A;  2CJN A;  2PMZ C;  2C2E A;  1T8E A;  3AI5 A;  2JH1 A;  2DW6 A;  2HI0 A;  4BBN F;  1TKK A;  3QWZ B;  8ICU A;  1MBT A;  4C00 A;  1W1O A;  1ONE A;  1UCV A;  4LDT B;  1Q1W A;  2PTY A;  2VIX A;  3DIP A;  1COO A;  4LTU A;  2LGX A;  1ZJN A;  3D2Q A;  3R0U A;  2GWS A;  3DBS A;  2JK6 A;  1KTK A;  4E6M A;  3IP4 B;  1UUP A;  5ALE A;  1SB3 C;  2GOW A;  7ICU A;  4LVS A;  3JPN A;  2FCS A;  3L17 A;  3UJR A;  3TAP A;  4MFC A;  2ASQ A;  2EKE C;  4PJ0 U;  5ALS A;  7ICT A;  2RDI A;  2QKQ A;  4ECR A;  1XLQ A;  3PZ7 A;  4GB9 A;  4XWT A;  1C4P A;  3D9X A;  5KT5 A;  4F92 B;  4NAW A;  1SWV A;  5AKG A;  3N4M B;  1WXM A;  3JSV A;  3B08 A;  2GO7 A;  3PW7 A;  3JVZ X;  1XS2 A;  2J42 A;  2QIE B;  2WFA A;  1SB3 B;  3TBL D;  2HZG A;  3N6H A;  3ZIM A;  1N60 A;  4L23 A;  3TUO A;  3WAP A;  2ALZ A;  4KPL A;  5DG9 A;  2EKI A;  2MRL A;  2UVV A;  1WUE A;  4E74 A;  2KX0 A;  1AYF A;  2RDX A;  3DVG Y;  1IPG A;  4ITK A;  4J9N A;  4F2S A;  4A3R A;  5K8E A;  3PML A;  3NVY B;  1JPD X;  4DWI A;  3CK5 A;  2J0M A;  4XYC A;  4GIV A;  1ZQT A;  1FD6 A;  2IY0 B;  3I99 A;  4BWM A;  4M9J A;  2JZZ A;  4N6E B;  2VFS A;  2R18 A;  2OO6 A;  4QZH A;  1XNS A;  4QZB A;  1VZ7 A;  4F50 A;  3R9K A;  4RNM A;  3R7Q A;  1GOZ A;  2ZXH A;  1TE2 A;  1EWY C;  4UB4 A;  4NJC A;  2YEP B;  1J7B A;  1JW9 D;  3M1Y A;  3L4P A;  3BJY A;  1SKR A;  1Q0W B;  4YXD B;  3AXC A;  1AW7 A;  2KMA A;  5L6G A;  3GRS A;  3Q14 C;  4DXF A;  4YD1 A;  4MDK E;  4H1Z A;  4NWI A;  4K7Z A;  3QX7 A;  2HHV A;  2WXG A;  2CHZ A;  4KKJ A;  5ADZ A;  4XGA B;  3V7L A;  2QPM A;  3H8S A;  4RPY A;  1E8G A;  3M63 B;  5HQX A;  3ETL A;  5TSS A;  1NU5 A;  3T9L A;  4Q2J A;  3II4 A;  1HUO A;  2VJ4 A;  1URJ A;  1N61 C;  4Y2V A;  2PXI A;  2M19 A;  4J9Q A;  1TZZ A;  7ICF A;  4DQO C;  1MPE A;  1EWC A;  4YSX B;  2JZ3 B;  3PSP A;  2E8P A;  2KVS A;  4DL5 A;  2MBQ A;  2WP9 B;  3NHE B;  4A8X C;  2PTL A;  2XH4 A;  3FC4 A;  5ALL A;  4DFP A;  1ZQS A;  5L1M A;  3M8R A;  4KN7 A;  8ICN A;  1ISN A;  3NZU A;  3U30 A;  3ALB A;  2AU0 A;  2ZAD A;  3CYJ A;  3BVZ A;  4JIO U;  1XAN A;  2OJW A;  1SE3 A;  2YTU A;  1KBU A;  1U45 A;  2VZK B;  2WXP A;  4WWM A;  1BPE A;  3SFD B;  4ANV A;  3VH4 B;  4I2E A;  2WXK A;  2W8K A;  2BGW A;  2AH5 A;  1TY0 A;  5L6F A;  3QZ7 A;  3EHV A;  1XS9 D;  4A6G A;  3A7U A;  1PQS A;  3IFW B;  1L7M A;  3W5U B;  4NL9 C;  1M4V A;  8ICC A;  5DGB A;  3LWM A;  4RQ8 A;  3NS8 A;  4HRS A;  1VAO A;  3DQ0 A;  1VQZ A;  2YAU A;  3V5F A;  3ZQ4 A;  3UGV A;  1RDF A;  4CGZ A;  4UAU A;  3UMC A;  3H40 A;  1E9M A;  4RQM A;  2XGP A;  1GES A;  2K60 A;  2PTX A;  2NO5 A;  5KFZ A;  3VQI A;  3OHA A;  3QN3 A;  3OZY A;  2A1J B;  3C5G A;  4IWO A;  4P0P A;  3QUT A;  4ARI A;  4LNO A;  4NLK A;  2VRR B;  4ZCW A;  2XK5 B;  3BYT B;  1QT9 A;  1KEJ A;  3W1Y A;  2H3I A;  4UDU C;  3KHH A;  4ZH4 A;  9ICL A;  1SEB D;  2XID A;  3NZG A;  1Z4N A;  3ZRC A;  1VJ5 A;  1JQ4 A;  2N0S B;  2HHX A;  2LYA A;  4OVZ A;  5DDY A;  3TAD A;  5AZH A;  4ZOH C;  2F8L A;  1FNU A;  9ICK A;  4ECU A;  4OZA A;  1NKE A;  2GI9 A;  4ZRQ A;  1PFD A;  1CRX A;  3Q45 A;  1MRA A;  2MP2 A;  5JUM A;  4G11 A;  4M6W A;  3ZW3 A;  2AL2 B;  3Q6J A;  2HSZ A;  4OHJ A;  2EAO A;  4Q8E A;  3EFC A;  2ZIV B;  2ZG6 A;  2UVR A;  1UBI A;  4AUQ C;  2MSE D;  5KFO A;  3KD3 A;  1ARO P;  5IIO A;  2DZI A;  1A77 A;  5TR5 A;  2XBB C;  2FI1 A;  4ZRP A;  3EGR A;  1ED1 A;  4G7F A;  4JQW C;  3CYM A;  4B0M A;  3IDW A;  2MU2 A;  3FCP A;  1S8O A;  3PRZ A;  1GXF A;  4I2A A;  2OED A;  2IZV B;  3GII A;  1K1S A;  1GRT A;  2NBU A;  3VAW A;  4EX6 A;  1KOT A;  3QNM A;  1WGY A;  3GIJ A;  3GOE A;  2MNR A;  2IA6 A;  2D07 B;  4E71 A;  4KGT A;  1N5X A;  4A9A A;  3IHQ B;  3QA8 A;  1U4B A;  3ZO5 B;  3BQ1 A;  1SXD A;  2KOX A;  2F1I A;  5J0O A;  3SI8 A;  1L0V B;  2WXL A;  2HQM A;  3UXK A;  3C2M A;  2NPX A;  2E8N A;  1STZ A;  2PP0 A;  2JZP A;  4IT1 A;  4XWW A;  4CF5 A;  9ICU A;  1ZOY B;  4K7U A;  4BJQ A;  4BUR A;  2XH7 A;  1AAR A;  4K1W A;  2LJI A;  3QZ8 A;  1TYG B;  4G0N B;  3H0M B;  2AJQ A;  2LEK A;  4GRT A;  3PO4 A;  4Y2Q A;  2EQY A;  3TAC B;  3U9I A;  3TAR A;  1X9S A;  3H0R B;  2RHF A;  2N7E A;  4Z6E A;  4CDG A;  1FM0 D;  2WYQ A;  4ICV A;  3DWG C;  5CP2 A;  2CDU A;  3PST A;  4H50 A;  2KQ4 X;  1I7H A;  2NQL A;  2KDB A;  2K39 A;  1YT3 A;  3Q8C A;  3RB3 A;  2H3F A;  5KFK A;  3URH A;  4J3O D;  2JXT A;  3RT3 B;  2G0A A;  5FJR A;  3UJE A;  1ZOL A;  2WP6 A;  4EMW A;  2O2V A;  1FCL A;  2N7D A;  4WAF A;  3OJS A;  3C19 A;  3WKE A;  3V5C A;  4IP5 A;  1BZL A;  1Q1R A;  4DHG A;  1SXT A;  1F9J A;  3IJQ A;  3RFZ B;  3R66 C;  1ZQA A;  4AJW A;  2BT6 A;  3F5E A;  4UBB A;  1TK8 A;  4NAM A;  4M47 A;  4RGO S;  2R8J A;  1A5R A;  1F0X A;  4F4Y A;  2F2A B;  1D9D A;  1JXL A;  1WWV A;  3AEG B;  1UT5 A;  3TI0 A;  5T14 A;  3VH3 B;  2I0K A;  2GBN A;  4C7Z A;  2WGS A;  2Y9U A;  3M6Z A;  1YX5 B;  2KYW A;  1QLN A;  2BTE A;  1KSP A;  3HIL A;  2JEJ A;  3HM3 A;  3ES8 A;  1IM4 A;  2XY7 A;  1S0N A;  2Q4W A;  2E8M A;  4C56 C;  1E0Y A;  9ICP A;  1QLU A;  4ECV A;  1DNC A;  3OZM A;  1UPH A;  4G3X B;  1TIF A;  5AKE A;  3WAL A;  4FA6 A;  1A70 A;  3BQ2 A;  2GDQ A;  5C23 A;  3DER A;  2Y9T A;  1D9F A;  1V86 A;  2L00 B;  4W9K A;  3DES A;  3PG6 A;  4KLD A;  4IRC A;  2L5Y A;  1LM8 B;  4H4T A;  4IQT A;  4R8U A;  2W7O A;  1YZ7 A;  1UA0 A;  2RDB C;  3U4E G;  2QIL A;  4ACF A;  3ZDM C;  2HCF A;  2N9X A;  3MY9 A;  5AE3 A;  4ED8 A;  4MFA A;  3H7S A;  2OZT A;  1L7Y A;  3X23 A;  2NRV A;  1S9F A;  2PP1 A;  2WF6 A;  3RJG A;  4I27 A;  2ZCB A;  3RN9 C;  4LII A;  4MH8 A;  3ZTD A;  1C76 A;  2W43 A;  1X2I A;  4UAS A;  1ZDX A;  8ICX A;  3I57 A;  2KV2 A;  2KN4 A;  1E5W A;  1Z2M A;  2KEY A;  4MSM B;  1SGG A;  2DEN B;  2UYZ B;  3HT3 A;  2O3G A;  3LYY A;  3DGH A;  3K1R B;  4HVB A;  2P3Z A;  4EEK A;  1JRO A;  2ISP A;  1FRD A;  2VFV A;  4NLN A;  4RNA A;  2ASL A;  5CEH A;  4HWI B;  4M00 A;  3TFR A;  1I4X A;  2W3S A;  1YQ3 B;  4DS4 A;  3W2D A;  4DF4 A;  2GOL A;  1TK0 A;  3H8H A;  2JX5 A;  5KFQ A;  1WZ3 A;  4Y2J A;  2V4L A;  2KXJ A;  3Q3O C;  5ALV A;  5J0T A;  1KF6 B;  1WMH A;  4ED7 A;  1WGD A;  3ISB A;  1AN8 A;  3RNC C;  3UJ2 A;  2OKT A;  4W9I A;  4KLT A;  2K8A A;  4DL7 A;  4HNL A;  4FHK A;  4BVU C;  3KWL A;  2LI5 A;  3GZN I;  1JUD A;  1ZQX A;  2KIC A;  5AIB A;  3DDM A;  1RLF A;  2DF4 B;  3VCC A;  1S3S G;  3N4E A;  3N7P D;  2NRT A;  2WNM A;  1TKY A;  4Q8F A;  4C7Y A;  4YN4 A;  4HG0 A;  2LGI A;  7ICK A;  1ENF A;  4CHK A;  5F9L A;  4DL4 A;  4JV1 A;  2L83 A;  4BOS C;  4A90 A;  1T0R C;  2YQU A;  2EZX A;  3GQC A;  2PFO A;  2NBW B;  1UXY A;  5HP4 A;  2ASJ A;  2AGQ A;  1TJE A;  1WXV A;  1YN5 A;  2MJD A;  3I3T B;  1RAX A;  3MC9 A;  3T6C A;  1XO3 A;  1GPX A;  4KLM A;  3F2C A;  5DPW A;  2AXR A;  2GR2 A;  3SHQ A;  3PV1 A;  2R9Z A;  2RP5 A;  5TR3 A;  2HOI A;  5ALF A;  7ICS A;  3IT6 B;  2JHD A;  3QU4 A;  3AE2 B;  2PW9 A;  3G6V A;  1Z00 B;  1L7N A;  5HFY A;  2GGI A;  1OQQ A;  5JCL A;  2BB5 A;  3DK8 A;  1PDZ A;  4OW0 A;  3Q3J A;  3TWA A;  2RAB A;  5FXP A;  2A19 A;  1K53 A;  4J9R A;  4J03 A;  4GYP C;  3P3B A;  1HZ5 A;  1QQ5 A;  1NDD A;  9ICR A;  2JU6 X;  1IV8 A;  2G4S A;  4PHP A;  4WAA A;  4YSY B;  3RNB C;  4KWS A;  3EJB B;  1TAM A;  4TV3 A;  5DB8 A;  2PS2 A;  4K2S A;  3NVY A;  1C78 A;  2ZZ0 A;  4ED0 A;  4RGM A;  3BW7 A;  2DZK A;  4HPL B;  3QHT A;  1Z3E B;  1XO0 A;  7ICN A;  2V3S A;  2XN9 C;  4I6L B;  3RMK C;  4YP3 A;  3WAN A;  2HHU A;  2DZJ A;  3H4D A;  1V1P A;  3TQP A;  2KD1 A;  2G06 A;  1B4F A;  4BFR A;  3GV5 B;  4I2C A;  2ODG A;  3N32 A;  4I2I A;  5JXV A;  5FJO A;  5AUI A;  4FE3 A;  3PPA A;  3ZLZ A;  2VFU A;  2GR3 A;  3QTP A;  2WAQ F;  1KQQ A;  3QLD A;  1X6J A;  4B9V A;  4M9L A;  1RWS A;  2MBE A;  1MN8 A;  2WHE A;  1V9J A;  2JXX A;  3L3F X;  2PFP A;  1B9R A;  4F8C B;  5C3J B;  1NEK B;  4UAT A;  1L3S A;  2ZUC A;  4KLF A;  1WX9 A;  4YR0 A;  3DFY A;  3SSZ A;  1MHX A;  4NJ8 A;  3TAN A;  3SEB A;  1P43 A;  3MC0 B;  3Q8R B;  2N4F A;  4LA1 A;  1CMX B;  3UQA A;  1D5M C;  2R2O A;  4JX1 C;  8ICT A;  4N59 A;  2DL0 A;  5D79 A;  4J57 A;  4TVY A;  5DDM A;  5HHZ A;  1NZP A;  3DBR I;  2K8C B;  2QAR B;  2NMQ A;  2C3D A;  3EZ5 A;  4J9S A;  4PYU A;  3V6C B;  1BPY A;  2DYB A;  3HVZ A;  1D8B A;  3FV9 A;  4HXD A;  2IDY A;  3DJJ A;  3HK0 A;  1TBE A;  2GGG A;  5HI1 A;  3RH5 A;  1P9D U;  3IAS 1;  3QEB Z;  5KAI U;  1Q3V A;  2ZZP B;  2V0G A;  1KKX A;  3S2A A;  1R7S A;  4XX5 A;  2K22 A;  1N61 A;  2VH1 A;  4KLL A;  4DHZ B;  4F4R A;  3DJG X;  3ZJT A;  2LUE A;  3U8Z A;  1BXT A;  3A9K B;  3AED B;  1PZN A;  4MEM A;  5TIS U;  4A20 A;  5IN7 A;  3PM9 A;  3A0H U;  1NKB A;  4O95 A;  1VR9 A;  3NZ3 A;  3DK4 A;  2ES6 A;  2C22 A;  3Q8K A;  2WF8 A;  3GZF A;  2OH2 A;  4WJN A;  4H2H A;  3PLV A;  3QUC A;  4EEN A;  4GXK A;  2XEW A;  4H2A A;  2HTH A;  3RH6 A;  4NQK E;  1IUE A;  5J0R A;  4P7I A;  3TQ1 A;  2A1J A;  2K5P A;  2DLB A;  4M9H A;  3VUW A;  4DHJ D;  5I1W A;  7ICP A;  4OJP A;  3POP A;  3NOB A;  2BQU A;  3JW0 X;  2XK5 A;  5KTQ A;  3ONS A;  4CQN A;  2H88 B;  2GBM A;  2G5H B;  3NFU A;  3T79 A;  3OSP A;  1ZRN A;  4NL9 A;  1ZUD 2;  3DK9 A;  1ZQV A;  4HPN A;  2AQ2 B;  1K1Q A;  5EWF A;  1GAQ B;  5KHQ A;  2GL5 A;  3MAB A;  1MG4 A;  4ANW A;  2D11 A;  2FNJ B;  2Y3S A;  2QMT A;  2I1K A;  1CZP A;  3H9D A;  1A76 A;  2ZVN A;  2NYV A;  5KG1 A;  1NK7 A;  2D5G A;  2AL2 A;  2VA3 A;  2KDM A;  5CTR C;  2NRW A;  2I6X A;  1TKD A;  4LNK A;  2ZIV A;  4IKG A;  1T5X D;  4C4T A;  2F1J A;  3AEV A;  3GY1 A;  1HIW A;  4RUA A;  1ZDV A;  4KX6 B;  2P8B A;  4W9C A;  4FI4 A;  3NUH B;  1XWL A;  2GBR A;  4K8D A;  5L1I A;  1JWA D;  4I29 A;  2OAI A;  4F4K A;  3RJI A;  1F9C A;  4IL0 A;  2VH2 A;  2GR0 A;  1A0P A;  4RQ7 A;  1AHV A;  4IM2 A;  3GV7 B;  2XH0 A;  4DSF A;  3SQP A;  1JEH A;  4AYB C;  1RRB A;  5KFN A;  3GFK B;  1HTQ A;  2FE9 A;  2BS4 B;  2OYY A;  9ICM A;  5J2I A;  8ICI A;  5D94 A;  3ZVV A;  1ZQW A;  4G50 A;  5G5H B;  1BPZ A;  5F9N A;  1JAL A;  5G5G B;  2IOH A;  3L8K A;  3AMZ A;  1FEZ A;  1Z4O A;  3UM9 A;  4BX9 C;  2DPJ A;  1WSP A;  4Z6F A;  4JV2 A;  4JUZ A;  4KN4 A;  2KOB A;  3WKD A;  5EWE A;  2NTT A;  4EZJ A;  2KT7 A;  1LXD A;  1VZ6 A;  5KG0 A;  4PYT A;  3RCY A;  3H6N A;  4KLE A;  2ZJD A;  4NLZ A;  4MGI E;  9ICA A;  1BNP A;  1F2R I;  1QLT A;  3SZ2 A;  3C0R B;  1RQN A;  2KNJ A;  3TTE A;  2WXF A;  2F5Z A;  1OW5 A;  3VA8 A;  2H3V A;  3PRP B;  5KFE A;  1KFT A;  1N63 C;  4DXA B;  3SU8 X;  1GET A;  5AKK A;  2OM6 A;  1J0G A;  2KIV A;  1EBD A;  3P4Q B;  2J0J A;  4C8L A;  2FJ6 A;  2IPK D;  1S5L U;  3K9P B;  3PSI A;  2WXR A;  9ICF A;  5GTI U;  2KJH B;  4FXC A;  2BCV A;  4EZL A;  1ZR6 A;  1V97 A;  3JPT A;  2OQY A;  3JVA A;  3APD A;  4IUM B;  5KFW A;  2ZUB A;  3RB4 A;  2VFT A;  2W04 A;  3RIT A;  1QOA A;  1WR1 A;  3KW5 B;  5AM5 A;  2KMC A;  2E8O A;  5AKH A;  1W1S A;  1YD8 U;  4OJO A;  5EE3 A;  5AM3 A;  2Y08 A;  3DBH I;  1L4Z B;  4MGK E;  5BMG A;  1KFD A;  3TEW A;  3ZJV A;  5IDZ A;  1ZQU A;  5KFH A;  3Q8F A;  1Q5W B;  5KFX A;  3V60 A;  4AQ7 A;  1EC8 A;  1WCN A;  3STP A;  2ONE A;  3C8Y A;  4MMW A;  3SQS A;  2N1W A;  4MEX A;  4DSE A;  5E6J A;  2WQY B;  3FW9 A;  1GB1 A;  2F8K A;  1Q3U A;  5KL8 B;  5IIK A;  5J0Q A;  1OTR B;  1YNT E;  3DVN U;  5D46 A;  2HJ8 A;  4IC9 A;  5BOL A;  1MG8 A;  1ZD3 A;  1WRI A;  5FXD A;  2VAN A;  1KKO A;  1WRD B;  1JWB D;  2DWQ A;  4FLH A;  3TEZ A;  1N2X A;  2N1R A;  1UQV A;  2WF9 A;  4JMU A;  4ZA0 A;  1V9P A;  2JZB B;  3QAQ A;  3WIM A;  1SL1 A;  3T8M A;  3EJD B;  2WXN A;  3Q8A A;  3QQ8 B;  5III A;  1WVF A;  2C5L C;  3H8J A;  3RB6 A;  5ALJ A;  5AWV A;  3N1X C;  4QW8 A;  1PUT A;  3TOY A;  3DV9 A;  1FNV A;  3AE7 B;  4FJV B;  2WB1 C;  1BWC A;  4GXJ A;  1MHH E;  3MC1 A;  5KL1 B;  2FAZ A;  4ASW C;  3T8Q A;  3OJU A;  1OXJ A;  1DK2 A;  1GRE A;  3BVG A;  5U25 A;  4K3C A;  1SZH A;  4QIW F;  4ED2 A;  3H8A A;  4F4X A;  2K6D B;  4ENL A;  4EQX A;  2HXT A;  2M1M A;  2XCP A;  3P4S B;  3RNA C;  4WWP A;  1PK3 A;  3D47 A;  5E79 U;  3ZDC A;  2FPK A;  1J7C A;  1ECQ A;  3FJ4 A;  4P4O A;  1MVK A;  4HJK A;  4O3Q A;  4LJP B;  5DQG A;  3U7D A;  4M2Y A;  2BCQ A;  4MH0 E;  3P63 A;  3CNH A;  3UXL A;  2C2D A;  4I2J A;  4XRH A;  2ZC8 A;  3M7D A;  4RT2 A;  5BYQ A;  3OPS A;  4IL6 U;  2L05 A;  2CN1 A;  1ZD5 A;  2UVU A;  3V7K A;  4TUU A;  4UB6 U;  1Z1V A;  4DL3 A;  4TQR A;  2YVC A;  4MGG A;  1X9W A;  3E2E A;  5FJT A;  3IN5 A;  1V5T A;  1EU3 A;  4MEL A;  2X8H A;  2K4I A;  3NXL A;  3TSH A;  1WI0 A;  2LXA A;  2PKO A;  4DOB A;  2GRT A;  3CAW A;  2MBH A;  3ML9 A;  3EEZ A;  3DVN V;  4HKZ E;  1C20 A;  1KCZ A;  2WF5 A;  3PX4 A;  1F1H A;  3ISC A;  2BR0 A;  1ZQC A;  4Y2X A;  4P4P A;  4F72 A;  3KUD B;  3PLU A;  1WZ0 A;  1DZN A;  8ICE A;  3ZNH B;  4DK5 A;  1K5O A;  1RM6 C;  3RNG C;  3PMN A;  4G3I A;  1QQ6 A;  4IC7 B;  3BQ0 A;  5H92 C;  5J8Y C;  2RQ5 A;  4I2D A;  1TV9 A;  1UNS A;  2V4I B;  3BDP A;  1I42 A;  4F3O A;  2PMV A;  3Q4D A;  3AU6 A;  3QU5 A;  1Z00 A;  3EEC A;  3ZTC A;  2M8S A;  3VVW B;  5JRB A;  1E6E B;  2DZM A;  1AHZ A;  5IIM A;  3PFR A;  3IV6 A;  4O3N A;  4JE3 B;  5CWR A;  1F0Z A;  5DLF A;  3VR8 B;  3APC A;  2BYT A;  4C8K A;  3MDA A;  4K3B A;  3QEA Z;  3CGC A;  1NNL A;  4IL2 A;  3GIM A;  2KJ9 A;  1SGH A;  5CR0 A;  5HML A;  4PS3 A;  1L3T A;  3C1Y A;  4YTN B;  1KDH A;  1PDY A;  1RM6 B;  4CO7 A;  4W9L A;  1ZQP A;  3BIN A;  4PS8 A;  5DQI A;  3DHI C;  2Q85 A;  5AK5 A;  4JWU C;  2BPF A;  8ICA A;  3BS7 A;  4J9L A;  5IIN A;  2BPS A;  2K1F A;  3S5S A;  3KZX A;  1L8L A;  4LZG A;  2FMS A;  1TGZ B;  9ICX A;  2EMS A;  3GE3 C;  5HNK A;  3THV A;  4KV2 A;  3PW2 A;  4GYP A;  2W0H A;  4QZF A;  5J2R A;  1AQ6 A;  2AL6 A;  3AV8 A;  3I6T A;  4YG2 A;  2GGH A;  4MM3 B;  3MJW A;  3NRZ B;  4XLO A;  9ICC A;  1XD3 B;  3KHR A;  3B9J B;  4NLC A;  1R4M I;  5IO9 A;  4A3O A;  4TVW A;  2LPE A;  4IR9 A;  1TZO A;  2PE6 B;  4O5C A;  3RUI B;  3KKA C;  2GGE A;  2OX4 A;  1STE A;  4QWE A;  2KQ7 A;  2K8C A;  4I2G A;  1WUF A;  4Q44 A;  3PZP A;  2QAR A;  4BC7 A;  4PVH A;  4WJP A;  1L5U A;  4ZRK A;  1DOQ A;  2FPM A;  8ICO A;  3N1Y C;  4YMM A;  1CUK A;  4RF0 A;  4W9F A;  2C7H A;  4IP4 A;  2PI5 A;  2WOI A;  1SE4 A;  1GRB A;  1YQB A;  3FM9 A;  1B1Z A;  2WWZ A;  2AHO B;  3BY4 B;  3I28 A;  1TS2 A;  3BK1 A;  3QAR A;  3NS1 B;  2PGE A;  4LLG M;  2PP3 A;  1XF5 L;  2K4H A;  4PT5 A;  2HOQ A;  1ZQO A;  3A9K A;  1K51 A;  1KL9 A;  2W9M A;  3N97 B;  2EEL A;  4FZN A;  2OQH A;  5FMH A;  3VC8 A;  2N9K A;  3DWM A;  1T0S C;  2DX5 B;  3JPR A;  2LM4 A;  4R3D A;  3IAM 1;  4ECY A;  2FMP A;  4KGS A;  2IY1 B;  4YMN A;  3TL5 A;  3FAH A;  2NV3 A;  3B2G A;  4DOA A;  1V6E A;  1WUD A;  4FBT A;  3EA6 A;  3V61 A;  2CPR A;  2NVU I;  2KTR B;  1S0O A;  2N9E B;  1AHU A;  4JB1 A;  1PGA A;  5JTI A;  5L1K A;  1GRG A;  4M9G A;  4UW9 A;  1FXA A;  1EM7 A;  5H8Y E;  2IGH A;  2P66 A;  3R2I A;  4FS1 A;  2KP7 A;  1PDX A;  5ALH A;  1ZQH A;  4TSS A;  2D3D A;  2QC8 A;  8ICL A;  3CW2 C;  9ICH A;  2WX0 A;  3OAW A;  1I4P A;  4IM3 A;  4CRX A;  3CGB A;  3TFS A;  2ZTC A;  4TQ0 A;  1T3Q C;  3EF6 A;  2BVG A;  2NBV B;  1T94 A;  2B21 A;  4FAD A;  3K1Z A;  5BOE A;  3OSN A;  4JK1 A;  3C28 A;  3JPP A;  2M9N A;  3KZI U;  1GG3 A;  4DFK A;  3M95 A;  4FHJ A;  3UGB B;  3RZF A;  4DDI D;  3F5A A;  1ZQQ A;  2HHW A;  3TEX A;  2GQW A;  3M62 B;  4C8N A;  4WJQ A;  1QSY A;  3RR1 A;  3FWA A;  3NO1 A;  4AP4 C;  1SXE A;  3GZN B;  2IO3 B;  3H1U A;  4RM8 A;  5J2F A;  4GC6 A;  3SFE B;  3VHT C;  4QZI A;  1BNO A;  4PZF A;  2E1E A;  4EWJ A;  4DL2 A;  1XCT L;  4NY0 A;  5AM2 A;  3ZDB A;  4M0X A;  1ZJM A;  4IRD A;  3C23 A;  3PSE B;  1B0X A;  2M0X A;  4CNQ A;  2WPF A;  1BVS A;  2IOF A;  4U7C A;  3PR5 B;  4C4R A;  3AEB B;  8ICS A;  1L8P A;  1SF0 A;  3DDC B;  1W1M A;  3LK9 A;  4K7W A;  4K81 A;  3QU7 A;  1L6U A;  2QJL A;  4REZ A;  3AQE A;  1WFY A;  3B0Y A;  4I2F A;  5DPR A;  1E8X A;  4A35 A;  2KKP A;  2KZZ A;  2ZIW B;  3VUY A;  5G5H A;  5G5G A;  5J2E A;  4E8G A;  2PLP A;  2W9C B;  4RM9 A;  3CRX A;  1E7V A;  3ZLH A;  5AKJ A;  3G6Y A;  1E7U A;  1BML C;  4EBC A;  4QNL A;  3KQ4 A;  3ZRF A;  3TCS A;  4ELT A;  3MTN B;  4DEZ A;  3UPQ A;  3GU3 A;  3NGD A;  2J7Q B;  1Z5S B;  1WXS A;  1D5X C;  1TKE A;  1V8C A;  5IOI A;  1HE8 A;  2KG5 A;  3GRT A;  2XVT A;  1WM2 A;  4F4W A;  3FDS A;  3B0X A;  1FO4 A;  3MWC A;  3PVL A;  5D3D A;  4EZ6 A;  4K8G A;  3G6X A;  3HPF A;  5BPC A;  4HCN B;  3L5K A;  4Z1Y A;  2K8B B;  4B0E A;  4QWA A;  1KH0 A;  1YQ4 B;  1BUI C;  2J0K A;  1NJW A;  1L3V A;  4YSZ B;  5JHB A;  2BWF A;  5KFJ A;  2MUT B;  1ZQF A;  1V59 A;  5ALG A;  2DUY A;  1I4H A;  4RU9 A;  2MX2 A;  5DBA A;  3LYS A;  3NY5 A;  3GC2 A;  3AEA B;  3ZVH B;  2JV3 A;  3FKY A;  4B95 A;  1IYF A;  1KLN A;  3R25 A;  4F5O A;  1ZDL A;  2B3A A;  2OWO A;  3C29 A;  3PSF A;  4EZ9 A;  4IWQ A;  4C4V B;  4I2H A;  2EXR A;  3I6E A;  4DYE A;  1N63 A;  1C1Y B;  3L16 A;  3DBR B;  3ZNZ B;  2XO7 A;  2BKF A;  1NK8 A;  4KIK B;  4PS7 A;  1N62 A;  5BOM A;  3ZJU A;  1HUZ A;  1B43 A;  5EE1 A;  3VTE A;  2ZJA A;  2NO4 A;  1TK5 A;  4BWJ A;  5ALX A;  4NLB A;  4CF4 A;  5IKC M;  1FHV A;  5DB6 A;  1HEK A;  4OO1 J;  3OC4 A;  2WU2 B;  1TYT A;  1ET9 A;  2GGJ A;  2ZW0 A;  2EDU A;  4H19 A;  4DSL A;  1NDA A;  3KYC D;  5ALI A;  2IYD B;  1OEY A;  5JHA A;  1RXV A;  3URY A;  1L7P A;  1GRA A;  2JZB A;  1PVQ A;  1DXS A;  1GNU A;  2KKC A;  1PK1 B;  1Q8K A;  2MSN A;  4KIT B;  1SJC A;  2YVF A;  1FIQ B;  4TUR A;  4UB5 A;  2J4X A;  4AP9 A;  2KDF B;  3RGT A;  3A7A A;  2SEB D;  5HKH A;  4PYZ A;  3HPO A;  2KZR A;  5LXI B;  4QWD A;  5JU5 A;  1N6Z A;  2P4P A;  2C60 A;  3ZKJ C;  3GIL A;  4K4G A;  4J3Z A;  1QH9 A;  1DK3 A;  1UT8 A;  4DO9 A;  2GRI A;  1R4N B;  2KDE B;  1GC6 A;  3PVX A;  3ES7 A;  5BYR A;  3V6E B;  4EX7 A;  2V3N A;  2KZM A;  1V85 A;  2I38 A;  3GO2 A;  4GGQ A;  1DOX A;  1KFS A;  3RBE A;  9ICG A;  4P1C C;  3A0B U;  1WE6 A;  3IK4 A;  2XIC A;  2JYT A;  3PZ8 A;  2ACZ B;  2OZ3 A;  2D3B A;  2H5X A;  3PRM B;  3HKZ C;  3D2J A;  3GSY A;  4KVG B;  1ZET A;  1FCC C;  1T4G A;  4NNJ B;  5J2K A;  7ICI A;  1WE7 A;  4LDT D;  4UAR A;  3TEY A;  2XY5 A;  2AGP A;  2G45 B;  1JMS A;  2MAX A;  1KJT A;  5KT3 A;  4LCD E;  3SD5 A;  4BBN C;  4DHJ B;  1KN0 A;  2HNE A;  2UWQ A;  2UUV A;  3AUL A;  4HCP B;  4YVZ A;  2HJ1 A;  3HX0 A;  2JEF A;  5FR6 A;  3RJK A;  1V5O A;  3KTQ A;  2IJ0 A;  2M0A A;  5T8I A;  4X2P A;  3RJA A;  1L8O A;  1K50 A;  1SIJ A;  4BKS D;  4EFO A;  3DED A;  2KVR A;  5LNK 1;  4FS2 A;  2CS4 A;  2WXM A;  4IZG A;  3X0W A;  4XA5 A;  3PW0 A;  2LAS A;  2Y5C A;  4XDD A;  5AKL A;  2MRP A;  3J9C A;  3PW5 A;  3LVV A;  3JZU A;  1FFV C;  2G4D B;  4YL8 A;  1DII A;  4JV0 A;  4FN2 A;  1XSP A;  5KFG A;  1W1K A;  4OAL A;  1L5P A;  3EC8 A;  3SYZ A;  2K25 A;  4WQM A;  5F3X B;  2PLS A;  2CR5 A;  3R2T A;  1WG8 A;  1F2R C;  2O6V D;  3RBD A;  4GFJ A;  4O3S A;  1C79 A;  4YWS A;  3E56 A;  4JN8 A;  2POD A;  4Z17 A;  2DQN B;  2IBK A;  5AI0 A;  2KIW A;  3V62 A;  1OFF A;  4AYB F;  4M02 A;  4J56 A;  1EC9 A;  2JXJ A;  4AS1 A;  1LQB A;  3KFU F;  2FUH B;  3L0W B;  4N58 A;  3ECI A;  3VRA B;  1E9I A;  2HXU A;  3RO6 A;  1FRR A;  2P6U A;  3I9V 1;  1GEU A;  3SDL C;  5ALT A;  3RTV A;  4W9H A;  4KZC A;  4UB2 A;  4B6W A;  4E3C A;  2C9W B;  3WKA A;  3HVD A;  2WDV B;  2LGS A;  1Z1B A;  2LHT A;  1P48 A;  4OCZ A;  1CI4 A;  1R6W A;  1S1Q B;  4XUS A;  5J8Y A;  2G09 A;  1SBB B;  1LGR A;  5EWG A;  1IXR A;  3M3J A;  1S77 D;  3VTU A;  1U48 A;  2RDJ A;  2WXO A;  1V38 A;  2MBR A;  1WX8 A;  3DGZ A;  4H4Y A;  4TUP A;  3F53 A;  5KFS A;  1H38 A;  4RUC A;  5AKX A;  1NK4 A;  1J2N A;  3DVG X;  4CYE A;  1I35 A;  2GBK A;  5EOZ A;  3AU2 A;  4CE6 A;  4YMO A;  4B9K A;  4ZRI A;  3S47 A;  3I1Y A;  4GMV A;  4TMA B;  1ZY8 A;  2MUC A;  2YN4 A;  2HHT A;  2CHW A;  2V3B A;  1ZQZ A;  2BPC A;  3NRZ A;  3M9M B;  3CIR B;  4MM3 A;  2D8C A;  3DBH B;  2Q4T A;  4RQ3 A;  2KC1 A;  3AQF A;  3B9J A;  1SJE D;  4ZYS A;  2ZIU B;  2KAN A;  4KZ0 A;  4IWP A;  5J04 A;  2VKQ A;  2YMQ A;  1ZX9 A;  3TW9 A;  2MW5 A;  2DW7 A;  3TSJ A;  2LVQ A;  3RYT A;  2WDW A;  4AJY B;  2MJ3 A;  4FBJ B;  4FDC B;  4EQS A;  1DGS A;  3SD7 A;  2KHQ A;  2DGZ A;  1CJE A;  3B2F A;  2BVH A;  2ATL A;  2PGW A;  3SN0 A;  4UB8 U;  1FMA D;  4I6N B;  2FPL A;  1HQR D;  2JSV X;  3ZNG C;  9ICW A;  1L6N A;  2R2Z A;  3BII D;  2FBW B;  2Y0S F;  2EAP A;  4BOZ B;  5D49 A;  3ENL A;  4PGX A;  1MSW D;  2YB1 A;  4GIR A;  3Q8L A;  3WA0 A;  3CXB A;  3EAO A;  4BGD A;  4RCO A;  4C8O A;  4FZL A;  3RCZ A;  4TQ1 A;  2K4P A;  3NS1 A;  1P0R A;  2WHI A;  3ZLG A;  3DQV A;  1RPL A;  1SWW A;  2DAJ A;  3KKA A;  2QJM A;  1DIQ A;  5AI5 A;  2Y1I A;  5AUK A;  3PS6 A;  3GD3 A;  1CQV A;  5IAA C;  3LDA A;  2INP E;  3W9C B;  2Y4G A;  1YJ1 A;  1K4Q A;  6ENL A;  2R8I A;  2P8C A;  1EF5 A;  1RFA A;  2MJE A;  4M0W B;  3MSY A;  2FYM A;  5KFB A;  3Q6B A;  4EMJ A;  3SR6 B;  1T6B X;  1NI3 A;  1C3T A;  3D2S A;  2KTR A;  3DFH A;  4BCA A;  4CCH A;  1FEH A;  5G55 A;  3F2D A;  3S1C A;  1MA7 A;  3ZXV A;  1TAU A;  1SJD A;  3CGE A;  4DCC A;  3ISD A;  4JQ9 A;  4DQI A;  2NRZ A;  4QZ8 A;  4OJ6 A;  4FX9 A;  1SV0 C;  4ECX A;  3MJ5 A;  1SL2 A;  1JX4 A;  1LVL A;  2PTZ A;  1JI7 A;  2V1Y A;  4MGZ E;  4O3R A;  4R65 A;  5J0X A;  4HYK A;  4RMA A;  4HPM B;  5JCI A;  4OZB A;  2BC1 A;  3CGD A;  1DXL A;  4Y2S A;  2KK0 A;  1XLO A;  2M56 B;  2OVL A;  4IHC A;  4YTM B;  4OJ5 A;  1PVR A;  2FDR A;  2RLT A;  4URK A;  3U52 E;  2I2Y A;  2H3Z A;  2VA8 A;  1E8F A;  2BS3 B;  5AI9 A;  5J2A A;  5L1L A;  4A8E A;  4O1N A;  2LMR A;  4FFD A;  1ZQD A;  1S10 A;  4A55 A;  3J81 j;  1JXE A;  3N1Z C;  2PSN A;  5IP4 D;  1T3Q A;  3Q3F A;  3AE8 B;  4KX3 A;  4JAY A;  1RYR A;  5KFC A;  2F77 X;  4Y2Y A;  1BPB A;  3UI3 A;  3AEF B;  4F5R A;  3H7P B;  4XE0 A;  3PT2 B;  2D10 A;  4YFK A;  1NZB A;  3RZW C;  2P88 A;  3LXF A;  2KAC A;  1GB4 A;  3LWL A;  2BQ3 A;  1GSN A;  4M6U A;  4ECZ A;  2WDR B;  3S6J A;  3KUZ A;  3I76 A;  4YD2 A;  3ZNI D;  4GR1 A;  2ZIW A;  4J9M A;  1QSS A;  5JCK A;  7ICQ A;  3R1Z A;  2F3N A;  2W9C A;  2ICI A;  3PO5 A;  4RQ0 A;  5AK4 A;  3KHL A;  2EMT A;  1TAQ A;  4ZRJ A;  1FEB A;  5ALP A;  4PL1 A;  3QCA A;  3ORY A;  2GBJ A;  2QQ6 A;  1L2N A;  3PNC A;  3M8S A;  1K8R B;  2QGY A;  1L0Y B;  1JRP A;  3BSM A;  3L08 A;  3O0H A;  1WGG A;  3T3F A;  4B9N A;  3BWU D;  1ACC A;  5ALQ A;  1NK9 A;  2PFQ A;  2GB1 A;  3LB8 C;  2CHX A;  4YCX A;  3DBL I;  3D2H A;  2HE7 A;  1Q1O A;  2ZTE A;  1MNS A;  1RVK A;  7ENL A;  1QCK A;  8ICR A;  2K8H A;  2ZW1 A;  4HJG E;  2K8B A;  2MEK A;  4WIP A;  4EE2 A;  3SEN A;  3NVW B;  4JWN A;  4W9D A;  2IBI B;  3MHZ A;  4BAX A;  1GO3 F;  2P13 A;  2KMD A;  2BQQ A;  2QB0 B;  4F5P A;  4B9U A;  2WXJ A;  2ZEQ A;  2WOW A;  2MUT A;  4LNN A;  1IGD A;  1TT5 B;  3W1S C;  2E6X A;  1I4G A;  4EOY A;  4B9T A;  3VC5 A;  2PMZ F;  2PKE A;  1RFK A;  2GLS A;  3IRU A;  5DLG A;  1D8Y A;  2LXC A;  4RFB A;  5I4D A;  2QAE A;  1MI0 A;  3MFI A;  4ADW A;  2J52 A;  2W11 A;  3OWE B;  5ALR A;  4MEY A;  5AIC A;  4Q45 A;  1N48 A;  4FZM A;  3RRH A;  4C4V A;  2RSU A;  1D3Z A;  3N6J A;  2W9A A;  2JQR B;  1E8H A;  2QJJ A;  7ICG A;  2D2Q A;  4KIK A;  3OP2 A;  3VXW A;  1JOA A;  2BCU A;  4XZ4 A;  2KFJ A;  4DDG D;  1S0V A;  4JGH B;  3MC8 A;  2Q5W D;  1WM3 A;  5ALO A;  1IIP A;  3EWA A;  5J0Y A;  4NM2 A;  2JPH A;  4TUS A;  5C2T B;  2ZZC A;  2YQE A;  4PWC A;  3ABV B;  4W9J A;  2K89 A;  3EUB 2;  4G9B A;  2PFN A;  2JWU A;  5GMV A;  1W1J A;  2KJ5 A;  3PK7 A;  1U9L A;  4H4R A;  3TMP B;  5EDS A;  3D2N A;  1PK1 A;  5J0W A;  2ZJ5 A;  4EYH B;  1FIQ A;  3HM6 X;  3KBB A;  4HEA 1;  2LJ5 A;  2INC C;  2BHN A;  2YVS A;  2P3H A;  5KFL A;  5J2D A;  1D6E C;  4KTQ A;  1TS4 A;  1FFU C;  1GRF A;  2WBA A;  4ZYN A;  4F8R A;  2B76 B;  2YEP F;  4P6V F;  5IIJ A;  3H8W A;  4GME A;  1U4A A;  2LGD A;  2Z59 B;  5AM0 A;  2FCN A;  4KDL B;  5BMI A;  4S0R A;  2A1A A;  5ALM A;  4RQ2 A;  1BPD A;  1SJH D;  4NLG A;  2HVH A;  1X40 A;  1MQ2 A;  3E58 A;  2VA2 A;  1DTN A;  4BV6 A;  5ALD A;  4PVE A;  3TSS A;  2E3T A;  4KMU A;  4ECW A;  3W5V B;  1YJJ A;  1JDF A;  1N5W C;  2DYO A;  4DQQ A;  1QLB B;  3VFC A;  3MGV A;  2BGF A;  3AUO A;  3PY8 A;  1K52 A;  2W55 A;  5EE0 A;  1QIL A;  4FUL A;  4PHE A;  1LB2 B;  4DQS A;  1WGH A;  3RRG A;  3QE9 Y;  7ICJ A;  4H4X A;  3N9Y C;  2IO0 B;  4WUR A;  3V3X A;  4ELU A;  1QOF A;  3FIL B;  3AU5 A;  1XSL A;  4EM3 A;  2PPH A;  4PGQ A;  2CFY A;  3AL0 B;  1QTM A;  3FYY A;  1KRP A;  1D7Y A;  1O03 A;  1ZP0 B;  2ON8 A;  2V3P A;  2WX1 A;  4EEW A;  1NHR A;  2O56 A;  1J19 A;  2KJR A;  5ALU A;  4K4I A;  3N30 A;  3KUC B;  5FXE A;  2ZVO A;  3KUM A;  2KN7 A;  3EW9 A;  2LUM A;  1TYP A;  5L95 C;  3JS8 A;  2DFL A;  3P4P B;  1IP9 A;  4W9E A;  1XEE A;  1H6V A;  2LYH A;  1KTQ A;  1VLB A;  2WTF A;  1WVE A;  1BT0 A;  2AQ3 B;  4ROP A;  5J0S A;  3ALR A;  1WGR A;  3SAH A;  7ICL A;  1LVH A;  2PVO D;  1SJA A;  4YXJ A;  1YJI A;  5J2C A;  2UVW A;  3BYY B;  1YZ6 A;  2AQ0 A;  3K9O B;  2H89 B;  5KHO A;  2FCQ A;  2L0F A;  1ZKQ A;  3GD6 A;  1S76 D;  3ZGZ A;  4HCL A;  2IMW P;  3CF6 E;  4UAW A;  2FMQ A;  1FFV A;  5GTH U;  3NG0 A;  3BZC A;  5CRX A;  1JN3 A;  3Q2A C;  4DNS A;  2X99 A;  4GIB A;  1XXG A;  1NOM A;  2FIF A;  3UIP B;  1VD2 A;  2AAQ A;  1SKW A;  4JN7 A;  3KHG A;  2W9B B;  1N56 A;  5FXF A;  2PCE A;  4H4P A;  4HCH A;  4O3O A;  5FR3 A;  3DDH A;  5ALN A;  5CHV C;  2BVF A;  2LI6 A;  2GH1 A;  5KG7 A;  2MHJ A;  2ZTD A;  2Y3A A;  4ACO A;  4YR2 A;  4ANU A;  3W8Z A;  1E90 A;  3IM1 A;  1W1L A;  3RH4 A;  2LRW A;  1CEZ A;  4GC7 A;  2D3G A;  2OEH A;  3V05 A;  4EYI B;  3OLM D;  2JMG A;  2HTM E;  5AHX A;  1EXN A;  4DX3 A;  3AE3 B;  4HKQ A;  2G5I B;  1OUQ A;  3RJE A;  4HPP A;  4WJO A;  5E6N A;  4KLH A;  2V3A A;  5DPT A;  4JHM A;  1YIW A;  3HRD D;  3ZDD A;  2WAQ C;  4LK0 M;  1UGJ A;  2L7R A;  3A1Q B;  2VJ5 A;  3UQ2 A;  3WK5 A;  1P1A A;  2QHO A;  4US8 A;  4NPN A;  1EF1 A;  4M0A A;  1W6T A;  2L1A A;  5EBK A;  2G9H D;  2Q0Z X;  1S97 A;  4WWN A;  4B6J A;  3GE8 C;  2QKN A;  3IJL A;  3UIN B;  2K4E A;  5FJP A;  2ZIU A;  4MT5 A;  2V4R A;  4GN1 A;  2J53 A;  3N3K B;  1QKZ A;  1TY2 A;  2EQ8 A;  3AEE B;  3R0K A;  2J6T A;  4J9O A;  4WH4 A;  2GH5 A;  2YMM A;  4NEW A;  4DSJ A;  3VTW A;  2H3Q A;  3CP8 A;  5AZG A;  1TTN A;  1ZD4 A;  1EU4 A;  3P42 A;  5AZF A;  1SE2 A;  4TQS A;  3Q8Q B;  4RNN A;  4KLJ A;  1LFD A;  3H4K A;  5E6P A;  2ISO A;  2LWP A;  3NAS A;  4TUQ A;  2NPT B;  4UAV A;  1I19 A;  5IA7 A;  4F5N A;  5DGA A;  2OCE A;  5AE1 A;  1P7F A;  1ZK7 A;  1IYX A;  3LAD A;  4O5E A;  2W82 A;  3CB3 A;  4HDO A;  1KW4 A;  2BQR A;  2HOF A;  9ICJ A;  3A9J B;  2JYE A;  2N9P C;  1JCK B;  3MP9 A;  4BXO B;  4KLO A;  3WK6 A;  4M0W A;  3D46 A;  1M6Y A;  3MFG A;  3EPI A;  3A7R A;  1MO9 A;  1MBB A;  2X8G A;  3T5L A;  3QU9 A;  4O3P A;  2LFI A;  1WJN A;  4IQV A;  4ZDV A;  9ICI A;  3PO0 A;  4ELV A;  4X5V A;  2OZ8 A;  2KE7 A;  4H4V A;  3EPG A;  1MJD A;  3F2B A;  1JPM A;  1P7D A;  2XNA C;  1MDL A;  2JR5 A;  2CJO A;  5K4L A;  2CU1 A;  1F8W A;  2IHN A;  3C1Z A;  1XDI A;  4M01 A;  1HEZ E;  1F77 A;  3I4K A;  5DQH A;  1WWT A;  1LKY B;  4GXB A;  5KFR A;  1MC8 A;  3IBE A;  5KFP A;  1WGK A;  2KWU B;  2O6K A;  1UZX B;  5HHD G;  1SZP A;  4PPX A;  4GSW A;  4BUG A;  1EC7 A;  4Z6D A;  3HKZ F;  4UQG A;  3RD2 A;  2F44 A;  5AM4 A;  4OVV A;  1NEN B;  4XC2 A;  2EZZ A;  5AM1 A;  2IGD A;  1SV0 A;  2K0P A;  3ONN A;  1ZQN A;  1QSL A;  3OGU A;  3OTR A;  3GV8 B;  5LXH A;  1COK A;  1F52 A;  4TKN A;  4ICU A;  4DHZ E;  1V81 A;  1WMH B;  5JH5 C;  1V2Y A;  5HMR A;  1ELS A;  4KKI A;  1XQQ A;  8ICF A;  4IOI E;  5D7G A;  3ENE A;  3HW2 A;  1UEL A;  3S1E A;  1Y8R C;  2I5H A;  4HAI A;  2ZJ8 A;  4NXZ A;  2DHZ A;  2PE9 A;  2Z0D B;  2BW2 A;  1FEA A;  1KKR A;  3DHH C;  4YQW A;  3H7P A;  5EU9 A;  1WR6 E;  4R63 A;  4FBU A;  9ICN A;  1FPY A;  4DSK A;  2KVC A;  1PGX A;  3AU4 A;  4DS5 A;  1RXW A;  3RR8 A;  1YQZ A;  3DH9 A;  1VCB A;  3KLJ A;  2NQW A;  1BGX T;  1MDR A;  4WJ3 B;  4GFI A;  1F5S A;  5FP0 A;  5KFU A;  4PHD A;  3RJJ A;  1L0X B;  4NV0 A;  4NY8 A;  2RDH A;  5JRT A;  4HLE A;  3MQT A;  4AWJ A;  2W03 A;  7ICH A;  1ESF A;  3ZDA A;  1FEC A;  1DYQ A;  2E5A A;  4FP1 A;  2O6V B;  1QOB A;  1XLN A;  5FK9 C;  4J1O A;  1RG6 A;  1KN5 A;  3AH7 A;  4OZC A;  1HTO A;  1QF6 A;  5AI4 A;  2HBK A;  3DEE A;  3BJS A;  2C2R A;  2SAK A;  1WJU A;  4EQR A;  3D2D A;  2J6U A;  1X6I A;  3NTU A;  4PZN A;  3IT4 B;  4MLA A;  2W54 A;  2VFR A;  2JRZ A;  3VTV A;  3TAQ A;  2NRX A;  2DAF A;  2IOF K;  1OEP A;  3NVW A;  2JF5 A;  4F93 B;  1YN4 A;  3T4W A;  1NHS A;  3ZD8 A;  1ZW7 A;  4F5Q A;  3AB5 A;  4K7S A;  2QB0 A;  5AI6 A;  4FJY A;  4JPS A;  1V1P B;  3N7S C;  1WF9 A;  2MQJ A;  1SJB A;  3PRE A;  4BKG A;  2HHS A;  1FXI A;  4KLS A;  2C7N B;  2LM1 A;  4IRK A;  1C77 A;  3PX0 A;  1JML A;  3LJ3 A;  5J18 A;  3LB8 A;  4GDL B;  3VRB B;  1OJT A;  1EBH A;  3QFA A;  5CJ7 A;  3JYU A;  1ZD2 P;  1I4Q A;  2KTF A;  3DG6 A;  3ICX A;  4DXK A;  1WJ6 A;  1ZKH A;  1UF0 A;  2V9H A;  3BZD B;  3V6H A;  3AN1 A;  3MR6 A;  2N1V A;  3W1S A;  3SEI A;  3QIJ A;  3TKA A;  2AXT U;  1N62 C;  2J6S A;  4P4M A;  3V6J A;  9ICO A;  3H7V A;  1XT9 B;  1OQY A;  1X9X A;  2OFJ A;  4CF3 A;  3H12 A;  2P6R A;  1TZ1 A;  2X8X X;  3BK2 A;  2JY6 A;  3O65 B;  3PQB A;  2QCZ A;  1C7Y A;  1AOG A;  5E6O A;  2EQ7 A;  1JWU D;  4WQO B;  4S17 A;  1TS3 A;  3AEC B;  3KVF B;  2AL3 A;  4DF8 A;  3IG8 A;  2INN E;  2PA6 A;  2KC2 A;  4K4H A;  9ICQ A;  4UBC A;  2XCA A;  4RQ5 A;  1H8C A;  3T5K A;  2GQT A;  4QIW C;  3SAF A;  3R07 C;  2NR2 A;  4PH5 A;  2ZNV C;  2XGQ A;  1TFR A;  5J0P A;  2BF8 B;  4O5K A;  1YN3 A;  2FKP A;  5ER0 A;  3B97 A;  3UCD A;  1UH6 A;  4BBY A;  1XC9 A;  2GLE A;  2ONQ A;  2HBL A;  4US9 A;  2LYB A;  3ZI4 A;  4KLI A;  4O9M A;  2MA1 A;  1FFU A;  1L7O A;  3P0W A;  1HZ6 A;  4NM1 A;  4JWS C;  4MJS B;  3N20 C;  4W9G A;  1ZXH A;  2JEI A;  1MUC A;  4C80 A;  5AIA A;  2KN5 A;  4RT3 A;  5AI8 A;  4DWD A;  4J9P A;  3FIL A;  1C4C A;  3ZUN A;  3UCC A;  2BC0 A;  2FLN A;  5TZV A;  4QWC A;  4QZA A;  2ZNV B;  2YY6 A;  4Z6C A;  5KG3 A;  2NS5 A;  2WDQ B;  4ARC A;  3UIO B;  3NUQ A;  3KYD D;  1XLP A;  3MFH A;  5ALZ A;  2HMX A;  2OOB B;  1NBF C;  1NI2 A;  3K1G A;  1UWM A;  1V1O A;  1ROE A;  1N5W A;  2WXI A;  4I2B A;  3ZLF A;  4JLC A;  4HN8 A;  3TIX A;  4IR1 A;  1X2G A;  1ZQJ A;  2LMC A;  2IPI A;  3RJ8 A;  3RNM A;  1JWS D;  5DBC A;  3M9O B;  4KSK C;  5H2F U;  3Q8B A;  2R61 A;  5L9X A;  1ONF A;  1ZXI C;  4WWO A;  4PGY A;  4MFF A;  2PPG A;  1J97 A;  2KK8 A;  2A4Z A;  4NJ7 A;  1WY8 A;  3FW7 A;  4ZOH B;  1NVI D;  1XO1 A;  5CB1 A;  2QJN A;  3OW1 A;  4ECS A;  2CU3 A;  3JPO A;  1KFY B;  5ALY A;  1FNW A;  5J17 A;  1SKS A;  3P2B A;  1WXA A;  5IIL A;  2CRX A;  3NVZ B;  4PVJ A;  3HUI A;  1M6I A;  1BPX A;  3H4B A;  2KFN A;  4UAZ A;  3ZDT A;  4B9L A;  1YMH E;  4LNF A;  4QZG A;  4EBD A;  2K9X A;  4F1S A;  3ED5 A;  2BCS A;  3DPD A;  3WAM A;  3PWI A;  2QDE A;  2W9B A;  3R11 A;  1X66 A;  4UAY A;  2W8L A;  4XQ8 A;  1ZE3 D;  4YR3 A;  2ZIX B;  3T3O A;  1E10 A;  2J3N A;  1NK0 A;  3V7J A;  3H0L B;  3DBL B;  3A4R A;  2MCN B;  1KLG D;  2PU0 A;  2YVJ A;  1FHU A;  5DB9 A;  5L83 A;  3A33 B;  1NYQ A;  4MAC A;  3NVV B;  3T5H A;  3AE9 B;  2B6G A;  3K4G A;  3HJE A;  5AKY A;  7ICR A;  1NK6 A;  4DFJ A;  2KFK B;  3PZD A;  4IG7 B;  4MSQ B;  3Q3N C;  3CWI A;  3TX1 A;  1PGB A;  2G1E A;  9ICB A;  1C9F A;  5FS7 A;  4P1B C;  2LVO A;  3EYZ A;  3UXP A;  1M94 A;  2BPG A;  3A1Q A;  3QJZ A;  4GDK B;  2V4Q A;  1A6S A;  4IM0 A;  3PW4 A;  3I5J C;  4RZR A;  2KO3 A;  1MOK A;  5L1J A;  3QC8 B;  3M9N B;  2DBY A;  3MDC A;  2AQ1 B;  3DCG A;  1VDV A;  2ASD A;  4IQU A;  2ZZB A;  3ZD9 A;  7ICV A;  2EH9 A;  1H4R A;  4GLS C;  4F4Z A;  3QUB A;  4HK2 A;  2AEH A;  2IND C;  2KHV A;  3OG5 A;  1SE9 A;  4P16 A;  3Q8E A;  2PI4 A;  4ZHP A;  1ZQI A;  2KQS A;  1X2H A;  5C0Y A;  1TKG A;  2HD5 B;  2XGZ A;  4RQ1 A;  2HBJ A;  2X8C A;  4B9S A;  2OJR A;  3RF9 A;  3RJF A;  3R7R A;  4F2R A;  4G8T A;  1TVA A;  3JPS A;  3RNF C;  3NRW A;  1WXQ A;  5ALK A;  1HSK A;  2LVP A;  2BYV E;  5KT7 A;  4DWF A;  8ICM A;  1ZYQ A;  1KRH A;  3EKG A;  3QYP A;  2E1F A;  3C0P A;  2NPT A;  2RK5 A;  3JPQ A;  1T0Q C;  4E0D A;  4PVK A;  3QPE A;  3MKC A;  2Y5P A;  5KG4 A;  5DG7 A;  4PZO A;  1S0M A;  1ZQE A;  2BVC A;  3GDX A;  2BCP A;  3VCN A;  4M04 A;  2Y5B B;  3MHS D;  4ANX A;  5BYS A;  3A9J A;  4UB1 A;  2LRU A;  2KWC A;  4BXO A;  2YLM A;  1SL0 A;  3RFA A;  5C5J A;  3E0F A;  1IBX B;  1L6V A;  3HW8 A;  4II3 B;  3C5F A;  1XSN A;  2C28 A;  4YWO A;  2EZY A;  4LZD A;  9ICS A;  3BS5 B;  4E4F A;  3LAE A;  4EEY A;  2BCR A;  1Z19 A;  1VZ8 A;  4N9F 4;  4HRO A;  3VC6 A;  7ICE A;  3VCB A;  4QZ9 A;  1WYG A;  1I4R A;  2LZ6 A;  2ZUD A;  5KAF U;  1ZQB A;  1ZQY A;  2HBM A;  4IS7 A;  2QSD A;  4ED6 A;  4RQN A;  2F1H A;  1NK5 A;  2BDP A;  5BO4 B;  4P0Q B;  2NTS A;  3L13 A;  2CKH B;  4EUT A;  4EEL A;  2GQU A;  5HG2 A;  3UMB A;  2R8G A;  2FCM A;  3CMM B;  1BKH A;  1S7M A;  2NVK X;  1Y56 A;  4ED3 A;  3RR7 A;  7ICM A;  1W1Q A;  2FLP A;  1NJZ A;  3P1M A;  3D32 A;  2KFZ A;  1LKY A;  1SIF A;  2B0C A;  8ICW A;  3L10 B;  2I5Q A;  1JCT A;  1HA5 A;  4O3M A;  3U7Z A;  3RPF C;  2V9W A;  4PHA A;  2L0T A;  3UXO A;  5KFA A;  2WPC A;  4J9K A;  3PX6 A;  1UBQ A;  1VRA B;  2VZK D;  3TCA A;  4MKS A;  1E7P B;  2DKX A;  3BZK A;  4ICA A;  2XI9 A;  3UJF A;  5DG8 A;  1OEY J;  3UF8 A;  2FUG 1;  2UU7 A;  5KFY A;  8ICJ A;  3IC9 A;  5FJU A;  3QU2 A;  2A8X A;  1RZT A;  1J2M A;  3THU A;  5DCN A;  3PHX B;  4RPX A;  4RQ6 A;  4YT0 B;  2XH2 A;  2M17 A;  4H4Z A;  4DL6 A;  5B66 U;  4BKS A;  4QWB A;  5EE9 A;  3GS2 A;  2Z8L A;  2RPQ A;  2Z7J A;  1Y88 A; 
#chains in the Genus database with same CATH homology
 1SJH D;  4DXG A;  3AV8 A;  4ZRP A;  3EGR A;  4MM3 B;  4XLO A;  3NRZ B;  4B0M A;  4PVE A;  3B9J B;  3TSS A;  2E3T A;  3W5V B;  2W3R A;  2LHD A;  1YJJ A;  4TVW A;  3ETR B;  1N5W C;  1TZO A;  2DYO A;  1QLB B;  2OED A;  3P4R B;  1K52 A;  4NZL B;  4PWB A;  2W55 A;  1QIL A;  5EE0 A;  1LO5 D;  1STE A;  4BC7 A;  3N9Y C;  3LLB A;  4WUR A;  4PVH A;  3V3X A;  4KGT A;  1QOF A;  3FIL B;  1N5X A;  4RF0 A;  4BC9 A;  4A9A A;  5I1V A;  2LHE A;  1SE4 A;  1B1Z A;  1L0V B;  2AX5 A;  2WXL A;  3R8B A;  1TS2 A;  1ZP0 B;  2JZP A;  2ON8 A;  2V3P A;  3BK1 A;  4XWW A;  3NS1 B;  2HDE A;  3HRD C;  1ZOY B;  4LLG M;  1XF5 L;  4PT5 A;  2LJI A;  1K51 A;  2EEL A;  2PVG C;  5FXE A;  1TYG B;  2LEK A;  2N9K A;  3DWM A;  2LUM A;  3JS8 A;  4R3D A;  3P4P B;  1ZPS A;  3IAM 1;  1XEE A;  1FM0 D;  4KGS A;  3ZYY X;  3FAH A;  3B2G A;  3DWG C;  1VLB A;  3EA6 A;  3U2S C;  1WVE A;  2QEJ C;  4USA A;  2AQ3 B;  2KQ4 X;  1I7H A;  4YTP B;  1AHU A;  4JB1 A;  1PGA A;  3Q8C A;  4EC3 A;  2PVO D;  4ML8 A;  1YJI A;  1FXA A;  1EM7 A;  1QOG A;  4J3O D;  2JXT A;  3BYY B;  5H8Y E;  2IGH A;  3R2I A;  2H89 B;  1PDX A;  1N60 C;  3ZGZ A;  4TSS A;  2DYM A;  1FCL A;  2WU5 B;  4WAF A;  1FFV A;  3AE6 B;  1I4P A;  4DNS A;  1SXT A;  3RFZ B;  1XXG A;  4TQ0 A;  4RH6 A;  1T3Q C;  2BT6 A;  2BVG A;  5FXF A;  4NAM A;  4RGO S;  1F0X A;  4NAW B;  5FR3 A;  2BVF A;  2VAO A;  3O13 A;  2X38 A;  3AEG B;  1PYW D;  5BMH A;  2I0K A;  2Y3A A;  3W8Z A;  3TEX A;  4C7Z A;  3FWA A;  1W1L A;  2BTE A;  3V05 A;  3SFE B;  2Q4W A;  4C56 C;  1E0Y A;  4PZF A;  1QLU A;  1XCT L;  2HTM E;  3AE3 B;  4HKQ A;  1A70 A;  1C4A A;  1RYJ A;  1L4D B;  1DGJ A;  3HRD D;  4LK0 M;  1UGJ A;  4US8 A;  3AEB B;  3U4E G;  2L1A A;  2G9H D;  2QIL A;  2QKN A;  3AM9 A;  5AE3 A;  1SF0 A;  1W1M A;  4MT5 A;  1L6U A;  2J53 A;  2QJL A;  1QKZ A;  1TY2 A;  4REZ A;  4MH8 A;  3AEE B;  1C76 A;  2TSS A;  4WH4 A;  3Q69 A;  1ZDX A;  5G5H A;  3I57 A;  2KN4 A;  5G5G A;  2PLP A;  3T3N A;  2O3G A;  1EU4 A;  3P42 A;  1DOY A;  3LYY A;  1SE2 A;  1JRO A;  1FRD A;  4YWG G;  1BML C;  2VFV A;  3GP7 A;  4RNA A;  3VR9 B;  3KQ4 A;  1I4X A;  1I19 A;  2W3S A;  1YQ3 B;  3W8W A;  3W2D A;  5AE1 A;  1P7F A;  2KMM A;  1D5X C;  1TKE A;  1V8C A;  3H8H A;  2JX5 A;  2W82 A;  1W1R A;  2JYE A;  1JCK B;  2OHF A;  1KF6 B;  1P7E A;  1FO4 A;  3MP9 A;  1AN8 A;  5D3D A;  4M0W A;  3MFG A;  3BVM A;  3A7R A;  3KWL A;  1MBB A;  4B0E A;  1KH0 A;  1YQ4 B;  4RGN A;  1BUI C;  2LFI A;  4YSZ B;  3PO0 A;  1HXY D;  1OQR A;  2WNM A;  1TKY A;  2WXQ A;  3W8X A;  4C7Y A;  1I4H A;  4HG0 A;  2LGI A;  1ENF A;  3NVZ A;  2L83 A;  2XNA C;  3E9S A;  3AEA B;  2CJO A;  2KAJ A;  4A90 A;  4UD8 A;  3FW8 A;  3AE5 B;  1UXY A;  1YN5 A;  2MJD A;  1TJE A;  2EXR A;  2L32 A;  1HEZ E;  1F77 A;  1XO3 A;  1ZXI A;  1N63 A;  1GPX A;  2AXR A;  1WWT A;  3AE1 B;  3GB1 A;  4D2K A;  3IT6 B;  1WGK A;  1N62 A;  3ZJU A;  3AE2 B;  2PW9 A;  5HHD G;  5HFY A;  1OQQ A;  5EE1 A;  2BB5 A;  3KLS X;  3VTE A;  1NEN B;  3NVV A;  2K0P A;  4OW0 A;  4ZHO A;  5FXP A;  2WU2 B;  1K53 A;  1ET9 A;  2ZW0 A;  1HZ5 A;  2JU6 X;  4YSY B;  5HMR A;  4KKI A;  5D7G A;  4IOI E;  3URY A;  3S1E A;  3NVY A;  1C78 A;  4RGM A;  3BW7 A;  2BW2 A;  1FIQ B;  2L52 A;  2XN9 C;  2J4X A;  1V1P A;  2SEB D;  3A7A A;  2WXH A;  1PGX A;  5FKA C;  2P4P A;  5JXV A;  5AUI A;  2NQW A;  5AE2 A;  1E0Z A;  2VFU A;  2GRI A;  4RF1 A;  1RWS A;  4KGR A;  5BYR A;  1L0X B;  2V3N A;  1TS5 A;  1B9R A;  2I38 A;  5C3J B;  1NEK B;  2RDH A;  1IGC A;  1DOX A;  1ESF A;  1MHX A;  1SSN A;  1DYQ A;  2JYT A;  3PZ8 A;  3SEB A;  2E5A A;  2ACZ B;  3MC0 B;  1QOB A;  1XLN A;  2K3U A;  5FK9 C;  1D5M C;  4JX1 C;  5D79 A;  1JWM D;  4N59 A;  4XDC A;  3D2J A;  3GSY A;  4TVY A;  3AH7 A;  4OZC A;  5HHZ A;  1FCC C;  2RDG A;  2KWD A;  1QF6 A;  3TEY A;  5GXG B;  4L2Y A;  2N9L A;  2SAK A;  2WS3 B;  3D2D A;  2NMQ A;  2UUV A;  3HVZ A;  3IT4 B;  4MLA A;  5D3I B;  2W54 A;  2IDY A;  2VFR A;  2RMM A;  2IJ0 A;  5T8I A;  1IBX A;  2M0A A;  5HI1 A;  3RJA A;  3IAS 1;  3NVW A;  1K50 A;  3DED A;  1SIJ A;  1VJK A;  1YN4 A;  3AB5 A;  2V0G A;  5LNK 1;  1R7S A;  2K22 A;  2WXM A;  1N61 A;  2Y5C A;  1V1P B;  4JPS A;  4XDD A;  3ZJT A;  1BXT A;  3AED B;  3J9C A;  3PM9 A;  2RPV A;  1DII A;  1FFV C;  1FXI A;  3AE4 B;  1W1K A;  4OAL A;  1VR9 A;  1C77 A;  1L5P A;  1JML A;  3NZ3 A;  2BS2 B;  4WQM A;  4O95 A;  2PLS A;  4GDL B;  3VRB B;  2Y3R A;  3R2T A;  1F2R C;  2N7J A;  3KWV A;  1D5Z C;  1C79 A;  2WLB A;  3E56 A;  4H2A A;  4RGT A;  1UWX A;  1J7A A;  2FE8 A;  1IUE A;  1I4Q A;  2K5P A;  2DLB A;  2IGG A;  5I1W A;  1OFF A;  3POP A;  1XCQ L;  1QQR A;  3BZD B;  3AN1 A;  4AS1 A;  4CQN A;  2H88 B;  3W1S A;  3VRA B;  4N58 A;  4A6Q A;  4IDI A;  1FRR A;  3I9V 1;  1ZUD 2;  2AQ2 B;  2BB6 A;  1GAQ B;  3HVD A;  2WDV B;  2Y3S A;  2QMT A;  3EUB 3;  3S1D A;  1CZP A;  3BK2 A;  1ET6 A;  1SBB B;  3PQB A;  2D5G A;  3S1F A;  2KDM A;  2WXO A;  2MBR A;  3HSU A;  1DOI A;  4IKG A;  1T5X D;  1JWU D;  1KLU D;  3KJM A;  1ZDV A;  1TS3 A;  3AEC B;  4KX6 B;  2INN E;  1CK1 A;  2PLI A;  3NUH B;  1JWA D;  2OAI A;  3WCQ A;  4TMA B;  2GQT A;  3R07 C;  2UUU A;  3SR6 A;  1AHV A;  3NRZ A;  1YN3 A;  3CIR B;  1NYR A;  4BBY A;  2ONQ A;  3B9J A;  1SJE D;  4ZYS A;  4US9 A;  3ETR A;  2BS4 B;  1FFU A;  2MH7 A;  1HZ6 A;  3TSJ A;  1AWD A;  4JWS C;  1ZXH A;  2WDW A;  2MJ3 A;  1D4B A;  4C80 A;  5G5H B;  1CJE A;  3B2F A;  2BBC A;  2BVH A;  1JAL A;  5G5G B;  1Q10 A;  1FMA D;  3AMZ A;  3FIL A;  1C4C A;  1HQR D;  2JSV X;  4L1B A;  2R2Z A;  1WSP A;  3BII D;  2FBW B;  2NTT A;  2PIA A;  2WDQ B;  1VZ6 A;  4ARC A;  4PYT A;  1XLP A;  4RCO A;  4TQ1 A;  3NS1 A;  1UWM A;  1V1O A;  1ROE A;  1N5W A;  2WXI A;  3IXS A;  1F2R I;  5MPO A;  1QLT A;  2CJN A;  1DIQ A;  5AUK A;  2Y4G A;  1X2G A;  1CQV A;  2WXF A;  2INP E;  2LMC A;  3W9C B;  2IPI A;  3RJ8 A;  1JWS D;  1MBT A;  2R8D A;  3Q8B A;  2R61 A;  1W1O A;  2MJE A;  1N63 C;  1ZXI C;  4LTU A;  1T6B X;  1NI3 A;  3FW7 A;  4ZOH B;  3P4Q B;  3SR6 B;  2IPK D;  1N62 C;  1NVI D;  4BCA A;  2WXR A;  1FEH A;  1KTK A;  4FXC A;  1ZR6 A;  2CU3 A;  1UUP A;  1KFY B;  1V97 A;  3S1C A;  1FNW A;  1SB3 C;  2VFT A;  3NVZ B;  4PVJ A;  1QOA A;  3HUI A;  3MJ5 A;  1W1S A;  5EE3 A;  2Y08 A;  1YMH E;  2K9X A;  1L4Z B;  5BMG A;  1XLQ A;  3PZ7 A;  4XWT A;  1C4P A;  4OZB A;  3TEW A;  3ZJV A;  3Q8F A;  1ZE3 D;  4AQ7 A;  1XLO A;  2M56 B;  3T3O A;  1E10 A;  4YTM B;  3C8Y A;  2J42 A;  2QIE B;  5E6J A;  2WQY B;  3FW9 A;  1KLG D;  3U52 E;  2I2Y A;  1GB1 A;  1SB3 B;  1YNT E;  1NYQ A;  2BS3 B;  4O1N A;  1E8F A;  1N60 A;  4MAC A;  4L23 A;  3TUO A;  3AE9 B;  3NVV B;  1WRI A;  5FXD A;  1JWB D;  4A55 A;  2DWQ A;  2EKI A;  3CWI A;  3TX1 A;  1PGB A;  3TEZ A;  2G1E A;  1AYF A;  1T3Q A;  1C9F A;  4ITK A;  3AE8 B;  4GDK B;  4JAY A;  5K8E A;  3NVY B;  2WXN A;  3Q8A A;  3UI3 A;  3AEF B;  1FD6 A;  2AQ1 B;  2DBY A;  4XE0 A;  3I99 A;  1VDV A;  1WVF A;  4N6E B;  2VFS A;  5AWV A;  4GLS C;  1PUT A;  1VZ7 A;  1FNV A;  2KAC A;  3AE7 B;  3LXF A;  1GB4 A;  1GOZ A;  2WDR B;  1EWY C;  4NJC A;  4P16 A;  2YEP B;  1MHH E;  3Q8E A;  1J7B A;  4ZHP A;  1X2H A;  1JW9 D;  3L4P A;  1TKG A;  4YXD B;  1AW7 A;  5L6G A;  3BVG A;  2ICI A;  4DXF A;  1WXQ A;  2WXG A;  1HSK A;  4KKJ A;  5ADZ A;  3P4S B;  2QPM A;  5HQX A;  1E8G A;  5TSS A;  4Q2J A;  1KRH A;  3C0P A;  2RK5 A;  1N61 C;  1L0Y B;  1JRP A;  1J7C A;  2M19 A;  4PVK A;  2Y5P A;  1MVK A;  4DQO C;  1MPE A;  1EWC A;  5EE9 A;  4YSX B;  3BWU D;  1ACC A;  2GB1 A;  5BYS A;  3LB8 C;  3P63 A;  2WP9 B;  4A8X C;  2PTL A;  3D2H A;  3FC4 A;  1IBX B;  1L6V A;  4HJG E;  2ZW1 A;  5BYQ A;  3BVZ A;  2MEK A;  4WIP A;  4EE2 A;  3NVW B;  1SE3 A;  4WWM A;  2VZK B;  2WXP A;  3MHZ A;  3LAE A;  3SFD B;  1VZ8 A;  2P13 A;  2WXK A;  4HRO A;  2WXJ A;  1TY0 A;  5L6F A;  1WYG A;  1EU3 A;  1IGD A;  1I4R A;  2E6X A;  1I4G A;  3A7U A;  4RFB A;  1RFK A;  3TSH A;  5I4D A;  2QSD A;  3W5U B;  1M4V A;  2PKO A;  1MI0 A;  4HRS A;  1VQZ A;  2J52 A;  1VAO A;  3DQ0 A;  2NTS A;  4HKZ E;  3ZQ4 A;  3OWE B;  2GQU A;  5HG2 A;  1Y56 A;  1E9M A;  1DZN A;  2JQR B;  3P1M A;  1E8H A;  1W1Q A;  1RM6 C;  3VQI A;  5H92 C;  1UNS A;  2V4I B;  2PMV A;  1HA5 A;  4ARI A;  3U7Z A;  3RPF C;  3BYT B;  1QT9 A;  1E6E B;  4UDU C;  1AHZ A;  1SEB D;  2Q5W D;  4JE3 B;  1F0Z A;  1VRA B;  1JQ4 A;  2N0S B;  2VZK D;  3VR8 B;  1E7P B;  2BYT A;  5C2T B;  4PWC A;  4OVZ A;  3ABV B;  3EUB 2;  2JWU A;  1W1J A;  4YTN B;  4ZOH C;  2FUG 1;  1RM6 B;  1FNU A;  4OZA A;  4ZRQ A;  2GI9 A;  1PFD A;  1FIQ A;  2Q85 A;  4HEA 1;  4JWU C;  4OHJ A;  4YT0 B;  2YVS A;  2P3H A;  1D6E C;  1FFU C;  1TS4 A;  2B76 B;  2YEP F;  4P6V F;  3GS2 A;  2IGD A;  2Z8L A;  5BMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...