2W55A

Crystal structure of xanthine dehydrogenase (e232q variant) from rhodobacter capsulatus in complex with hypoxanthine
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
molecule keywords XANTHINE DEHYDROGENASE
total genus 114
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w55A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w55A01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w55A03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w55A05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w55A04
5FXDA 2E3TA 3AE8B 1FFUA 3AE3B 2WP9B 3B9JA 3FW8A 3CWIA 2EXRA 3PO0A 4PZFA 1FIQA 1FXAA 1FRRA 1FFUC 2O3GA 3D2HA 2WDVB 2WDRB 3NVYB 1JQ4A 1W1RA 1TYGB 2WLBA 1YQ4B 3EUB2 4ZOHB 1RYJA 3W8XA 1XLNA 3VR8B 1L6UA 1W1QA 1N5WA 3AE9B 2Q5WD 2QJLA 3S1DA 1W1MA 1DZNA 1QF6A 3BW7A 3AEDB 3TX1A 4YT0B 1AWDA 3CIRB 1WVEA 1NEKB 1X2GA 1KF6B 5FXFA 3B2FA 1JW9D 4JB1A 5FXEA 1E6EB 2DBYA 2P3HA 3W5UB 1JROA 3WCQA 4TVYA 3NVYA 2MH7A 4WQMA 3C0PA 3AE1B 4KX6B 4HROA 1QOGA 2WDQB 4PYTA 4LTUA 3W8ZA 2NQWA 1T3QA 1NI3A 5C3JB 3A7AA 1L6VA 3DWMA 2VFRA 3P4QB 1MBTA 3R07C 5G5HA 3AECB 1SIJA 3NVZA 4YSZB 5AE2A 3AE4B 4MLAA 4BC7A 1IUEA 3A7RA 1V8CA 1RM6B 5HHZA 4C80A 2GQUA 1NYQA 3S1CA 3B2GA 2MJDA 2VFTA 1N61A 4JWUC 4ZHOA 1AHUA 3AE5B 1UXYA 1QLBB 2VAOA 4O95A 1DOXA 5C2TB 3S1FA 2EKIA 1OQQA 1PFDA 1ZUD2 5GXGB 2N0SB 1SB3C 2KMMA 1VJKA 3BIID 1OQRA 1N60C 1X2HA 3TSJA 2VFSA 2BS4B 2WU2B 4PWBA 2PIAA 1N63A 2LEKA 3P4SB 3L4PA 2H88B 1NVID 4N59A 1E7PB 5AE3A 1QOAA 5EE0A 2WS3B 4WWMA 1AHZA 1CZPA 3LXFA 2ACZB 3SR6A 2R2ZA 3ETRA 5EE1A 3NVWA 3KJMA 4N6EB 1NENB 2PLSA 1A70A 3NS1A 1WYGA 2K22A 2QKNA 3W5VB 4YSYB 3SFDB 1QLTA 1SB3B 4YTMB 5G5GA 3NRZB 1CJEA 3ETRB 1SF0A 1VLBA 1QOBA 2BVFA 1JWBD 2AXRA 1N62C 4C7YA 2MBRA 3P4PB 3EUB3 4USAA 1PUTA 1XLOA 2WQYB 1R7SA 1B9RA 1E8HA 2P4PA 3FWAA 2E5AA 3DQ0A 4A9AA 2FBWB 1FXIA 3AH7A 3D2DA 3DWGC 1NYRA 1YJIA 1OFFA 1QOFA 1XO3A 2M56B 3NVWB 5AUKA 2AX5A 4PVJA 3P1MA 2Q85A 3D2JA 1E8FA 5HMRA 2W55A 1DIIA 1N63C 1EWYC 1YJJA 1DIQA 1J7AA 4EC3A 1WWTA 3NS1B 4FXCA 1AYFA 4JWSC 2BS2B 1FFVA 3AV8A 1W1KA 1E9MA 3AE6B 4PVEA 4PVKA 1TKEA 1QT9A 1XLPA 3W8WA 2JX5A 1FIQB 1WVFA 5AUIA 3AMZA 1DOIA 2L52A 1QLUA 4YTNB 1N5WC 2PVOD 5FXPA 1KRHA 1RWSA 3VRBB 1W1OA 2RK5A 1V97A 3AN1A 2K9XA 3LLBA 1WGKA 1YQ3B 3TSHA 4HRSA 3HUIA 3B9JB 2DWQA 4YSXB 4YXDB 3AEBB 1I19A 4N58A 4TVWA 1XLQA 2PLIA 1F0ZA 1HSKA 3AM9A 3VR9B 4UD8A 1DOYA 5H8YE 1RFKA 2MJEA 1ZXIA 2BT6A 3P63A 2I0KA 1FM0D 5ADZA 4IDIA 4PVHA 5D79A 3NVZB 2CJNA 2PKOA 3A7UA 3AEAB 2VFVA 2BVHA 1J7BA 2K5PA 1E0YA 2B76B 1N62A 3DEDA 5MPOA 2W54A 2Q4WA 1N61C 2R8DA 3FAHA 3I99A 2PVGC 1L0VB 3VTEA 2JQRB 3HRDC 4YTPB 2W3RA 4OALA 4JAYA 1VDVA 2OHFA 3RPFC 5EE3A 2P13A 5HQXA 3SR6B 2H89B 3NRZA 1I7HA 1UWMA 5G5GB 3AEEB 1GPXA 2HTME 1W1LA 1KFYB 2KAJA 3HVZA 3LB8C 1AHVA 1FO4A 1T3QC 2Y5CA 2G1EA 3AB5A 4ZHPA 3FW9A 4BCAA 3NVVB 2WU5B 3AE7B 1TKYA 3P4RB 1PDXA 3KWLA 1F0XA 3SFEB 2MJ3A 2M19A 3AE2B 2CU3A 3NVVA 1J7CA 3ZYYX 3LAEA 5H92C 1ZR6A 3JS8A 4ML8A 4BC9A 3VRAB 1W1JA 3GSYA 4US8A 2L83A 1MBBA 3FC4A 1N60A 1GAQB 4XLOA 1WRIA 1JRPA 3AEFB 4ITKA 1JWAD 3PM9A 1WXQA 1E0ZA 1W1SA 4BBYA 4US9A 3S1EA 2GQTA 1TJEA 1ZXIC 4JX1C 1VAOA 3FW7A 3W9CB 1RM6C 1N5XA 3AEGB 1ROEA 4P6VF 1FFVC 2W3SA 4ZOHC 1L5PA 4PWCA 2OAIA 2CJOA 1ZOYB 1DGJA 4C7ZA 1FMAD 2VFUA 1FRDA 3ABVB 4HG0A 3HRDD 5G5HB 1TKGA 1E8GA 5EE9A 1VQZA 1E10A 2BS3B 5AE1A 2QPMA 4DNSA 1ZP0B 2YVSA 2QIEB 1JALA 2BVGA
chains in the Genus database with same CATH superfamily
2E3TA 3HX0A 1EF5A 2MEKA 2WXFA 3AE8B 4F5PA 3S47A 3NASA 1L0YB 5KL1B 1TZZA 1WGGA 2ATLA 1TTNA 2XBBC 1RQLA 3FCPA 4YR2A 1TIFA 3I76A 5JUMA 3CWIA 3H0LB 3Q8EA 2EXRA 1VR9A 3KH0A 3KLJA 2LRUA 2NTSA 4A3PA 3PX6A 3RB4A 1FIQA 5KT3A 1FEHA 2LMCA 1WIAA 2J42A 2OOBB 2O3GA 3D2HA 1E8WA 1X40A 2CXYA 2G4SA 2Q0ZX 4B9TA 5FK9C 2EQ6A 2WDRB 5BMHA 2ISOA 4UAZA 2CS4A 4HAIA 2HOFA 1BPYA 3AU4A 1X6JA 4TMAB 3EF6A 1W1RA 3K75D 4LDTD 4Y2VA 5KAIU 1NK6A 1Q46A 3WKDA 3EUB2 2EZXA 4FBTA 4AYBC 3KZXA 4HLEA 4GGBA 2MBQA 1XLNA 3VTWA 4CDGA 1L6UA 1ZQXA 1PDZA 4B0MA 4HYRA 1J2MA 2L5YA 3ML9A 2WAQC 3IJQA 4HPNA 1F5SA 3IJLA 1JPMA 4JB3A 1S9FA 2P35A 1T0SC 2D3GA 3MFGA 1YN5A 2IYDB 2JUOA 1HE8A 4ANXA 2Z7JA 5KFOA 4ZA0A 4H4WA 3C19A 3SQPA 3EECA 3H0RB 2LBOA 1WYWB 3BW7A 5D49A 3VFKA 3AEDB 1D3ZA 3TJIA 2KZ3A 1MA7A 1J19A 1KF6B 2ZADA 2L3ZA 2PMZC 2QDFA 3PV8A 2GI9A 3B2FA 2KIWA 2EQ7A 3SN0A 3Q8PB 5DPSA 5BPCA 5DB9A 2JGAA 4F4KA 5E6NA 3SEIA 4Q43A 2DF4B 1CI4A 3DVGY 5FXEA 7ICMA 3SBFA 2O6KA 2RPQA 2DBYA 4DHZE 1NJZA 1Q0WB 1P1AA 4ZCWA 3W5UB 4OJ5A 4EWJA 2P3HA 1N56A 4TVYA 2ZCBA 1F9JA 2DYBA 2MH7A 2BYVE 4WQMA 2BKRB 3UXNA 5AM2A 3QKEA 1D9FA 2WDQB 1GOZA 3PV1A 3RYTA 3HWTA 2PI5A 2PI4A 2NQWA 2KSOB 1TE6A 3LVWA 1L6VA 1WCLA 3DWMA 3JYUA 2NO5A 1GRGA 3M1YA 4DSIA 1RLFA 3QCAA 1MBTA 3EZ5A 3R10A 2YMQA 4Z6EA 3WK8A 4KDIC 4YWOA 2OKTA 1XNSA 2XH2A 3R3MA 1SKRA 1ZQMA 4H1ZA 4LNKA 5AE2A 2XH4A 3RJGA 4HEA1 3AE4B 4FZNA 4P4MA 3DHGC 3RZFA 3V72A 2NBWB 3ZLHA 3CSTA 4M6UA 3FXGA 1ZMCA 1N2XA 1GESA 4XQ8A 4YMNA 4IM0A 3L5OA 2ZIUB 3ZJUA 3V5FA 2GOWA 4O3OA 3BYTB 3Q3NC 5FJOA 5FS9A 1KQQA 3KYCD 4EBEA 2K4HA 1UA1A 2BW2A 3S1CA 2FPMA 2MJDA 1P7EA 2LUEA 3FM9A 2KFKA 2IBIB 3I5JC 4UAWA 2W03A 2PE9A 2CU1A 2IO0B 4WH4A 4IP5A 4P2HA 3AE5B 2Y08A 5CB1A 4CCHA 2VAOA 1JX4A 3WK4A 4KLJA 4O95A 3TQ1A 1DOXA 2W0HA 4DO9A 2HI0A 1OQQA 1ZUD2 3IC9A 4EEYA 2BGFA 4NAWA 1J8CA 2PFOA 2ZTDA 1TS2A 2J52A 4DEZA 4LA1A 2ZJ8A 2JZBA 1SE9A 4IRDA 2BB5A 3X0WA 2WPEA 1VZ7A 4FHKA 4MGIE 4Z6CA 4B9NA 5DQGA 2BS4B 4DX3A 2KWUB 3QA8A 5KFLA 4H19A 1YJ1A 4F5OA 2HMXA 2AL6A 1N63A 2PIAA 3V6HA 1NJYA 3FKYA 4K7SA 5AM0A 2FMSA 2LEKA 1U9LA 2WWZA 3OZMA 1XC9A 5JH5C 4FZMA 1KSPA 2HBLA 3GZNI 2E8NA 3KOOA 3ML8A 4RQ7A 4S0RA 2INNE 2NRXA 2V3SA 4N59A 1NZBA 1E7PB 4W9CA 1QOAA 5IN7A 1K4QA 3P42A 5KFKA 3R0UA 2HHVA 1L6NA 1P0RA 4M9LA 5BOFA 5DPRA 4CO7A 9ICCA 3FV9A 1ZX9A 4H4RA 2LRWA 1H4RA 5IA7A 1WGDA 2AL3A 2MNRA 3TW9A 4NL9A 2ESEA 2PLSA 3PMNA 1M6IA 3ZDCA 7ICOA 3DJJA 5J2KA 4ED8A 1T0YA 4RNMA 3ECIA 1WYGA 2JZ3B 2KWCA 5KFXA 1WE7A 1ZK7A 5KG4A 3RO6A 1QLTA 1TFRA 5KTQA 2Z0EB 5AZHA 3PG6A 4RQ2A 4OJPA 4DDGD 4TUPA 3ALBA 4YTMB 5IDZA 3QEAZ 3EPGA 4BWJA 1Q5WB 1S1QB 4ZYSA 1KN5A 2EAOA 2KHVA 2FCNA 4GMVA 1QOBA 4EZLA 1SGGA 3DDMA 3M3JA 1E8YA 4I6LB 2XY6A 4YR0A 1JI7A 1GRTA 2PU0A 4NXZA 3OG5A 4QIWF 1WY8A 1BPDA 1NELA 4DSJA 3WAMA 4KX3A 3C2LA 4B95A 4USAA 4GFIA 2BPCA 1XLOA 3H9DA 3H7VA 2WQYB 3UQ0A 4KVGB 1B9RA 3IRUA 5ALEA 3HM3A 1OTRB 4I27A 4I6PA 4GDKA 3PRMB 3TWAA 2FAZA 5J0UA 1DTNA 8ICEA 3U26A 2XCAA 3ZIMA 3FWAA 3DBRB 4NZLB 4L23A 5KG1A 5AKIA 5ALDA 1QKZA 2HDEA 1NHPA 3HPFA 3MDCA 2WX1A 4I2DA 3D2DA 1ZYQA 2C60A 2HZGA 2KWDA 2WXHA 2ZC8A 1OFFA 2ZUCA 3TEXA 1TK5A 2M56B 3RMKC 3IG8A 1ZY8A 3NVWB 2MBEA 3I3TB 1PDYA 5KFQA 1YMHE 3ZXRA 3OSPA 4XC2A 2Q85A 5KFZA 5HMRA 3LDZE 4XWTA 4H4SA 3CMMB 2MUTA 3O65B 4B9MA 4NAMA 2WF6A 3SAFA 2JZZA 2YY6A 4F8CB 3I57A 3IAS1 1QQ6A 3C8YA 1DIQA 2PU1A 2HNEA 2L76A 5K4LA 4U7CA 4J03A 4EFOA 2R8IA 1WWTA 3QYPA 1KRPA 4EUTA 2AU0A 1ZDLA 3IHQB 4OJOA 4A8EA 2KWVB 5IAAC 4MSMB 4DXFA 4DSKA 2GOLA 2D5GA 2V1YA 4XDDA 3AV8A 1CRXA 1E9MA 3AE6B 2LVPA 4MEMA 4EZKA 4G8TA 4Y2RA 1XLPA 2FMPA 3W8WA 4IP4A 1U48A 2JEGA 2LGYA 3ZRCA 3N4FA 2F3NA 4F5NA 1UBIA 2L52A 4PT5A 1QLUA 4YTNB 5ALUA 3GZNB 4O0IA 2PVOD 4NWIA 3B0AA 4KDLB 3DESA 1D5MC 2Y9TA 4GIBA 4EKUA 3M8SA 5C0YA 4W9LA 2QJJA 4H83A 4WWNA 1ZW7A 2LM4A 4MJSB 3VRBB 4R63A 1UHUA 5AM5A 3ZJTA 1W1OA 2OFJA 1FPYA 2HHUA 1UT5A 1K5OA 2R2QA 1ZQEA 4KV2A 3SU8X 3VH3B 3QFAA 1V97A 4Q44A 3PHWB 3UGVA 1I4QA 3NGDA 2R8HA 4CF4A 2D07B 5JRTA 3H7SA 4M6WB 2Y1JA 1PZNA 3TAQA 4UATA 3C2MA 1YQ3B 4C8NA 4IQWA 3QU9A 3HUIA 4DSFA 3R2IA 5ALHA 4HVBA 1X9MA 2DKZA 4B9VA 3N20C 5AKJA 5JCNA 3JPNA 1AARA 5KFGA 3PSEB 4YXDB 3F53A 2YVCA 3AEBB 4FA6A 1T4GA 4BVUC 1NK9A 2FLLA 2RDGA 1ZQDA 2WP5A 3Q8AA 4PS3A 4NJ7A 2E1EA 2JRIB 3RRAA 2N7JA 4G50A 1WWVA 4G3XB 3N4EA 3AM9A 2KD0A 3VR9B 1RFKA 4IC7B 2SAKA 2MJEA 4K7ZA 1ZRMA 4K8DA 2PTLA 3C0RB 3GE8C 1ZQGA 3P63A 2D8CA 4H2AA 1GEUA 2A5UA 4K4IA 4I2EA 4PVHA 1U47A 2WOWA 3RNEC 2WPCA 5D79A 3NVZB 1K51A 3GFKB 1WF9A 4NJ8A 4UAYA 2KHWB 3DBSA 1IV8A 2AL1A 1NK7A 1QILA 4E5TA 3A7UA 1V49A 1GXFA 4F4ZA 2ASDA 3SSZA 4OZBA 4EYIB 3HILA 1S97A 4KPLA 1X2IA 2PFQA 3G6XA 3SI8A 2PFNA 1SE2A 1JOAA 3GRSA 4L1BA 2LPEA 2E1FA 1J2NA 4WJ3B 4QWEA 2B76B 1TYPA 3OJUA 3R0KA 4KEMA 3MY9A 3PZPA 2YN4A 5MPOA 7ICKA 4WURA 4XA5A 2JF5A 1H38A 3OHAA 4X2PA 1HTOA 1K8RB 1OJTA 1L7PA 4WWPA 2PVGC 2W9NA 1ZQVA 3Q8FA 2HOIA 5C1ZA 2V3PA 4M9GA 3VTVA 4FJZA 2ZTCA 4GXJA 2O6VA 4R3DA 3TACB 4F5RA 3DV9A 4DS5A 5AK5A 1MOKA 4M8MA 2KYWA 3ZDTA 2JY6A 2NTTA 5L1MA 4OALA 3K9PB 4RM9A 4BBNC 3CGCA 3CYJA 4O9MA 1L4DB 1URJA 2FNJB 1PVQA 1MI0A 2Y5PA 4ANWA 8ICVA 1IBXB 1JUDA 3NRZA 3U30A 2VH1A 2K1FA 2G9HD 3R11A 1WG8A 1ZXHA 1W1LA 2P66A 4PGQA 2A1AA 4IR1A 3QX1A 1FD6A 1DK2A 3LB8C 2GBJA 4E8GA 1FO4A 2PP1A 2LHEA 4DOAA 3U2SC 2VZKD 3VUYA 1T3QC 1A76A 4I2HA 1MHHE 1PGXA 2K8CB 2M0NA 1MG4A 4HPPA 5CTRC 3AB5A 4MSQB 5FS7A 3LB8A 4OCZA 3VA8A 5JHBA 2KVZA 5FP0A 1NJXA 3MR5A 1IIPA 1MSWD 2BYFA 3H1UA 1FEBA 2L00B 4G7FA 4MM3B 1BT0A 4C8LA 3D2SA 2WU5B 3EJEB 1LV5A 4C4SA 3A9JB 3AE7B 2PCEA 8ICWA 2RLTA 2CRXA 3TADA 4DSLA 2FIFA 2KVRA 2GRIA 3KWLA 3L16A 8ICQA 3P93A 1Z5SB 1SE3A 4F5QA 4F8RA 2MJ3A 4Y2JA 3UINB 1FNUA 2AGPA 5JCIA 2C5LC 2H3ZA 2M19A 3J9CA 3NZUA 5AKEA 1WI0A 2HSZA 2EZYA 3R66C 3ALRA 2CKHB 3QTPA 4OJLA 1D5ZC 3URYA 3RZWC 2OJWA 2DW6A 4K4GA 3BK2A 4RQ6A 4JV0A 4WAFA 2K4IA 4PJ0U 2ONEA 9ICTA 3ZYYX 1SJBA 4DL3A 2KMCA 1XU4A 4J9MA 4ECQA 1XCQL 4O1NA 1LFDA 1BWCA 2ZIWB 2DPIA 1E8ZA 1W1JA 5EU9A 3T3NA 3K1ZA 3KUZA 3GSYA 1COKA 3IG3A 5TSSA 3VUXA 2LFIA 2K4PA 1L8LA 3FC4A 2WXKA 1KCZA 2G45B 4MELA 1LVLA 1GV4A 2YX8A 4XLOA 5KFRA 1N6ZA 1UZXB 5KFPA 1XXGA 3D32A 3DDCB 4ITKA 3ZDMC 4DXAB 4KSKC 4BAXA 3DK8A 2LI6A 4KLMA 1IXRA 3TARA 2DFLA 1TGZB 1V5TA 3U7ZA 1C4PA 3HK0A 1VZ8A 4QZFA 4LLGM 2IPIA 2EZZA 4MF8A 2V4RA 4RGTA 3D46A 5ALRA 4KLIA 3JPPA 5LLIA 2JYTA 4JX1C 3PVLA 3WU2U 4YN4A 2IA6A 4RGNA 1XSLA 2KK8A 2J53A 1CK1A 1RM6C 4KMUA 2BQ3A 2N9LA 4NEWA 3DOWA 4WJQA 3ED5A 3ENLA 4DS4A 2PW9A 1WR6E 3UCDA 3SYZA 2DZMA 2GB1A 2QVHA 3L8KA 1COOA 3N9YC 2W3SA 1FFVC 3A0BU 5E6PA 2FYMA 4J3ZA 2CJOA 3ZTDA 5AWVA 5KFFA 4J9QA 2BCUA 1VZ6A 5HP4A 4M9HA 1NK0A 2BKEA 4H4ZA 1WXVA 2DNFA 2GL5A 5ER0A 1K1QA 5KHOA 3X23A 3A33B 4QNLA 2O2VA 4LCDE 2KTFA 3DEQA 4DWDA 5DCNA 4URKA 1FRDA 4FI4A 3PSFA 3GS2A 3Q3MC 4G11A 2MSNA 9ICKA 4BKGA 3RH4A 3T4WA 2M17A 2WDTB 4ECSA 2XY7A 1Q1WA 5L9XA 3OPXA 2FE8A 3C5FA 4ED1A 3JZUA 4TUSA 2BS3B 4ZRJA 4A20A 5CA7A 3Q8KA 5J8YC 4C00A 2Y0SF 4BWMA 2D3AA 5AI8A 2HHQA 2GR0A 5CR0A 2YVSA 4M00A 1ZD3A 4ROPA 4DXKA 5CJ7A 4AOFA 3QUCA 2BVGA 2JV3A 2KV2A 3CP8A 4KLDA 5T8IA 5J8YA 4ZOHB 2NQLA 3O0FA 3RGTA 3EFCA 4ZRIA 3VHTC 1XO0A 4KT2A 3GE3C 2KNBA 4PHDA 2E5SA 3JPRA 4BOZB 2OZ3A 7ENLA 3TI0A 3RT3B 5DBCA 2N1VA 4RQ4A 3ZDEA 3HIZA 4IT1A 2B6GA 3TTEA 1FXAA 4EELA 2BCQA 2YMLA 5DB8A 2JEJA 3KWVA 3RNGC 2KSOA 5ALXA 3BVGA 3C21A 3DERA 1RPLA 2OEHA 3TEYA 4XYCA 1SJED 4WIPA 1LB2B 2ZZCA 3VCBA 4LNOA 3TANA 5B66U 1GRFA 3NVYB 1MVKA 1SJAA 3RCZA 1X66A 5AK6A 3QE9Y 2AH5A 3C28A 4CRXA 4GC7A 2HE7A 1B22A 1T7PA 2KTQA 5HMLA 3C2KA 4P16A 1BPZA 4W9FA 2JXXA 2G3QB 3GB1A 5L83A 1R4NB 5J17A 2LD9A 1GSNA 1Z1VA 2G4DB 2C3DA 2OVLA 3QU4A 3RBEA 1JCTA 5JTIA 2OZ8A 3ISDA 4KWSA 1N5WA 1V9PA 5J2DA 3AE9B 2QJLA 3VCNA 3EC8A 3H0MB 4NM1A 3HPOA 2L0TA 4FX9A 5CHFA 4QZAA 5E6OA 1EC7A 1XD3B 4KLSA 2MCNB 3B97A 3JVAA 4K3BA 1RQNA 4BJQA 3P2BA 1ZJNA 5U25A 3MFIA 3M9MB 3NS8A 3TX1A 1ZQBA 2CN1A 3HSUA 3CIRB 4GN1A 1EO6A 4UB4A 1KFSA 3Q8BA 2B3AA 5FXFA 2INPE 2X50A 2IZVB 5FS8A 4I2FA 5KAFU 3QXGA 3L3FX 1B4FA 1Z19A 3CSFA 3S2AA 4K7WA 1YQBA 4KITB 5KG7A 4UB1A 1ZQIA 1ELSA 2VKQA 5B5EU 3N6HA 3BDPA 3LDAA 9ICBA 1SE4A 2XEWA 4IZGA 4RUAA 4DWFA 2NVUI 2A4ZA 2PTXA 1HEZE 3DVGX 4FN2A 2BWFA 4F72A 1SZHA 2AXTU 3KBBA 9ICIA 2CHWA 2HBMA 3C0PA 1ACCA 4EQRA 3THUA 4MJSA 1WUEA 3UXOA 1QOGA 4LTUA 4KKIA 1KKOA 3A0HU 2KLCA 5EBKA 4EQXA 3A7AA 4FBUA 3ES8A 4RQNA 5TR3A 3ZD9A 1RYSA 3P4QB 9ICOA 5CRXA 1YQZA 2GMIC 1FEZA 2JH7A 1KJTA 2KJ6A 1Q1OA 4J9OA 4I2JA 2DKXA 3NVZA 4YSZB 1ZQZA 2MA1A 4BC7A 2K4EA 2JXTA 1WUFA 4FDCB 2KJHB 3MR3A 1IUEA 4EBCA 3RAQA 4W9JA 1HUOA 1IYFA 4E4FA 5JCKA 4ED2A 1V8CA 3QAQA 3T5JA 5ALJA 1S8OA 4UQGA 4IQVA 1HA5A 2YEPF 2KN5A 3HW8A 2GQUA 2BVCA 2FLNA 3T9LA 1NYQA 5AKYA 2ZXHA 4LDTB 1RG6A 4X57B 2HCFA 2UVVA 1WRDB 2VFTA 3H8AA 4EZ9A 2P8BA 4ZHOA 2L0FA 3KYDD 2PFPA 2WF7A 1QLBB 2KTRA 2W9BB 2YLMA 3A1QB 1UXYA 2LHTA 3BY4B 2HXUA 5C2TB 3S1FA 2DQNB 8ICOA 3PLVA 2KC1A 1E7UA 3H12A 4PHEA 2N0SB 3Q69A 1SB3C 1ONFA 1VRAB 5F9LA 1O08A 1HZ5A 2KMMA 1PQSA 1WH3A 2ZZPB 4R66A 4IQTA 4UASA 1N60C 4QWBA 5KG3A 4DLGA 1FECA 1XPYA 2WU2B 4PWBA 2JT4B 3N28A 2WHEA 1XDIA 4ASWC 2YB4A 7ICEA 3AU2A 3ENEA 1CUKA 5BYSA 2FKPA 3NHEB 2OQYA 4XZ4A 3TMPB 1H8CA 2MX2A 4Q8FA 1UCVA 3B1LX 3IXSA 2JYEA 3MC9A 2QGYA 3LADA 3D9XA 5DBBA 4Z1YA 4KTQA 9ICQA 1AHZA 3Q6JA 2NCNA 3UQBA 2W11A 3LXFA 4DNAA 2ACZB 4P1CC 4WWOA 4K3CA 3RJEA 1IBXA 2R2ZA 5EE1A 1YOVB 3MHSD 1Z00A 4MDKE 5D94A 4HKZE 1K53A 5J0QA 4TV3A 1SKSA 3PZ8A 2UUVA 1JIHA 5BO4B 4RGMA 4ED6A 3EW9A 1D8BA 3NG0A 3W5VB 4AYBF 4RF0A 4B9KA 2N9PC 2W43A 9ICPA 3QN3A 4PZNA 5L1JA 1MQ3A 1XF5L 2DYMA 3UGBB 1SB3B 2ZNVC 1UT8A 3I6EA 2KO3A 5FMHA 3V61A 5G5GA 5AM3A 5J2IA 2ZIWA 1CJEA 1M94A 2X38A 4ANUA 4ECZA 4O3QA 2EH9A 3KD3A 4JGHB 3UJEA 3OSNA 3L54A 3B0YA 3F2BA 5HHDG 4HK2A 2FCMA 2MBRA 3L5KA 1T0QC 2XNAC 1WXMA 1WR1A 3QLDA 4DL6A 3ZNID 3T79A 2XH7A 3ORYA 2MWSB 2K8CA 4E0DA 2WFAA 4K2SA 3V4BA 1R7SA 2IGGA 3K4GA 2WOVA 2Y4GA 3IVFA 4ELTA 2YB1A 5AK3A 2OG9A 2V4QA 4J57A 1KFDA 2P4PA 4C4RA 2P6RA 4CE6A 1GRHA 2E6XA 2JRZA 2E8PA 5AI6A 1C9FA 1V80A 2QILA 3Q6BA 5J18A 2L8JA 3DQ0A 4A9AA 1L7MA 1FXIA 3RH5A 2BWES 5J29A 1TAMA 1B43A 4NLZA 2KX0A 1WMHB 8ICLA 3MGHA 1L3VA 4O3RA 1QOFA 3R2TA 4M0WA 5TR5A 1MUCA 2GGHA 3CB3A 5AUKA 4BX9C 4J9LA 2Y0SC 1S77D 2JSVX 4EZ6A 2M0AA 4RCOA 3HKZF 4EE2A 1E8FA 4KMOB 3BZCA 1TK0A 2MU2A 4DBGA 2YAUA 2EQ9A 3C1YA 3WK9A 1DIIA 2P6UA 3T3FA 2LVOA 3PREA 1N63C 1ED1A 1YJJA 3BQTA 4ELVA 5IKCM 4I2CA 4DCCA 3JPOA 3LJ3A 8ICUA 2WDWA 4EC3A 3RH6A 4DFDA 4JV2A 3NS1B 3RJJA 2BPGA 2D10A 3ZNZB 1JMLA 1AQ6A 2G5IB 3ZUNA 1WX8A 1OQYA 3VFCA 3ZD8A 2A19A 1D6EC 1F2RI 1W1KA 1IGCA 5EOZA 1SXEA 3BZDB 3EA6A 3L13A 1RAXA 3Q45A 4Y2PA 3KHRA 3PX0A 4M9NA 1WVFA 3Q4DA 5JCLA 2LGSA 9ICXA 2DZIA 4J9RA 4NLKA 2WB1F 1L0XB 4BKSD 2NV3A 2L7RA 3H4BA 1N5WC 1GRAA 1ZQOA 4H4YA 3SJNA 2L1AA 4KN4A 4GR1A 2NRTA 3HW2A 4NY8A 4J9PA 9ICGA 1RWSA 2KMAA 2X8HA 2KLGA 4HXDA 3E58A 4GGQA 1AOGA 2I1JA 2RK5A 3KHGA 2I1KA 4DLEA 2HDOA 4XX5A 1X1MA 2WXLA 4N9F4 4ACFA 5D46A 4ADWA 3AN1A 4DQQA 3LLBA 4NAWB 1E8XA 2R8KA 2KKVA 2MHJA 4F4RA 4H2HA 3TSHA 5JRBA 2ISPA 3B9JB 1WJ6A 3ISBA 2AQ0A 4YSXB 3MKCA 3MWCA 3WANA 2RDXA 2KDFB 2BC1A 5KT4A 4IRKA 1UNSA 5CHWA 1KFTA 3OW1A 2KD1A 2FJ6A 2DAJA 5AIAA 4FJVB 2MRLA 7ICFA 1S76D 1L3TA 2J3NA 2R9ZA 3PVXA 1L8PA 4P0QA 4NLGA 3QUQA 7ICUA 5HKHA 5H8YE 3KLSX 4J56A 2J7QB 3ZNGC 5L95C 2KJ8A 4HYKA 5F3XB 2WAQF 4DFJA 4LVSA 3DBHB 1ZPSA 4AUQC 1XANA 1NI2A 2CPRA 2BT6A 1FM0D 4BV6A 4IDIA 3UJSA 4YVZA 9ICWA 3QZ8A 1UELA 1ENFA 5HI1A 3RBDA 2JR5A 3CYMA 5KFAA 2VFVA 4ECUA 1EBGA 2ZNVB 4ELUA 4X5VA 4MACA 1CQVA 1XQQA 2GR1A 3ZTCA 2WXOA 1U49A 3PFRA 4DYEA 3PSTA 2RDIA 2K5PA 4PL1A 2OLAA 2YEPB 5BMGA 1V2YA 1N62A 2LM1A 1QH9A 3OAWA 8ICSA 2N9KA 3EFUA 7ICRA 2W54A 3LWLA 1UF0A 3DBLI 2A1JA 1K50A 4ZYNA 1N61C 2R8DA 3PTFC 3FAHA 3NUHB 1J97A 2DYOA 3I99A 3G6YA 2ASQA 4QIWC 4DFPA 3BQ2A 3ZKJC 3APFA 2W7OA 3CT2A 3ETLA 2QKQA 2K8BA 3H7PA 2BPSA 1TY2A 2HBKA 4GU2A 2W3RA 2P8CA 2YVGA 1T94A 4JAYA 3SAGA 3Q8MA 4DF4A 5J2EA 2ALZA 2QARA 2LASA 2OHFA 4R8UA 5EE3A 4LNNA 2H3VA 1Y56A 3WALA 5HQXA 5KG5A 2KZZA 2GGJA 2I9GA 1I7HA 4QZGA 4EMIA 5GRTA 4RQ1A 3UM9A 4QZIA 2XGPA 2LWPA 3AEEB 2BKFA 1X9SA 2KDMA 5FJRA 4C4VA 3QWZB 2KAJA 4DHGA 5FKAC 1YX6B 2F8LA 4RGOS 4F3OA 1AHVA 4MFCA 4LIIA 2BZFA 3WK6A 3CXOA 4IG7B 5EDSA 5C23A 4PPXA 2PTYA 2G07A 2RDJA 1EBDA 5AICA 2A8XA 2QQ6A 3GILA 4JWNA 1Z00B 2G1EA 2VH2A 3PW2A 4P0PB 8ICXA 1QTMA 3AI5A 5KFDA 1BVSA 2F76X 3QU7A 3T5HA 3H8MA 2BBCA 3GY1A 4PS8A 3GU3A 3ZQ4A 5D4BA 9ICUA 3OGUA 3MJ5A 4JHMA 5FJUA 3UXLA 3BZKA 4XRHA 1D7YA 2LJ5A 3GIKA 2KJ5A 1YEYA 3RB6A 1TT5B 3SFEB 1F0XA 2H3QA 4RNNA 9ICFA 2NPTB 3R8BA 1RXWA 4YL8A 4EENA 3HJEA 1RXVA 2PE6B 3WKBA 3V7JA 2HD5B 5AKGA 6ENLA 2CU3A 4MEXA 3KW5B 4Q8EA 5ALMA 5LXHA 3A9KA 1ZQWA 5IOIA 5BOEA 2ZZ0A 4QAYA 4DXGA 5ENLA 5GMVA 2C3CA 5ALYA 3CNHA 1PGAA 4KKJA 5H92C 2CHXA 3LAEA 4AQ7A 3MR6A 3AL0B 4FBJB 3PW4A 1LXDA 2KOBA 4PGXA 3BINA 3PGEA 4A55A 2W9BA 4BC9A 3A1QA 4OVVA 5ALFA 5G2NA 2AJQA 7ICGA 3SD5A 2H5XA 4US8A 1WSPA 3N97B 4DQOC 1U45A 2IBKA 1GUAB 4HDOA 3GDXA 3UMCA 3RJKA 2HHSA 3VAWA 2OCEA 2BQQA 4GGHA 1JRPA 3AEFB 2X8CA 2GBKA 1WXQA 5LXIB 2R8GA 2VJ4A 2C7NB 1WCNA 4K1WA 1EM7A 3M7DA 4OHJA 4BBNF 1RDFA 3LYSA 1OEYJ 2XVTA 1E0ZA 4RUCA 5KT6A 2GH1A 3BQ7A 1C77A 4MM3A 4RT3A 3KHHA 1A6SA 2WF8A 3S6JA 3OJ4B 1FCCC 3MGIA 2K8AA 3B0XA 3P3BA 4W9DA 4IR9A 1DRGA 2KFZA 4M9JA 2K25A 2TPRA 3C23A 1R4MI 2P88A 4RM8A 4HCDA 1N5XA 2YQUA 1SIFA 3UIOB 4GLXA 2AL2B 2A3VA 2UUUA 4M0XA 1XO1A 4E3CA 1V85A 1SGHA 3N6JA 1I35A 2WXJA 3EEZA 1T3NA 2JZBB 2F8KA 4QZCA 1NJWA 4ZOHC 3SZ2A 1L5PA 5ALGA 4KLQA 3SN1A 4A6GA 2OAIA 3STPA 4DL4A 5FS6A 4QJFB 2WF9A 1KL9A 4KLTA 1E7VA 4HDQA 4WAAA 4EQSA 3APCA 1DGJA 4I28A 2KDIA 2C9WB 4C7ZA 5D3IB 4MGKE 3ZVHA 1FMAD 1LQBA 2KQ7A 4F93B 1JWMD 5IIIA 2VFUA 2JH1A 5GTHU 5KG0A 4LJPB 1SL0A 4GFJA 1KKRA 1TAUA 2PGEA 1ZKHA 1G6JA 2KN7A 4RT2A 5U1OA 5EE9A 2XICA 5HR6A 1VQZA 2AHOB 2ZG6A 5J0TA 4RQ5A 3RR7A 4S17A 4YXMA 5IIJA 2IHMA 5D3DA 2P3ZA 5DDYA 4UBCA 7ICLA 4UAVA 3BS5B 1ZP0B 1BGXT 4AJWA 3PS6A 5GTIU 3MC1A 9ICVA 3TCAA 1X9XA 1ZD4A 1EBHA 4UB6U 2O56A 3NVVA 3VTEA 4MMWA 4BUGA 1IPGA 2Z0DB 1FFUA 2NRVA 5J2AA 5AZGA 3DBRI 1V38A 4ZRQA 4TQRA 4CYEA 3B9JA 3DGBA 4M52A 2KQSA 4A3RA 1D8YA 2GH5A 5KFMA 2ODGA 1IG6A 3PO0A 4P1BC 4PZFA 3RAXA 2HJ1A 3N32A 3DFHA 1TKKA 3SQSA 1FRRA 1FFUC 3V5CA 3DDHA 1YX5B 3CXBA 5CX3A 4K1RB 3KUCB 3UIPB 5KT5A 4RPXA 1LGRA 5J0YA 1MHXA 4IL6U 3Q8SB 3TADC 3WKCA 1T8EA 2IO1B 5ALQA 1L3SA 1C4AA 4PH5A 3Q3JA 5L1LA 2C7MB 4HN8A 1D9DA 4HNCA 3M6KA 1GETA 2BCVA 4Y2XA 9ICJA 2KK0A 2DLBA 2MA9B 1WGYA 3W8XA 3Q3OC 4W9KA 3LWMA 3PWGA 3DPDA 4MT5A 1SL2A 3L10B 2CHZA 3VR8B 5DG8A 4F7ZA 1KLVA 2K89A 4YD1A 4DFMA 3GIIA 4KLFA 2IY1B 4NEVA 2WP6A 4PHPA 2GSHA 1W1MA 5DGBA 1NDDA 4M0WB 2M1MA 3PO5A 1WGHA 3GIMA 3ZLZA 1Q3VA 4GISA 4O3MA 1MG8A 4G0NB 1TS4A 4ARCA 5BMIA 2Z8LA 5I1WA 2INDC 3PT2B 5KT2A 2V6OA 4Y2YA 4A90A 5HFYA 1AWDA 8ICPA 4NV0A 1WVEA 5L6GA 2XGQA 1QQ5A 4YG2A 1NBFC 4MF2A 9ICMA 1ZQ1C 3RB3A 5CP2A 2J6TA 1TE2A 1JW9D 1WXAA 2KMDA 3PLUA 1DXLA 4JB1A 2J0MA 1FEAA 2W04A 3CGBA 2V4LA 1BPXA 4JN8A 4XE0A 2V9HA 3IP4B 5DPWA 3EWAA 1E6EB 4O3SA 1MRAA 1WGRA 2WF5A 1PK1A 2HQMA 3IBEA 3WCQA 1OUQA 1KLUD 4XWWA 2BR0A 3DIPA 1C4CA 3NVYA 1PVRA 1SSNA 4M02A 3DG6A 3EKGA 3E2EA 4MKSA 2PP0A 5ALVA 4BDPA 5E79U 3JSVA 4PYTA 2JMGA 2ZJ5A 3W8ZA 3DK4A 3UXKA 2YVJA 3RITA 1ZD5A 4QZHA 1SL1A 1WWUA 3R7QA 5C3JB 2FIDA 3T5LA 2TSSA 4F4WA 2VFRA 4O3PA 2CDUA 5TISU 2OPJA 3D6JA 2MBOA 3ZXVA 2PODA 2FI1A 3OTRA 3PSIA 5G5HA 2VA3A 1GC7A 5G55A 1SIJA 3OPSA 3M95A 4M0AA 4C4TA 2MLBA 2OZTA 1TYTA 3GD6A 3A4RA 3IDWA 5IIMA 1NOMA 2XK5A 2FE9A 2XO7A 1ZKQA 4MLAA 2Y1IA 3ES7A 3RNFC 3FILA 2HVHA 4NNJB 3MUCA 1Q3UA 5DB7A 4J3OD 3VVWB 3A7RA 4PGYA 4KX5A 8ICJA 2QMTA 4Y2UA 7ICIA 4AP9A 4B6JA 3Q8CA 5HHZA 4AP4C 4C80A 4P0QB 3I9V1 4FLHA 4MHVA 4TSSA 1ZETA 4GIVA 3RNBC 2UVRA 3BK1A 5LNK1 3B2GA 4YCXA 3M9OB 5EWGA 7ICQA 5KG6A 1DYQA 4ED7A 1M4VA 2W9AA 1RRBA 5FJTA 2BYTA 1AHUA 1UPHA 2ZZBA 1C78A 2EQ8A 3ZVVA 4EMWA 2F1JA 4UBBA 1R4NI 2N7EA 3TFRA 4F50A 3N7SC 1PFDA 5GXGB 3VC5A 2OXOA 2VIXA 4I2GA 5K8EA 4F91B 2LYAA 1TY0A 1VJKA 4RQ0A 4JPSA 1EU4A 2JXJA 3AXCA 3EHVA 3H7IA 2WXGA 2VFSA 4M8NA 2C22A 3BVZA 1IYXA 2UVUA 2OEDA 2KDBA 3T9PA 2REXA 4EX7A 1K1SA 2R2OA 1WX7A 2MW5A 4PS7A 4QZDA 2KHQA 2QC8A 5AE3A 5AKKA 4NL9C 3QU2A 1F44A 1NHRA 5EE0A 2WS3B 3SN4A 2ZUDA 4WWMA 3MC8A 4ICUA 2F1IA 3QX7A 3U8ZA 3IJIA 2Z59B 2YMPA 4IHCA 3PX4A 3PK7A 3KJMA 4MGYE 3VCCA 5KHQA 4RZRA 1NENB 1ZQQA 5KFSA 4ECVA 3E0FA 2EAMA 3PSPA 3RRGA 1DXSA 2YQEA 3NS1A 1A70A 4IWQA 3VDZA 1V86A 3ZGZA 2AEHA 3I6TA 2IOFA 4Y2TA 2QKNA 2AGQA 3GO2A 5BYRA 3K1RB 3IT4B 2AKZA 2KEYA 4G3IA 1JXEA 2NPTA 2EANA 3QEBZ 2NMQA 4KLHA 2VANA 3NRZB 4DOBA 1KN0A 1UWXA 2INCC 1PK3A 1TAQA 2HXTA 2LXCA 1VLBA 4GIRA 2RDHA 1N62C 3V6JA 2G06A 4C7YA 1EC8A 3QC8B 3A9KB 4G9BA 3A9JA 4FO6A 3JW7A 2B0CA 3BJYA 2WOIA 2DX5B 4UDUC 1BMLC 3P4PB 2JWZA 3CW2C 2C2DA 5ALOA 1UD7A 1EF1A 3T8MA 3MC0B 2E8MA 2ZPNA 1R0MA 1E8HA 4QWAA 4EYHB 1VD2A 4APNA 2QB0B 2NRZA 1L5UA 8ICZA 1HXYD 2SEBD 1R6WA 9ICSA 1EWCA 2L32A 5KG2A 3APDA 2E5AA 4Q45A 4C0ZA 4OD0A 2K6QA 1TZ1A 1V81A 1H2IA 4NJ6A 3N7PD 3Q14C 3DWGC 4MGZE 1NYRA 2LZ6A 5KVIA 1SZPA 4DQRA 2ZVNA 3EAOA 4YWSA 4OZCA 2AKMA 1SBBB 4KGTA 4RF1A 1S0MA 4IQUA 8ICYA 4RH6A 3BYYB 4M01A 2AX5A 5I4DA 1BQGA 4PVJA 2G08A 3P1MA 3DFYA 3GOEA 1HTQA 2V0GA 3ZI4A 2ZJAA 3URHA 3QPEA 1QSLA 2RPVA 2UU7A 5KT7A 1I4RA 3KUMA 2FCQA 3I4KA 2WXNA 4E6MA 8ICTA 2EDUA 1NPXA 1KD0A 3H6NA 2XGZA 3GD4A 3HKZC 3ISCA 2FDRA 2UVWA 4IRCA 4K4HA 1ZDVA 3QK0A 3GQCA 4HWIB 1BUIC 3SQIA 2R8JA 2N4FA 3L08A 1SXDA 5TZVA 1FFVA 2HBJA 2BS2B 2RRDA 4ECWA 1P3QU 1QT9A 2Y9UA 4B0EA 3ZDBA 1OXJA 4YQWA 5AUIA 1DOIA 1PUZA 3EYZA 3KZIU 4MGGA 1LO5D 2XCPA 2IOFK 1SWVA 3N1XC 5KFNA 2WBAA 4AWJA 1B1ZA 2HHXA 2I1QA 4KLOA 2NYVA 2J4XA 2A1JB 3IHPC 1KRHA 1Q8KA 4HJGE 2JEFA 4EZJA 3OJSA 3SV4A 1MC8A 2I6XA 4GSWA 8ICRA 4IWOA 4W9HA 4M2YA 3VH4B 4ANVA 2FPKA 1MJDA 2XY5A 5CEHA 4ED0A 4TQ0A 3V6CB 3EJDB 3BSMA 3AULA 3ZVHB 1JMSA 1ZJMA 2D3DA 1EU3A 2AQ2B 1GERA 3VDGA 2WB1C 2PJHA 7ICTA 3TBLD 3W1SC 1UGJA 2M0XA 4HRSA 1ZQHA 1GO3F 2DWQA 4GOCA 1F0MA 4FULA 1TV9A 5HHHA 3UPQA 1EUVB 4TVWA 3RR8A 3VC6A 2PLIA 4IUMB 1NKBA 4BXOA 2KFJA 4FE3A 1F0ZA 2Y3SA 1RVKA 1HSKA 3AU5A 9ICLA 3F2CA 2HVIA 1I4XA 2JU6X 4U6PA 3AEVA 2R61A 4TKNA 4UD8A 2GGIA 1DOYA 2RP5A 3H8WA 5IIKA 5DB6A 2PPGA 2KKCA 1Z1BA 2ICIA 2L05A 5AM1A 2FCSA 4GDLB 1ZXIA 2DGZA 4DK5A 3SMVA 3ZJVA 1O03A 2W7PA 3IG5A 5AI9A 5AKZA 2IO2B 5ALIA 5KFIA 2V3NA 3LYYA 5EWFA 1UH6A 2K8HA 2CJNA 4RMAA 1HUZA 1FHUA 3Q8QB 2PKOA 3C5GA 3D2QA 3F2DA 4ECTA 4IKGA 2W8LA 4ARIA 1Z4OA 4DL5A 2CHRA 3AEAB 3V05A 1V6EA 4QZ8A 2JVCA 4O3NA 2BVHA 2NR2A 5J2BA 2EELA 3SENA 4XDCA 4KLLA 2PA6A 1BXTA 1DK3A 1DGSA 1GG3A 1XT9B 4Y2QA 2IDYA 4E74A 3Q8RB 2RHFA 4WQOB 3QARA 2YMMA 2Q4WA 2WPFA 2NPXA 3QIJA 2VA8A 1S10A 3P0WA 2I5QA 1F77A 5FJPA 2UYZB 4DOCA 4QW8A 1L0VB 3E9SA 3B08A 4UW9A 1NU5A 9ICRA 5KFEA 2JPHA 3HRDC 4IWPA 4YTPB 3KUDB 4IC9A 4DSEA 4M04A 3R25A 1KM7A 4M47A 1AN8A 2ZEQA 2X8GA 1I4GA 5J2FA 3DHIC 1TBEA 1VDVA 4OO1J 4RPYA 2KXJA 5DGAA 2QDDA 3TKAA 7ICJA 4IOIE 3F5EA 4EQWA 4ZH4A 2XI9A 3SR6B 4A35A 2EMTA 2ZW1A 3TIXA 1SV4A 3CK5A 1ZQPA 2HTME 2KQ4X 1KFYB 3UI3A 4DDID 4QZBA 1GPXA 1GJZA 3UJFA 3OWEB 1XWLA 1IP9A 4IS7A 2RQ5A 3HVZA 4D2KA 1AROP 4YR3A 4ZRPA 4FJYA 1NK5A 3HHMA 2PP3A 2GR2A 2OO6A 3GC2A 3OP2A 5J0WA 2Y5CA 1HZ6A 1FCLA 4BOSC 1SV0C 2OM6A 4I2BA 4JV1A 1Y88A 4ZHPA 2BDPA 2KVCA 1TK8A 1L2NA 4Y2SA 4IL0A 2MP2A 1SJDA 1KBUA 3SHQA 2KP7A 1C3TA 2H3IA 3JW0X 4JL9A 1PDXA 4JUZA 2EQYA 1BNPA 2POZA 1L3UA 2EMSA 5FR6A 2V4IB 4ZDVA 1HJPA 1NKEA 1OEYA 3DBHI 3JPQA 1U4AA 2J0KA 4HKQA 5AI0A 1JN3A 3N4MB 1T6BX 2D3CA 3VTUA 2GO7A 2ZVOA 3AE2B 5ALWA 4YWGG 3M9NB 5AEKB 1E90A 3POPA 2GBRA 4KGRA 1WXSA 5KFHA 2KJRA 4H4VA 4JDRA 3DEEA 2JZPA 3U52E 3VUWA 4F2RA 1C79A 1ZR6A 3W1YA 1JEHA 1S7MA 1ZQTA 3UMBA 1Y8RC 3II4A 3O0HA 1PYWD 4K7UA 1T5XD 4K8GA 4RQ3A 2L83A 2Q4TA 7ICNA 1MBBA 4F4YA 3H4DA 2MBHA 1EXNA 2LGDA 1N60A 1HIWA 4F2SA 1GAQB 2KOXA 1ZQNA 1WRIA 3HM6X 3HVDA 4MH8A 2C2EA 5DDMA 1JWAD 3PM9A 1ISNA 5DG9A 1CEZA 1ZGUB 3DVNU 4ED3A 3RUIB 2AGOA 2WX0A 2K6DB 1BKHA 4YMMA 1GC6A 1YD8U 2GBMA 2YVFA 4DQSA 1LKYB 3RJIA 4OJ6A 3ZLFA 1MN8A 2O2VB 3EJBB 4AJYB 2VZKB 4A3OA 1UUPA 1KW4A 4C8KA 4R65A 3PR4A 3TEZA 4BBYA 3PWIA 3TCSA 4ECYA 3MQTA 1ET9A 1TJEA 2AWTA 1FXTB 2X8XX 2KG5A 1P43A 1YN4A 7ICVA 2NRWA 3QNMA 3V7KA 3N1YC 4H50A 3WK5A 2ZXIA 3W9CB 3RTVA 4ECRA 3U4EG 3AEGB 4BZAA 2F2AB 3V7LA 3WKAA 1ROEA 2O6VD 5AZFA 4TUUA 1BPBA 5BOMA 4P6VF 1BNOA 2OX4A 1SEBD 4B9UA 3DBLB 1X6IA 5J2CA 4C4VB 4GC6A 4DQIA 3GZFA 1XS2A 2NVKX 2BHNA 2RD0A 2ZIUA 3PHXB 3ZRFA 2DZJA 1L7NA 1ZOYB 2IJ0A 2QARB 2IHNA 2KX3A 4P4PA 4KLEA 8ICAA 4BFRA 1YNTE 3N7RC 2WXRA 3ZNHB 3RNCC 5KNIA 4P0PA 3QFBA 4HG0A 3ABVB 3HRDD 1TKGA 3FJ4A 1ZE3D 1I4PA 1KH0A 1V5OA 1ONEA 2E8OA 3QUTA 3PPAA 4ICVA 5JZEB 3TSSA 1Q1RA 2Y5BB 1E10A 2BTEA 1TS5A 4GDLA 1NZPA 1EC9A 4UB5A 4ICAA 2QSDA 1ZQUA 4M6WA 5AE1A 4DNSA 3DH9A 4KZCA 2G09A 2N1RA 3UJRA 7ICHA 3TUOA 2JHDA 4QZEA 3U4FA 4PL2A 3FILB 5DKWA 1YZ6A 4R8UB 1ZQRA 4DHJB 3KKAC 1JALA 5FXDA 4R64A 5KFVA 2KZMA 3AE3B 2ZUBA 4L2YA 3PQBA 2N1WA 5ALKA 4QWDA 2WP9B 1F3PA 1LPFA 1MFWA 3MDAA 2QJMA 3FW8A 2AQ3B 1F2RC 5IP4D 4J9KA 2KTRB 2KZRA 3ONSA 1W6TA 3KKAA 2FMQA 2HTHA 2K3UA 1QSSA 2JRHA 4ENLA 5AM4A 2WDVB 4GXIA 4MFAA 3H8HA 2EAPA 3QZ7A 2BCSA 1K52A 4YMOA 2C2RA 1KTKA 2IO3B 3ONNA 2GLEA 1JQ4A 3UXPA 4KPRA 2LYHA 4EEWA 4LJXA 1TYGB 2WLBA 3T6CA 1YQ4B 2WTFA 2K39A 3IT6B 2OH2A 5D2MB 4LK0M 1JWSD 4GRTA 2LVQA 2V9WA 2B21A 4DF8A 3RJAA 1AW7A 1RYJA 5HMMA 3VC8A 3MJWA 2QAEA 1IGDA 2BCPA 4JK1A 5F9NA 1D5XC 4NPNA 3VQIA 1W1QA 5I1VA 1XCTL 2Q5WD 2N9XA 3THVA 1WZ3A 2VJ5A 5KFCA 4NLBA 3I63C 5D6JB 3RR1A 1DZNA 1QF6A 1VCBA 2LI5A 3BQ1A 3PO4A 1ESFA 3VXWA 3OC4A 1HEKA 1NNLA 1NHQA 3BWUD 3DG7A 3G6VA 1FNWA 4BXOB 2KN4A 3GIJA 4FS1A 3TEWA 4YT0B 1SXTA 4B9SA 1X2GA 3V3WA 1NEKB 3CF6E 4W9GA 2LKYA 2LHDA 4QZ9A 3MHZA 5KFJA 4EOYA 3ZVIA 1NK4A 5J0SA 2GWSA 3I28A 1UBQA 3PW5A 2MSED 4Z17A 3I1YA 3V6EB 4RQMA 4J1OA 2O6VB 4RNAA 1Z3EB 3FDSA 5AKLA 4DHZB 4WJNA 3NZGA 3QUBA 1SJHD 3PZDA 2FLPA 2BDUA 2BQRA 3RB0A 1S0NA 1P48A 2PMQA 1JROA 3PY8A 3ZO5B 4JIOU 3NOBA 3BJSA 4J9SA 3AE1B 4KX6B 1I4HA 2M8SA 1A0PA 1N48A 1X9WA 4HROA 4NQKE 2W9MA 2HJ8A 2GQWA 3SEBA 3RCYA 3TWBA 3AU6A 1T3QA 3PZ7A 1NI3A 1WJNA 3UQ2A 1SJCA 4I2AA 4FFDA 1SV0A 4DFKA 2HHTA 1WZ0A 2IOHA 1NDAA 5KFUA 4RPZA 3CRXA 1XHCA 3R07C 4A6QA 2KACA 3AECB 1L7YA 3DG3A 3GV8B 4KLUA 4JLCA 3RNAC 3CGDA 3PNCA 3W2DA 1F9CA 5J0OA 2VRRB 5ALZA 2DZKA 4IM2A 2WXIA 1JDFA 2XIDA 3MFHA 3LK9A 3GP7A 2GDQA 2QB1A 5DQHA 2KT7A 1RM6B 3R1ZA 2BF8B 5EWEA 4LJOB 3U7DA 2PMZF 4JQWC 3AUOA 9ICEA 4KN7A 3IN5A 2ASLA 4HCLA 3WAPA 1N61A 4JWUC 5DPTA 4FZLA 4PHAA 3ZDAA 1P9DU 4F4XA 4BKSA 2QDEA 3TQPA 4LZGA 1BPEA 1RFAA 2FUG1 3RJFA 1OGWA 4CGZA 5DQIA 1WJUA 1ZQJA 4H4XA 2EKIA 2RDBC 2I5HA 3EANA 2EKEC 5HNKA 2N9EB 2PKEA 2WYQA 3KQ4A 3M6ZA 2PXIA 2F1HA 2MAXA 3NXLA 3BIID 4IM3A 1OQRA 4HPLB 8ICBA 2LJIA 4PZOA 1ECWA 2LXAA 3NZSA 4J6IA 2DHZA 3TSJA 3LVVA 1Z2MA 1X2HA 7ICPA 3WK7A 3D2NA 1Q10A 3OZYA 5HHIA 4H4UA 8ICHA 1YIWA 3BQ0A 2PLPA 3OLMD 3P4SB 4BKTA 3L4PA 4TURA 5A0LA 1V9JA 5CWRA 2H88B 4HPMB 3DHHC 8ICMA 5J2JA 4I2IA 4QW9A 1NVID 4EM4A 2D3BA 2Y3AA 1ZRNA 5AI4A 2WHIA 2ZPYA 1YT3A 5KFTA 1CZPA 3IK4A 1UGMA 1UQVA 4ACOA 3U9IA 3SR6A 3MABA 2BCRA 1JPDX 3ETRA 4UAUA 3NVWA 2PTWA 1ZQFA 1F8WA 3DK9A 4KLGA 1C1YB 4A8XC 4NY0A 4N6EB 1V1PA 2DPJA 3WAOA 4LNIA 3RJ8A 4JWMA 5BYQA 4I6NB 4EX6A 3M63B 3NJTA 2IPKD 2K22A 4NQLB 3DCGA 4TUQA 1CMXB 1ZD2P 4YSYB 4J9NA 2HHWA 8ICIA 2RR9A 3L17A 3H70A 3SFDB 5KFWA 2R18A 5C5JA 1WM2A 4E4UA 3KVFB 1DOQA 4CF3A 4W9EA 1S0VA 3KHLA 4UB8U 2LUMA 1SF0A 1IM4A 2BVFA 2P0IA 2RSUA 1JWBD 4YD2A 2MQJA 2BC0A 1TZOA 2AXRA 2XSXA 2MP2B 3RI7C 5AKXA 5KFYA 1PK1B 2GBNA 3UMGA 2G5HB 2WGSA 3EUB3 1QSYA 1PUTA 2C7HA 5JHAA 3Q2AC 5J0RA 2MBBB 4GXKA 4Z6FA 3UQAA 2UWQA 1LKYA 4CF5A 1WFYA 4NLNA 2CR5A 2BPFA 2ZW0A 3RFZB 3RJHA 4GB9A 4OW0A 5ALNA 2GRTA 2IY0B 1P7FA 2FBWB 3GV7B 3AH7A 1ZQYA 3S1DA 3PR5B 3HT3A 1YZ7A 1ZQCA 1YJIA 4YP3A 4BGDA 3NY5A 1D4BA 4HCPB 1XO3A 2PPHA 1JRUA 3DJGX 4O5KA 2LMRA 2KFKB 3D2JA 9ICHA 4LZDA 4RU9A 2KANA 1QQRA 2M4NA 2HOQA 2W55A 1C76A 4TQ1A 1MO9A 2K8BB 4KSLC 2LGXA 4H4PA 2Y3RA 1EWYC 4B9LA 2I2YA 5AHXA 4DL2A 2BGWA 1MDLA 1J7AA 4P4OA 4O5EA 5AK4A 2DAFA 2DENB 3H8JA 4FXCA 1AYFA 1T0RC 3JVZX 2G0AA 1L8OA 3TAPA 2YTUA 3N3KB 5AKHA 4JWSC 1TVAA 9ICAA 2XK5B 4NJCA 4DN1A 5ALSA 1C20A 4PVEA 5CHGA 2XC9A 1TKDA 1JWUD 4F92B 4PVKA 1TKEA 2KC2A 2QEJC 4MH0E 1SKWA 1L7OA 2JX5A 1FIQB 2RABA 2V3BA 3AMZA 2KVSA 3AQFA 1GREA 1ZMDA 4RNOA 5CHVC 2NBUA 1P7DA 3NRWA 4K81A 5FXPA 2KE7A 2J6UA 2ON8A 1S5LU 1GNUA 3QJZA 4KIKA 3SDLC 1ECQA 3CAWA 4GMEA 5AI5A 5HG2A 1WE6A 1KLGD 2LGIA 4XUSA 3RULA 5L1KA 4EBDA 5ALTA 5AIBA 4RQ8A 3BS5A 1B0XA 2IMWP 4F71A 1LM8B 2K9XA 3T8QA 2PTZA 1WGKA 3FVDA 3BVMA 3V3XA 4FS2A 1TS3A 2PGWA 2D11A 3T5KA 1V59A 4GLSC 3IV6A 3WA0A 2P13A 3N1ZC 1GRBA 3MGVA 2N7DA 3UF8A 1I19A 1WUDA 1RYRA 2AQ1B 4N58A 2OQHA 1XEEA 1XLQA 1J0GA 4EM3A 5BOLA 2RMMA 1S0OA 1DNCA 5IILA 4PYUA 3NO1A 3ETRB 4UB3A 4PYZA 4JMUA 2W82A 1MQ2A 2DUYA 2JEIA 3NTUA 1MDRA 3GV5B 3QQ8B 5KFBA 3JSVB 2I0KA 2K60A 2W8KA 1FNVA 2MUCA 5ADZA 2KKPA 3MSYA 2ZTEA 4P7IA 3TOYA 3SAHA 4YXJA 5IINA 7ICSA 1PGBA 2ZIVA 2AYOB 1ET6A 2I38A 2WXMA 2ZCCA 1ZQSA 3SD7A 5JU5A 5JCMA 3RRHA 4KIKB 3C1ZA 2DL0A 3TL5A 2ZIXB 3SV3A 2PS2A 2VA2A 1J7BA 1NHSA 3LXDA 2KIVA 3NZ3A 3EPIA 5DLFA 2DW7A 1OW5A 4UB2A 1E0YA 2OJRA 3H8SA 3TJPA 3A4SC 3DEDA 5J04A 2RGFA 4FHJA 4TQSA 4FP1A 4C8MA 2XN9C 1I42A 3GRTA 3T3OA 1SWWA 3RF9A 1XS9D 3E56A 1JCKB 2KICA 3AQEA 2AL2A 2QCZA 2QHOA 4MEYA 4W9IA 2WNMA 2ZIXA 1RZTA 2LYBA 2JQRB 3FG2P 8ICGA 4II2B 4BURA 2MRPA 3H4KA 2M9NA 4KZ0A 3PMLA 1ZQAA 2F77X 4EEKA 2QJNA 3RPFC 3UCCA 5D7GA 3QHTA 3O13A 1OEPA 4YFKA 2H89B 3RN9C 1STZA 1UWMA 3PRPB 3FYYA 5G5GB 3ZLGA 1KEJA 3JPTA 2J0JA 3V62A 1JXLA 4KGSA 9ICNA 3V60A 4IW0A 1ZQLA 4OVUA 3F5AA 1C7YA 1HQRD 8ICFA 5DLGA 2JWUA 4C56C 1NKCA 1GB1A 3M8RA 8ICKA 4FADA 3RFAA 1KOTA 5J0XA 4GYPA 1X42A 3R9KA 2KFNA 1WX9A 1ZDXA 4OVZA 1ZOLA 2FUHB 4II3B 3N30A 3FW9A 4BCAA 4Z6DA 1ZQKA 1WMHA 2V3AA 3WKEA 4REZA 2C28A 4DQPA 2NO4A 3Q3FA 3BS7A 3IFWB 4RFBA 3NVVB 1E9IA 1LVHA 3DGZA 5DG7A 1TKYA 2IGHA 3P4RB 4GYPC 4JE3B 4HCNB 3R7RA 3DQVA 3EGRA 4CNQA 1FHVA 5J0PA 2GR3A 3MR2A 1MNSA 3RD2A 5KVHA 1NK8A 1D8LA 2KNJA 3ICXA 1PVPA 2W9CA 2BQUA 3MP9A 1E5WA 1GB4A 3K9OB 3M62B 5ALPA 5J2HA 1J7CA 5T14A 2MUTB 3PRZA 2GLSA 2ASJA 2ONQA 1STEA 4WJOA 3ZW3A 3QU5A 1KKXA 3JS8A 1F52A 4ML8A 1KDHA 8ICCA 5HR7A 3VRAB 1P98A 2QLTA 3H40A 3W1SA 3H7PB 1A5RA 3MBYA 4Q2JA 5IO9A 2BB6A 2D6FC 1QZEA 4AS1A 4CQNA 4CHKA 3DVNV 3JPSA 1KLNA 3J81j 2NS5A 3KFUF 4WJPA 2KJ9A 4JQ9A 2H3FA 2QB0A 1WM3A 4NM2A 2WXPA 4PK1A 4QWCA 5IIOA 3L0WB 4GDKB 1QCKA 4DHJD 1H6VA 1F1HA 4DL7A 3CGEA 3RNMA 2OYYA 2KDEB 1W1SA 2ES6A 3KTQA 1KTQA 2JK6A 4US9A 2HW3A 3S1EA 2GQTA 1VJ5A 1L4ZB 2WXQA 4LNFA 1ZXIC 4HNLA 5H2FU 1MPEA 4EMJA 2FPLA 3OHBA 1VAOA 3IAM1 3FW7A 4B6WA 3BOXA 2D2QA 2AQ4A 2OWOA 1R4MB 4H4TA 4F1SA 1RYUA 4C8OA 4H4QA 1S3SG 1XSNA 2F44A 3PW7A 2GGEA 3DGHA 1XSPA 4PWCA 3NUQA 1Z4NA 3OJ3A 2GGGA 3K1GA 1QQ7A 4IL2A 4DWIA 4ECXA 5L1IA 2NBVB 5E6JA 2PMVA 3MZNA 1V1OA 5JXVA 5FR3A 3GD3A 2CFYA 1UA0A 3IM1A 2XH0A 2BYEA 4UARA 8ICNA 5KL8B 4XGAB 2J6SA 1BZLA 5ALLA 4HCHA 5L6FA 3OTQA 5DBAA 2PEAA 3S5SA 2ZIVB 1WJ4A 2PSNA 1U4BA 2ZJDA 4E71A 5G5HB 3TJ4A 1A77A 2F5ZA 4I29A 1E8GA 4O5CA 2W9CB 3PW0A 5J2RA 2X99A 3HP6A 4NLCA 2K0PA 1YN3A 3D47A 1V1PB 3MTNB 2QPMA 3NFUA 1M6YA 1QLNA 3UJ2A 3WIMA 4GXBA 3ZDDA 3V6KA 3FYHA 2QIEB 3TFSA 2IGDA 3Q8LA 3C29A 4ZRKA 5J2GA 2AAQA 4HJKA 4MFFA 4JN7A 4OZAA
chains in the Genus database with same CATH topology
5FXDA 2E3TA 2MEKA 3AE8B 5T8IA 2WXFA 1FFUA 3AE3B 4L2YA 1L0YB 3PQBA 2WP9B 4ZRQA 3B9JA 3FW8A 2AQ3B 1F2RC 3Q8EA 3CWIA 2EXRA 1VR9A 2NTSA 3PO0A 4PZFA 1FIQA 1FEHA 2LMCA 1FXAA 1FRRA 2J42A 2K3UA 3KWVA 1FFUC 3BVGA 3D2HA 2O3GA 2WDVB 3TEYA 1SJED 4WIPA 5FK9C 3H8HA 1K52A 1KTKA 2WDRB 1MHXA 5BMHA 3NVYB 1MVKA 1JQ4A 4TMAB 1W1RA 1TYGB 1C4AA 2WLBA 1YQ4B 3IT6B 3EUB2 1JWSD 4LK0M 2DLBA 3RJAA 4P16A 1AW7A 1RYJA 4ZOHB 3GB1A 3W8XA 1XLNA 1IGDA 4MT5A 3VR8B 1L6UA 1D5XC 4B0MA 3VQIA 1W1QA 1N5WA 1XCTL 2Q5WD 3AE9B 2QJLA 3MFGA 3S1DA 1W1MA 5I1VA 1YN5A 1DZNA 1QF6A 1ESFA 1TS4A 4ARCA 5BMIA 2Z8LA 5I1WA 3BWUD 3BW7A 1FNWA 3AEDB 2KN4A 4A90A 3TX1A 5HFYA 3TEWA 4YT0B 1SXTA 1AWDA 3CIRB 1WVEA 1NEKB 1X2GA 1KF6B 2LHDA 3Q8BA 3MHZA 5FXFA 2INPE 2GI9A 3B2FA 1JW9D 4JB1A 4RNAA 4XE0A 5FXEA 1E6EB 1SJHD 2DBYA 1SE4A 2P3HA 3W5UB 1JROA 3WCQA 1KLUD 1HEZE 4XWWA 4TVYA 1C4CA 3NVYA 1SSNA 2MH7A 4WQMA 3C0PA 3AE1B 4KX6B 1ACCA 1I4HA 4HROA 1QOGA 2WDQB 1GOZA 4LTUA 3SEBA 4KKIA 4PYTA 3W8ZA 2NQWA 1T3QA 3PZ7A 1NI3A 5C3JB 3A7AA 1L6VA 3DWMA 2TSSA 2VFRA 3P4QB 1MBTA 3R07C 5G5HA 4A6QA 2KACA 3AECB 1SIJA 3NVZA 4YSZB 5AE2A 4HEA1 3AE4B 4MLAA 4BC7A 2JXTA 3W2DA 3FILA 1IUEA 2WXIA 4J3OD 3GP7A 3A7RA 1V8CA 2QMTA 1RM6B 1HA5A 3Q8CA 5HHZA 2YEPF 3ZJUA 4C80A 2GQUA 3I9V1 1NYQA 3BYTB 4TSSA 3BK1A 5LNK1 3S1CA 3B2GA 2BW2A 2MJDA 2VFTA 1P7EA 1N61A 4JWUC 1DYQA 1M4VA 4ZHOA 2BYTA 1AHUA 4WH4A 2Y08A 2FUG1 1C78A 3AE5B 1QLBB 1UXYA 2VAOA 4O95A 1DOXA 5C2TB 3S1FA 2EKIA 1OQQA 1PFDA 1ZUD2 5GXGB 2N0SB 3Q69A 1SB3C 5K8EA 1TS2A 1TY0A 3KQ4A 1VRAB 2J52A 2KMMA 1HZ5A 1VJKA 3BIID 2BB5A 1OQRA 4JPSA 1N60C 1EU4A 1VZ7A 2LJIA 1X2HA 3TSJA 2VFSA 2BS4B 2WU2B 2WXGA 4PWBA 3BVZA 2OEDA 2PIAA 1Q10A 1N63A 2LEKA 2PLPA 3P4SB 3L4PA 5BYSA 2H88B 2INNE 1NVID 4N59A 1E7PB 5AE3A 2Y3AA 3IXSA 2JYEA 1QOAA 5EE0A 3P42A 2WS3B 4WWMA 1AHZA 1CZPA 3LXFA 2ACZB 3SR6A 1IBXA 3ETRA 2R2ZA 5EE1A 3NVWA 3KJMA 4HKZE 4A8XC 1K53A 4N6EB 1NENB 2PLSA 1V1PA 1A70A 5L6GA 3ZGZA 3PZ8A 3NS1A 2UUVA 3RJ8A 5BYQA 4RGMA 1WYGA 2IPKD 2K22A 3W5VB 2QKNA 4YSYB 4RF0A 5BYRA 3SFDB 1QLTA 1XF5L 2DYMA 1SB3B 3IT4B 3HSUA 4YTMB 2NMQA 5G5GA 2X38A 3NRZB 1CJEA 1UWXA 2LUMA 4ZYSA 1SF0A 3ETRB 1VLBA 1QOBA 2BVFA 1JWBD 1TZOA 2RDHA 1N62C 2AXRA 5HHDG 4C7YA 2MBRA 2XNAC 1W1KA 4UDUC 1BMLC 3P4PB 3EUB3 4USAA 1PUTA 1XLOA 2WQYB 1R7SA 2IGGA 1B9RA 2Y4GA 3MC0B 1E8HA 2ZW0A 2SEBD 3RFZB 2P4PA 1HXYD 4OW0A 2E6XA 3FWAA 4NZLB 4L23A 1EWCA 1QKZA 2HDEA 2L32A 1C9FA 2E5AA 2QILA 3DQ0A 4A9AA 1P7FA 2FBWB 1FXIA 3AH7A 3D2DA 3DWGC 2KWDA 1NYRA 2WXHA 1YJIA 1OFFA 4OZCA 3TEXA 1D4BA 1QOFA 1SBBB 1XO3A 2M56B 4KGTA 3R2TA 4M0WA 4RF1A 4RH6A 3NVWB 3BYYB 5AUKA 2AX5A 5I4DA 4PVJA 1YMHE 3P1MA 2JSVX 4RCOA 2M0AA 4EE2A 4TQ1A 2Q85A 1QQRA 2V0GA 1E8FA 2W55A 1C76A 4XWTA 5HMRA 2RPVA 1DIIA 4NAMA 1I4RA 1N63C 2Y3RA 1EWYC 1YJJA 3I57A 3IAS1 2I2YA 3C8YA 1DIQA 1J7AA 2WXNA 2WDWA 4EC3A 1WWTA 3NS1B 4FXCA 1AYFA 1ZDVA 1JMLA 1BUIC 4JWSC 4DXFA 4NJCA 4XDDA 2D5GA 2BS2B 1FFVA 1D6EC 1F2RI 1E9MA 1JWUD 1IGCA 3AE6B 3AV8A 3BZDB 3EA6A 1TKEA 1QT9A 1XLPA 2QEJC 4B0EA 4PVKA 3W8WA 2JX5A 1FIQB 1WVFA 5AUIA 3AMZA 1DOIA 2L52A 1L0XB 4PT5A 1QLUA 4YTNB 1N5WC 1LO5D 2PVOD 2L1AA 5FXPA 1D5MC 1B1ZA 4HJGE 2ON8A 2J4XA 1KRHA 1RWSA 5HG2A 2LGIA 1KLGD 3VRBB 1W1OA 3ZJTA 2RK5A 4TQ0A 1V97A 1I4QA 2WXLA 3AN1A 1EU3A 2AQ2B 2K9XA 3LLBA 4NAWB 1WGKA 1YQ3B 3TSHA 1UGJA 3BVMA 3HUIA 4HRSA 3V3XA 3R2IA 3B9JB 1TS3A 2DWQA 4YSXB 4GLSC 4YXDB 4PVEA 2P13A 3AEBB 1I19A 1UNSA 4N58A 4TVWA 2AQ1B 1XEEA 1XLQA 2RDGA 2PLIA 2RMMA 3Q8AA 1F0ZA 2Y3SA 1HSKA 2N7JA 1I4XA 3AM9A 2JU6X 2R61A 3VR9B 4UD8A 2W82A 1DOYA 5H8YE 1RFKA 3KLSX 2SAKA 2MJEA 4GDLB 1ZPSA 2ICIA 2PTLA 1ZXIA 2BT6A 3P63A 2I0KA 1FM0D 3ZJVA 4H2AA 1FNVA 5ADZA 4IDIA 4PVHA 2V3NA 3LYYA 3NVZB 1K51A 5D79A 2CJNA 2I38A 1PGBA 2PKOA 1ET6A 2WXMA 1ENFA 4IKGA 1QILA 4ARIA 5HI1A 3A7UA 3AEAB 3V05A 2VFVA 2BVHA 4OZBA 2EELA 4MACA 1CQVA 1J7BA 4XDCA 2WXOA 3NZ3A 1SE2A 1BXTA 2K5PA 4L1BA 1E0YA 2YEPB 5BMGA 2B76B 1N62A 3DEDA 2IDYA 2N9KA 2XN9C 5MPOA 3T3OA 2W54A 4WURA 2Q4WA 3E56A 1K50A 1N61C 1JCKB 2R8DA 3FAHA 1F77A 2DYOA 3NUHB 3I99A 2PVGC 3Q8FA 1L0VB 3E9SA 2WNMA 2V3PA 3VTEA 2JQRB 4R3DA 4YTPB 3HRDC 1TY2A 2W3RA 1AN8A 2NTTA 4OALA 1I4GA 4JAYA 1VDVA 2OHFA 1L4DB 5EE3A 4IOIE 3RPFC 1Y56A 1MI0A 2Y5PA 5D7GA 1IBXB 3SR6B 5HQXA 3O13A 2H89B 3NRZA 1I7HA 1UWMA 5G5GB 2G9HD 2ZW1A 1ZXHA 3AEEB 2KDMA 2HTME 2KQ4X 1KFYB 3UI3A 1GPXA 1W1LA 4KGSA 3OWEB 2KAJA 1FD6A 4D2KA 3HVZA 3LB8C 5FKAC 4RGOS 4ZRPA 1HQRD 1AHVA 1FO4A 2LHEA 2JWUA 3U2SC 2VZKD 4C56C 1GB1A 2Y5CA 1T3QC 1MHHE 1HZ6A 1PGXA 1FCLA 2G1EA 1ZDXA 3AB5A 4OVZA 4ZHPA 2BBCA 3FW9A 4BCAA 3ZQ4A 4REZA 3MJ5A 4MM3B 3NVVB 2WU5B 4RFBA 3AE7B 1TKYA 2IGHA 1PDXA 3P4RB 2BVGA 4JE3B 3KWLA 2GRIA 1F0XA 3SFEB 3EGRA 2V4IB 1SE3A 2MJ3A 3R8BA 1FNUA 4HKQA 1T6BX 2M19A 3J9CA 3AE2B 4YWGG 3MP9A 3POPA 2CU3A 1GB4A 1D5ZC 3URYA 4KGRA 1J7CA 3BK2A 4DXGA 4WAFA 2ONQA 1STEA 3ZYYX 1PGAA 2JZPA 4KKJA 5H92C 3U52E 1C79A 1ZR6A 3LAEA 4AQ7A 3JS8A 1XCQL 4O1NA 4A55A 4ML8A 4BC9A 3VRAB 1W1JA 3T3NA 3GSYA 1PYWD 3W1SA 1T5XD 4US8A 1WSPA 2L83A 2LFIA 4Q2JA 5TSSA 4DQOC 1MBBA 3FC4A 2BB6A 2WXKA 4AS1A 4CQNA 1N60A 1GAQB 4XLOA 1WRIA 3HVDA 1XXGA 1JRPA 3AEFB 4ITKA 4MH8A 1JWAD 3PM9A 1WXQA 3D2JA 2WXPA 1EM7A 4GDKB 4OHJA 1E0ZA 4OZAA 3U7ZA 1C4PA 2VZKB 1UUPA 1VZ8A 1C77A 1W1SA 3TEZA 4LLGM 4BBYA 2IPIA 4RGTA 4US9A 3S1EA 2GQTA 1ET9A 1L4ZB 1TJEA 2WXQA 1ZXIC 1FCCC 1MPEA 1YN4A 2JYTA 4JX1C 1VAOA 3IAM1 3FW7A 4RGNA 3W9CB 2J53A 1CK1A 3U4EG 1RM6C 1N5XA 2N9LA 3AEGB 1ROEA 2UUUA 4P6VF 2PW9A 2WXJA 1SEBD 2GB1A 1FFVC 3N9YC 2W3SA 4ZOHC 1L5PA 4PWCA 2OAIA 5AWVA 2CJOA 1VZ6A 5E6JA 2PMVA 1V1OA 5JXVA 1ZOYB 5FR3A 1DGJA 2IJ0A 4C7ZA 5D3IB 1FMAD 1YNTE 2WXRA 1JWMD 5L6FA 2VFUA 1FRDA 3ABVB 4HG0A 3GS2A 3HRDD 5G5HB 1TKGA 1ZE3D 1I4PA 1KH0A 1E8GA 3TSSA 5EE9A 1VQZA 1E10A 2BTEA 1TS5A 2FE8A 2QSDA 2BS3B 2K0PA 1YN3A 5AE1A 5D3DA 1V1PB 2QPMA 4DNSA 1ZP0B 3TUOA 2YVSA 2QIEB 2IGDA 3FILB 1JALA 3NVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FXD A;  2E3T A;  3AE8 B;  1FFU A;  3AE3 B;  2WP9 B;  3B9J A;  3FW8 A;  3CWI A;  2EXR A;  3PO0 A;  4PZF A;  1FIQ A;  1FXA A;  1FRR A;  1FFU C;  2O3G A;  3D2H A;  2WDV B;  2WDR B;  3NVY B;  1JQ4 A;  1W1R A;  1TYG B;  2WLB A;  1YQ4 B;  3EUB 2;  4ZOH B;  1RYJ A;  3W8X A;  1XLN A;  3VR8 B;  1L6U A;  1W1Q A;  1N5W A;  3AE9 B;  2Q5W D;  2QJL A;  3S1D A;  1W1M A;  1DZN A;  1QF6 A;  3BW7 A;  3AED B;  3TX1 A;  4YT0 B;  1AWD A;  3CIR B;  1WVE A;  1NEK B;  1X2G A;  1KF6 B;  5FXF A;  3B2F A;  1JW9 D;  4JB1 A;  5FXE A;  1E6E B;  2DBY A;  2P3H A;  3W5U B;  1JRO A;  3WCQ A;  4TVY A;  3NVY A;  2MH7 A;  4WQM A;  3C0P A;  3AE1 B;  4KX6 B;  4HRO A;  1QOG A;  2WDQ B;  4PYT A;  4LTU A;  3W8Z A;  2NQW A;  1T3Q A;  1NI3 A;  5C3J B;  3A7A A;  1L6V A;  3DWM A;  2VFR A;  3P4Q B;  1MBT A;  3R07 C;  5G5H A;  3AEC B;  1SIJ A;  3NVZ A;  4YSZ B;  5AE2 A;  3AE4 B;  4MLA A;  4BC7 A;  1IUE A;  3A7R A;  1V8C A;  1RM6 B;  5HHZ A;  4C80 A;  2GQU A;  1NYQ A;  3S1C A;  3B2G A;  2MJD A;  2VFT A;  1N61 A;  4JWU C;  4ZHO A;  1AHU A;  3AE5 B;  1UXY A;  1QLB B;  2VAO A;  4O95 A;  1DOX A;  5C2T B;  3S1F A;  2EKI A;  1OQQ A;  1PFD A;  1ZUD 2;  5GXG B;  2N0S B;  1SB3 C;  2KMM A;  1VJK A;  3BII D;  1OQR A;  1N60 C;  1X2H A;  3TSJ A;  2VFS A;  2BS4 B;  2WU2 B;  4PWB A;  2PIA A;  1N63 A;  2LEK A;  3P4S B;  3L4P A;  2H88 B;  1NVI D;  4N59 A;  1E7P B;  5AE3 A;  1QOA A;  5EE0 A;  2WS3 B;  4WWM A;  1AHZ A;  1CZP A;  3LXF A;  2ACZ B;  3SR6 A;  2R2Z A;  3ETR A;  5EE1 A;  3NVW A;  3KJM A;  4N6E B;  1NEN B;  2PLS A;  1A70 A;  3NS1 A;  1WYG A;  2K22 A;  2QKN A;  3W5V B;  4YSY B;  3SFD B;  1QLT A;  1SB3 B;  4YTM B;  5G5G A;  3NRZ B;  1CJE A;  3ETR B;  1SF0 A;  1VLB A;  1QOB A;  2BVF A;  1JWB D;  2AXR A;  1N62 C;  4C7Y A;  2MBR A;  3P4P B;  3EUB 3;  4USA A;  1PUT A;  1XLO A;  2WQY B;  1R7S A;  1B9R A;  1E8H A;  2P4P A;  3FWA A;  2E5A A;  3DQ0 A;  4A9A A;  2FBW B;  1FXI A;  3AH7 A;  3D2D A;  3DWG C;  1NYR A;  1YJI A;  1OFF A;  1QOF A;  1XO3 A;  2M56 B;  3NVW B;  5AUK A;  2AX5 A;  4PVJ A;  3P1M A;  2Q85 A;  3D2J A;  1E8F A;  5HMR A;  2W55 A;  1DII A;  1N63 C;  1EWY C;  1YJJ A;  1DIQ A;  1J7A A;  4EC3 A;  1WWT A;  3NS1 B;  4FXC A;  1AYF A;  4JWS C;  2BS2 B;  1FFV A;  3AV8 A;  1W1K A;  1E9M A;  3AE6 B;  4PVE A;  4PVK A;  1TKE A;  1QT9 A;  1XLP A;  3W8W A;  2JX5 A;  1FIQ B;  1WVF A;  5AUI A;  3AMZ A;  1DOI A;  2L52 A;  1QLU A;  4YTN B;  1N5W C;  2PVO D;  5FXP A;  1KRH A;  1RWS A;  3VRB B;  1W1O A;  2RK5 A;  1V97 A;  3AN1 A;  2K9X A;  3LLB A;  1WGK A;  1YQ3 B;  3TSH A;  4HRS A;  3HUI A;  3B9J B;  2DWQ A;  4YSX B;  4YXD B;  3AEB B;  1I19 A;  4N58 A;  4TVW A;  1XLQ A;  2PLI A;  1F0Z A;  1HSK A;  3AM9 A;  3VR9 B;  4UD8 A;  1DOY A;  5H8Y E;  1RFK A;  2MJE A;  1ZXI A;  2BT6 A;  3P63 A;  2I0K A;  1FM0 D;  5ADZ A;  4IDI A;  4PVH A;  5D79 A;  3NVZ B;  2CJN A;  2PKO A;  3A7U A;  3AEA B;  2VFV A;  2BVH A;  1J7B A;  2K5P A;  1E0Y A;  2B76 B;  1N62 A;  3DED A;  5MPO A;  2W54 A;  2Q4W A;  1N61 C;  2R8D A;  3FAH A;  3I99 A;  2PVG C;  1L0V B;  3VTE A;  2JQR B;  3HRD C;  4YTP B;  2W3R A;  4OAL A;  4JAY A;  1VDV A;  2OHF A;  3RPF C;  5EE3 A;  2P13 A;  5HQX A;  3SR6 B;  2H89 B;  3NRZ A;  1I7H A;  1UWM A;  5G5G B;  3AEE B;  1GPX A;  2HTM E;  1W1L A;  1KFY B;  2KAJ A;  3HVZ A;  3LB8 C;  1AHV A;  1FO4 A;  1T3Q C;  2Y5C A;  2G1E A;  3AB5 A;  4ZHP A;  3FW9 A;  4BCA A;  3NVV B;  2WU5 B;  3AE7 B;  1TKY A;  3P4R B;  1PDX A;  3KWL A;  1F0X A;  3SFE B;  2MJ3 A;  2M19 A;  3AE2 B;  2CU3 A;  3NVV A;  1J7C A;  3ZYY X;  3LAE A;  5H92 C;  1ZR6 A;  3JS8 A;  4ML8 A;  4BC9 A;  3VRA B;  1W1J A;  3GSY A;  4US8 A;  2L83 A;  1MBB A;  3FC4 A;  1N60 A;  1GAQ B;  4XLO A;  1WRI A;  1JRP A;  3AEF B;  4ITK A;  1JWA D;  3PM9 A;  1WXQ A;  1E0Z A;  1W1S A;  4BBY A;  4US9 A;  3S1E A;  2GQT A;  1TJE A;  1ZXI C;  4JX1 C;  1VAO A;  3FW7 A;  3W9C B;  1RM6 C;  1N5X A;  3AEG B;  1ROE A;  4P6V F;  1FFV C;  2W3S A;  4ZOH C;  1L5P A;  4PWC A;  2OAI A;  2CJO A;  1ZOY B;  1DGJ A;  4C7Z A;  1FMA D;  2VFU A;  1FRD A;  3ABV B;  4HG0 A;  3HRD D;  5G5H B;  1TKG A;  1E8G A;  5EE9 A;  1VQZ A;  1E10 A;  2BS3 B;  5AE1 A;  2QPM A;  4DNS A;  1ZP0 B;  2YVS A;  2QIE B;  1JAL A;  2BVG A; 
#chains in the Genus database with same CATH topology
 2E3T A;  3HX0 A;  1EF5 A;  2MEK A;  2WXF A;  3AE8 B;  4F5P A;  3S47 A;  3NAS A;  1L0Y B;  5KL1 B;  1TZZ A;  1WGG A;  2ATL A;  1TTN A;  2XBB C;  1RQL A;  3FCP A;  4YR2 A;  1TIF A;  3I76 A;  5JUM A;  3CWI A;  3H0L B;  3Q8E A;  2EXR A;  1VR9 A;  3KH0 A;  3KLJ A;  2LRU A;  2NTS A;  4A3P A;  3PX6 A;  3RB4 A;  1FIQ A;  5KT3 A;  1FEH A;  2LMC A;  1WIA A;  2J42 A;  2OOB B;  2O3G A;  3D2H A;  1E8W A;  1X40 A;  2CXY A;  2G4S A;  2Q0Z X;  4B9T A;  5FK9 C;  2EQ6 A;  2WDR B;  5BMH A;  2ISO A;  4UAZ A;  2CS4 A;  4HAI A;  2HOF A;  1BPY A;  3AU4 A;  1X6J A;  4TMA B;  3EF6 A;  1W1R A;  3K75 D;  4LDT D;  4Y2V A;  5KAI U;  1NK6 A;  1Q46 A;  3WKD A;  3EUB 2;  2EZX A;  4FBT A;  4AYB C;  3KZX A;  4HLE A;  4GGB A;  2MBQ A;  1XLN A;  3VTW A;  4CDG A;  1L6U A;  1ZQX A;  1PDZ A;  4B0M A;  4HYR A;  1J2M A;  2L5Y A;  3ML9 A;  2WAQ C;  3IJQ A;  4HPN A;  1F5S A;  3IJL A;  1JPM A;  4JB3 A;  1S9F A;  2P35 A;  1T0S C;  2D3G A;  3MFG A;  1YN5 A;  2IYD B;  2JUO A;  1HE8 A;  4ANX A;  2Z7J A;  5KFO A;  4ZA0 A;  4H4W A;  3C19 A;  3SQP A;  3EEC A;  3H0R B;  2LBO A;  1WYW B;  3BW7 A;  5D49 A;  3VFK A;  3AED B;  1D3Z A;  3TJI A;  2KZ3 A;  1MA7 A;  1J19 A;  1KF6 B;  2ZAD A;  2L3Z A;  2PMZ C;  2QDF A;  3PV8 A;  2GI9 A;  3B2F A;  2KIW A;  2EQ7 A;  3SN0 A;  3Q8P B;  5DPS A;  5BPC A;  5DB9 A;  2JGA A;  4F4K A;  5E6N A;  3SEI A;  4Q43 A;  2DF4 B;  1CI4 A;  3DVG Y;  5FXE A;  7ICM A;  3SBF A;  2O6K A;  2RPQ A;  2DBY A;  4DHZ E;  1NJZ A;  1Q0W B;  1P1A A;  4ZCW A;  3W5U B;  4OJ5 A;  4EWJ A;  2P3H A;  1N56 A;  4TVY A;  2ZCB A;  1F9J A;  2DYB A;  2MH7 A;  2BYV E;  4WQM A;  2BKR B;  3UXN A;  5AM2 A;  3QKE A;  1D9F A;  2WDQ B;  1GOZ A;  3PV1 A;  3RYT A;  3HWT A;  2PI5 A;  2PI4 A;  2NQW A;  2KSO B;  1TE6 A;  3LVW A;  1L6V A;  1WCL A;  3DWM A;  3JYU A;  2NO5 A;  1GRG A;  3M1Y A;  4DSI A;  1RLF A;  3QCA A;  1MBT A;  3EZ5 A;  3R10 A;  2YMQ A;  4Z6E A;  3WK8 A;  4KDI C;  4YWO A;  2OKT A;  1XNS A;  2XH2 A;  3R3M A;  1SKR A;  1ZQM A;  4H1Z A;  4LNK A;  5AE2 A;  2XH4 A;  3RJG A;  4HEA 1;  3AE4 B;  4FZN A;  4P4M A;  3DHG C;  3RZF A;  3V72 A;  2NBW B;  3ZLH A;  3CST A;  4M6U A;  3FXG A;  1ZMC A;  1N2X A;  1GES A;  4XQ8 A;  4YMN A;  4IM0 A;  3L5O A;  2ZIU B;  3ZJU A;  3V5F A;  2GOW A;  4O3O A;  3BYT B;  3Q3N C;  5FJO A;  5FS9 A;  1KQQ A;  3KYC D;  4EBE A;  2K4H A;  1UA1 A;  2BW2 A;  3S1C A;  2FPM A;  2MJD A;  1P7E A;  2LUE A;  3FM9 A;  2KFK A;  2IBI B;  3I5J C;  4UAW A;  2W03 A;  2PE9 A;  2CU1 A;  2IO0 B;  4WH4 A;  4IP5 A;  4P2H A;  3AE5 B;  2Y08 A;  5CB1 A;  4CCH A;  2VAO A;  1JX4 A;  3WK4 A;  4KLJ A;  4O95 A;  3TQ1 A;  1DOX A;  2W0H A;  4DO9 A;  2HI0 A;  1OQQ A;  1ZUD 2;  3IC9 A;  4EEY A;  2BGF A;  4NAW A;  1J8C A;  2PFO A;  2ZTD A;  1TS2 A;  2J52 A;  4DEZ A;  4LA1 A;  2ZJ8 A;  2JZB A;  1SE9 A;  4IRD A;  2BB5 A;  3X0W A;  2WPE A;  1VZ7 A;  4FHK A;  4MGI E;  4Z6C A;  4B9N A;  5DQG A;  2BS4 B;  4DX3 A;  2KWU B;  3QA8 A;  5KFL A;  4H19 A;  1YJ1 A;  4F5O A;  2HMX A;  2AL6 A;  1N63 A;  2PIA A;  3V6H A;  1NJY A;  3FKY A;  4K7S A;  5AM0 A;  2FMS A;  2LEK A;  1U9L A;  2WWZ A;  3OZM A;  1XC9 A;  5JH5 C;  4FZM A;  1KSP A;  2HBL A;  3GZN I;  2E8N A;  3KOO A;  3ML8 A;  4RQ7 A;  4S0R A;  2INN E;  2NRX A;  2V3S A;  4N59 A;  1NZB A;  1E7P B;  4W9C A;  1QOA A;  5IN7 A;  1K4Q A;  3P42 A;  5KFK A;  3R0U A;  2HHV A;  1L6N A;  1P0R A;  4M9L A;  5BOF A;  5DPR A;  4CO7 A;  9ICC A;  3FV9 A;  1ZX9 A;  4H4R A;  2LRW A;  1H4R A;  5IA7 A;  1WGD A;  2AL3 A;  2MNR A;  3TW9 A;  4NL9 A;  2ESE A;  2PLS A;  3PMN A;  1M6I A;  3ZDC A;  7ICO A;  3DJJ A;  5J2K A;  4ED8 A;  1T0Y A;  4RNM A;  3ECI A;  1WYG A;  2JZ3 B;  2KWC A;  5KFX A;  1WE7 A;  1ZK7 A;  5KG4 A;  3RO6 A;  1QLT A;  1TFR A;  5KTQ A;  2Z0E B;  5AZH A;  3PG6 A;  4RQ2 A;  4OJP A;  4DDG D;  4TUP A;  3ALB A;  4YTM B;  5IDZ A;  3QEA Z;  3EPG A;  4BWJ A;  1Q5W B;  1S1Q B;  4ZYS A;  1KN5 A;  2EAO A;  2KHV A;  2FCN A;  4GMV A;  1QOB A;  4EZL A;  1SGG A;  3DDM A;  3M3J A;  1E8Y A;  4I6L B;  2XY6 A;  4YR0 A;  1JI7 A;  1GRT A;  2PU0 A;  4NXZ A;  3OG5 A;  4QIW F;  1WY8 A;  1BPD A;  1NEL A;  4DSJ A;  3WAM A;  4KX3 A;  3C2L A;  4B95 A;  4USA A;  4GFI A;  2BPC A;  1XLO A;  3H9D A;  3H7V A;  2WQY B;  3UQ0 A;  4KVG B;  1B9R A;  3IRU A;  5ALE A;  3HM3 A;  1OTR B;  4I27 A;  4I6P A;  4GDK A;  3PRM B;  3TWA A;  2FAZ A;  5J0U A;  1DTN A;  8ICE A;  3U26 A;  2XCA A;  3ZIM A;  3FWA A;  3DBR B;  4NZL B;  4L23 A;  5KG1 A;  5AKI A;  5ALD A;  1QKZ A;  2HDE A;  1NHP A;  3HPF A;  3MDC A;  2WX1 A;  4I2D A;  3D2D A;  1ZYQ A;  2C60 A;  2HZG A;  2KWD A;  2WXH A;  2ZC8 A;  1OFF A;  2ZUC A;  3TEX A;  1TK5 A;  2M56 B;  3RMK C;  3IG8 A;  1ZY8 A;  3NVW B;  2MBE A;  3I3T B;  1PDY A;  5KFQ A;  1YMH E;  3ZXR A;  3OSP A;  4XC2 A;  2Q85 A;  5KFZ A;  5HMR A;  3LDZ E;  4XWT A;  4H4S A;  3CMM B;  2MUT A;  3O65 B;  4B9M A;  4NAM A;  2WF6 A;  3SAF A;  2JZZ A;  2YY6 A;  4F8C B;  3I57 A;  3IAS 1;  1QQ6 A;  3C8Y A;  1DIQ A;  2PU1 A;  2HNE A;  2L76 A;  5K4L A;  4U7C A;  4J03 A;  4EFO A;  2R8I A;  1WWT A;  3QYP A;  1KRP A;  4EUT A;  2AU0 A;  1ZDL A;  3IHQ B;  4OJO A;  4A8E A;  2KWV B;  5IAA C;  4MSM B;  4DXF A;  4DSK A;  2GOL A;  2D5G A;  2V1Y A;  4XDD A;  3AV8 A;  1CRX A;  1E9M A;  3AE6 B;  2LVP A;  4MEM A;  4EZK A;  4G8T A;  4Y2R A;  1XLP A;  2FMP A;  3W8W A;  4IP4 A;  1U48 A;  2JEG A;  2LGY A;  3ZRC A;  3N4F A;  2F3N A;  4F5N A;  1UBI A;  2L52 A;  4PT5 A;  1QLU A;  4YTN B;  5ALU A;  3GZN B;  4O0I A;  2PVO D;  4NWI A;  3B0A A;  4KDL B;  3DES A;  1D5M C;  2Y9T A;  4GIB A;  4EKU A;  3M8S A;  5C0Y A;  4W9L A;  2QJJ A;  4H83 A;  4WWN A;  1ZW7 A;  2LM4 A;  4MJS B;  3VRB B;  4R63 A;  1UHU A;  5AM5 A;  3ZJT A;  1W1O A;  2OFJ A;  1FPY A;  2HHU A;  1UT5 A;  1K5O A;  2R2Q A;  1ZQE A;  4KV2 A;  3SU8 X;  3VH3 B;  3QFA A;  1V97 A;  4Q44 A;  3PHW B;  3UGV A;  1I4Q A;  3NGD A;  2R8H A;  4CF4 A;  2D07 B;  5JRT A;  3H7S A;  4M6W B;  2Y1J A;  1PZN A;  3TAQ A;  4UAT A;  3C2M A;  1YQ3 B;  4C8N A;  4IQW A;  3QU9 A;  3HUI A;  4DSF A;  3R2I A;  5ALH A;  4HVB A;  1X9M A;  2DKZ A;  4B9V A;  3N20 C;  5AKJ A;  5JCN A;  3JPN A;  1AAR A;  5KFG A;  3PSE B;  4YXD B;  3F53 A;  2YVC A;  3AEB B;  4FA6 A;  1T4G A;  4BVU C;  1NK9 A;  2FLL A;  2RDG A;  1ZQD A;  2WP5 A;  3Q8A A;  4PS3 A;  4NJ7 A;  2E1E A;  2JRI B;  3RRA A;  2N7J A;  4G50 A;  1WWV A;  4G3X B;  3N4E A;  3AM9 A;  2KD0 A;  3VR9 B;  1RFK A;  4IC7 B;  2SAK A;  2MJE A;  4K7Z A;  1ZRM A;  4K8D A;  2PTL A;  3C0R B;  3GE8 C;  1ZQG A;  3P63 A;  2D8C A;  4H2A A;  1GEU A;  2A5U A;  4K4I A;  4I2E A;  4PVH A;  1U47 A;  2WOW A;  3RNE C;  2WPC A;  5D79 A;  3NVZ B;  1K51 A;  3GFK B;  1WF9 A;  4NJ8 A;  4UAY A;  2KHW B;  3DBS A;  1IV8 A;  2AL1 A;  1NK7 A;  1QIL A;  4E5T A;  3A7U A;  1V49 A;  1GXF A;  4F4Z A;  2ASD A;  3SSZ A;  4OZB A;  4EYI B;  3HIL A;  1S97 A;  4KPL A;  1X2I A;  2PFQ A;  3G6X A;  3SI8 A;  2PFN A;  1SE2 A;  1JOA A;  3GRS A;  4L1B A;  2LPE A;  2E1F A;  1J2N A;  4WJ3 B;  4QWE A;  2B76 B;  1TYP A;  3OJU A;  3R0K A;  4KEM A;  3MY9 A;  3PZP A;  2YN4 A;  5MPO A;  7ICK A;  4WUR A;  4XA5 A;  2JF5 A;  1H38 A;  3OHA A;  4X2P A;  1HTO A;  1K8R B;  1OJT A;  1L7P A;  4WWP A;  2PVG C;  2W9N A;  1ZQV A;  3Q8F A;  2HOI A;  5C1Z A;  2V3P A;  4M9G A;  3VTV A;  4FJZ A;  2ZTC A;  4GXJ A;  2O6V A;  4R3D A;  3TAC B;  4F5R A;  3DV9 A;  4DS5 A;  5AK5 A;  1MOK A;  4M8M A;  2KYW A;  3ZDT A;  2JY6 A;  2NTT A;  5L1M A;  4OAL A;  3K9P B;  4RM9 A;  4BBN C;  3CGC A;  3CYJ A;  4O9M A;  1L4D B;  1URJ A;  2FNJ B;  1PVQ A;  1MI0 A;  2Y5P A;  4ANW A;  8ICV A;  1IBX B;  1JUD A;  3NRZ A;  3U30 A;  2VH1 A;  2K1F A;  2G9H D;  3R11 A;  1WG8 A;  1ZXH A;  1W1L A;  2P66 A;  4PGQ A;  2A1A A;  4IR1 A;  3QX1 A;  1FD6 A;  1DK2 A;  3LB8 C;  2GBJ A;  4E8G A;  1FO4 A;  2PP1 A;  2LHE A;  4DOA A;  3U2S C;  2VZK D;  3VUY A;  1T3Q C;  1A76 A;  4I2H A;  1MHH E;  1PGX A;  2K8C B;  2M0N A;  1MG4 A;  4HPP A;  5CTR C;  3AB5 A;  4MSQ B;  5FS7 A;  3LB8 A;  4OCZ A;  3VA8 A;  5JHB A;  2KVZ A;  5FP0 A;  1NJX A;  3MR5 A;  1IIP A;  1MSW D;  2BYF A;  3H1U A;  1FEB A;  2L00 B;  4G7F A;  4MM3 B;  1BT0 A;  4C8L A;  3D2S A;  2WU5 B;  3EJE B;  1LV5 A;  4C4S A;  3A9J B;  3AE7 B;  2PCE A;  8ICW A;  2RLT A;  2CRX A;  3TAD A;  4DSL A;  2FIF A;  2KVR A;  2GRI A;  3KWL A;  3L16 A;  8ICQ A;  3P93 A;  1Z5S B;  1SE3 A;  4F5Q A;  4F8R A;  2MJ3 A;  4Y2J A;  3UIN B;  1FNU A;  2AGP A;  5JCI A;  2C5L C;  2H3Z A;  2M19 A;  3J9C A;  3NZU A;  5AKE A;  1WI0 A;  2HSZ A;  2EZY A;  3R66 C;  3ALR A;  2CKH B;  3QTP A;  4OJL A;  1D5Z C;  3URY A;  3RZW C;  2OJW A;  2DW6 A;  4K4G A;  3BK2 A;  4RQ6 A;  4JV0 A;  4WAF A;  2K4I A;  4PJ0 U;  2ONE A;  9ICT A;  3ZYY X;  1SJB A;  4DL3 A;  2KMC A;  1XU4 A;  4J9M A;  4ECQ A;  1XCQ L;  4O1N A;  1LFD A;  1BWC A;  2ZIW B;  2DPI A;  1E8Z A;  1W1J A;  5EU9 A;  3T3N A;  3K1Z A;  3KUZ A;  3GSY A;  1COK A;  3IG3 A;  5TSS A;  3VUX A;  2LFI A;  2K4P A;  1L8L A;  3FC4 A;  2WXK A;  1KCZ A;  2G45 B;  4MEL A;  1LVL A;  1GV4 A;  2YX8 A;  4XLO A;  5KFR A;  1N6Z A;  1UZX B;  5KFP A;  1XXG A;  3D32 A;  3DDC B;  4ITK A;  3ZDM C;  4DXA B;  4KSK C;  4BAX A;  3DK8 A;  2LI6 A;  4KLM A;  1IXR A;  3TAR A;  2DFL A;  1TGZ B;  1V5T A;  3U7Z A;  1C4P A;  3HK0 A;  1VZ8 A;  4QZF A;  4LLG M;  2IPI A;  2EZZ A;  4MF8 A;  2V4R A;  4RGT A;  3D46 A;  5ALR A;  4KLI A;  3JPP A;  5LLI A;  2JYT A;  4JX1 C;  3PVL A;  3WU2 U;  4YN4 A;  2IA6 A;  4RGN A;  1XSL A;  2KK8 A;  2J53 A;  1CK1 A;  1RM6 C;  4KMU A;  2BQ3 A;  2N9L A;  4NEW A;  3DOW A;  4WJQ A;  3ED5 A;  3ENL A;  4DS4 A;  2PW9 A;  1WR6 E;  3UCD A;  3SYZ A;  2DZM A;  2GB1 A;  2QVH A;  3L8K A;  1COO A;  3N9Y C;  2W3S A;  1FFV C;  3A0B U;  5E6P A;  2FYM A;  4J3Z A;  2CJO A;  3ZTD A;  5AWV A;  5KFF A;  4J9Q A;  2BCU A;  1VZ6 A;  5HP4 A;  4M9H A;  1NK0 A;  2BKE A;  4H4Z A;  1WXV A;  2DNF A;  2GL5 A;  5ER0 A;  1K1Q A;  5KHO A;  3X23 A;  3A33 B;  4QNL A;  2O2V A;  4LCD E;  2KTF A;  3DEQ A;  4DWD A;  5DCN A;  4URK A;  1FRD A;  4FI4 A;  3PSF A;  3GS2 A;  3Q3M C;  4G11 A;  2MSN A;  9ICK A;  4BKG A;  3RH4 A;  3T4W A;  2M17 A;  2WDT B;  4ECS A;  2XY7 A;  1Q1W A;  5L9X A;  3OPX A;  2FE8 A;  3C5F A;  4ED1 A;  3JZU A;  4TUS A;  2BS3 B;  4ZRJ A;  4A20 A;  5CA7 A;  3Q8K A;  5J8Y C;  4C00 A;  2Y0S F;  4BWM A;  2D3A A;  5AI8 A;  2HHQ A;  2GR0 A;  5CR0 A;  2YVS A;  4M00 A;  1ZD3 A;  4ROP A;  4DXK A;  5CJ7 A;  4AOF A;  3QUC A;  2BVG A;  2JV3 A;  2KV2 A;  3CP8 A;  4KLD A;  5T8I A;  5J8Y A;  4ZOH B;  2NQL A;  3O0F A;  3RGT A;  3EFC A;  4ZRI A;  3VHT C;  1XO0 A;  4KT2 A;  3GE3 C;  2KNB A;  4PHD A;  2E5S A;  3JPR A;  4BOZ B;  2OZ3 A;  7ENL A;  3TI0 A;  3RT3 B;  5DBC A;  2N1V A;  4RQ4 A;  3ZDE A;  3HIZ A;  4IT1 A;  2B6G A;  3TTE A;  1FXA A;  4EEL A;  2BCQ A;  2YML A;  5DB8 A;  2JEJ A;  3KWV A;  3RNG C;  2KSO A;  5ALX A;  3BVG A;  3C21 A;  3DER A;  1RPL A;  2OEH A;  3TEY A;  4XYC A;  1SJE D;  4WIP A;  1LB2 B;  2ZZC A;  3VCB A;  4LNO A;  3TAN A;  5B66 U;  1GRF A;  3NVY B;  1MVK A;  1SJA A;  3RCZ A;  1X66 A;  5AK6 A;  3QE9 Y;  2AH5 A;  3C28 A;  4CRX A;  4GC7 A;  2HE7 A;  1B22 A;  1T7P A;  2KTQ A;  5HML A;  3C2K A;  4P16 A;  1BPZ A;  4W9F A;  2JXX A;  2G3Q B;  3GB1 A;  5L83 A;  1R4N B;  5J17 A;  2LD9 A;  1GSN A;  1Z1V A;  2G4D B;  2C3D A;  2OVL A;  3QU4 A;  3RBE A;  1JCT A;  5JTI A;  2OZ8 A;  3ISD A;  4KWS A;  1N5W A;  1V9P A;  5J2D A;  3AE9 B;  2QJL A;  3VCN A;  3EC8 A;  3H0M B;  4NM1 A;  3HPO A;  2L0T A;  4FX9 A;  5CHF A;  4QZA A;  5E6O A;  1EC7 A;  1XD3 B;  4KLS A;  2MCN B;  3B97 A;  3JVA A;  4K3B A;  1RQN A;  4BJQ A;  3P2B A;  1ZJN A;  5U25 A;  3MFI A;  3M9M B;  3NS8 A;  3TX1 A;  1ZQB A;  2CN1 A;  3HSU A;  3CIR B;  4GN1 A;  1EO6 A;  4UB4 A;  1KFS A;  3Q8B A;  2B3A A;  5FXF A;  2INP E;  2X50 A;  2IZV B;  5FS8 A;  4I2F A;  5KAF U;  3QXG A;  3L3F X;  1B4F A;  1Z19 A;  3CSF A;  3S2A A;  4K7W A;  1YQB A;  4KIT B;  5KG7 A;  4UB1 A;  1ZQI A;  1ELS A;  2VKQ A;  5B5E U;  3N6H A;  3BDP A;  3LDA A;  9ICB A;  1SE4 A;  2XEW A;  4IZG A;  4RUA A;  4DWF A;  2NVU I;  2A4Z A;  2PTX A;  1HEZ E;  3DVG X;  4FN2 A;  2BWF A;  4F72 A;  1SZH A;  2AXT U;  3KBB A;  9ICI A;  2CHW A;  2HBM A;  3C0P A;  1ACC A;  4EQR A;  3THU A;  4MJS A;  1WUE A;  3UXO A;  1QOG A;  4LTU A;  4KKI A;  1KKO A;  3A0H U;  2KLC A;  5EBK A;  4EQX A;  3A7A A;  4FBU A;  3ES8 A;  4RQN A;  5TR3 A;  3ZD9 A;  1RYS A;  3P4Q B;  9ICO A;  5CRX A;  1YQZ A;  2GMI C;  1FEZ A;  2JH7 A;  1KJT A;  2KJ6 A;  1Q1O A;  4J9O A;  4I2J A;  2DKX A;  3NVZ A;  4YSZ B;  1ZQZ A;  2MA1 A;  4BC7 A;  2K4E A;  2JXT A;  1WUF A;  4FDC B;  2KJH B;  3MR3 A;  1IUE A;  4EBC A;  3RAQ A;  4W9J A;  1HUO A;  1IYF A;  4E4F A;  5JCK A;  4ED2 A;  1V8C A;  3QAQ A;  3T5J A;  5ALJ A;  1S8O A;  4UQG A;  4IQV A;  1HA5 A;  2YEP F;  2KN5 A;  3HW8 A;  2GQU A;  2BVC A;  2FLN A;  3T9L A;  1NYQ A;  5AKY A;  2ZXH A;  4LDT B;  1RG6 A;  4X57 B;  2HCF A;  2UVV A;  1WRD B;  2VFT A;  3H8A A;  4EZ9 A;  2P8B A;  4ZHO A;  2L0F A;  3KYD D;  2PFP A;  2WF7 A;  1QLB B;  2KTR A;  2W9B B;  2YLM A;  3A1Q B;  1UXY A;  2LHT A;  3BY4 B;  2HXU A;  5C2T B;  3S1F A;  2DQN B;  8ICO A;  3PLV A;  2KC1 A;  1E7U A;  3H12 A;  4PHE A;  2N0S B;  3Q69 A;  1SB3 C;  1ONF A;  1VRA B;  5F9L A;  1O08 A;  1HZ5 A;  2KMM A;  1PQS A;  1WH3 A;  2ZZP B;  4R66 A;  4IQT A;  4UAS A;  1N60 C;  4QWB A;  5KG3 A;  4DLG A;  1FEC A;  1XPY A;  2WU2 B;  4PWB A;  2JT4 B;  3N28 A;  2WHE A;  1XDI A;  4ASW C;  2YB4 A;  7ICE A;  3AU2 A;  3ENE A;  1CUK A;  5BYS A;  2FKP A;  3NHE B;  2OQY A;  4XZ4 A;  3TMP B;  1H8C A;  2MX2 A;  4Q8F A;  1UCV A;  3B1L X;  3IXS A;  2JYE A;  3MC9 A;  2QGY A;  3LAD A;  3D9X A;  5DBB A;  4Z1Y A;  4KTQ A;  9ICQ A;  1AHZ A;  3Q6J A;  2NCN A;  3UQB A;  2W11 A;  3LXF A;  4DNA A;  2ACZ B;  4P1C C;  4WWO A;  4K3C A;  3RJE A;  1IBX A;  2R2Z A;  5EE1 A;  1YOV B;  3MHS D;  1Z00 A;  4MDK E;  5D94 A;  4HKZ E;  1K53 A;  5J0Q A;  4TV3 A;  1SKS A;  3PZ8 A;  2UUV A;  1JIH A;  5BO4 B;  4RGM A;  4ED6 A;  3EW9 A;  1D8B A;  3NG0 A;  3W5V B;  4AYB F;  4RF0 A;  4B9K A;  2N9P C;  2W43 A;  9ICP A;  3QN3 A;  4PZN A;  5L1J A;  1MQ3 A;  1XF5 L;  2DYM A;  3UGB B;  1SB3 B;  2ZNV C;  1UT8 A;  3I6E A;  2KO3 A;  5FMH A;  3V61 A;  5G5G A;  5AM3 A;  5J2I A;  2ZIW A;  1CJE A;  1M94 A;  2X38 A;  4ANU A;  4ECZ A;  4O3Q A;  2EH9 A;  3KD3 A;  4JGH B;  3UJE A;  3OSN A;  3L54 A;  3B0Y A;  3F2B A;  5HHD G;  4HK2 A;  2FCM A;  2MBR A;  3L5K A;  1T0Q C;  2XNA C;  1WXM A;  1WR1 A;  3QLD A;  4DL6 A;  3ZNI D;  3T79 A;  2XH7 A;  3ORY A;  2MWS B;  2K8C A;  4E0D A;  2WFA A;  4K2S A;  3V4B A;  1R7S A;  2IGG A;  3K4G A;  2WOV A;  2Y4G A;  3IVF A;  4ELT A;  2YB1 A;  5AK3 A;  2OG9 A;  2V4Q A;  4J57 A;  1KFD A;  2P4P A;  4C4R A;  2P6R A;  4CE6 A;  1GRH A;  2E6X A;  2JRZ A;  2E8P A;  5AI6 A;  1C9F A;  1V80 A;  2QIL A;  3Q6B A;  5J18 A;  2L8J A;  3DQ0 A;  4A9A A;  1L7M A;  1FXI A;  3RH5 A;  2BWE S;  5J29 A;  1TAM A;  1B43 A;  4NLZ A;  2KX0 A;  1WMH B;  8ICL A;  3MGH A;  1L3V A;  4O3R A;  1QOF A;  3R2T A;  4M0W A;  5TR5 A;  1MUC A;  2GGH A;  3CB3 A;  5AUK A;  4BX9 C;  4J9L A;  2Y0S C;  1S77 D;  2JSV X;  4EZ6 A;  2M0A A;  4RCO A;  3HKZ F;  4EE2 A;  1E8F A;  4KMO B;  3BZC A;  1TK0 A;  2MU2 A;  4DBG A;  2YAU A;  2EQ9 A;  3C1Y A;  3WK9 A;  1DII A;  2P6U A;  3T3F A;  2LVO A;  3PRE A;  1N63 C;  1ED1 A;  1YJJ A;  3BQT A;  4ELV A;  5IKC M;  4I2C A;  4DCC A;  3JPO A;  3LJ3 A;  8ICU A;  2WDW A;  4EC3 A;  3RH6 A;  4DFD A;  4JV2 A;  3NS1 B;  3RJJ A;  2BPG A;  2D10 A;  3ZNZ B;  1JML A;  1AQ6 A;  2G5I B;  3ZUN A;  1WX8 A;  1OQY A;  3VFC A;  3ZD8 A;  2A19 A;  1D6E C;  1F2R I;  1W1K A;  1IGC A;  5EOZ A;  1SXE A;  3BZD B;  3EA6 A;  3L13 A;  1RAX A;  3Q45 A;  4Y2P A;  3KHR A;  3PX0 A;  4M9N A;  1WVF A;  3Q4D A;  5JCL A;  2LGS A;  9ICX A;  2DZI A;  4J9R A;  4NLK A;  2WB1 F;  1L0X B;  4BKS D;  2NV3 A;  2L7R A;  3H4B A;  1N5W C;  1GRA A;  1ZQO A;  4H4Y A;  3SJN A;  2L1A A;  4KN4 A;  4GR1 A;  2NRT A;  3HW2 A;  4NY8 A;  4J9P A;  9ICG A;  1RWS A;  2KMA A;  2X8H A;  2KLG A;  4HXD A;  3E58 A;  4GGQ A;  1AOG A;  2I1J A;  2RK5 A;  3KHG A;  2I1K A;  4DLE A;  2HDO A;  4XX5 A;  1X1M A;  2WXL A;  4N9F 4;  4ACF A;  5D46 A;  4ADW A;  3AN1 A;  4DQQ A;  3LLB A;  4NAW B;  1E8X A;  2R8K A;  2KKV A;  2MHJ A;  4F4R A;  4H2H A;  3TSH A;  5JRB A;  2ISP A;  3B9J B;  1WJ6 A;  3ISB A;  2AQ0 A;  4YSX B;  3MKC A;  3MWC A;  3WAN A;  2RDX A;  2KDF B;  2BC1 A;  5KT4 A;  4IRK A;  1UNS A;  5CHW A;  1KFT A;  3OW1 A;  2KD1 A;  2FJ6 A;  2DAJ A;  5AIA A;  4FJV B;  2MRL A;  7ICF A;  1S76 D;  1L3T A;  2J3N A;  2R9Z A;  3PVX A;  1L8P A;  4P0Q A;  4NLG A;  3QUQ A;  7ICU A;  5HKH A;  5H8Y E;  3KLS X;  4J56 A;  2J7Q B;  3ZNG C;  5L95 C;  2KJ8 A;  4HYK A;  5F3X B;  2WAQ F;  4DFJ A;  4LVS A;  3DBH B;  1ZPS A;  4AUQ C;  1XAN A;  1NI2 A;  2CPR A;  2BT6 A;  1FM0 D;  4BV6 A;  4IDI A;  3UJS A;  4YVZ A;  9ICW A;  3QZ8 A;  1UEL A;  1ENF A;  5HI1 A;  3RBD A;  2JR5 A;  3CYM A;  5KFA A;  2VFV A;  4ECU A;  1EBG A;  2ZNV B;  4ELU A;  4X5V A;  4MAC A;  1CQV A;  1XQQ A;  2GR1 A;  3ZTC A;  2WXO A;  1U49 A;  3PFR A;  4DYE A;  3PST A;  2RDI A;  2K5P A;  4PL1 A;  2OLA A;  2YEP B;  5BMG A;  1V2Y A;  1N62 A;  2LM1 A;  1QH9 A;  3OAW A;  8ICS A;  2N9K A;  3EFU A;  7ICR A;  2W54 A;  3LWL A;  1UF0 A;  3DBL I;  2A1J A;  1K50 A;  4ZYN A;  1N61 C;  2R8D A;  3PTF C;  3FAH A;  3NUH B;  1J97 A;  2DYO A;  3I99 A;  3G6Y A;  2ASQ A;  4QIW C;  4DFP A;  3BQ2 A;  3ZKJ C;  3APF A;  2W7O A;  3CT2 A;  3ETL A;  2QKQ A;  2K8B A;  3H7P A;  2BPS A;  1TY2 A;  2HBK A;  4GU2 A;  2W3R A;  2P8C A;  2YVG A;  1T94 A;  4JAY A;  3SAG A;  3Q8M A;  4DF4 A;  5J2E A;  2ALZ A;  2QAR A;  2LAS A;  2OHF A;  4R8U A;  5EE3 A;  4LNN A;  2H3V A;  1Y56 A;  3WAL A;  5HQX A;  5KG5 A;  2KZZ A;  2GGJ A;  2I9G A;  1I7H A;  4QZG A;  4EMI A;  5GRT A;  4RQ1 A;  3UM9 A;  4QZI A;  2XGP A;  2LWP A;  3AEE B;  2BKF A;  1X9S A;  2KDM A;  5FJR A;  4C4V A;  3QWZ B;  2KAJ A;  4DHG A;  5FKA C;  1YX6 B;  2F8L A;  4RGO S;  4F3O A;  1AHV A;  4MFC A;  4LII A;  2BZF A;  3WK6 A;  3CXO A;  4IG7 B;  5EDS A;  5C23 A;  4PPX A;  2PTY A;  2G07 A;  2RDJ A;  1EBD A;  5AIC A;  2A8X A;  2QQ6 A;  3GIL A;  4JWN A;  1Z00 B;  2G1E A;  2VH2 A;  3PW2 A;  4P0P B;  8ICX A;  1QTM A;  3AI5 A;  5KFD A;  1BVS A;  2F76 X;  3QU7 A;  3T5H A;  3H8M A;  2BBC A;  3GY1 A;  4PS8 A;  3GU3 A;  3ZQ4 A;  5D4B A;  9ICU A;  3OGU A;  3MJ5 A;  4JHM A;  5FJU A;  3UXL A;  3BZK A;  4XRH A;  1D7Y A;  2LJ5 A;  3GIK A;  2KJ5 A;  1YEY A;  3RB6 A;  1TT5 B;  3SFE B;  1F0X A;  2H3Q A;  4RNN A;  9ICF A;  2NPT B;  3R8B A;  1RXW A;  4YL8 A;  4EEN A;  3HJE A;  1RXV A;  2PE6 B;  3WKB A;  3V7J A;  2HD5 B;  5AKG A;  6ENL A;  2CU3 A;  4MEX A;  3KW5 B;  4Q8E A;  5ALM A;  5LXH A;  3A9K A;  1ZQW A;  5IOI A;  5BOE A;  2ZZ0 A;  4QAY A;  4DXG A;  5ENL A;  5GMV A;  2C3C A;  5ALY A;  3CNH A;  1PGA A;  4KKJ A;  5H92 C;  2CHX A;  3LAE A;  4AQ7 A;  3MR6 A;  3AL0 B;  4FBJ B;  3PW4 A;  1LXD A;  2KOB A;  4PGX A;  3BIN A;  3PGE A;  4A55 A;  2W9B A;  4BC9 A;  3A1Q A;  4OVV A;  5ALF A;  5G2N A;  2AJQ A;  7ICG A;  3SD5 A;  2H5X A;  4US8 A;  1WSP A;  3N97 B;  4DQO C;  1U45 A;  2IBK A;  1GUA B;  4HDO A;  3GDX A;  3UMC A;  3RJK A;  2HHS A;  3VAW A;  2OCE A;  2BQQ A;  4GGH A;  1JRP A;  3AEF B;  2X8C A;  2GBK A;  1WXQ A;  5LXI B;  2R8G A;  2VJ4 A;  2C7N B;  1WCN A;  4K1W A;  1EM7 A;  3M7D A;  4OHJ A;  4BBN F;  1RDF A;  3LYS A;  1OEY J;  2XVT A;  1E0Z A;  4RUC A;  5KT6 A;  2GH1 A;  3BQ7 A;  1C77 A;  4MM3 A;  4RT3 A;  3KHH A;  1A6S A;  2WF8 A;  3S6J A;  3OJ4 B;  1FCC C;  3MGI A;  2K8A A;  3B0X A;  3P3B A;  4W9D A;  4IR9 A;  1DRG A;  2KFZ A;  4M9J A;  2K25 A;  2TPR A;  3C23 A;  1R4M I;  2P88 A;  4RM8 A;  4HCD A;  1N5X A;  2YQU A;  1SIF A;  3UIO B;  4GLX A;  2AL2 B;  2A3V A;  2UUU A;  4M0X A;  1XO1 A;  4E3C A;  1V85 A;  1SGH A;  3N6J A;  1I35 A;  2WXJ A;  3EEZ A;  1T3N A;  2JZB B;  2F8K A;  4QZC A;  1NJW A;  4ZOH C;  3SZ2 A;  1L5P A;  5ALG A;  4KLQ A;  3SN1 A;  4A6G A;  2OAI A;  3STP A;  4DL4 A;  5FS6 A;  4QJF B;  2WF9 A;  1KL9 A;  4KLT A;  1E7V A;  4HDQ A;  4WAA A;  4EQS A;  3APC A;  1DGJ A;  4I28 A;  2KDI A;  2C9W B;  4C7Z A;  5D3I B;  4MGK E;  3ZVH A;  1FMA D;  1LQB A;  2KQ7 A;  4F93 B;  1JWM D;  5III A;  2VFU A;  2JH1 A;  5GTH U;  5KG0 A;  4LJP B;  1SL0 A;  4GFJ A;  1KKR A;  1TAU A;  2PGE A;  1ZKH A;  1G6J A;  2KN7 A;  4RT2 A;  5U1O A;  5EE9 A;  2XIC A;  5HR6 A;  1VQZ A;  2AHO B;  2ZG6 A;  5J0T A;  4RQ5 A;  3RR7 A;  4S17 A;  4YXM A;  5IIJ A;  2IHM A;  5D3D A;  2P3Z A;  5DDY A;  4UBC A;  7ICL A;  4UAV A;  3BS5 B;  1ZP0 B;  1BGX T;  4AJW A;  3PS6 A;  5GTI U;  3MC1 A;  9ICV A;  3TCA A;  1X9X A;  1ZD4 A;  1EBH A;  4UB6 U;  2O56 A;  3NVV A;  3VTE A;  4MMW A;  4BUG A;  1IPG A;  2Z0D B;  1FFU A;  2NRV A;  5J2A A;  5AZG A;  3DBR I;  1V38 A;  4ZRQ A;  4TQR A;  4CYE A;  3B9J A;  3DGB A;  4M52 A;  2KQS A;  4A3R A;  1D8Y A;  2GH5 A;  5KFM A;  2ODG A;  1IG6 A;  3PO0 A;  4P1B C;  4PZF A;  3RAX A;  2HJ1 A;  3N32 A;  3DFH A;  1TKK A;  3SQS A;  1FRR A;  1FFU C;  3V5C A;  3DDH A;  1YX5 B;  3CXB A;  5CX3 A;  4K1R B;  3KUC B;  3UIP B;  5KT5 A;  4RPX A;  1LGR A;  5J0Y A;  1MHX A;  4IL6 U;  3Q8S B;  3TAD C;  3WKC A;  1T8E A;  2IO1 B;  5ALQ A;  1L3S A;  1C4A A;  4PH5 A;  3Q3J A;  5L1L A;  2C7M B;  4HN8 A;  1D9D A;  4HNC A;  3M6K A;  1GET A;  2BCV A;  4Y2X A;  9ICJ A;  2KK0 A;  2DLB A;  2MA9 B;  1WGY A;  3W8X A;  3Q3O C;  4W9K A;  3LWM A;  3PWG A;  3DPD A;  4MT5 A;  1SL2 A;  3L10 B;  2CHZ A;  3VR8 B;  5DG8 A;  4F7Z A;  1KLV A;  2K89 A;  4YD1 A;  4DFM A;  3GII A;  4KLF A;  2IY1 B;  4NEV A;  2WP6 A;  4PHP A;  2GSH A;  1W1M A;  5DGB A;  1NDD A;  4M0W B;  2M1M A;  3PO5 A;  1WGH A;  3GIM A;  3ZLZ A;  1Q3V A;  4GIS A;  4O3M A;  1MG8 A;  4G0N B;  1TS4 A;  4ARC A;  5BMI A;  2Z8L A;  5I1W A;  2IND C;  3PT2 B;  5KT2 A;  2V6O A;  4Y2Y A;  4A90 A;  5HFY A;  1AWD A;  8ICP A;  4NV0 A;  1WVE A;  5L6G A;  2XGQ A;  1QQ5 A;  4YG2 A;  1NBF C;  4MF2 A;  9ICM A;  1ZQ1 C;  3RB3 A;  5CP2 A;  2J6T A;  1TE2 A;  1JW9 D;  1WXA A;  2KMD A;  3PLU A;  1DXL A;  4JB1 A;  2J0M A;  1FEA A;  2W04 A;  3CGB A;  2V4L A;  1BPX A;  4JN8 A;  4XE0 A;  2V9H A;  3IP4 B;  5DPW A;  3EWA A;  1E6E B;  4O3S A;  1MRA A;  1WGR A;  2WF5 A;  1PK1 A;  2HQM A;  3IBE A;  3WCQ A;  1OUQ A;  1KLU D;  4XWW A;  2BR0 A;  3DIP A;  1C4C A;  3NVY A;  1PVR A;  1SSN A;  4M02 A;  3DG6 A;  3EKG A;  3E2E A;  4MKS A;  2PP0 A;  5ALV A;  4BDP A;  5E79 U;  3JSV A;  4PYT A;  2JMG A;  2ZJ5 A;  3W8Z A;  3DK4 A;  3UXK A;  2YVJ A;  3RIT A;  1ZD5 A;  4QZH A;  1SL1 A;  1WWU A;  3R7Q A;  5C3J B;  2FID A;  3T5L A;  2TSS A;  4F4W A;  2VFR A;  4O3P A;  2CDU A;  5TIS U;  2OPJ A;  3D6J A;  2MBO A;  3ZXV A;  2POD A;  2FI1 A;  3OTR A;  3PSI A;  5G5H A;  2VA3 A;  1GC7 A;  5G55 A;  1SIJ A;  3OPS A;  3M95 A;  4M0A A;  4C4T A;  2MLB A;  2OZT A;  1TYT A;  3GD6 A;  3A4R A;  3IDW A;  5IIM A;  1NOM A;  2XK5 A;  2FE9 A;  2XO7 A;  1ZKQ A;  4MLA A;  2Y1I A;  3ES7 A;  3RNF C;  3FIL A;  2HVH A;  4NNJ B;  3MUC A;  1Q3U A;  5DB7 A;  4J3O D;  3VVW B;  3A7R A;  4PGY A;  4KX5 A;  8ICJ A;  2QMT A;  4Y2U A;  7ICI A;  4AP9 A;  4B6J A;  3Q8C A;  5HHZ A;  4AP4 C;  4C80 A;  4P0Q B;  3I9V 1;  4FLH A;  4MHV A;  4TSS A;  1ZET A;  4GIV A;  3RNB C;  2UVR A;  3BK1 A;  5LNK 1;  3B2G A;  4YCX A;  3M9O B;  5EWG A;  7ICQ A;  5KG6 A;  1DYQ A;  4ED7 A;  1M4V A;  2W9A A;  1RRB A;  5FJT A;  2BYT A;  1AHU A;  1UPH A;  2ZZB A;  1C78 A;  2EQ8 A;  3ZVV A;  4EMW A;  2F1J A;  4UBB A;  1R4N I;  2N7E A;  3TFR A;  4F50 A;  3N7S C;  1PFD A;  5GXG B;  3VC5 A;  2OXO A;  2VIX A;  4I2G A;  5K8E A;  4F91 B;  2LYA A;  1TY0 A;  1VJK A;  4RQ0 A;  4JPS A;  1EU4 A;  2JXJ A;  3AXC A;  3EHV A;  3H7I A;  2WXG A;  2VFS A;  4M8N A;  2C22 A;  3BVZ A;  1IYX A;  2UVU A;  2OED A;  2KDB A;  3T9P A;  2REX A;  4EX7 A;  1K1S A;  2R2O A;  1WX7 A;  2MW5 A;  4PS7 A;  4QZD A;  2KHQ A;  2QC8 A;  5AE3 A;  5AKK A;  4NL9 C;  3QU2 A;  1F44 A;  1NHR A;  5EE0 A;  2WS3 B;  3SN4 A;  2ZUD A;  4WWM A;  3MC8 A;  4ICU A;  2F1I A;  3QX7 A;  3U8Z A;  3IJI A;  2Z59 B;  2YMP A;  4IHC A;  3PX4 A;  3PK7 A;  3KJM A;  4MGY E;  3VCC A;  5KHQ A;  4RZR A;  1NEN B;  1ZQQ A;  5KFS A;  4ECV A;  3E0F A;  2EAM A;  3PSP A;  3RRG A;  1DXS A;  2YQE A;  3NS1 A;  1A70 A;  4IWQ A;  3VDZ A;  1V86 A;  3ZGZ A;  2AEH A;  3I6T A;  2IOF A;  4Y2T A;  2QKN A;  2AGQ A;  3GO2 A;  5BYR A;  3K1R B;  3IT4 B;  2AKZ A;  2KEY A;  4G3I A;  1JXE A;  2NPT A;  2EAN A;  3QEB Z;  2NMQ A;  4KLH A;  2VAN A;  3NRZ B;  4DOB A;  1KN0 A;  1UWX A;  2INC C;  1PK3 A;  1TAQ A;  2HXT A;  2LXC A;  1VLB A;  4GIR A;  2RDH A;  1N62 C;  3V6J A;  2G06 A;  4C7Y A;  1EC8 A;  3QC8 B;  3A9K B;  4G9B A;  3A9J A;  4FO6 A;  3JW7 A;  2B0C A;  3BJY A;  2WOI A;  2DX5 B;  4UDU C;  1BML C;  3P4P B;  2JWZ A;  3CW2 C;  2C2D A;  5ALO A;  1UD7 A;  1EF1 A;  3T8M A;  3MC0 B;  2E8M A;  2ZPN A;  1R0M A;  1E8H A;  4QWA A;  4EYH B;  1VD2 A;  4APN A;  2QB0 B;  2NRZ A;  1L5U A;  8ICZ A;  1HXY D;  2SEB D;  1R6W A;  9ICS A;  1EWC A;  2L32 A;  5KG2 A;  3APD A;  2E5A A;  4Q45 A;  4C0Z A;  4OD0 A;  2K6Q A;  1TZ1 A;  1V81 A;  1H2I A;  4NJ6 A;  3N7P D;  3Q14 C;  3DWG C;  4MGZ E;  1NYR A;  2LZ6 A;  5KVI A;  1SZP A;  4DQR A;  2ZVN A;  3EAO A;  4YWS A;  4OZC A;  2AKM A;  1SBB B;  4KGT A;  4RF1 A;  1S0M A;  4IQU A;  8ICY A;  4RH6 A;  3BYY B;  4M01 A;  2AX5 A;  5I4D A;  1BQG A;  4PVJ A;  2G08 A;  3P1M A;  3DFY A;  3GOE A;  1HTQ A;  2V0G A;  3ZI4 A;  2ZJA A;  3URH A;  3QPE A;  1QSL A;  2RPV A;  2UU7 A;  5KT7 A;  1I4R A;  3KUM A;  2FCQ A;  3I4K A;  2WXN A;  4E6M A;  8ICT A;  2EDU A;  1NPX A;  1KD0 A;  3H6N A;  2XGZ A;  3GD4 A;  3HKZ C;  3ISC A;  2FDR A;  2UVW A;  4IRC A;  4K4H A;  1ZDV A;  3QK0 A;  3GQC A;  4HWI B;  1BUI C;  3SQI A;  2R8J A;  2N4F A;  3L08 A;  1SXD A;  5TZV A;  1FFV A;  2HBJ A;  2BS2 B;  2RRD A;  4ECW A;  1P3Q U;  1QT9 A;  2Y9U A;  4B0E A;  3ZDB A;  1OXJ A;  4YQW A;  5AUI A;  1DOI A;  1PUZ A;  3EYZ A;  3KZI U;  4MGG A;  1LO5 D;  2XCP A;  2IOF K;  1SWV A;  3N1X C;  5KFN A;  2WBA A;  4AWJ A;  1B1Z A;  2HHX A;  2I1Q A;  4KLO A;  2NYV A;  2J4X A;  2A1J B;  3IHP C;  1KRH A;  1Q8K A;  4HJG E;  2JEF A;  4EZJ A;  3OJS A;  3SV4 A;  1MC8 A;  2I6X A;  4GSW A;  8ICR A;  4IWO A;  4W9H A;  4M2Y A;  3VH4 B;  4ANV A;  2FPK A;  1MJD A;  2XY5 A;  5CEH A;  4ED0 A;  4TQ0 A;  3V6C B;  3EJD B;  3BSM A;  3AUL A;  3ZVH B;  1JMS A;  1ZJM A;  2D3D A;  1EU3 A;  2AQ2 B;  1GER A;  3VDG A;  2WB1 C;  2PJH A;  7ICT A;  3TBL D;  3W1S C;  1UGJ A;  2M0X A;  4HRS A;  1ZQH A;  1GO3 F;  2DWQ A;  4GOC A;  1F0M A;  4FUL A;  1TV9 A;  5HHH A;  3UPQ A;  1EUV B;  4TVW A;  3RR8 A;  3VC6 A;  2PLI A;  4IUM B;  1NKB A;  4BXO A;  2KFJ A;  4FE3 A;  1F0Z A;  2Y3S A;  1RVK A;  1HSK A;  3AU5 A;  9ICL A;  3F2C A;  2HVI A;  1I4X A;  2JU6 X;  4U6P A;  3AEV A;  2R61 A;  4TKN A;  4UD8 A;  2GGI A;  1DOY A;  2RP5 A;  3H8W A;  5IIK A;  5DB6 A;  2PPG A;  2KKC A;  1Z1B A;  2ICI A;  2L05 A;  5AM1 A;  2FCS A;  4GDL B;  1ZXI A;  2DGZ A;  4DK5 A;  3SMV A;  3ZJV A;  1O03 A;  2W7P A;  3IG5 A;  5AI9 A;  5AKZ A;  2IO2 B;  5ALI A;  5KFI A;  2V3N A;  3LYY A;  5EWF A;  1UH6 A;  2K8H A;  2CJN A;  4RMA A;  1HUZ A;  1FHU A;  3Q8Q B;  2PKO A;  3C5G A;  3D2Q A;  3F2D A;  4ECT A;  4IKG A;  2W8L A;  4ARI A;  1Z4O A;  4DL5 A;  2CHR A;  3AEA B;  3V05 A;  1V6E A;  4QZ8 A;  2JVC A;  4O3N A;  2BVH A;  2NR2 A;  5J2B A;  2EEL A;  3SEN A;  4XDC A;  4KLL A;  2PA6 A;  1BXT A;  1DK3 A;  1DGS A;  1GG3 A;  1XT9 B;  4Y2Q A;  2IDY A;  4E74 A;  3Q8R B;  2RHF A;  4WQO B;  3QAR A;  2YMM A;  2Q4W A;  2WPF A;  2NPX A;  3QIJ A;  2VA8 A;  1S10 A;  3P0W A;  2I5Q A;  1F77 A;  5FJP A;  2UYZ B;  4DOC A;  4QW8 A;  1L0V B;  3E9S A;  3B08 A;  4UW9 A;  1NU5 A;  9ICR A;  5KFE A;  2JPH A;  3HRD C;  4IWP A;  4YTP B;  3KUD B;  4IC9 A;  4DSE A;  4M04 A;  3R25 A;  1KM7 A;  4M47 A;  1AN8 A;  2ZEQ A;  2X8G A;  1I4G A;  5J2F A;  3DHI C;  1TBE A;  1VDV A;  4OO1 J;  4RPY A;  2KXJ A;  5DGA A;  2QDD A;  3TKA A;  7ICJ A;  4IOI E;  3F5E A;  4EQW A;  4ZH4 A;  2XI9 A;  3SR6 B;  4A35 A;  2EMT A;  2ZW1 A;  3TIX A;  1SV4 A;  3CK5 A;  1ZQP A;  2HTM E;  2KQ4 X;  1KFY B;  3UI3 A;  4DDI D;  4QZB A;  1GPX A;  1GJZ A;  3UJF A;  3OWE B;  1XWL A;  1IP9 A;  4IS7 A;  2RQ5 A;  3HVZ A;  4D2K A;  1ARO P;  4YR3 A;  4ZRP A;  4FJY A;  1NK5 A;  3HHM A;  2PP3 A;  2GR2 A;  2OO6 A;  3GC2 A;  3OP2 A;  5J0W A;  2Y5C A;  1HZ6 A;  1FCL A;  4BOS C;  1SV0 C;  2OM6 A;  4I2B A;  4JV1 A;  1Y88 A;  4ZHP A;  2BDP A;  2KVC A;  1TK8 A;  1L2N A;  4Y2S A;  4IL0 A;  2MP2 A;  1SJD A;  1KBU A;  3SHQ A;  2KP7 A;  1C3T A;  2H3I A;  3JW0 X;  4JL9 A;  1PDX A;  4JUZ A;  2EQY A;  1BNP A;  2POZ A;  1L3U A;  2EMS A;  5FR6 A;  2V4I B;  4ZDV A;  1HJP A;  1NKE A;  1OEY A;  3DBH I;  3JPQ A;  1U4A A;  2J0K A;  4HKQ A;  5AI0 A;  1JN3 A;  3N4M B;  1T6B X;  2D3C A;  3VTU A;  2GO7 A;  2ZVO A;  3AE2 B;  5ALW A;  4YWG G;  3M9N B;  5AEK B;  1E90 A;  3POP A;  2GBR A;  4KGR A;  1WXS A;  5KFH A;  2KJR A;  4H4V A;  4JDR A;  3DEE A;  2JZP A;  3U52 E;  3VUW A;  4F2R A;  1C79 A;  1ZR6 A;  3W1Y A;  1JEH A;  1S7M A;  1ZQT A;  3UMB A;  1Y8R C;  3II4 A;  3O0H A;  1PYW D;  4K7U A;  1T5X D;  4K8G A;  4RQ3 A;  2L83 A;  2Q4T A;  7ICN A;  1MBB A;  4F4Y A;  3H4D A;  2MBH A;  1EXN A;  2LGD A;  1N60 A;  1HIW A;  4F2S A;  1GAQ B;  2KOX A;  1ZQN A;  1WRI A;  3HM6 X;  3HVD A;  4MH8 A;  2C2E A;  5DDM A;  1JWA D;  3PM9 A;  1ISN A;  5DG9 A;  1CEZ A;  1ZGU B;  3DVN U;  4ED3 A;  3RUI B;  2AGO A;  2WX0 A;  2K6D B;  1BKH A;  4YMM A;  1GC6 A;  1YD8 U;  2GBM A;  2YVF A;  4DQS A;  1LKY B;  3RJI A;  4OJ6 A;  3ZLF A;  1MN8 A;  2O2V B;  3EJB B;  4AJY B;  2VZK B;  4A3O A;  1UUP A;  1KW4 A;  4C8K A;  4R65 A;  3PR4 A;  3TEZ A;  4BBY A;  3PWI A;  3TCS A;  4ECY A;  3MQT A;  1ET9 A;  1TJE A;  2AWT A;  1FXT B;  2X8X X;  2KG5 A;  1P43 A;  1YN4 A;  7ICV A;  2NRW A;  3QNM A;  3V7K A;  3N1Y C;  4H50 A;  3WK5 A;  2ZXI A;  3W9C B;  3RTV A;  4ECR A;  3U4E G;  3AEG B;  4BZA A;  2F2A B;  3V7L A;  3WKA A;  1ROE A;  2O6V D;  5AZF A;  4TUU A;  1BPB A;  5BOM A;  4P6V F;  1BNO A;  2OX4 A;  1SEB D;  4B9U A;  3DBL B;  1X6I A;  5J2C A;  4C4V B;  4GC6 A;  4DQI A;  3GZF A;  1XS2 A;  2NVK X;  2BHN A;  2RD0 A;  2ZIU A;  3PHX B;  3ZRF A;  2DZJ A;  1L7N A;  1ZOY B;  2IJ0 A;  2QAR B;  2IHN A;  2KX3 A;  4P4P A;  4KLE A;  8ICA A;  4BFR A;  1YNT E;  3N7R C;  2WXR A;  3ZNH B;  3RNC C;  5KNI A;  4P0P A;  3QFB A;  4HG0 A;  3ABV B;  3HRD D;  1TKG A;  3FJ4 A;  1ZE3 D;  1I4P A;  1KH0 A;  1V5O A;  1ONE A;  2E8O A;  3QUT A;  3PPA A;  4ICV A;  5JZE B;  3TSS A;  1Q1R A;  2Y5B B;  1E10 A;  2BTE A;  1TS5 A;  4GDL A;  1NZP A;  1EC9 A;  4UB5 A;  4ICA A;  2QSD A;  1ZQU A;  4M6W A;  5AE1 A;  4DNS A;  3DH9 A;  4KZC A;  2G09 A;  2N1R A;  3UJR A;  7ICH A;  3TUO A;  2JHD A;  4QZE A;  3U4F A;  4PL2 A;  3FIL B;  5DKW A;  1YZ6 A;  4R8U B;  1ZQR A;  4DHJ B;  3KKA C;  1JAL A;  5FXD A;  4R64 A;  5KFV A;  2KZM A;  3AE3 B;  2ZUB A;  4L2Y A;  3PQB A;  2N1W A;  5ALK A;  4QWD A;  2WP9 B;  1F3P A;  1LPF A;  1MFW A;  3MDA A;  2QJM A;  3FW8 A;  2AQ3 B;  1F2R C;  5IP4 D;  4J9K A;  2KTR B;  2KZR A;  3ONS A;  1W6T A;  3KKA A;  2FMQ A;  2HTH A;  2K3U A;  1QSS A;  2JRH A;  4ENL A;  5AM4 A;  2WDV B;  4GXI A;  4MFA A;  3H8H A;  2EAP A;  3QZ7 A;  2BCS A;  1K52 A;  4YMO A;  2C2R A;  1KTK A;  2IO3 B;  3ONN A;  2GLE A;  1JQ4 A;  3UXP A;  4KPR A;  2LYH A;  4EEW A;  4LJX A;  1TYG B;  2WLB A;  3T6C A;  1YQ4 B;  2WTF A;  2K39 A;  3IT6 B;  2OH2 A;  5D2M B;  4LK0 M;  1JWS D;  4GRT A;  2LVQ A;  2V9W A;  2B21 A;  4DF8 A;  3RJA A;  1AW7 A;  1RYJ A;  5HMM A;  3VC8 A;  3MJW A;  2QAE A;  1IGD A;  2BCP A;  4JK1 A;  5F9N A;  1D5X C;  4NPN A;  3VQI A;  1W1Q A;  5I1V A;  1XCT L;  2Q5W D;  2N9X A;  3THV A;  1WZ3 A;  2VJ5 A;  5KFC A;  4NLB A;  3I63 C;  5D6J B;  3RR1 A;  1DZN A;  1QF6 A;  1VCB A;  2LI5 A;  3BQ1 A;  3PO4 A;  1ESF A;  3VXW A;  3OC4 A;  1HEK A;  1NNL A;  1NHQ A;  3BWU D;  3DG7 A;  3G6V A;  1FNW A;  4BXO B;  2KN4 A;  3GIJ A;  4FS1 A;  3TEW A;  4YT0 B;  1SXT A;  4B9S A;  1X2G A;  3V3W A;  1NEK B;  3CF6 E;  4W9G A;  2LKY A;  2LHD A;  4QZ9 A;  3MHZ A;  5KFJ A;  4EOY A;  3ZVI A;  1NK4 A;  5J0S A;  2GWS A;  3I28 A;  1UBQ A;  3PW5 A;  2MSE D;  4Z17 A;  3I1Y A;  3V6E B;  4RQM A;  4J1O A;  2O6V B;  4RNA A;  1Z3E B;  3FDS A;  5AKL A;  4DHZ B;  4WJN A;  3NZG A;  3QUB A;  1SJH D;  3PZD A;  2FLP A;  2BDU A;  2BQR A;  3RB0 A;  1S0N A;  1P48 A;  2PMQ A;  1JRO A;  3PY8 A;  3ZO5 B;  4JIO U;  3NOB A;  3BJS A;  4J9S A;  3AE1 B;  4KX6 B;  1I4H A;  2M8S A;  1A0P A;  1N48 A;  1X9W A;  4HRO A;  4NQK E;  2W9M A;  2HJ8 A;  2GQW A;  3SEB A;  3RCY A;  3TWB A;  3AU6 A;  1T3Q A;  3PZ7 A;  1NI3 A;  1WJN A;  3UQ2 A;  1SJC A;  4I2A A;  4FFD A;  1SV0 A;  4DFK A;  2HHT A;  1WZ0 A;  2IOH A;  1NDA A;  5KFU A;  4RPZ A;  3CRX A;  1XHC A;  3R07 C;  4A6Q A;  2KAC A;  3AEC B;  1L7Y A;  3DG3 A;  3GV8 B;  4KLU A;  4JLC A;  3RNA C;  3CGD A;  3PNC A;  3W2D A;  1F9C A;  5J0O A;  2VRR B;  5ALZ A;  2DZK A;  4IM2 A;  2WXI A;  1JDF A;  2XID A;  3MFH A;  3LK9 A;  3GP7 A;  2GDQ A;  2QB1 A;  5DQH A;  2KT7 A;  1RM6 B;  3R1Z A;  2BF8 B;  5EWE A;  4LJO B;  3U7D A;  2PMZ F;  4JQW C;  3AUO A;  9ICE A;  4KN7 A;  3IN5 A;  2ASL A;  4HCL A;  3WAP A;  1N61 A;  4JWU C;  5DPT A;  4FZL A;  4PHA A;  3ZDA A;  1P9D U;  4F4X A;  4BKS A;  2QDE A;  3TQP A;  4LZG A;  1BPE A;  1RFA A;  2FUG 1;  3RJF A;  1OGW A;  4CGZ A;  5DQI A;  1WJU A;  1ZQJ A;  4H4X A;  2EKI A;  2RDB C;  2I5H A;  3EAN A;  2EKE C;  5HNK A;  2N9E B;  2PKE A;  2WYQ A;  3KQ4 A;  3M6Z A;  2PXI A;  2F1H A;  2MAX A;  3NXL A;  3BII D;  4IM3 A;  1OQR A;  4HPL B;  8ICB A;  2LJI A;  4PZO A;  1ECW A;  2LXA A;  3NZS A;  4J6I A;  2DHZ A;  3TSJ A;  3LVV A;  1Z2M A;  1X2H A;  7ICP A;  3WK7 A;  3D2N A;  1Q10 A;  3OZY A;  5HHI A;  4H4U A;  8ICH A;  1YIW A;  3BQ0 A;  2PLP A;  3OLM D;  3P4S B;  4BKT A;  3L4P A;  4TUR A;  5A0L A;  1V9J A;  5CWR A;  2H88 B;  4HPM B;  3DHH C;  8ICM A;  5J2J A;  4I2I A;  4QW9 A;  1NVI D;  4EM4 A;  2D3B A;  2Y3A A;  1ZRN A;  5AI4 A;  2WHI A;  2ZPY A;  1YT3 A;  5KFT A;  1CZP A;  3IK4 A;  1UGM A;  1UQV A;  4ACO A;  3U9I A;  3SR6 A;  3MAB A;  2BCR A;  1JPD X;  3ETR A;  4UAU A;  3NVW A;  2PTW A;  1ZQF A;  1F8W A;  3DK9 A;  4KLG A;  1C1Y B;  4A8X C;  4NY0 A;  4N6E B;  1V1P A;  2DPJ A;  3WAO A;  4LNI A;  3RJ8 A;  4JWM A;  5BYQ A;  4I6N B;  4EX6 A;  3M63 B;  3NJT A;  2IPK D;  2K22 A;  4NQL B;  3DCG A;  4TUQ A;  1CMX B;  1ZD2 P;  4YSY B;  4J9N A;  2HHW A;  8ICI A;  2RR9 A;  3L17 A;  3H70 A;  3SFD B;  5KFW A;  2R18 A;  5C5J A;  1WM2 A;  4E4U A;  3KVF B;  1DOQ A;  4CF3 A;  4W9E A;  1S0V A;  3KHL A;  4UB8 U;  2LUM A;  1SF0 A;  1IM4 A;  2BVF A;  2P0I A;  2RSU A;  1JWB D;  4YD2 A;  2MQJ A;  2BC0 A;  1TZO A;  2AXR A;  2XSX A;  2MP2 B;  3RI7 C;  5AKX A;  5KFY A;  1PK1 B;  2GBN A;  3UMG A;  2G5H B;  2WGS A;  3EUB 3;  1QSY A;  1PUT A;  2C7H A;  5JHA A;  3Q2A C;  5J0R A;  2MBB B;  4GXK A;  4Z6F A;  3UQA A;  2UWQ A;  1LKY A;  4CF5 A;  1WFY A;  4NLN A;  2CR5 A;  2BPF A;  2ZW0 A;  3RFZ B;  3RJH A;  4GB9 A;  4OW0 A;  5ALN A;  2GRT A;  2IY0 B;  1P7F A;  2FBW B;  3GV7 B;  3AH7 A;  1ZQY A;  3S1D A;  3PR5 B;  3HT3 A;  1YZ7 A;  1ZQC A;  1YJI A;  4YP3 A;  4BGD A;  3NY5 A;  1D4B A;  4HCP B;  1XO3 A;  2PPH A;  1JRU A;  3DJG X;  4O5K A;  2LMR A;  2KFK B;  3D2J A;  9ICH A;  4LZD A;  4RU9 A;  2KAN A;  1QQR A;  2M4N A;  2HOQ A;  2W55 A;  1C76 A;  4TQ1 A;  1MO9 A;  2K8B B;  4KSL C;  2LGX A;  4H4P A;  2Y3R A;  1EWY C;  4B9L A;  2I2Y A;  5AHX A;  4DL2 A;  2BGW A;  1MDL A;  1J7A A;  4P4O A;  4O5E A;  5AK4 A;  2DAF A;  2DEN B;  3H8J A;  4FXC A;  1AYF A;  1T0R C;  3JVZ X;  2G0A A;  1L8O A;  3TAP A;  2YTU A;  3N3K B;  5AKH A;  4JWS C;  1TVA A;  9ICA A;  2XK5 B;  4NJC A;  4DN1 A;  5ALS A;  1C20 A;  4PVE A;  5CHG A;  2XC9 A;  1TKD A;  1JWU D;  4F92 B;  4PVK A;  1TKE A;  2KC2 A;  2QEJ C;  4MH0 E;  1SKW A;  1L7O A;  2JX5 A;  1FIQ B;  2RAB A;  2V3B A;  3AMZ A;  2KVS A;  3AQF A;  1GRE A;  1ZMD A;  4RNO A;  5CHV C;  2NBU A;  1P7D A;  3NRW A;  4K81 A;  5FXP A;  2KE7 A;  2J6U A;  2ON8 A;  1S5L U;  1GNU A;  3QJZ A;  4KIK A;  3SDL C;  1ECQ A;  3CAW A;  4GME A;  5AI5 A;  5HG2 A;  1WE6 A;  1KLG D;  2LGI A;  4XUS A;  3RUL A;  5L1K A;  4EBD A;  5ALT A;  5AIB A;  4RQ8 A;  3BS5 A;  1B0X A;  2IMW P;  4F71 A;  1LM8 B;  2K9X A;  3T8Q A;  2PTZ A;  1WGK A;  3FVD A;  3BVM A;  3V3X A;  4FS2 A;  1TS3 A;  2PGW A;  2D11 A;  3T5K A;  1V59 A;  4GLS C;  3IV6 A;  3WA0 A;  2P13 A;  3N1Z C;  1GRB A;  3MGV A;  2N7D A;  3UF8 A;  1I19 A;  1WUD A;  1RYR A;  2AQ1 B;  4N58 A;  2OQH A;  1XEE A;  1XLQ A;  1J0G A;  4EM3 A;  5BOL A;  2RMM A;  1S0O A;  1DNC A;  5IIL A;  4PYU A;  3NO1 A;  3ETR B;  4UB3 A;  4PYZ A;  4JMU A;  2W82 A;  1MQ2 A;  2DUY A;  2JEI A;  3NTU A;  1MDR A;  3GV5 B;  3QQ8 B;  5KFB A;  3JSV B;  2I0K A;  2K60 A;  2W8K A;  1FNV A;  2MUC A;  5ADZ A;  2KKP A;  3MSY A;  2ZTE A;  4P7I A;  3TOY A;  3SAH A;  4YXJ A;  5IIN A;  7ICS A;  1PGB A;  2ZIV A;  2AYO B;  1ET6 A;  2I38 A;  2WXM A;  2ZCC A;  1ZQS A;  3SD7 A;  5JU5 A;  5JCM A;  3RRH A;  4KIK B;  3C1Z A;  2DL0 A;  3TL5 A;  2ZIX B;  3SV3 A;  2PS2 A;  2VA2 A;  1J7B A;  1NHS A;  3LXD A;  2KIV A;  3NZ3 A;  3EPI A;  5DLF A;  2DW7 A;  1OW5 A;  4UB2 A;  1E0Y A;  2OJR A;  3H8S A;  3TJP A;  3A4S C;  3DED A;  5J04 A;  2RGF A;  4FHJ A;  4TQS A;  4FP1 A;  4C8M A;  2XN9 C;  1I42 A;  3GRT A;  3T3O A;  1SWW A;  3RF9 A;  1XS9 D;  3E56 A;  1JCK B;  2KIC A;  3AQE A;  2AL2 A;  2QCZ A;  2QHO A;  4MEY A;  4W9I A;  2WNM A;  2ZIX A;  1RZT A;  2LYB A;  2JQR B;  3FG2 P;  8ICG A;  4II2 B;  4BUR A;  2MRP A;  3H4K A;  2M9N A;  4KZ0 A;  3PML A;  1ZQA A;  2F77 X;  4EEK A;  2QJN A;  3RPF C;  3UCC A;  5D7G A;  3QHT A;  3O13 A;  1OEP A;  4YFK A;  2H89 B;  3RN9 C;  1STZ A;  1UWM A;  3PRP B;  3FYY A;  5G5G B;  3ZLG A;  1KEJ A;  3JPT A;  2J0J A;  3V62 A;  1JXL A;  4KGS A;  9ICN A;  3V60 A;  4IW0 A;  1ZQL A;  4OVU A;  3F5A A;  1C7Y A;  1HQR D;  8ICF A;  5DLG A;  2JWU A;  4C56 C;  1NKC A;  1GB1 A;  3M8R A;  8ICK A;  4FAD A;  3RFA A;  1KOT A;  5J0X A;  4GYP A;  1X42 A;  3R9K A;  2KFN A;  1WX9 A;  1ZDX A;  4OVZ A;  1ZOL A;  2FUH B;  4II3 B;  3N30 A;  3FW9 A;  4BCA A;  4Z6D A;  1ZQK A;  1WMH A;  2V3A A;  3WKE A;  4REZ A;  2C28 A;  4DQP A;  2NO4 A;  3Q3F A;  3BS7 A;  3IFW B;  4RFB A;  3NVV B;  1E9I A;  1LVH A;  3DGZ A;  5DG7 A;  1TKY A;  2IGH A;  3P4R B;  4GYP C;  4JE3 B;  4HCN B;  3R7R A;  3DQV A;  3EGR A;  4CNQ A;  1FHV A;  5J0P A;  2GR3 A;  3MR2 A;  1MNS A;  3RD2 A;  5KVH A;  1NK8 A;  1D8L A;  2KNJ A;  3ICX A;  1PVP A;  2W9C A;  2BQU A;  3MP9 A;  1E5W A;  1GB4 A;  3K9O B;  3M62 B;  5ALP A;  5J2H A;  1J7C A;  5T14 A;  2MUT B;  3PRZ A;  2GLS A;  2ASJ A;  2ONQ A;  1STE A;  4WJO A;  3ZW3 A;  3QU5 A;  1KKX A;  3JS8 A;  1F52 A;  4ML8 A;  1KDH A;  8ICC A;  5HR7 A;  3VRA B;  1P98 A;  2QLT A;  3H40 A;  3W1S A;  3H7P B;  1A5R A;  3MBY A;  4Q2J A;  5IO9 A;  2BB6 A;  2D6F C;  1QZE A;  4AS1 A;  4CQN A;  4CHK A;  3DVN V;  3JPS A;  1KLN A;  3J81 j;  2NS5 A;  3KFU F;  4WJP A;  2KJ9 A;  4JQ9 A;  2H3F A;  2QB0 A;  1WM3 A;  4NM2 A;  2WXP A;  4PK1 A;  4QWC A;  5IIO A;  3L0W B;  4GDK B;  1QCK A;  4DHJ D;  1H6V A;  1F1H A;  4DL7 A;  3CGE A;  3RNM A;  2OYY A;  2KDE B;  1W1S A;  2ES6 A;  3KTQ A;  1KTQ A;  2JK6 A;  4US9 A;  2HW3 A;  3S1E A;  2GQT A;  1VJ5 A;  1L4Z B;  2WXQ A;  4LNF A;  1ZXI C;  4HNL A;  5H2F U;  1MPE A;  4EMJ A;  2FPL A;  3OHB A;  1VAO A;  3IAM 1;  3FW7 A;  4B6W A;  3BOX A;  2D2Q A;  2AQ4 A;  2OWO A;  1R4M B;  4H4T A;  4F1S A;  1RYU A;  4C8O A;  4H4Q A;  1S3S G;  1XSN A;  2F44 A;  3PW7 A;  2GGE A;  3DGH A;  1XSP A;  4PWC A;  3NUQ A;  1Z4N A;  3OJ3 A;  2GGG A;  3K1G A;  1QQ7 A;  4IL2 A;  4DWI A;  4ECX A;  5L1I A;  2NBV B;  5E6J A;  2PMV A;  3MZN A;  1V1O A;  5JXV A;  5FR3 A;  3GD3 A;  2CFY A;  1UA0 A;  3IM1 A;  2XH0 A;  2BYE A;  4UAR A;  8ICN A;  5KL8 B;  4XGA B;  2J6S A;  1BZL A;  5ALL A;  4HCH A;  5L6F A;  3OTQ A;  5DBA A;  2PEA A;  3S5S A;  2ZIV B;  1WJ4 A;  2PSN A;  1U4B A;  2ZJD A;  4E71 A;  5G5H B;  3TJ4 A;  1A77 A;  2F5Z A;  4I29 A;  1E8G A;  4O5C A;  2W9C B;  3PW0 A;  5J2R A;  2X99 A;  3HP6 A;  4NLC A;  2K0P A;  1YN3 A;  3D47 A;  1V1P B;  3MTN B;  2QPM A;  3NFU A;  1M6Y A;  1QLN A;  3UJ2 A;  3WIM A;  4GXB A;  3ZDD A;  3V6K A;  3FYH A;  2QIE B;  3TFS A;  2IGD A;  3Q8L A;  3C29 A;  4ZRK A;  5J2G A;  2AAQ A;  4HJK A;  4MFF A;  4JN7 A;  4OZA A; 
#chains in the Genus database with same CATH homology
 5FXD A;  2E3T A;  2MEK A;  3AE8 B;  5T8I A;  2WXF A;  1FFU A;  3AE3 B;  4L2Y A;  1L0Y B;  3PQB A;  2WP9 B;  4ZRQ A;  3B9J A;  3FW8 A;  2AQ3 B;  1F2R C;  3Q8E A;  3CWI A;  2EXR A;  1VR9 A;  2NTS A;  3PO0 A;  4PZF A;  1FIQ A;  1FEH A;  2LMC A;  1FXA A;  1FRR A;  2J42 A;  2K3U A;  3KWV A;  1FFU C;  3BVG A;  3D2H A;  2O3G A;  2WDV B;  3TEY A;  1SJE D;  4WIP A;  5FK9 C;  3H8H A;  1K52 A;  1KTK A;  2WDR B;  1MHX A;  5BMH A;  3NVY B;  1MVK A;  1JQ4 A;  4TMA B;  1W1R A;  1TYG B;  1C4A A;  2WLB A;  1YQ4 B;  3IT6 B;  3EUB 2;  1JWS D;  4LK0 M;  2DLB A;  3RJA A;  4P16 A;  1AW7 A;  1RYJ A;  4ZOH B;  3GB1 A;  3W8X A;  1XLN A;  1IGD A;  4MT5 A;  3VR8 B;  1L6U A;  1D5X C;  4B0M A;  3VQI A;  1W1Q A;  1N5W A;  1XCT L;  2Q5W D;  3AE9 B;  2QJL A;  3MFG A;  3S1D A;  1W1M A;  5I1V A;  1YN5 A;  1DZN A;  1QF6 A;  1ESF A;  1TS4 A;  4ARC A;  5BMI A;  2Z8L A;  5I1W A;  3BWU D;  3BW7 A;  1FNW A;  3AED B;  2KN4 A;  4A90 A;  3TX1 A;  5HFY A;  3TEW A;  4YT0 B;  1SXT A;  1AWD A;  3CIR B;  1WVE A;  1NEK B;  1X2G A;  1KF6 B;  2LHD A;  3Q8B A;  3MHZ A;  5FXF A;  2INP E;  2GI9 A;  3B2F A;  1JW9 D;  4JB1 A;  4RNA A;  4XE0 A;  5FXE A;  1E6E B;  1SJH D;  2DBY A;  1SE4 A;  2P3H A;  3W5U B;  1JRO A;  3WCQ A;  1KLU D;  1HEZ E;  4XWW A;  4TVY A;  1C4C A;  3NVY A;  1SSN A;  2MH7 A;  4WQM A;  3C0P A;  3AE1 B;  4KX6 B;  1ACC A;  1I4H A;  4HRO A;  1QOG A;  2WDQ B;  1GOZ A;  4LTU A;  3SEB A;  4KKI A;  4PYT A;  3W8Z A;  2NQW A;  1T3Q A;  3PZ7 A;  1NI3 A;  5C3J B;  3A7A A;  1L6V A;  3DWM A;  2TSS A;  2VFR A;  3P4Q B;  1MBT A;  3R07 C;  5G5H A;  4A6Q A;  2KAC A;  3AEC B;  1SIJ A;  3NVZ A;  4YSZ B;  5AE2 A;  4HEA 1;  3AE4 B;  4MLA A;  4BC7 A;  2JXT A;  3W2D A;  3FIL A;  1IUE A;  2WXI A;  4J3O D;  3GP7 A;  3A7R A;  1V8C A;  2QMT A;  1RM6 B;  1HA5 A;  3Q8C A;  5HHZ A;  2YEP F;  3ZJU A;  4C80 A;  2GQU A;  3I9V 1;  1NYQ A;  3BYT B;  4TSS A;  3BK1 A;  5LNK 1;  3S1C A;  3B2G A;  2BW2 A;  2MJD A;  2VFT A;  1P7E A;  1N61 A;  4JWU C;  1DYQ A;  1M4V A;  4ZHO A;  2BYT A;  1AHU A;  4WH4 A;  2Y08 A;  2FUG 1;  1C78 A;  3AE5 B;  1QLB B;  1UXY A;  2VAO A;  4O95 A;  1DOX A;  5C2T B;  3S1F A;  2EKI A;  1OQQ A;  1PFD A;  1ZUD 2;  5GXG B;  2N0S B;  3Q69 A;  1SB3 C;  5K8E A;  1TS2 A;  1TY0 A;  3KQ4 A;  1VRA B;  2J52 A;  2KMM A;  1HZ5 A;  1VJK A;  3BII D;  2BB5 A;  1OQR A;  4JPS A;  1N60 C;  1EU4 A;  1VZ7 A;  2LJI A;  1X2H A;  3TSJ A;  2VFS A;  2BS4 B;  2WU2 B;  2WXG A;  4PWB A;  3BVZ A;  2OED A;  2PIA A;  1Q10 A;  1N63 A;  2LEK A;  2PLP A;  3P4S B;  3L4P A;  5BYS A;  2H88 B;  2INN E;  1NVI D;  4N59 A;  1E7P B;  5AE3 A;  2Y3A A;  3IXS A;  2JYE A;  1QOA A;  5EE0 A;  3P42 A;  2WS3 B;  4WWM A;  1AHZ A;  1CZP A;  3LXF A;  2ACZ B;  3SR6 A;  1IBX A;  3ETR A;  2R2Z A;  5EE1 A;  3NVW A;  3KJM A;  4HKZ E;  4A8X C;  1K53 A;  4N6E B;  1NEN B;  2PLS A;  1V1P A;  1A70 A;  5L6G A;  3ZGZ A;  3PZ8 A;  3NS1 A;  2UUV A;  3RJ8 A;  5BYQ A;  4RGM A;  1WYG A;  2IPK D;  2K22 A;  3W5V B;  2QKN A;  4YSY B;  4RF0 A;  5BYR A;  3SFD B;  1QLT A;  1XF5 L;  2DYM A;  1SB3 B;  3IT4 B;  3HSU A;  4YTM B;  2NMQ A;  5G5G A;  2X38 A;  3NRZ B;  1CJE A;  1UWX A;  2LUM A;  4ZYS A;  1SF0 A;  3ETR B;  1VLB A;  1QOB A;  2BVF A;  1JWB D;  1TZO A;  2RDH A;  1N62 C;  2AXR A;  5HHD G;  4C7Y A;  2MBR A;  2XNA C;  1W1K A;  4UDU C;  1BML C;  3P4P B;  3EUB 3;  4USA A;  1PUT A;  1XLO A;  2WQY B;  1R7S A;  2IGG A;  1B9R A;  2Y4G A;  3MC0 B;  1E8H A;  2ZW0 A;  2SEB D;  3RFZ B;  2P4P A;  1HXY D;  4OW0 A;  2E6X A;  3FWA A;  4NZL B;  4L23 A;  1EWC A;  1QKZ A;  2HDE A;  2L32 A;  1C9F A;  2E5A A;  2QIL A;  3DQ0 A;  4A9A A;  1P7F A;  2FBW B;  1FXI A;  3AH7 A;  3D2D A;  3DWG C;  2KWD A;  1NYR A;  2WXH A;  1YJI A;  1OFF A;  4OZC A;  3TEX A;  1D4B A;  1QOF A;  1SBB B;  1XO3 A;  2M56 B;  4KGT A;  3R2T A;  4M0W A;  4RF1 A;  4RH6 A;  3NVW B;  3BYY B;  5AUK A;  2AX5 A;  5I4D A;  4PVJ A;  1YMH E;  3P1M A;  2JSV X;  4RCO A;  2M0A A;  4EE2 A;  4TQ1 A;  2Q85 A;  1QQR A;  2V0G A;  1E8F A;  2W55 A;  1C76 A;  4XWT A;  5HMR A;  2RPV A;  1DII A;  4NAM A;  1I4R A;  1N63 C;  2Y3R A;  1EWY C;  1YJJ A;  3I57 A;  3IAS 1;  2I2Y A;  3C8Y A;  1DIQ A;  1J7A A;  2WXN A;  2WDW A;  4EC3 A;  1WWT A;  3NS1 B;  4FXC A;  1AYF A;  1ZDV A;  1JML A;  1BUI C;  4JWS C;  4DXF A;  4NJC A;  4XDD A;  2D5G A;  2BS2 B;  1FFV A;  1D6E C;  1F2R I;  1E9M A;  1JWU D;  1IGC A;  3AE6 B;  3AV8 A;  3BZD B;  3EA6 A;  1TKE A;  1QT9 A;  1XLP A;  2QEJ C;  4B0E A;  4PVK A;  3W8W A;  2JX5 A;  1FIQ B;  1WVF A;  5AUI A;  3AMZ A;  1DOI A;  2L52 A;  1L0X B;  4PT5 A;  1QLU A;  4YTN B;  1N5W C;  1LO5 D;  2PVO D;  2L1A A;  5FXP A;  1D5M C;  1B1Z A;  4HJG E;  2ON8 A;  2J4X A;  1KRH A;  1RWS A;  5HG2 A;  2LGI A;  1KLG D;  3VRB B;  1W1O A;  3ZJT A;  2RK5 A;  4TQ0 A;  1V97 A;  1I4Q A;  2WXL A;  3AN1 A;  1EU3 A;  2AQ2 B;  2K9X A;  3LLB A;  4NAW B;  1WGK A;  1YQ3 B;  3TSH A;  1UGJ A;  3BVM A;  3HUI A;  4HRS A;  3V3X A;  3R2I A;  3B9J B;  1TS3 A;  2DWQ A;  4YSX B;  4GLS C;  4YXD B;  4PVE A;  2P13 A;  3AEB B;  1I19 A;  1UNS A;  4N58 A;  4TVW A;  2AQ1 B;  1XEE A;  1XLQ A;  2RDG A;  2PLI A;  2RMM A;  3Q8A A;  1F0Z A;  2Y3S A;  1HSK A;  2N7J A;  1I4X A;  3AM9 A;  2JU6 X;  2R61 A;  3VR9 B;  4UD8 A;  2W82 A;  1DOY A;  5H8Y E;  1RFK A;  3KLS X;  2SAK A;  2MJE A;  4GDL B;  1ZPS A;  2ICI A;  2PTL A;  1ZXI A;  2BT6 A;  3P63 A;  2I0K A;  1FM0 D;  3ZJV A;  4H2A A;  1FNV A;  5ADZ A;  4IDI A;  4PVH A;  2V3N A;  3LYY A;  3NVZ B;  1K51 A;  5D79 A;  2CJN A;  2I38 A;  1PGB A;  2PKO A;  1ET6 A;  2WXM A;  1ENF A;  4IKG A;  1QIL A;  4ARI A;  5HI1 A;  3A7U A;  3AEA B;  3V05 A;  2VFV A;  2BVH A;  4OZB A;  2EEL A;  4MAC A;  1CQV A;  1J7B A;  4XDC A;  2WXO A;  3NZ3 A;  1SE2 A;  1BXT A;  2K5P A;  4L1B A;  1E0Y A;  2YEP B;  5BMG A;  2B76 B;  1N62 A;  3DED A;  2IDY A;  2N9K A;  2XN9 C;  5MPO A;  3T3O A;  2W54 A;  4WUR A;  2Q4W A;  3E56 A;  1K50 A;  1N61 C;  1JCK B;  2R8D A;  3FAH A;  1F77 A;  2DYO A;  3NUH B;  3I99 A;  2PVG C;  3Q8F A;  1L0V B;  3E9S A;  2WNM A;  2V3P A;  3VTE A;  2JQR B;  4R3D A;  4YTP B;  3HRD C;  1TY2 A;  2W3R A;  1AN8 A;  2NTT A;  4OAL A;  1I4G A;  4JAY A;  1VDV A;  2OHF A;  1L4D B;  5EE3 A;  4IOI E;  3RPF C;  1Y56 A;  1MI0 A;  2Y5P A;  5D7G A;  1IBX B;  3SR6 B;  5HQX A;  3O13 A;  2H89 B;  3NRZ A;  1I7H A;  1UWM A;  5G5G B;  2G9H D;  2ZW1 A;  1ZXH A;  3AEE B;  2KDM A;  2HTM E;  2KQ4 X;  1KFY B;  3UI3 A;  1GPX A;  1W1L A;  4KGS A;  3OWE B;  2KAJ A;  1FD6 A;  4D2K A;  3HVZ A;  3LB8 C;  5FKA C;  4RGO S;  4ZRP A;  1HQR D;  1AHV A;  1FO4 A;  2LHE A;  2JWU A;  3U2S C;  2VZK D;  4C56 C;  1GB1 A;  2Y5C A;  1T3Q C;  1MHH E;  1HZ6 A;  1PGX A;  1FCL A;  2G1E A;  1ZDX A;  3AB5 A;  4OVZ A;  4ZHP A;  2BBC A;  3FW9 A;  4BCA A;  3ZQ4 A;  4REZ A;  3MJ5 A;  4MM3 B;  3NVV B;  2WU5 B;  4RFB A;  3AE7 B;  1TKY A;  2IGH A;  1PDX A;  3P4R B;  2BVG A;  4JE3 B;  3KWL A;  2GRI A;  1F0X A;  3SFE B;  3EGR A;  2V4I B;  1SE3 A;  2MJ3 A;  3R8B A;  1FNU A;  4HKQ A;  1T6B X;  2M19 A;  3J9C A;  3AE2 B;  4YWG G;  3MP9 A;  3POP A;  2CU3 A;  1GB4 A;  1D5Z C;  3URY A;  4KGR A;  1J7C A;  3BK2 A;  4DXG A;  4WAF A;  2ONQ A;  1STE A;  3ZYY X;  1PGA A;  2JZP A;  4KKJ A;  5H92 C;  3U52 E;  1C79 A;  1ZR6 A;  3LAE A;  4AQ7 A;  3JS8 A;  1XCQ L;  4O1N A;  4A55 A;  4ML8 A;  4BC9 A;  3VRA B;  1W1J A;  3T3N A;  3GSY A;  1PYW D;  3W1S A;  1T5X D;  4US8 A;  1WSP A;  2L83 A;  2LFI A;  4Q2J A;  5TSS A;  4DQO C;  1MBB A;  3FC4 A;  2BB6 A;  2WXK A;  4AS1 A;  4CQN A;  1N60 A;  1GAQ B;  4XLO A;  1WRI A;  3HVD A;  1XXG A;  1JRP A;  3AEF B;  4ITK A;  4MH8 A;  1JWA D;  3PM9 A;  1WXQ A;  3D2J A;  2WXP A;  1EM7 A;  4GDK B;  4OHJ A;  1E0Z A;  4OZA A;  3U7Z A;  1C4P A;  2VZK B;  1UUP A;  1VZ8 A;  1C77 A;  1W1S A;  3TEZ A;  4LLG M;  4BBY A;  2IPI A;  4RGT A;  4US9 A;  3S1E A;  2GQT A;  1ET9 A;  1L4Z B;  1TJE A;  2WXQ A;  1ZXI C;  1FCC C;  1MPE A;  1YN4 A;  2JYT A;  4JX1 C;  1VAO A;  3IAM 1;  3FW7 A;  4RGN A;  3W9C B;  2J53 A;  1CK1 A;  3U4E G;  1RM6 C;  1N5X A;  2N9L A;  3AEG B;  1ROE A;  2UUU A;  4P6V F;  2PW9 A;  2WXJ A;  1SEB D;  2GB1 A;  1FFV C;  3N9Y C;  2W3S A;  4ZOH C;  1L5P A;  4PWC A;  2OAI A;  5AWV A;  2CJO A;  1VZ6 A;  5E6J A;  2PMV A;  1V1O A;  5JXV A;  1ZOY B;  5FR3 A;  1DGJ A;  2IJ0 A;  4C7Z A;  5D3I B;  1FMA D;  1YNT E;  2WXR A;  1JWM D;  5L6F A;  2VFU A;  1FRD A;  3ABV B;  4HG0 A;  3GS2 A;  3HRD D;  5G5H B;  1TKG A;  1ZE3 D;  1I4P A;  1KH0 A;  1E8G A;  3TSS A;  5EE9 A;  1VQZ A;  1E10 A;  2BTE A;  1TS5 A;  2FE8 A;  2QSD A;  2BS3 B;  2K0P A;  1YN3 A;  5AE1 A;  5D3D A;  1V1P B;  2QPM A;  4DNS A;  1ZP0 B;  3TUO A;  2YVS A;  2QIE B;  2IGD A;  3FIL B;  1JAL A;  3NVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...