2W55A

Crystal structure of xanthine dehydrogenase (e232q variant) from rhodobacter capsulatus in complex with hypoxanthine
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE DEHYDROGENASE
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 114
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w55A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w55A01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w55A03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w55A05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w55A04
3AV8A 1DGJA 3FW8A 2AX5A 2Q85A 1N5WC 3FAHA 1T3QA 1OQRA 1E10A 1GAQB 3ETRB 1N61A 1E9MA 1FRDA 2W3RA 1SB3C 1E8HA 3C0PA 3L4PA 4TVYA 1FFVA 2CU3A 1RFKA 2E5AA 5EE0A 1TJEA 4KX6B 5FXPA 1FIQB 3NVYA 1YQ3B 3B2FA 4UD8A 5FXEA 1J7BA 1FXIA 3NVVA 1NI3A 4N58A 2VFTA 1PUTA 2KMMA 3D2HA 3S1DA 1N62C 1QLBB 2WQYB 5FXDA 4BCAA 2CJNA 1ZR6A 4WWMA 1XLPA 2K5PA 1DOXA 1JRPA 2Y5CA 2WU5B 3AEEB 3P1MA 1DIIA 2VFVA 4DNSA 1YJIA 2QPMA 5FXFA 2BVFA 2MH7A 2OAIA 1ZXIA 5G5GB 4ZOHB 1KFYB 1RYJA 1N63A 2QJLA 1E0ZA 5AUKA 2YVSA 1FRRA 3NS1A 2KAJA 2JX5A 1QLUA 1FIQA 3W5VB 4JB1A 3DEDA 2PLSA 2ACZB 4IDIA 2PVOD 2BS3B 3D2JA 1SIJA 1QT9A 3I99A 4PVKA 2WU2B 2WDRB 2VFSA 3P4SB 5GXGB 3AE5B 4ZHOA 1FXAA 4PVHA 3AE6B 3AE2B 1EWYC 1ZOYB 3AEBB 1VAOA 1DZNA 2DBYA 3B9JB 3P63A 4BC7A 5HHZA 4JAYA 3CWIA 1WXQA 4YTNB 1MBBA 3WCQA 1UXYA 2WP9B 4YSYB 1I7HA 5EE9A 5C2TB 1WGKA 3HRDC 4OALA 4PYTA 3S1CA 2EXRA 1YJJA 2VFUA 4BBYA 1WVFA 1NEKB 3W8ZA 3VRAB 2E3TA 1DOYA 1VLBA 1WWTA 2MJDA 3NRZB 1N60C 1JALA 4LTUA 4BC9A 1WVEA 4C7YA 2WDVB 2B76B 5EE3A 1QLTA 4US9A 3RPFC 4C80A 3LB8C 2L52A 1AWDA 2GQTA 3NS1B 1L6VA 1JQ4A 3B9JA 1TYGB 3W5UB 2K9XA 1TKEA 3AE1B 1A70A 1OFFA 3FWAA 1JWBD 2P3HA 5AE3A 1SB3B 2VFRA 2BS4B 2BS2B 1NYRA 4PVJA 1WRIA 3P4QB 1J7CA 2BT6A 4N6EB 1XLOA 4A9AA 1OQQA 3LLBA 3S1EA 2OHFA 4YTMB 3AB5A 3AE7B 2BVHA 3HRDD 3AEDB 3W8XA 1N5XA 3NRZA 1AYFA 1XLNA 3HUIA 5HMRA 2L83A 2N0SB 2MJEA 4EC3A 3P4PB 1TKGA 2PIAA 1N5WA 3HVZA 3DWGC 4ZOHC 2P13A 2QIEB 1V8CA 1WYGA 1CJEA 2H89B 3AMZA 5AE2A 4PWBA 1W1SA 4C7ZA 1FFUC 1GPXA 1RM6C 1ROEA 5D79A 2R2ZA 1E6EB 2DWQA 3GSYA 1X2GA 1T3QC 2NQWA 4O95A 3TSJA 1N61C 3AH7A 3VR8B 4N59A 2QKNA 3AE4B 3KWLA 1VJKA 1B9RA 3AEAB 5ADZA 2BVGA 2W55A 1FFVC 3DWMA 2W54A 1N62A 3W8WA 1E7PB 1E8FA 1L5PA 1JROA 2W3SA 3EUB2 1JW9D 4HROA 1FM0D 1L6UA 1YQ4B 3BIID 2EKIA 1UWMA 2P4PA 5G5HB 4HG0A 3ABVB 4PWCA 2LEKA 3A7UA 3W9CB 1W1JA 4PZFA 2MBRA 1W1KA 3JS8A 4ML8A 2M56B 2I0KA 3NVZB 3VRBB 1VDVA 4US8A 2JQRB 3B2GA 3AN1A 2Q5WD 1ZXIC 1QF6A 2WDQB 1KRHA 3DQ0A 1N63C 1FO4A 4JX1C 2HTME 2CJOA 1TKYA 4USAA 1W1MA 4PVEA 5AUIA 1QOBA 3AE8B 1NVID 1JWAD 5G5HA 3CIRB 3AECB 1DOIA 1PDXA 1AHVA 1W1OA 3SR6B 1KF6B 1W1LA 3A7RA 5H8YE 1MBTA 2G1EA 3BW7A 3AE3B 4JWSC 3VTEA 1ZP0B 2MJ3A 3LAEA 3PM9A 3NVZA 1I19A 1VQZA 3FW7A 2PLIA 1V97A 1QOGA 1ZUD2 2PKOA 3FC4A 5HQXA 1QOFA 3LXFA 3AM9A 3SFEB 1N60A 4YT0B 5AE1A 3NVWB 1SF0A 2FBWB 3VR9B 4WQMA 1AHZA 1QOAA 4FXCA 4MLAA 4P6VF 3ETRA 1F0ZA 1E0YA 3TSHA 1F0XA 3D2DA 2H88B 3PO0A 2R8DA 3SFDB 1XLQA 2WS3B 3P4RB 2GQUA 3FW9A 1HSKA 2WLBA 1W1QA 4ZHPA 3R07C 5MPOA 4JWUC 4ITKA 1DIQA 3SR6A 1RM6B 2RK5A 4XLOA 1NYQA 1FMAD 4YXDB 3S1FA 3AEGB 1CZPA 3TX1A 1X2HA 2AXRA 5EE1A 4HRSA 2PVGC 1L0VB 1J7AA 5H92C 4TVWA 3ZYYX 1PFDA 3NVWA 1RWSA 1NENB 3AE9B 4YTPB 3AEFB 2M19A 3KJMA 5C3JB 3A7AA 3NVYB 1R7SA 1W1RA 4YSZB 5G5GA 1E8GA 3NVVB 2VAOA 1IUEA 2K22A 1AHUA 1XO3A 4YSXB 2Q4WA 3EUB3 2O3GA 1FFUA
chains in the Genus database with same CATH superfamily
3I3TB 1ZQUA 1TYPA 2IY1B 3GD4A 3FW8A 4MT5A 8ICFA 2WOWA 1ET6A 2D5GA 2Q85A 3FAHA 4I2IA 1RG6A 2EQ6A 1OQRA 2OLAA 4WJPA 3Q4DA 5J2IA 4UASA 1SGGA 1TAMA 5K4LA 4UBCA 1GAQB 4PHEA 2NRXA 4CGZA 2RR9A 2F76X 1FRDA 2J53A 3QTPA 1IYXA 5KAFU 1WR6E 3ZTDA 2C2EA 7ICTA 5J2EA 5KFJA 3L4PA 3H8MA 3C0PA 4F5QA 1V85A 1WZ0A 3GZNI 3L10B 2GO7A 2OYYA 2KZ3A 2C60A 3QU2A 2YX8A 2FPLA 3U4EG 1XO0A 1K51A 2QILA 1NU5A 2AJQA 3WK4A 1RFKA 4DBGA 5EE0A 3KHGA 2LJ5A 3EZ5A 1RAXA 3IV6A 3CGDA 1FIQB 4NQLB 3NVYA 2FMSA 2K6DB 1YZ6A 1WY8A 2NRZA 1YQ3B 2BKRB 2XICA 1L0YB 1UCVA 5J2DA 3Q8MA 3KUCB 4EKUA 2EQ9A 1AN8A 4UD8A 3PG6A 2D2QA 2YMLA 1J7BA 3PRMB 3M9MB 3Q8LA 3B97A 1BMLC 4N58A 2HHQA 3SJNA 5KFTA 4HDOA 4B9NA 4DSJA 2LZ6A 4AUQC 2D07B 2I5QA 3RZWC 4KSLC 2N9PC 3S1DA 4XC2A 3KFUF 4BCAA 4NJ7A 2QDDA 1NJWA 2CJNA 5AKKA 2KDEB 3DG3A 3ZLGA 4WWMA 4YMOA 3CT2A 2FIFA 4ENLA 1JXEA 4Z1YA 3EWAA 3RB6A 2VKQA 5ALSA 1S7MA 4GB9A 3RGTA 4PHAA 5FJTA 2JPHA 2WXNA 3A33B 1MSWD 4MJSA 1YJIA 1UGJA 4OZCA 3QPEA 4ZRIA 2FPMA 2AH5A 5J0XA 1GRGA 3SSZA 2BVFA 2JK6A 3AUOA 3QNMA 4Y2UA 2KZMA 3FV9A 1ZXIA 2GBNA 2K8CB 3MFHA 4NL9C 5G5GB 4ZOHB 5TR5A 3BVZA 5FR3A 1BWCA 1IBXA 3MR3A 3FG2P 5D46A 3TQ1A 4RT3A 2L1AA 4RGTA 2NQLA 1XO1A 3STPA 3PO4A 1I4QA 2F77X 4M0WB 1WUDA 1SV4A 3RTVA 4TSSA 3Q8EA 3RFAA 4J9KA 2V0GA 2FLLA 1F9CA 3ZXVA 4UB2A 2JX5A 5E6JA 4ROPA 2QC8A 5J2RA 3CNHA 4DF4A 3IK4A 1R0MA 3RCYA 3OHAA 3ZDAA 5KHQA 4A3RA 2BC1A 4NWIA 3V7LA 4FHJA 3JSVB 2UUVA 1WJNA 2ZXIA 3UGBB 4RH6A 5KG7A 3VTVA 1S10A 2LGIA 3JPOA 3GD6A 1V6EA 4QWBA 3NOBA 5DPTA 2EH9A 1IM4A 4P0PB 2WDRB 2GH5A 2QGYA 2RPQA 3GFKB 4O3QA 2LXCA 3Q3JA 1S8OA 1SJDA 1D8LA 2V3NA 2LHTA 5ALVA 1OEPA 3EJEB 4HCLA 4H2AA 3QUBA 5HMMA 4PZOA 3GIMA 2OH2A 2KZRA 5FK9C 1RQLA 2I2YA 5J0RA 1P7FA 1WH3A 5G2NA 3CB3A 1ZOYB 1HQRD 2H3VA 2WF9A 4YXMA 1JUDA 4C4VB 1JCKB 2KMAA 4K4HA 4O3OA 3A9JA 4J9OA 1DZNA 2ZTDA 2IHNA 1L8PA 3DERA 4GIBA 4BC7A 2KJHB 4E71A 1E8WA 3PSEB 4OO1J 1UWXA 2M0NA 1XS9D 4JAYA 5DG8A 1GB4A 2KWUB 3N28A 1MBBA 3SBFA 3Q8SB 4I6NB 4Q2JA 1YZ7A 2V4RA 3MHZA 4HEA1 3BSMA 3VFCA 5KVHA 3NHEB 2WF6A 3THUA 4L23A 1SIFA 2KP7A 3NTUA 4DL3A 2A3VA 1ET9A 1K52A 1L4ZB 1UZXB 1VZ6A 2WXHA 5E6PA 3B0XA 1WGKA 2NPXA 3N1YC 4M52A 1STZA 2CRXA 5KFEA 3W1YA 2ZXHA 4GYPA 2DKZA 4URKA 2KVRA 5FS9A 3T8MA 1QQ5A 3I5JC 3MY9A 4WWPA 4GC7A 2K6QA 4O3SA 2NVKX 4ECTA 1HXYD 5AM1A 1WGRA 1WMHA 3H8SA 3ZD8A 3MR6A 2PGWA 3ZTCA 4HYRA 4Y2YA 4XDCA 3W8ZA 4KGSA 3OTRA 2JRHA 3RF9A 5KFGA 5DB7A 4ECXA 1F52A 2JYTA 5FS8A 4UAWA 3TI0A 1KDHA 1ACCA 4DQSA 2D3CA 5JCNA 3FYHA 1E9IA 4EQRA 2KLGA 4C7YA 4B6JA 3WU2U 4IRDA 1WZ3A 1EU4A 1PGAA 3QC8B 2UVRA 2LVPA 1KN0A 1KFTA 1UT8A 4FJYA 3I1YA 4O0IA 3RB3A 1BUIC 3LYYA 1COKA 1D8BA 5B5EU 4HCDA 1IP9A 1V9PA 5BMHA 2LYHA 2KDMA 3DBSA 3DCGA 5ALPA 4QZCA 5J04A 2XIDA 3PS6A 4KPRA 1N6ZA 2PMZF 3GC2A 2Y3AA 3AE1B 1TKEA 3RNMA 1K8RB 1L3VA 9ICUA 3GZNB 4UDUC 2OZ8A 4BJQA 1JWBD 2E1FA 1QSLA 3IJIA 2Y9TA 4DF8A 3SN4A 4DL2A 2F2AB 2HOFA 4HK2A 2AAQA 4NAWA 4EX6A 3D6JA 4YWOA 3EFCA 4AJWA 1BNOA 2AHOB 4BGDA 4REZA 4WAFA 3HP6A 2DPJA 3EJDB 3Q8BA 2I9GA 2P6RA 4U7CA 9ICJA 1Q0WB 3E2EA 3RI7C 1BPEA 5J0QA 3IRUA 4IS7A 3NGDA 1TZOA 5D2MB 3LVWA 2LVQA 1FECA 5D3IB 4KLQA 2OO6A 4YTMB 2GH1A 3LWLA 3I28A 1T3NA 5AKLA 5AI6A 3QEAZ 2BVHA 3QU9A 3TADA 4JE3B 4BXOA 1NPXA 1N5XA 2BB6A 4DQPA 1MN8A 2KKVA 2JZBB 1C4PA 2ZZCA 3VH3B 1EF1A 4JN8A 8ICAA 1H4RA 3TSSA 1P3QU 3WK7A 2HVHA 2M17A 1L0XB 2EQ8A 1W6TA 1ZOLA 1ZQFA 3MC1A 3Q6BA 4EC3A 4ECYA 1EBHA 2GR1A 2AYOB 2QB0A 2BQUA 3EANA 4FN2A 4EWJA 2W43A 2BPGA 2C7MB 1CK1A 4S0RA 3C2MA 2JEJA 2OOBB 2P13A 4G8TA 4I6PA 7ICMA 4DSEA 2JH1A 2KHVA 2XSXA 2V9HA 3CP8A 4XRHA 4O1NA 3QQ8B 4F72A 2GGEA 2P8CA 1Z19A 2MCNB 5HHDG 4O3MA 2ZJ8A 3PR4A 1V5TA 2KTFA 3V4BA 4P16A 4I2FA 4K4GA 4ECSA 3RR8A 3E0FA 2I1JA 3OP2A 4O3PA 2GOWA 4HXDA 3ZDDA 4IQWA 2W8LA 4O5KA 1O08A 3UMCA 1UBQA 3T9PA 2GR3A 2XN9C 2ATLA 4ZRPA 3OJ3A 3TW9A 2G06A 9ICHA 4YXJA 4U6PA 3GSYA 3MGHA 3DDMA 2AL3A 1N61C 3RO6A 2AQ0A 2HOIA 9ICSA 3ETLA 2QKNA 5DDYA 2GGHA 3AE4B 2Y9UA 1E8YA 3DVNU 1C1YB 8ICOA 1TTNA 1S5LU 2F5ZA 3MR5A 1VJKA 2OEHA 9ICFA 2IGDA 4TUQA 3MC8A 4P1CC 3PW0A 5EWFA 1B9RA 5ADZA 1MQ3A 5HFYA 2BVGA 3TWBA 3PV1A 2KKCA 2XO7A 1HTQA 4FFDA 3MABA 1N62A 1P43A 3DGZA 5L1IA 5LNK1 3LXDA 2E8OA 4GFIA 2LI5A 1IPGA 2KSOB 4FS2A 2GGIA 2O6VD 4UB4A 1Y8RC 2LYAA 1JW9D 2JT4B 2MBHA 1FM0D 4J6IA 5KFYA 1L6UA 2BCRA 4OJ6A 4YR3A 3ZNHB 3IVFA 4NEWA 2YQUA 2WP6A 3DVGX 3RRGA 1ZRMA 1QLNA 2WWZA 2VZKD 4LNIA 4A8XC 5ALWA 1GRFA 1TKKA 4H4UA 4P0QA 9ICAA 2RP5A 2EKIA 3LDAA 4DL5A 3QUTA 3RN9C 3OSPA 4NNJB 3ABVB 1EUVB 2LGSA 3BOXA 1GERA 1ED1A 8ICPA 1TS3A 2LGYA 4PWCA 5AZHA 2NBUA 3R2IA 1PGXA 3BK2A 5J0UA 3Q8KA 3E58A 3CXOA 4NLKA 8ICWA 4BKTA 3HT3A 4KZCA 1ZKHA 4ML8A 3RYTA 2UYZB 5HI1A 3IT6B 2I0KA 4K7WA 3BJSA 4IWQA 3UCDA 4DXGA 2BCUA 2P35A 3Q8PB 1F1HA 3CSFA 4IM2A 2BDPA 4NJ6A 4EZLA 2QJJA 3AN1A 2LVOA 3NZGA 1QF6A 1ZQLA 2PFOA 2W11A 4UB3A 3N4MB 2R8KA 2BVCA 3A1QA 3H6NA 4ASWC 4GR1A 4MELA 3PMLA 5I4DA 2JRZA 4K81A 2VRRB 3II4A 4DX3A 4HLEA 3TJ4A 2WF8A 4M9LA 5AIAA 1FO4A 3S2AA 2INPE 4QWCA 4MHVA 2K4EA 2LD9A 2QDEA 3R2TA 3RJGA 3A0HU 2I38A 2REXA 1TKDA 2BQRA 3I6TA 2W9CB 2YMMA 1MVKA 5KAIU 4YFKA 1X9SA 2W9AA 5KFHA 4ANVA 4XWWA 2QJMA 2WAQF 5HNKA 1F2RC 1N56A 2C3DA 2JV3A 1XC9A 1F9JA 2HNEA 3AE8B 1JXLA 2IHMA 1T6BX 5BYSA 2PKEA 3GD3A 1F2RI 2KE7A 4DFPA 2R2QA 4HCPB 4AWJA 2RPVA 1E7UA 3EHVA 4J3OD 4KIKA 3PVXA 3R3MA 2ZIWB 2EQ7A 1SL2A 4DFKA 2Y08A 3NUHB 1SJHD 4HPLB 1UPHA 2MA9B 4NLNA 4IOIE 1DOQA 3HPOA 2PPGA 5GTHU 4I2AA 1NZPA 9ICWA 4GGQA 2POZA 4C56C 2L00B 3A7RA 7ICPA 2L32A 4KSKC 1YX6B 2TPRA 4WJOA 4A90A 8ICZA 1KOTA 3NVZA 5AICA 2HHUA 2DYBA 2UWQA 9ICMA 2B21A 4I2JA 3W1SC 1VQZA 2QARA 3UM9A 1BVSA 1QSSA 1V97A 4DDGD 4Y2QA 2J3NA 3NFUA 4KWSA 3UMBA 4I2DA 3AQEA 4TKNA 2V6OA 5B66U 2PKOA 4C4SA 2KACA 3MUCA 2WFAA 4Q43A 1EM7A 2R8JA 3BS5A 3NRWA 1TGZB 3NVWB 3T8QA 3N6HA 4ECUA 3RNBC 1VRAB 4DNAA 2MWSB 4FI4A 3J81j 2RGFA 3FYYA 4JL9A 2NO5A 3ETRA 3UQ2A 1C7YA 1E0YA 3IG8A 2R8DA 4BWJA 5KFSA 3SFDB 5DPWA 2NV3A 4B9VA 2WS3B 3NG0A 5IN7A 4LVSA 5LXIB 4H19A 5J2GA 1SKWA 2AKZA 2ZW0A 2NRWA 5ALHA 2QEJC 1JCTA 4YD2A 3EYZA 1SV0C 4HKZE 3ZIMA 4EMWA 2FCNA 1HSKA 2CPRA 2WLBA 1B0XA 1I4GA 1LFDA 3TWAA 1V49A 9ICLA 2E8MA 3R07C 2OPJA 3PR5B 4AJYB 1ZD3A 4KN4A 5MPOA 3CGBA 3ML8A 8ICHA 2K3UA 3A0BU 1U45A 1A5RA 4WJNA 3DJJA 2HDEA 2V4LA 1Q3UA 1FXTB 2RK5A 5E6NA 2EQYA 3PZPA 2IO2B 4J9LA 4YXDB 4AYBF 2KKPA 1GOZA 2ZC8A 2G3QB 2KEYA 5IIOA 4JGHB 2MP2B 2NMQA 2PP3A 5J2FA 3PX6A 2Q0ZX 1D5XC 3I57A 4DXFA 3GV7B 3OZYA 4IZGA 2C9WB 2PW9A 2CU1A 3QYPA 1NK7A 1XD3B 3EGRA 2K8AA 2PVGC 3APFA 3WAPA 1L5UA 1KTKA 3PGEA 3VUWA 2H5XA 4KLHA 2ESEA 2X8XX 3KKAA 2ZIUA 4RQNA 5AKHA 4EENA 3V62A 2FUHB 1LGRA 3NXLA 4YTPB 3SQPA 2XVTA 2V3PA 3KUZA 3AEFB 4MGGA 4DLEA 5CHWA 3A7AA 3U4FA 4RQ7A 8ICJA 1R7SA 3FILA 3PZ7A 4YWGG 2XGQA 4GLSC 4IRKA 4A35A 1GRAA 1RZTA 3MJ5A 3H7PB 5JHAA 4EBCA 5AM5A 2V4QA 3KW5B 2KXJA 3PRPB 4P4MA 2W0HA 1WFYA 2W9BB 1C3TA 1XS2A 3B0YA 2KN4A 2RHFA 1NK9A 1L7MA 1T0SC 4XYCA 3RCZA 2VAOA 2P88A 4HVBA 3M6ZA 2ZZ0A 3H0LB 1ZQNA 1PVRA 5C0YA 2OQHA 3ZO5B 1DXSA 5ALEA 2DKXA 4PGXA 2G09A 3I9V1 4KPLA 2G0AA 3WK5A 2O3GA 3T5KA 4QIWC 3RJJA 1Z3EB 1ZQGA 5GMVA 4KDLB 1AROP 1SXTA 1DK2A 5AKGA 1WI0A 1TS4A 3WK9A 2AX5A 2ZVOA 1T3QA 4GDKB 3MKCA 3Q8FA 4UAVA 1WIAA 3ETRB 2FPKA 1WR1A 4I2HA 1E9MA 1UD7A 1V9JA 2MUTB 4RQ3A 2D3AA 2JU6X 3ZJUA 3R1ZA 4MEMA 3GY1A 2W3RA 2M4NA 4IW0A 5KFAA 2BWFA 4F5OA 1KKRA 3K9OB 1SB3C 3MZNA 4H1ZA 4TVYA 5KFVA 4IP5A 4QZAA 4BUGA 1FNVA 3DFYA 4E6MA 5AI9A 5J2HA 1M6IA 2XH2A 4MFFA 4ZCWA 4J9SA 3ISDA 4KX6B 1GREA 1MOKA 1YEYA 3FVDA 3C5FA 4Y2SA 2FUG1 2PMQA 2J0MA 4MEYA 4B9TA 4ZYSA 3B2FA 2KVSA 5ALOA 2XI9A 3RR7A 4J56A 4DHJD 5FXEA 4MSMB 4F4WA 2MBOA 1B4FA 3DDHA 2C7HA 3MTNB 4EQWA 2NPTB 4NM2A 7ICOA 4MGIE 5DGBA 4MDKE 3EJBB 3D2HA 3ZNID 1TT5B 2KHQA 3GDXA 5AM0A 2KC2A 3U7DA 5KFIA 4CF5A 2ZNVC 3M95A 4PS7A 2K1FA 1UF0A 4XQ8A 3HW8A 1ZYQA 1X66A 1DOXA 2DYOA 2PODA 2Y5CA 1ZQJA 1KH0A 2WU5B 3P1MA 1ZQHA 3PLUA 1DIIA 3PW5A 2WB1F 2LPEA 3AXCA 2QPMA 5U25A 2K4IA 5IIJA 4Q44A 2NBWB 1QKZA 3K75D 4YG2A 1IGDA 4W9CA 4JPSA 1Q1OA 1MNSA 3NZSA 2EZYA 3RD2A 1URJA 3VH4B 4ARIA 2KOBA 1FRRA 3ONNA 4H4TA 2YVCA 4LNOA 4N9F4 5L6GA 2GOLA 5E6OA 1J2MA 4IWOA 3EECA 1FIQA 2PEAA 2J6UA 3WKBA 4JB1A 1ZRNA 3HK0A 1WGGA 3FM9A 3RJHA 1SIJA 2K8HA 3F2DA 4RGNA 2WU2B 3I99A 1Q1WA 4GMVA 3SU8X 2GLEA 3R10A 3D2NA 2RMMA 1JPMA 2QDFA 2WXLA 3UI3A 4RNOA 3N1ZC 4KVGB 1MDLA 2MSNA 1X42A 2HI0A 4DL7A 2D11A 3AE5B 4C00A 4ZHOA 4GLXA 1T0RC 4HPNA 3UJSA 2XEWA 4H4RA 3R9KA 3M8RA 1SXEA 3U8ZA 4FA6A 4PVHA 5CWRA 5BYRA 3P2BA 2OG9A 1EWYC 1PVQA 2CR5A 4RPYA 4F2RA 3PSPA 2KNJA 4KGRA 3ZI4A 3AEBB 4JV2A 3IN5A 4IKGA 4IR1A 2J4XA 1AOGA 4IC9A 3L17A 1YQBA 4IG7B 4DS4A 2DBYA 2VH1A 3B9JB 4M6WB 3SI8A 1EC8A 3C8YA 4J9MA 3H8HA 5ALKA 3DFHA 3ZD9A 4IP4A 4CE6A 5HHHA 4QZHA 1IYFA 1G6JA 3TFRA 1WXQA 3DK4A 1ZGUB 4YTNB 3VDGA 3OAWA 1S0NA 2K8CA 3V3XA 4KMUA 1WXSA 4HKQA 2X8HA 4F5NA 4P2HA 2WP9B 5BOFA 3EW9A 5KFXA 2PLPA 5EE9A 3WALA 2I1KA 3MJWA 4NLBA 1MJDA 2MU2A 3MDAA 4WJ3B 1WF9A 4XUSA 2KD0A 4DHZB 2ASJA 4M0WA 4RU9A 2C3CA 3GV8B 2ZJ5A 1ZQEA 1WJ6A 1WXAA 2MBEA 1P48A 4OALA 2INDC 1LB2B 5I1WA 1WXMA 4G11A 3U30A 3QK0A 5CX3A 3DH9A 2K89A 4YCXA 3A9KB 3RNCC 1RPLA 1FEAA 3JSVA 4B0EA 3R7RA 2BPCA 2GL5A 3VQIA 4BBYA 2OFJA 1ZKQA 3RJ8A 5AM3A 2N9XA 5KFPA 1H38A 4P0PA 2XNAC 4HWIB 3RRHA 3N20C 1SWVA 1VLBA 9ICXA 3DHHC 2IOHA 2Z0DB 3TCAA 3NRZB 4LA1A 4EEWA 2WXRA 2KJ9A 1N60C 4BC9A 3PFRA 3VC5A 2WDVB 3AI5A 3DHIC 1BKHA 5EE3A 2H3FA 5L1MA 3C1ZA 3RB4A 1NK4A 2DPIA 1RXWA 2O6KA 3KD3A 2CDUA 4H4YA 4C80A 1E8XA 1FNUA 3ICXA 4C4VA 1LO5D 4H4WA 2LMRA 3BJYA 1PYWD 4JWMA 2BZFA 3DJGX 5KG5A 3PZ8A 2PGEA 2K4HA 1IGCA 3GOEA 2K9XA 3JPSA 4K1WA 2TSSA 1WGDA 2BYFA 5TR3A 4KITB 2QQ6A 4K7SA 3L16A 3D9XA 5AE3A 1SE3A 1L8OA 2VANA 3BQ0A 1DNCA 1SB3B 3NUQA 2G5IB 2LM1A 2MQJA 4YR2A 1V38A 2KX0A 2GBKA 3RNFC 3ZVVA 2PTXA 1LKYB 3C2LA 2YVJA 3HW2A 3PHXB 4RT2A 1Z4OA 3KHHA 1NYRA 3B0AA 2GQWA 5DCNA 1Y56A 3EFUA 1ZJNA 4LDTD 5D94A 1WRIA 1A76A 5A0LA 1ZQIA 1EC9A 5AKZA 5IDZA 3RNGC 1XLOA 1F0MA 3KVFB 5EWEA 3TBLD 2PTLA 4A9AA 1OQQA 3TFSA 3N32A 2D10A 3ZLZA 2OHFA 2N9EB 3AE7B 4OCZA 4M9JA 1UNSA 3M8SA 4JQ9A 4RNAA 4ELTA 1AQ6A 1NOMA 1NDDA 2BF8B 3Q8AA 4DEZA 2BC0A 3DK8A 2KTRB 3RJKA 2IOFK 5DG9A 1NHRA 3RJFA 1JWMD 4CYEA 2R8GA 4F8RA 2ZNVB 4IQVA 1SGHA 2JZPA 2ON8A 1OW5A 4OJ5A 5HMRA 3AQFA 3BQ1A 3TOYA 2MJEA 3X0WA 1S1QB 3BZCA 2KFKB 3P4PB 4LNFA 3TAPA 1TY2A 2Y5PA 2RD0A 3U7ZA 2M1MA 1Q1RA 2OQYA 3H7SA 3Q3FA 1WJUA 3PK7A 1TK8A 3AU4A 5ALDA 4DS5A 4IRCA 2N1VA 3DWGC 5JZEB 3DK9A 4WAAA 5BMIA 4NY8A 3VTWA 2UUUA 5KFKA 2XGPA 5AK3A 3PV8A 3EPIA 3UGVA 2ALZA 3C19A 5AE2A 4J9RA 1WG8A 5AKJA 5KT3A 2ZJAA 2NCNA 4S17A 4A3OA 1FD6A 4PWBA 4YMMA 5AKYA 2NRTA 4EQSA 5F9LA 2YB1A 2XK5B 4IWPA 1GUAB 1R4NB 1ZQTA 2UU7A 4DDID 1GPXA 1V1OA 2A1AA 4X57B 4R64A 5D79A 2AGOA 1XWLA 3C29A 1QTMA 5JCIA 3ZVHB 1E6EB 1X2GA 2MBBB 2IPKD 2DFLA 1JN3A 2KFZA 3EC8A 3IJQA 1HUZA 3VR8B 4CF3A 2HCFA 4PL2A 4RQ1A 4ECVA 2XY7A 1BNPA 1WGHA 3ZDTA 3S5SA 2IYDB 4OW0A 4F5PA 2JEFA 3KWLA 3FCPA 2R8IA 2BDUA 4DFDA 4CNQA 3SYZA 1LM8B 4DWIA 5DQHA 2R18A 3SDLC 1MUCA 4E8GA 5ALJA 2EMSA 2VJ5A 3QA8A 1HUOA 2JZBA 1QQRA 1JPDX 2X99A 2EKEC 2KK8A 1FFVC 1P7DA 1C76A 1SL1A 3WAMA 1E7PB 5BOLA 5EOZA 1E8FA 3V5CA 5DB6A 3N3KB 3V3WA 1LV5A 3L0WB 3GIJA 2WGSA 3PTFC 2W3SA 1XPYA 2VJ4A 5ALGA 3Q2AC 2HHSA 2KQ7A 3DDCB 2N9LA 4R3DA 5DPSA 2PTWA 4H4XA 4DN1A 4JK1A 4PYUA 2FCSA 2WXPA 2F8LA 2YTUA 5AKXA 3QU7A 2K8BB 4ED0A 4B9LA 3QWZB 3ZGZA 3Q6JA 1K50A 2KFNA 8ICRA 1J0GA 2IO0B 3VDZA 1UWMA 2M0XA 3H70A 4NL9A 5G5HB 4HG0A 3U52E 4TUUA 3LADA 4RNMA 4KTQA 3SQIA 4CDGA 1BGXT 4GU2A 2UVVA 3TACB 4J9NA 4OJOA 2PE9A 2IA6A 3K1ZA 3ZJVA 3LYSA 2BR0A 1ZQAA 3PT2B 1W1KA 2WXIA 5TISU 3KOOA 3JS8A 3U9IA 1JX4A 1YD8U 3RZFA 3K1GA 4NV0A 5LLIA 4JWNA 1JEHA 2PSNA 4X2PA 1DYQA 1C9FA 1NKBA 3H1UA 4B95A 4RNNA 3JVAA 4US8A 3RH5A 2JQRB 1T94A 3WKCA 4M04A 3K4GA 2PCEA 4DFMA 4FBUA 1N63C 1ECQA 3ZXRA 4W9KA 5AHXA 3QX7A 2IMWP 5CR0A 5CJ7A 2GBRA 2HXUA 1JMLA 1GESA 2KSOA 4W9GA 2JZZA 2HHWA 4USAA 2L05A 4EEYA 1TV9A 1XU4A 2B0CA 5EWGA 1YOVB 3N4FA 4W9FA 2HJ8A 2H3ZA 5EDSA 4PHDA 1WE6A 3IT4B 2KTQA 1RXVA 4J57A 3DG7A 5J17A 1PDYA 4C4RA 5J0WA 3BDPA 2EZZA 1JWAD 5HP4A 2V3SA 4DOAA 2WX0A 3R7QA 3UIPB 2N4FA 5L1JA 2PMZC 3MDCA 2JXTA 1KTQA 3KYDD 2WXMA 4JLCA 4OVVA 5J2AA 1GRBA 3H0MB 8ICTA 3CIRB 2MUCA 1GXFA 3ES7A 7ICNA 1D9DA 1PUZA 4AP9A 1J19A 5LXHA 3DIPA 3WA0A 3VC6A 2AL2B 3SAFA 1MC8A 4KX5A 3SEBA 1RYRA 5H8YE 1MBTA 3KHLA 2AXTU 3AE3B 3OC4A 1X6IA 3VTEA 2HQMA 4ICUA 4TQSA 1Q10A 2MJ3A 3RNEC 3UINB 4MMWA 1I19A 1UH6A 5J0YA 1JWUD 1NJZA 2QB1A 3GRSA 4J9PA 3V6KA 2N1WA 4BBNF 1ZUD2 2WXGA 2L76A 4GGHA 3BYTB 2R61A 1MG8A 1ZX9A 4WWOA 1BXTA 2RABA 4ZDVA 5KFRA 4ANWA 1KKOA 3L5OA 1QOFA 3DHGC 1EC7A 3T4WA 4A55A 4ECRA 1V81A 3C2KA 1ZQCA 2VZKB 1D8YA 1AARA 5KFNA 3WK6A 4MFAA 4FXCA 4BVUC 3T3FA 1F3PA 4DYEA 4MLAA 1S76D 3BINA 3NJTA 2RDIA 2A8XA 3CYMA 2DQNB 2Y0SF 4IL6U 2O2VB 3T79A 3PO0A 1F0XA 2HXTA 2W9CA 5L83A 2YMPA 4F4XA 2VA2A 1XLQA 3A4RA 1KKXA 1L2NA 1VCBA 2Y5BB 2JR5A 3QCAA 4BBNC 1FCCC 2JVCA 3A4SC 3P4RB 4M0XA 5IA7A 3LJ3A 4ACFA 2W04A 3TAQA 2BCQA 2VA3A 4II2B 2JXJA 4P4OA 2BQQA 3DGHA 1TFRA 1GB1A 1L3TA 1L7NA 4ZHPA 2AWTA 3TEWA 4IL2A 2ZIWA 3QAQA 2MX2A 4ITKA 2VA8A 3T3OA 5JCLA 2ZCBA 2P8BA 4W9LA 2RDJA 4EYHB 1X9WA 3O0HA 4KLOA 3S1FA 2NRVA 2KV2A 2HDOA 4FHKA 2P3ZA 2OX4A 2XH0A 1ESFA 1Z5SB 3TX1A 1BPYA 4I29A 3HHMA 1NI2A 1X2HA 1ZDLA 4J3ZA 2KLCA 5EE1A 9ICBA 2L3ZA 1L7OA 2QHOA 2LGDA 4C8NA 2KD1A 3UXPA 2LMCA 5H92C 1MA7A 1V59A 3VA8A 4B9UA 4M0AA 1PFDA 3UQAA 1GRHA 1ENFA 5ALZA 3VXWA 1NJYA 2F1JA 1IXRA 3NVWA 1RWSA 3VUYA 4EM4A 5KG1A 1A6SA 2IY0B 3DBHI 4GRTA 3R0KA 2DAFA 4ZRKA 3KJMA 3TCSA 1TK0A 4P7IA 3PRZA 5KG0A 2Y1JA 2P0IA 1DRGA 7ICIA 2KMCA 2NO4A 3CXBA 1W1RA 1XANA 3IC9A 2HHTA 5KL1B 2JHDA 4TUPA 4GGBA 1WM2A 1GEUA 5HMLA 1TAUA 4D2KA 4I2CA 4G3IA 2G5HB 4KEMA 3M6KA 3ALRA 4B9KA 3SD7A 4RFBA 5J2BA 3NVVB 3SQSA 1ONEA 4YD1A 4HCNB 4MKSA 1DGSA 1IUEA 2DX5B 2V4IB 4DOCA 3L3FX 1JOAA 4PGYA 2ZPYA 2H3QA 4KN7A 1JMSA 2XY5A 4OVUA 2Q4WA 4LZGA 3CW2C 3AV8A 2QAEA 2EANA 3QU4A 4A6GA 2GRIA 5IIIA 2PU1A 1NK8A 3H4BA 5IO9A 1RYUA 4ELUA 3HSUA 1N5WC 2FYMA 1L3UA 3ES8A 7ICGA 2MP2A 1EBGA 3CMMB 4BKSA 1K1SA 1N61A 2IDYA 5BMGA 3QEBZ 3B08A 1JDFA 1OJTA 4G7FA 4HPMB 3VFKA 3N7SC 2W7OA 1GV4A 3IFWB 4FO6A 3V7JA 1CMXB 5HG2A 1E8HA 1E5WA 4MF8A 5DG7A 2FJ6A 2NVUI 4A6QA 3F53A 2BBCA 5KT5A 3R66C 3PW2A 3K9PB 9ICRA 3ENLA 1MDRA 5CEHA 2KK0A 1I4XA 5FXPA 4H4QA 4UARA 3RR1A 3S47A 1L4DB 5J2CA 4KLMA 3GIKA 2AQ1B 1STEA 2KVZA 3H7PA 2J6SA 3SMVA 1XSNA 2INNE 2WAQC 4RF1A 5TSSA 4BOZB 1TZZA 3AULA 1FXIA 2W9BA 1OEYJ 3SAGA 1VZ8A 2VFTA 5AWVA 4J1OA 4TQRA 2KN7A 1KEJA 3GQCA 1ZQMA 1D5MC 2EMTA 2KMMA 2Q4TA 3RAQA 2PE6B 4NPNA 3P3BA 2DUYA 2J7QB 1CEZA 1KFDA 2WQYB 4LJPB 3APCA 4JQWC 2HE7A 4UB1A 4QWAA 5KFDA 7ICLA 5JH5C 5BYQA 1ZR6A 4F8CB 2N7JA 1XLPA 3EKGA 3QHTA 1TE2A 2G4SA 2K5PA 3TEZA 1P7EA 4KMOB 1C79A 3ZDMC 3ZVIA 5DBCA 2C2DA 1S3SG 4GDKA 4LK0M 4DHGA 1WWUA 2ZTEA 1S77D 2KX3A 5AZGA 4ZYNA 3M62B 2ZIXB 5KFOA 7ICSA 4TUSA 2MUTA 4Q8EA 4WJQA 5ER0A 3V5FA 2ZUCA 2OAIA 7ICVA 4Z6DA 4XA5A 4F2SA 4MGZE 2O56A 1HZ6A 4LIIA 2VIXA 4NLCA 1FPYA 1RYJA 4UAUA 3QLDA 4M00A 4WWNA 5HR6A 4DSFA 2N9KA 4H50A 3R8BA 2AQ2B 2QJLA 4WURA 1GO3F 2GWSA 1OQYA 5AUKA 3WAOA 1E0ZA 1DXLA 1ZQZA 5DPRA 4DO9A 2AU0A 2WPEA 4I2EA 2XBBC 1ZQ1C 1H6VA 1WX8A 3FJ4A 3B1LX 3KQ4A 2DW7A 4NY0A 2KG5A 2Z8LA 5ENLA 5FJRA 2YMQA 3DEDA 1M6YA 4GIVA 2PLSA 3VAWA 2FMQA 2YLMA 3ZDBA 4OVZA 4ZRQA 4PJ0U 2EAMA 3N97B 1U49A 2PVOD 2BS3B 1SJCA 1UA1A 4APNA 1QT9A 3EAOA 2Y1IA 2E1EA 1BQGA 2FAZA 2V3AA 3MP9A 2VFSA 3RAXA 3TKAA 2NPTA 3P4SB 1SWWA 2BKEA 2YVFA 5J0OA 3ISCA 2R8HA 4G9BA 2I1QA 5J8YC 2ZZBA 2GRTA 1FXAA 4IL0A 2DF4B 5FS6A 3NZUA 5J0SA 1KBUA 3AE2B 4PT5A 4Q45A 4QZBA 1BPZA 1R4MI 2KVCA 1NBFC 2RDGA 3PSIA 5CHVC 5AIBA 1VAOA 3OGUA 4PH5A 3MWCA 4RUAA 1RDFA 1ZD2P 4AYBC 2IGHA 3F5EA 2CHXA 3PWIA 3UJFA 3SV3A 1ZQVA 3W1SA 4O5EA 9ICEA 2ASDA 3N7RC 4RCOA 3PWGA 1B43A 1SE4A 2C22A 3SZ2A 3ZKJC 5HHZA 4PPXA 1GSNA 5EBKA 1SKSA 2PJHA 3O13A 3BZKA 1Z2MA 3WCQA 1ZW7A 1UXYA 3DBHB 3N9YC 2DNFA 3UF8A 3M9NB 2BCVA 3BYYB 1PDZA 4YSYB 2GB1A 1PK3A 3IHQB 5BO4B 2Z7JA 3BZDB 2ZTCA 5ALRA 3M63B 4DHJB 4AQ7A 3I63C 1WGYA 3PREA 9ICTA 1RLFA 5JRTA 4FJZA 1WYWB 8ICGA 4GDLB 4PYZA 3QN3A 4MGYE 4PYTA 2K60A 3S1CA 4LZDA 2YAUA 5KFWA 3DEEA 4ED3A 1H8CA 1GRTA 5KFQA 5ALIA 2WF5A 5KT4A 1SSNA 1YJJA 3I6EA 2INCC 2ODGA 3PSTA 1SJAA 1SV0A 1SBBB 3IJLA 3ED5A 1U48A 5L95C 2KIVA 2J6TA 3OSNA 2E3TA 8ICSA 1DOYA 5T14A 5ALLA 2MJDA 5IIKA 4PK1A 2E6XA 2DZMA 4FDCB 2ZIVB 1JALA 4JMUA 2GBMA 2HW3A 5JXVA 1WVEA 2FCMA 2CXYA 4II3B 3GIIA 2B76B 2ZVNA 4B6WA 1QLTA 4PS3A 4EUTA 3LVVA 3QXGA 4I2GA 2K25A 5KFFA 1S9FA 6ENLA 2YEPF 3LB8C 4JV0A 2DZJA 1FHUA 4E4UA 2RLTA 4C0ZA 3PX0A 3HILA 4K8GA 1TS2A 3WIMA 2GQTA 3AEVA 1JQ4A 3B9JA 4M6WA 1NK0A 5E79U 1TYGB 2FE8A 3ZRFA 8ICCA 3E56A 1A70A 1XCQL 3WKAA 3O0FA 5AZFA 2LJIA 2Y3SA 4LJOB 1P1AA 4KKJA 2BS4B 4WH4A 4ED7A 4E74A 2XH4A 4MM3B 2HMXA 3THVA 1T0QC 2I6XA 7ICQA 4FBJB 3P4QB 3VHTC 2V1YA 2NTTA 3RRAA 1J7CA 2IJ0A 3EA6A 2BYTA 3JPQA 1IG6A 3A9KA 2L8JA 1ECWA 4FE3A 4O5CA 2KO3A 4MGKE 3S1EA 3LLBA 1Z00B 2NTSA 5K8EA 3AB5A 2I5HA 2RDHA 3ZNGC 3UJ2A 4H4ZA 4HN8A 3HRDD 5IP4D 2M9NA 5L1LA 5FKAC 2JWZA 1ZMDA 3NRZA 1AYFA 5F9NA 1XLNA 4FLHA 3HUIA 1F44A 2FLNA 1LPFA 1WRDB 2AL6A 2N0SB 5ALMA 3L5KA 5HHIA 4QZIA 4I28A 3RJAA 2WP5A 2IO3B 2PIAA 3PY8A 4DXAB 3Q3NC 3ENEA 2KMDA 3PMNA 2JEIA 4R65A 3F2BA 4DSKA 2BKFA 1ZXHA 3HVZA 2ISPA 1P0RA 2NS5A 1PK1B 4ZOHC 2QIEB 1V1PB 5J18A 1GC7A 1KN5A 2IO1B 2XGZA 3URHA 4XDDA 1K4QA 1WYGA 2WB1C 4DOBA 4IT1A 1CJEA 4DQIA 4KLTA 3AMZA 2H89B 4JN7A 1GC6A 2EAPA 3GE3C 3V60A 1HJPA 2IZVB 4RMAA 4M47A 3IHPC 1E8ZA 1LKYA 3KTQA 4NLGA 1FFUC 1E90A 1RM6C 3UXOA 1PVPA 1ROEA 4DK5A 4KLLA 3H8JA 5AKIA 4P4PA 1KLGD 3LWMA 4KLIA 4QAYA 4FULA 3DVNV 2R2ZA 4W9DA 3MGVA 4KLFA 5IOIA 1LXDA 3V61A 1YT3A 2NQWA 4A20A 5DKWA 5J2KA 9ICGA 2DL0A 2LHEA 4O95A 3MFIA 3TSJA 3AH7A 2C28A 3DBLI 1ZQXA 4Q8FA 5BPCA 1DTNA 2OZ3A 2D3GA 4N59A 2K4PA 3MR2A 4EEKA 1KW4A 2WHEA 4KLGA 3DPDA 4IM0A 3QFAA 1PGBA 4BFRA 4HNLA 4E5TA 5KFBA 1HEZE 2KTRA 5IAAC 3R25A 5DB9A 2DLBA 5ALQA 4ELVA 2PMVA 2W55A 3DWMA 2A1JB 2W54A 3CGCA 5D49A 1LVLA 4KX3A 1NZBA 1L6NA 2SEBD 4HNCA 2IOFA 3NASA 1YIWA 3AU5A 9ICIA 2F1IA 1NNLA 1HIWA 1L5PA 2KFKA 1JROA 5D7GA 3Q45A 3ZDCA 1WM3A 3KZXA 3EPGA 2LBOA 4HROA 4KZ0A 9ICKA 3C1YA 2XCAA 4LDTB 4IHCA 1V2YA 1ZK7A 1D6EC 1YQ4B 3PVLA 3CAWA 2PXIA 3BIID 5JHBA 3HWTA 3Q14C 4K3BA 2AQ4A 4ED2A 4P1BC 4RF0A 4W9JA 3RNAC 1FEBA 2P4PA 5DDMA 1U4AA 4R66A 2QSDA 3UMGA 2D3BA 1KLVA 4GIRA 3W9CB 4BZAA 2KDIA 3C21A 2XK5A 4PZFA 2MSED 3R0UA 1Z4NA 5HR7A 3JZUA 1VD2A 2ONEA 2KANA 3ZUNA 3QUQA 5AKEA 1MG4A 3PNCA 2M56B 2E5SA 1SKRA 3ZVHA 3AL0B 1SL0A 4KT2A 1Q5WB 2CHWA 4CCHA 3VRBB 2IBIB 3QE9Y 1U9LA 1CQVA 3N30A 1V5OA 2AQ3B 1L7PA 3B2GA 3T5JA 4B9MA 2W9NA 2ZPNA 4RM9A 1ZXIC 1TYTA 1FNWA 2WDQB 3RUIB 4JV1A 2AKMA 1XEEA 5ALYA 2WPCA 1SEBD 3WKDA 4GXBA 1WXVA 1ISNA 9ICOA 2C7NB 1VZ7A 3M3JA 2PPHA 3PPAA 5AK4A 4DWDA 3QKEA 5KFLA 1QSYA 3HKZF 3N1XC 5IIMA 4ED6A 1W1MA 4PVEA 1S0MA 4IR9A 5AUIA 2AEHA 1S97A 5KFCA 2Y3RA 5KTQA 1QOBA 3RJEA 5AI5A 1UQVA 1ZMCA 2E8NA 3UQBA 1KFSA 1Q3VA 2K8BA 3FXGA 4GN1A 3I4KA 1TIFA 3VTUA 4E3CA 1UT5A 1NVID 2LGXA 1KCZA 2LXAA 5G5HA 3AECB 5JRBA 1PDXA 1AHVA 4I2BA 1W1OA 4JIOU 4PL1A 4NQKE 4R8UB 1JI7A 2L7RA 1I35A 1YQZA 4WQOB 2E8PA 1UUPA 1T8EA 4K3CA 3HKZC 2YEPB 1FCLA 5L1KA 1KF6B 2PI5A 2ZCCA 3GS2A 3SR6B 2DAJA 1W1LA 3C5GA 2PA6A 2G1EA 3BW7A 3RBDA 1EU3A 1T0YA 1VR9A 3HM6X 3RT3B 1NHQA 4L2YA 1ZETA 1ZP0B 3BWUD 5AI4A 4BDPA 4UB5A 3PM9A 5DBBA 1QILA 2GR0A 3TANA 2D8CA 3GO2A 3V7KA 2PLIA 5TZVA 2WPFA 4Y2PA 3DG6A 2OM6A 3H7IA 3V72A 2WXOA 5HQXA 2FCQA 3DEQA 4RQMA 3ZRCA 3SFEB 1N60A 3OHBA 3IG3A 1D3ZA 2MRLA 2FBWB 3E9SA 5AE1A 5EU9A 2HOQA 3BQTA 4GSWA 4XE0A 1YN3A 1ZQRA 3PO5A 2H3IA 1QOAA 3ZLHA 1XT9B 4P6VF 3OJSA 1F0ZA 3TSHA 2KFJA 4RGOS 3QFBA 4GYPC 2XC9A 2BPFA 3D2DA 2HBJA 8ICEA 4PS8A 2X8GA 1WCNA 4RQ0A 4RQ8A 4F1SA 2DGZA 5DLGA 5D6JB 2G9HD 3TEXA 1Z1VA 1ZQSA 2GQUA 4Y2VA 2ZEQA 2HVIA 1S0VA 2CKHB 3VVWB 3FW9A 5DBAA 4YN4A 1TVAA 2L0TA 2C5LC 3Q3MC 4ANXA 1K5OA 1TY0A 2PI4A 1R6WA 2YN4A 1MFWA 1X1MA 2RSUA 1XNSA 5F3XB 1TZ1A 2F44A 4GFJA 2BPSA 4JWUC 3CGEA 4HCHA 3IAM1 2PTYA 2AL2A 4UATA 3D2SA 1RM6B 4XLOA 5JUMA 4ARCA 1D7YA 3DBLB 4F92B 1TK5A 2QKQA 1CZPA 4JDRA 2VH2A 1U4BA 3MSYA 2F3NA 3O65B 4IQTA 1C78A 2JWUA 8ICXA 3ZLFA 2O6VA 2PP0A 1ZDVA 4HRSA 4UB6U 1UELA 2PU0A 3OZMA 4KLUA 4KKIA 1D5ZC 2P6UA 2Z0EB 5KG2A 2HD5B 1KJTA 3TJPA 1KM7A 5AM2A 5CP2A 2ES6A 2BGFA 3H4DA 4RM8A 2GI9A 1XQQA 2ASLA 2L0FA 4RPZA 1F8WA 3KUDB 2M19A 1NJXA 3P0WA 2WDWA 2LFIA 1T4GA 2AGPA 4KLSA 3PX4A 4HPPA 3QUCA 2O2VA 2LWPA 4I6LB 3DVGY 1QZEA 4X5VA 2GSHA 5CTRC 3NVYB 3KLJA 2FI1A 2FIDA 4KGTA 4JHMA 3SN0A 1SJBA 3TMPB 2YB4A 1E8GA 4TMAB 4YP3A 3OPXA 4FJVB 4DQOC 4YL8A 4GISA 3SN1A 3TADC 8ICQA 1KLNA 3SD5A 4UQGA 4GMEA 2K22A 4C4TA 4DCCA 4F50A 1XSLA 1ZQPA 2BYEA 2KQSA 4OJLA 4LLGM 3UJRA 4EM3A 1SE9A 4YSXB 4AP4C 3EUB3 4RQ4A 1WX7A 3JW7A 4ED1A 1ZD5A 1M4VA 3V6CB 3L8KA 1DGJA 5D4BA 1NDAA 3N6JA 1X40A 5J29A 1A0PA 2ASQA 5KG3A 4B9SA 1QQ7A 2FDRA 2GLSA 4MJSB 1E10A 4YR0A 4Y2JA 1FEZA 2F8KA 1V80A 3KBBA 1NELA 3BQ7A 1OGWA 4XWTA 4MFCA 4Z6CA 3L54A 4F5RA 1SZPA 4G3XB 5DQIA 4IQUA 1N48A 1IBXB 1ZQKA 3TEYA 2D3DA 2ZG6A 2HBKA 5ALNA 4GC6A 2L5YA 1FFVA 1ZD4A 4JB3A 2EAOA 3ISBA 1MPEA 2OWOA 2CU3A 2E5AA 4C8MA 2DZKA 1TJEA 2OJRA 2Y4GA 5IKCM 1XXGA 3D32A 4YVZA 2WF7A 4BV6A 3M7DA 2JMGA 2PTZA 3BQ2A 3V05A 2KIWA 4MF2A 4EZKA 3H9DA 3QARA 1ZQYA 3NVVA 3ZQ4A 4HJKA 1NI3A 2WDTB 2ISOA 4J9QA 7ICFA 2QVHA 1PUTA 2EELA 2O6VB 1N62C 4F91B 2JY6A 4FP1A 1QLBB 5L6FA 5FXDA 3C0RB 3IP4B 2BQ3A 1CUKA 3W2DA 3H4KA 3UXNA 1TAQA 3SV4A 2RDBC 1ZPSA 3U2SC 3DQVA 3A9JB 4RGMA 1H2IA 2DHZA 4YQWA 3TTEA 3T5LA 1JRPA 5C5JA 3AEEB 2VFVA 2CN1A 3L13A 3MQTA 3RBEA 1I4HA 4DNSA 3VCCA 4F4RA 3GZFA 5FXFA 1V86A 3H8AA 2MH7A 4EZ9A 1YX5B 3UQ0A 2PFPA 2ZUBA 4XGAB 2KZZA 1HE8A 4YMNA 2M0AA 5C23A 4AS1A 2MBQA 1KL9A 1C4AA 5DGAA 1KFYB 3SENA 1WE7A 1N63A 4OZAA 2GGGA 1Y88A 5KG4A 3WKEA 3T9LA 2NR2A 4ZA0A 3JYUA 2KICA 1E7VA 2YVSA 1I42A 3NS1A 1IIPA 3DGBA 4I27A 2KAJA 4RUCA 3QZ8A 3UIOB 1KD0A 7ENLA 1T5XD 7ICRA 2MW5A 1QLUA 1RFAA 3EF6A 3GRTA 2KJRA 4AOFA 3W5VB 2Y0SC 2LHDA 5KFZA 1EWCA 2ACZB 1WMHB 3OJ4B 5CB1A 4K2SA 4IDIA 1D4BA 2ZZPB 3D2JA 7ICKA 3KUMA 2LI6A 5ALTA 2K39A 3BK1A 4PVKA 2ZADA 2EZXA 2YVGA 3MBYA 2ONQA 5GXGB 5KVIA 4DWFA 1RVKA 1FEHA 3NS8A 5DQGA 3SAHA 3RJIA 2JH7A 3T5HA 4UB8U 2WX1A 1QQ6A 3AE6B 3KWVA 2AL1A 4EYIB 4NAMA 4QWDA 2BWES 4QWEA 2ZUDA 1SJED 3MFGA 5CRXA 8ICIA 3UCCA 3U26A 2KOXA 4DHZE 2M8SA 4ZRJA 4GXIA 3Q8QB 3TUOA 2KHWB 3RFZB 3JPPA 3P63A 2YQEA 3MHSD 4M02A 5HKHA 1UHUA 1RYSA 2ZIXA 2J52A 2IPIA 1WWVA 3KYCD 2HHVA 3CWIA 3H12A 2HSZA 2MLBA 2HJ1A 1J97A 4FZLA 2WXQA 4H4VA 3ZJTA 3JPRA 4EMIA 1YJ1A 1I7HA 5C2TB 4NAWB 4H4SA 1QH9A 1NKEA 1MQ2A 4K4IA 1OUQA 2G4DB 1KSPA 1HTOA 1NK5A 1K53A 3HRDC 4K8DA 1AW7A 5BOEA 2K0PA 3I76A 2KJ6A 8ICYA 2YY6A 2KJ8A 2EXRA 2AGQA 2BYVE 2DZIA 3H7VA 2GGJA 8ICVA 5L9XA 5CHGA 4TQ1A 2VFUA 4J03A 4Y2TA 3ML9A 2OZTA 5FJPA 4PHPA 4HDQA 7ICEA 1WVFA 3ALBA 1NEKB 4F4ZA 5FMHA 4ACOA 1YNTE 2X8CA 1BPBA 4BXOB 3VRAB 2DW6A 5J0TA 1WWTA 1GJZA 3IG5A 2KDFB 1X2IA 2CHZA 4LTUA 3BS7A 3V6EB 4EZJA 7ICUA 2HBMA 4OD0A 2UVWA 4A3PA 2KJ5A 4US9A 3Q8CA 5AK6A 1C20A 5JCMA 3DBRI 1IV8A 4HJGE 2OKTA 2QB0B 3EEZA 3RPFC 2W03A 2KDBA 4TQ0A 2BCPA 3PW7A 2L52A 5G55A 1AWDA 2DYMA 5AEKB 5IILA 2KWVB 2WHIA 1GNUA 3NS1B 8ICMA 1L6VA 3LK9A 4BX9C 4MSQB 2V3BA 3NO1A 3K1RB 3RH6A 7ICJA 2GMIC 2KNBA 3W5UB 4HAIA 4ECWA 2J0KA 4CHKA 1F77A 1FHVA 1OFFA 4TV3A 4NLZA 3FWAA 4F7ZA 2P3HA 3JPTA 5ALXA 4DQRA 3PZDA 1UA0A 3M9OB 1X9XA 2JXXA 4RQ6A 2VFRA 3UPQA 5DLFA 4F4YA 2BS2B 5JU5A 4ECZA 2X50A 5AM4A 5CHFA 3IDWA 3FKYA 4H2HA 4PVJA 5JCKA 1SXDA 3NY5A 1J8CA 4C8LA 5J2JA 4CO7A 3TARA 3CYJA 3HPFA 3C23A 2BT6A 5AI0A 4GDLA 4N6EB 2OCEA 2C2RA 4W9EA 5ALUA 2LASA 3S6JA 3V6JA 3QX1A 4UAYA 3CF6E 1VJ5A 3OTQA 1GG3A 4Z6EA 1MHHE 3Q3OC 3H40A 4FS1A 4EFOA 1EBDA 2PFQA 2KWCA 2V9WA 2P66A 3AEDB 4PZNA 2WXJA 3W8XA 4ED8A 3KKAC 2LRWA 3DOWA 1HA5A 1Q8KA 2ZIVA 2LRUA 5U1OA 3OLMD 1M94A 4E4FA 2LKYA 4F93B 4DSLA 2LUMA 2L83A 3VC8A 2G45B 4Y2RA 4JUZA 1BZLA 2FLPA 4L1BA 3D47A 4FX9A 2LYBA 5D3DA 4FZNA 4E0DA 1TKGA 2FE9A 4DXKA 2OXOA 9ICNA 3RMKC 3WANA 1N5WA 4GXKA 1EXNA 3H8WA 2UVUA 1JIHA 3IXSA 2KC1A 2BHNA 3VCNA 1XDIA 2QCZA 2B3AA 1COOA 4G50A 4OJPA 4P0QB 3TL5A 2GR2A 3R11A 4K7ZA 4ICAA 1V8CA 1B22A 4BKGA 4XX5A 4PGQA 4QW9A 2B6GA 1NKCA 3V6HA 4GOCA 3G6XA 5I1VA 3APDA 1N2XA 2MA1A 4RQ5A 4KLJA 1W1SA 4FZMA 8ICKA 2OJWA 3BY4B 1WX9A 4MM3A 4C7ZA 4DFJA 3GP7A 2HHXA 4NJCA 3G6VA 3DV9A 1JWSD 2KN5A 2X38A 3PW4A 1MHXA 2MNRA 2QJNA 2SAKA 2BW2A 2DWQA 1YMHE 2JSVX 3ONSA 1T3QC 1WUFA 3N4EA 4O9MA 4KDIC 4EBEA 8ICUA 4K7UA 3TIXA 3TJIA 4BURA 2N7DA 4G0NB 2RRDA 5AI8A 1Z00A 3MC0B 2A4ZA 2A5UA 2JZ3B 2XY6A 1P98A 1ZDXA 3RULA 2KQ4X 2PS2A 2A19A 2RDXA 3QU5A 2WBAA 3A1QB 3AEAB 1OXJA 5KT7A 9ICPA 2WOVA 3CK5A 3CRXA 3QIJA 5ALFA 4R63A 1ZQBA 3HX0A 1ZY8A 3W8WA 4F4KA 3PLVA 1KLUD 4O3NA 3G6YA 1U47A 3X23A 2W9MA 4QZ8A 4M9NA 4EE2A 3EUB2 1XSPA 4B0MA 2WYQA 3UXKA 3VUXA 1BPDA 1OEYA 1LQBA 4MEXA 5KFMA 3MC9A 4M9GA 4M8NA 1PK1A 3JPNA 2IBKA 5FJUA 1K1QA 1V1PA 3ECIA 4IUMB 3JW0X 4MACA 1X6JA 2F1HA 4KIKB 2WOIA 1HZ5A 3P42A 3UJEA 3KHRA 2FKPA 1B1ZA 4IC7B 4QIWF 1A77A 5H2FU 3RITA 2LEKA 2W82A 7ICHA 4Y2XA 5KG6A 9ICQA 4WIPA 1ZJMA 2N7EA 1W1JA 3A7UA 1QCKA 3N7PD 2CHRA 1I4PA 4QZDA 1UBIA 2IGGA 2MBRA 1Z1BA 3RH4A 2ZW1A 5J0PA 3NVZB 2JRIB 1MRAA 1OTRB 1TBEA 3GU3A 3IBEA 2QARB 1VDVA 2MAXA 2BGWA 3BVGA 1ZQWA 2WXFA 3RB0A 3QJZA 2HZGA 2Q5WD 3HM3A 4EELA 4A8EA 1KRHA 4EX7A 2FMPA 2HTHA 4OZBA 3DQ0A 1SZHA 3P93A 3BS5B 5J8YA 2JEGA 4O3RA 1MI0A 3DBRB 3CSTA 4LCDE 2XH7A 3KZIU 3LDZE 2A1JA 1BPXA 4BKSD 4JX1C 4FADA 3H0RB 3IAS1 5KHOA 2HTME 3ZNZB 2CJOA 1WJ4A 1PQSA 2GDQA 1ONFA 1TKYA 4EOYA 4YWSA 4TURA 4LNKA 1CRXA 1P9DU 5C1ZA 3NZ3A 4NZLB 2OEDA 2GBJA 1GETA 8ICLA 3UXLA 1RQNA 4Z6FA 1ZQQA 3M1YA 3F2CA 1WSPA 5FJOA 4M6UA 1CI4A 2KYWA 5BOMA 4KV2A 3AU2A 2QMTA 1DOIA 3BVMA 3URYA 4CQNA 1YN4A 3WK8A 3OPSA 2ZJDA 1TE6A 2WXKA 4M9HA 1XHCA 2R2OA 1O03A 4QZFA 9ICVA 4BWMA 1BT0A 2KWDA 4W9HA 3PQBA 4ZH4A 4DL6A 4JWSC 1LVHA 5CA7A 3C28A 4XZ4A 4Z17A 3LAEA 3KH0A 2NBVB 4CRXA 1EF5A 2MHJA 2MEKA 1I4RA 4QJFB 3FW7A 4IM3A 4RPXA 1YN5A 1D9FA 3D46A 3POPA 4GXJA 2QLTA 3SEIA 1QOGA 4HYKA 1ZE3D 1L7YA 2LUEA 1NHPA 1PZNA 2BTEA 3FC4A 1TS5A 4K1RB 2ZIUB 4OHJA 1C4CA 4UBBA 3LXFA 3AM9A 5FR6A 2NYVA 2JGAA 2ICIA 4YT0B 1J2NA 1SF0A 3VR9B 4BAXA 4C8KA 4WQMA 1AHZA 4F3OA 1MO9A 3GV5B 5JTIA 2KT7A 1SE2A 3HVDA 4MH8A 4CF4A 5KFUA 1ZQDA 2H88B 3LB8A 3FILB 2J42A 3FDSA 3QZ7A 5FP0A 4QW8A 4QZEA 3SHQA 3T3NA 2G07A 3GB1A 5KT2A 3MGIA 5IINA 4MH0E 4LJXA 2OVLA 2WNMA 4W9IA 1XF5L 3Q69A 3JVZX 3ZDEA 1W1QA 3F5AA 4RQ2A 3HJEA 1XCTL 1Q46A 2JF5A 5FS7A 1ELSA 1X9MA 4UAZA 5GTIU 1RRBA 1R4NI 4R8UA 3HIZA 2W7PA 9ICCA 4LNNA 4BOSC 1DIQA 3SR6A 4H4PA 1DK3A 2D6FC 5DB8A 1NYQA 2PFNA 1FMAD 3GE8C 5AK5A 1UGMA 2R9ZA 3T6CA 2MRPA 1L8LA 1S0OA 5KNIA 1F5SA 4DLGA 4ECQA 3AEGB 3ZW3A 1L3SA 3OJUA 4DSIA 4QZGA 1R4MB 4M8MA 3OW1A 3PHWB 3TQPA 4H83A 4NM1A 3PSFA 2AXRA 2FNJB 2CS4A 3VCBA 1EO6A 4KLDA 1JRUA 4EBDA 2HBLA 3ORYA 4DL4A 1J7AA 1L0VB 2CFYA 1NK6A 1T7PA 3J9CA 4TVWA 4QZ9A 2G08A 4UW9A 5KT6A 3OG5A 3ZYYX 3GILA 4EMJA 8ICBA 4NEVA 2JUOA 4EZ6A 1NENB 2LM4A 2Z59B 4NXZA 4F71A 2WTFA 3AE9B 4ADWA 4ANUA 5C3JB 3DESA 4M01A 4FBTA 1WCLA 3D2QA 2N1RA 1WUEA 2XCPA 2W8KA 4QNLA 2RQ5A 1KRPA 4DQQA 3L08A 3KLSX 5T8IA 4YSZB 2PP1A 5G5GA 5GRTA 3Q8RB 4EQXA 1HEKA 4ICVA 5KL8B 2BCSA 1C77A 4KLEA 2BB5A 1KQQA 3AU6A 2JYEA 4NJ8A 1ZQOA 4C8OA 1NHSA 4RZRA 4M2YA 2EDUA 3IM1A 8ICNA 1XO3A 1AHUA 2DENB 2J0JA 1FFUA 3OWEB
chains in the Genus database with same CATH topology
3AV8A 1M4VA 2GRIA 1SXTA 1DGJA 3FW8A 4MT5A 1TS4A 2AX5A 1ET6A 2D5GA 1N5WC 2Q85A 3HSUA 3FAHA 1T3QA 4GDKB 1OQRA 1E10A 3Q8FA 1GAQB 3ETRB 1N61A 2IDYA 1E9MA 5BMGA 3ZJUA 2JU6X 4XWTA 1FRDA 2W3RA 2J53A 1SB3C 5HG2A 1IBXB 3TEYA 3L4PA 1E8HA 3C0PA 4TVYA 1FFVA 4A6QA 1FNVA 3U4EG 2BBCA 1MPEA 1K51A 2QILA 2CU3A 1RFKA 2E5AA 5EE0A 1TJEA 4KX6B 1XXGA 1I4XA 5FXPA 1FIQB 5AE1A 2FUG1 3NVYA 3V05A 1L4DB 1YQ3B 2AQ1B 4ZYSA 1STEA 1L0YB 3B2FA 1AN8A 2INNE 5TSSA 4RF1A 4UD8A 5FXEA 1J7BA 1FXIA 3NVVA 3ZQ4A 1BMLC 1NI3A 1VZ8A 4N58A 2VFTA 5AWVA 1PUTA 2KMMA 1D5MC 3D2HA 2EELA 3S1DA 1N62C 5L6FA 1QLBB 2WQYB 5FXDA 4BCAA 2CJNA 3W2DA 5BYQA 4WWMA 1ZR6A 2N7JA 1XLPA 1ZPSA 3U2SC 2K5PA 3TEZA 4RGMA 1P7EA 2DYOA 1C79A 1DOXA 1JRPA 2WXNA 1KH0A 2WU5B 2Y5CA 3AEEB 3P1MA 1I4HA 1YJIA 1UGJA 4LK0M 4OZCA 2VFVA 4DNSA 2QPMA 5FXFA 2BVFA 2MH7A 2OAIA 1QKZA 1ZXIA 5G5GB 1HZ6A 1IGDA 2M0AA 4JPSA 4AS1A 4ZOHB 1C4AA 3BVZA 1KFYB 4OZAA 1RYJA 1N63A 5FR3A 1IBXA 2N9KA 2L1AA 2AQ2B 2QJLA 4RGTA 4WURA 5AUKA 3R8BA 4ARIA 1E0ZA 1FRRA 2YVSA 1I4QA 4TSSA 3NS1A 2V0GA 3Q8EA 2KAJA 1T5XD 2JX5A 5E6JA 5L6GA 1QLUA 3KQ4A 1FIQA 2Z8LA 3W5VB 4JB1A 3DEDA 2PLSA 2LHDA 2ACZB 1EWCA 2UUVA 4OVZA 4IDIA 4ZRQA 2PVOD 4RH6A 1D4BA 2BS3B 2LGIA 3D2JA 1SIJA 1QT9A 3BK1A 4RGNA 2WU2B 3I99A 4PVKA 2WDRB 3MP9A 2VFSA 2RMMA 2ONQA 3P4SB 5GXGB 2WXLA 3UI3A 1FEHA 2V3NA 3AE5B 4ZHOA 1DIIA 1FXAA 4PVHA 3KWVA 4H2AA 3AE6B 5BYRA 3AE2B 4NAMA 4PT5A 5FK9C 1EWYC 1SJED 1P7FA 3MFGA 4KGRA 2I2YA 1ZOYB 1HQRD 2RDGA 3AEBB 1JCKB 1VAOA 1DZNA 4IKGA 2J4XA 2IGHA 3TUOA 3RFZB 2DBYA 3B9JB 3W1SA 3P63A 4BC7A 4RCOA 3C8YA 1SE4A 3H8HA 2J52A 5HHZA 2IPIA 1UWXA 4JAYA 3CWIA 1WXQA 3O13A 1GB4A 4YTNB 3V3XA 3WCQA 1MBBA 4Q2JA 4HKQA 3MHZA 3N9YC 2WXQA 4HEA1 1UXYA 3ZJTA 3BYYB 2WP9B 4YSYB 1I7HA 2GB1A 2PLPA 4NAWB 4L23A 3BZDB 5EE9A 5C2TB 1VZ6A 1ET9A 1K52A 4AQ7A 1L4ZB 2WXHA 1WGKA 4M0WA 1K53A 3HRDC 4OALA 1AW7A 5I1WA 2K0PA 4GDLB 4PYTA 3S1CA 2EXRA 4B0EA 1HXYD 1SSNA 1YJJA 4TQ1A 3VQIA 2VFUA 4BBYA 3RJ8A 1WVFA 1SBBB 1NEKB 4XDCA 1YNTE 3W8ZA 4KGSA 2XNAC 3VRAB 2E3TA 2JYTA 1DOYA 1VLBA 1WWTA 2MJDA 3NRZB 2Y4GA 2E6XA 1ACCA 1N60C 1JALA 2WXRA 4LTUA 4BC9A 5JXVA 1WVEA 4C7YA 2WDVB 1EU4A 2B76B 5EE3A 1QLTA 1PGAA 4US9A 3Q8CA 4HJGE 3RPFC 4C80A 1BUIC 2YEPF 1FNUA 3LB8C 3LYYA 4TQ0A 2L52A 1LO5D 1AWDA 2DYMA 1PYWD 5BMHA 2KDMA 1TS2A 2GQTA 3NS1B 1L6VA 1JQ4A 3PZ8A 3B9JA 1IGCA 1TYGB 3W5UB 2FE8A 2Y3AA 2K9XA 1TKEA 1F77A 3AE1B 1A70A 2TSSA 1OFFA 1XCQL 3E56A 4UDUC 3FWAA 1JWBD 2P3HA 2LJIA 1SE3A 5AE3A 1SB3B 2Y3SA 2VFRA 4KKJA 2BS4B 4WH4A 2BS2B 4MM3B 1NYRA 4WAFA 4REZA 1Y56A 4PVJA 3Q8BA 1WRIA 3P4QB 2NTTA 1J7CA 2BT6A 2IJ0A 3EA6A 4N6EB 1XLOA 2BYTA 1TZOA 2PTLA 4A9AA 1OQQA 3LLBA 5D3IB 3S1EA 1MHHE 2NTSA 2OHFA 4YTMB 5K8EA 3AB5A 3AE7B 1UNSA 2RDHA 4RNAA 2BVHA 4JE3B 3HRDD 3AEDB 3Q8AA 1N5XA 2WXJA 2BB6A 5FKAC 3W8XA 3NRZA 1AYFA 1XLNA 1C4PA 1HA5A 3HUIA 1JWMD 2LUMA 3TSSA 5HMRA 2ON8A 2L83A 1L0XB 2JZPA 2N0SB 4L1BA 2MJEA 4EC3A 3P4PB 5D3DA 1TY2A 1TKGA 2Y5PA 3U7ZA 3RJAA 2PIAA 1N5WA 1CK1A 1ZXHA 3HVZA 3DWGC 3IXSA 4ZOHC 2P13A 2QIEB 1V1PB 4O1NA 4XDDA 5BMIA 1V8CA 1WYGA 2UUUA 1CJEA 2H89B 3AMZA 5HHDG 5AE2A 5I1VA 1FD6A 4PWBA 1W1SA 4P16A 4C7ZA 3GP7A 1FFUC 4NJCA 1GPXA 1RM6C 1JWSD 1V1OA 1ROEA 1KLGD 2X38A 5D79A 1MHXA 2XN9C 2R2ZA 2SAKA 4ZRPA 2BW2A 1E6EB 2DWQA 1YMHE 2JSVX 1T3QC 3GSYA 1X2GA 2IPKD 2NQWA 2LHEA 4O95A 3TSJA 1N61C 3AH7A 3VR8B 4N59A 2QKNA 3MC0B 3AE4B 1ZDXA 4OW0A 2KQ4X 3KWLA 1PGBA 1VJKA 2IGDA 3AEAB 1B9RA 1HEZE 5ADZA 5HFYA 2BVGA 2DLBA 1QQRA 2PMVA 2W55A 3DWMA 1FFVC 2W54A 1N62A 3W8WA 1C76A 5LNK1 1E7PB 1KLUD 2SEBD 1E8FA 1L5PA 1JROA 5D7GA 4EE2A 2W3SA 3EUB2 1JW9D 4HROA 4B0MA 1FM0D 1L6UA 4R3DA 2N9LA 2WXPA 3ZGZA 1V1PA 2VZKD 1D6EC 1YQ4B 1K50A 4MACA 4A8XC 3BIID 2EKIA 1UWMA 2P4PA 4RF0A 1HZ5A 3P42A 5G5HB 4HG0A 3U52E 1B1ZA 3ABVB 2QSDA 1TS3A 4PWCA 2LEKA 2W82A 3A7UA 3W9CB 1W1JA 4WIPA 3R2IA 4PZFA 1PGXA 3BK2A 1I4PA 3ZJVA 2MBRA 2IGGA 1W1KA 2WXIA 3JS8A 4ML8A 2M56B 2ZW1A 5HI1A 3IT6B 2I0KA 3NVZB 1DYQA 1C9FA 3VRBB 1VDVA 4DXGA 4US8A 3BVGA 1CQVA 2JQRB 2AQ3B 3B2GA 2WXFA 3AN1A 2Q5WD 1ZXIC 1FNWA 1QF6A 2WDQB 1KRHA 4OZBA 3DQ0A 1N63C 1MI0A 5I4DA 1XEEA 1FO4A 1SEBD 4JX1C 3IAS1 1VZ7A 2INPE 2HTME 1JMLA 2CJOA 3R2TA 2I38A 1TKYA 4USAA 1W1MA 1MVKA 4PVEA 5AUIA 4XWWA 2Y3RA 1QOBA 3NZ3A 1F2RC 4NZLB 2OEDA 3IT4B 3AE8B 1T6BX 5BYSA 1WSPA 1NVID 1JWAD 1F2RI 2RPVA 2JXTA 4J3OD 2WXMA 5G5HA 3CIRB 2QMTA 3AECB 1DOIA 1PDXA 3BVMA 3URYA 1YN4A 4CQNA 1AHVA 1W1OA 2Y08A 3NUHB 1SJHD 1UUPA 2WXKA 2YEPB 4IOIE 1KF6B 1FCLA 3SR6B 3GS2A 1W1LA 3SEBA 3A7RA 2KWDA 5H8YE 4C56C 1MBTA 2G1EA 2L32A 3AE3B 1EU3A 3BW7A 1VR9A 3PQBA 4JWSC 4L2YA 1ZP0B 3BWUD 4A90A 3VTEA 1Q10A 2MJ3A 3LAEA 3PM9A 3NVZA 1I19A 1QILA 1JWUD 1VQZA 2MEKA 1I4RA 3FW7A 1YN5A 2PLIA 3POPA 1V97A 1QOGA 1ZUD2 2WXGA 1ZE3D 3BYTB 2R61A 2BTEA 2PKOA 1BXTA 3FC4A 1TS5A 2KACA 2WXOA 4OHJA 5HQXA 1C4CA 1QOFA 3LXFA 3AM9A 1EM7A 1N60A 2ICIA 4YT0B 3SFEB 1SF0A 2FBWB 3E9SA 2VZKB 3VR9B 4A55A 3NVWB 4WQMA 1AHZA 4XE0A 1VRAB 1YN3A 1QOAA 4FXCA 4MLAA 4P6VF 3ETRA 1F0ZA 1E0YA 3TSHA 4RGOS 1SE2A 3HVDA 4MH8A 2H88B 3PO0A 1F0XA 3D2DA 3SFDB 2R8DA 3FILB 1XLQA 2J42A 2WS3B 3T3NA 3GB1A 2G9HD 1FCCC 3P4RB 3TEXA 2ZW0A 2WNMA 2QEJC 2GQUA 1XF5L 4HKZE 3Q69A 3FW9A 1HSKA 2WLBA 1W1QA 1I4GA 1GB1A 1XCTL 1TY0A 4ZHPA 3TEWA 3R07C 5MPOA 4JWUC 4ITKA 2K3UA 3T3OA 3IAM1 1DIQA 3SR6A 2HDEA 1RM6B 2RK5A 4XLOA 1NYQA 1FMAD 4YXDB 4ARCA 3S1FA 1GOZA 3AEGB 1ESFA 1CZPA 3TX1A 2NMQA 1D5XC 3I57A 4DXFA 2AXRA 1X2HA 1C78A 2PW9A 2JWUA 5EE1A 3EGRA 1ZDVA 4HRSA 2PVGC 1L0VB 1D5ZC 1J7AA 2LMCA 1KTKA 4KKIA 3J9CA 5H92C 4TVWA 3ZYYX 1PFDA 1ENFA 3NVWA 1RWSA 2GI9A 1NENB 3AE9B 4YTPB 2V3PA 3AEFB 2M19A 3KJMA 5C3JB 2WDWA 2LFIA 3A7AA 3PZ7A 1R7SA 3FILA 4YWGG 1W1RA 3NVYB 4GLSC 4YSZB 3KLSX 4KGTA 5T8IA 5G5GA 3MJ5A 1E8GA 4TMAB 4D2KA 1C77A 4DQOC 2BB5A 4RFBA 3NVVB 2KN4A 2JYEA 2VAOA 1IUEA 2K22A 2V4IB 1AHUA 1XO3A 3I9V1 4LLGM 4YSXB 2Q4WA 3EUB3 2O3GA 1FFUA 3OWEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV8 A;  1DGJ A;  3FW8 A;  2AX5 A;  2Q85 A;  1N5W C;  3FAH A;  1T3Q A;  1OQR A;  1E10 A;  1GAQ B;  3ETR B;  1N61 A;  1E9M A;  1FRD A;  2W3R A;  1SB3 C;  1E8H A;  3C0P A;  3L4P A;  4TVY A;  1FFV A;  2CU3 A;  1RFK A;  2E5A A;  5EE0 A;  1TJE A;  4KX6 B;  5FXP A;  1FIQ B;  3NVY A;  1YQ3 B;  3B2F A;  4UD8 A;  5FXE A;  1J7B A;  1FXI A;  3NVV A;  1NI3 A;  4N58 A;  2VFT A;  1PUT A;  2KMM A;  3D2H A;  3S1D A;  1N62 C;  1QLB B;  2WQY B;  5FXD A;  4BCA A;  2CJN A;  1ZR6 A;  4WWM A;  1XLP A;  2K5P A;  1DOX A;  1JRP A;  2Y5C A;  2WU5 B;  3AEE B;  3P1M A;  1DII A;  2VFV A;  4DNS A;  1YJI A;  2QPM A;  5FXF A;  2BVF A;  2MH7 A;  2OAI A;  1ZXI A;  5G5G B;  4ZOH B;  1KFY B;  1RYJ A;  1N63 A;  2QJL A;  1E0Z A;  5AUK A;  2YVS A;  1FRR A;  3NS1 A;  2KAJ A;  2JX5 A;  1QLU A;  1FIQ A;  3W5V B;  4JB1 A;  3DED A;  2PLS A;  2ACZ B;  4IDI A;  2PVO D;  2BS3 B;  3D2J A;  1SIJ A;  1QT9 A;  3I99 A;  4PVK A;  2WU2 B;  2WDR B;  2VFS A;  3P4S B;  5GXG B;  3AE5 B;  4ZHO A;  1FXA A;  4PVH A;  3AE6 B;  3AE2 B;  1EWY C;  1ZOY B;  3AEB B;  1VAO A;  1DZN A;  2DBY A;  3B9J B;  3P63 A;  4BC7 A;  5HHZ A;  4JAY A;  3CWI A;  1WXQ A;  4YTN B;  1MBB A;  3WCQ A;  1UXY A;  2WP9 B;  4YSY B;  1I7H A;  5EE9 A;  5C2T B;  1WGK A;  3HRD C;  4OAL A;  4PYT A;  3S1C A;  2EXR A;  1YJJ A;  2VFU A;  4BBY A;  1WVF A;  1NEK B;  3W8Z A;  3VRA B;  2E3T A;  1DOY A;  1VLB A;  1WWT A;  2MJD A;  3NRZ B;  1N60 C;  1JAL A;  4LTU A;  4BC9 A;  1WVE A;  4C7Y A;  2WDV B;  2B76 B;  5EE3 A;  1QLT A;  4US9 A;  3RPF C;  4C80 A;  3LB8 C;  2L52 A;  1AWD A;  2GQT A;  3NS1 B;  1L6V A;  1JQ4 A;  3B9J A;  1TYG B;  3W5U B;  2K9X A;  1TKE A;  3AE1 B;  1A70 A;  1OFF A;  3FWA A;  1JWB D;  2P3H A;  5AE3 A;  1SB3 B;  2VFR A;  2BS4 B;  2BS2 B;  1NYR A;  4PVJ A;  1WRI A;  3P4Q B;  1J7C A;  2BT6 A;  4N6E B;  1XLO A;  4A9A A;  1OQQ A;  3LLB A;  3S1E A;  2OHF A;  4YTM B;  3AB5 A;  3AE7 B;  2BVH A;  3HRD D;  3AED B;  3W8X A;  1N5X A;  3NRZ A;  1AYF A;  1XLN A;  3HUI A;  5HMR A;  2L83 A;  2N0S B;  2MJE A;  4EC3 A;  3P4P B;  1TKG A;  2PIA A;  1N5W A;  3HVZ A;  3DWG C;  4ZOH C;  2P13 A;  2QIE B;  1V8C A;  1WYG A;  1CJE A;  2H89 B;  3AMZ A;  5AE2 A;  4PWB A;  1W1S A;  4C7Z A;  1FFU C;  1GPX A;  1RM6 C;  1ROE A;  5D79 A;  2R2Z A;  1E6E B;  2DWQ A;  3GSY A;  1X2G A;  1T3Q C;  2NQW A;  4O95 A;  3TSJ A;  1N61 C;  3AH7 A;  3VR8 B;  4N59 A;  2QKN A;  3AE4 B;  3KWL A;  1VJK A;  1B9R A;  3AEA B;  5ADZ A;  2BVG A;  2W55 A;  1FFV C;  3DWM A;  2W54 A;  1N62 A;  3W8W A;  1E7P B;  1E8F A;  1L5P A;  1JRO A;  2W3S A;  3EUB 2;  1JW9 D;  4HRO A;  1FM0 D;  1L6U A;  1YQ4 B;  3BII D;  2EKI A;  1UWM A;  2P4P A;  5G5H B;  4HG0 A;  3ABV B;  4PWC A;  2LEK A;  3A7U A;  3W9C B;  1W1J A;  4PZF A;  2MBR A;  1W1K A;  3JS8 A;  4ML8 A;  2M56 B;  2I0K A;  3NVZ B;  3VRB B;  1VDV A;  4US8 A;  2JQR B;  3B2G A;  3AN1 A;  2Q5W D;  1ZXI C;  1QF6 A;  2WDQ B;  1KRH A;  3DQ0 A;  1N63 C;  1FO4 A;  4JX1 C;  2HTM E;  2CJO A;  1TKY A;  4USA A;  1W1M A;  4PVE A;  5AUI A;  1QOB A;  3AE8 B;  1NVI D;  1JWA D;  5G5H A;  3CIR B;  3AEC B;  1DOI A;  1PDX A;  1AHV A;  1W1O A;  3SR6 B;  1KF6 B;  1W1L A;  3A7R A;  5H8Y E;  1MBT A;  2G1E A;  3BW7 A;  3AE3 B;  4JWS C;  3VTE A;  1ZP0 B;  2MJ3 A;  3LAE A;  3PM9 A;  3NVZ A;  1I19 A;  1VQZ A;  3FW7 A;  2PLI A;  1V97 A;  1QOG A;  1ZUD 2;  2PKO A;  3FC4 A;  5HQX A;  1QOF A;  3LXF A;  3AM9 A;  3SFE B;  1N60 A;  4YT0 B;  5AE1 A;  3NVW B;  1SF0 A;  2FBW B;  3VR9 B;  4WQM A;  1AHZ A;  1QOA A;  4FXC A;  4MLA A;  4P6V F;  3ETR A;  1F0Z A;  1E0Y A;  3TSH A;  1F0X A;  3D2D A;  2H88 B;  3PO0 A;  2R8D A;  3SFD B;  1XLQ A;  2WS3 B;  3P4R B;  2GQU A;  3FW9 A;  1HSK A;  2WLB A;  1W1Q A;  4ZHP A;  3R07 C;  5MPO A;  4JWU C;  4ITK A;  1DIQ A;  3SR6 A;  1RM6 B;  2RK5 A;  4XLO A;  1NYQ A;  1FMA D;  4YXD B;  3S1F A;  3AEG B;  1CZP A;  3TX1 A;  1X2H A;  2AXR A;  5EE1 A;  4HRS A;  2PVG C;  1L0V B;  1J7A A;  5H92 C;  4TVW A;  3ZYY X;  1PFD A;  3NVW A;  1RWS A;  1NEN B;  3AE9 B;  4YTP B;  3AEF B;  2M19 A;  3KJM A;  5C3J B;  3A7A A;  3NVY B;  1R7S A;  1W1R A;  4YSZ B;  5G5G A;  1E8G A;  3NVV B;  2VAO A;  1IUE A;  2K22 A;  1AHU A;  1XO3 A;  4YSX B;  2Q4W A;  3EUB 3;  2O3G A;  1FFU A; 
#chains in the Genus database with same CATH topology
 3I3T B;  1ZQU A;  1TYP A;  2IY1 B;  3GD4 A;  3FW8 A;  4MT5 A;  8ICF A;  2WOW A;  1ET6 A;  2D5G A;  2Q85 A;  3FAH A;  4I2I A;  1RG6 A;  2EQ6 A;  1OQR A;  2OLA A;  4WJP A;  3Q4D A;  5J2I A;  4UAS A;  1SGG A;  1TAM A;  5K4L A;  4UBC A;  1GAQ B;  4PHE A;  2NRX A;  4CGZ A;  2RR9 A;  2F76 X;  1FRD A;  2J53 A;  3QTP A;  1IYX A;  5KAF U;  1WR6 E;  3ZTD A;  2C2E A;  7ICT A;  5J2E A;  5KFJ A;  3L4P A;  3H8M A;  3C0P A;  4F5Q A;  1V85 A;  1WZ0 A;  3GZN I;  3L10 B;  2GO7 A;  2OYY A;  2KZ3 A;  2C60 A;  3QU2 A;  2YX8 A;  2FPL A;  3U4E G;  1XO0 A;  1K51 A;  2QIL A;  1NU5 A;  2AJQ A;  3WK4 A;  1RFK A;  4DBG A;  5EE0 A;  3KHG A;  2LJ5 A;  3EZ5 A;  1RAX A;  3IV6 A;  3CGD A;  1FIQ B;  4NQL B;  3NVY A;  2FMS A;  2K6D B;  1YZ6 A;  1WY8 A;  2NRZ A;  1YQ3 B;  2BKR B;  2XIC A;  1L0Y B;  1UCV A;  5J2D A;  3Q8M A;  3KUC B;  4EKU A;  2EQ9 A;  1AN8 A;  4UD8 A;  3PG6 A;  2D2Q A;  2YML A;  1J7B A;  3PRM B;  3M9M B;  3Q8L A;  3B97 A;  1BML C;  4N58 A;  2HHQ A;  3SJN A;  5KFT A;  4HDO A;  4B9N A;  4DSJ A;  2LZ6 A;  4AUQ C;  2D07 B;  2I5Q A;  3RZW C;  4KSL C;  2N9P C;  3S1D A;  4XC2 A;  3KFU F;  4BCA A;  4NJ7 A;  2QDD A;  1NJW A;  2CJN A;  5AKK A;  2KDE B;  3DG3 A;  3ZLG A;  4WWM A;  4YMO A;  3CT2 A;  2FIF A;  4ENL A;  1JXE A;  4Z1Y A;  3EWA A;  3RB6 A;  2VKQ A;  5ALS A;  1S7M A;  4GB9 A;  3RGT A;  4PHA A;  5FJT A;  2JPH A;  2WXN A;  3A33 B;  1MSW D;  4MJS A;  1YJI A;  1UGJ A;  4OZC A;  3QPE A;  4ZRI A;  2FPM A;  2AH5 A;  5J0X A;  1GRG A;  3SSZ A;  2BVF A;  2JK6 A;  3AUO A;  3QNM A;  4Y2U A;  2KZM A;  3FV9 A;  1ZXI A;  2GBN A;  2K8C B;  3MFH A;  4NL9 C;  5G5G B;  4ZOH B;  5TR5 A;  3BVZ A;  5FR3 A;  1BWC A;  1IBX A;  3MR3 A;  3FG2 P;  5D46 A;  3TQ1 A;  4RT3 A;  2L1A A;  4RGT A;  2NQL A;  1XO1 A;  3STP A;  3PO4 A;  1I4Q A;  2F77 X;  4M0W B;  1WUD A;  1SV4 A;  3RTV A;  4TSS A;  3Q8E A;  3RFA A;  4J9K A;  2V0G A;  2FLL A;  1F9C A;  3ZXV A;  4UB2 A;  2JX5 A;  5E6J A;  4ROP A;  2QC8 A;  5J2R A;  3CNH A;  4DF4 A;  3IK4 A;  1R0M A;  3RCY A;  3OHA A;  3ZDA A;  5KHQ A;  4A3R A;  2BC1 A;  4NWI A;  3V7L A;  4FHJ A;  3JSV B;  2UUV A;  1WJN A;  2ZXI A;  3UGB B;  4RH6 A;  5KG7 A;  3VTV A;  1S10 A;  2LGI A;  3JPO A;  3GD6 A;  1V6E A;  4QWB A;  3NOB A;  5DPT A;  2EH9 A;  1IM4 A;  4P0P B;  2WDR B;  2GH5 A;  2QGY A;  2RPQ A;  3GFK B;  4O3Q A;  2LXC A;  3Q3J A;  1S8O A;  1SJD A;  1D8L A;  2V3N A;  2LHT A;  5ALV A;  1OEP A;  3EJE B;  4HCL A;  4H2A A;  3QUB A;  5HMM A;  4PZO A;  3GIM A;  2OH2 A;  2KZR A;  5FK9 C;  1RQL A;  2I2Y A;  5J0R A;  1P7F A;  1WH3 A;  5G2N A;  3CB3 A;  1ZOY B;  1HQR D;  2H3V A;  2WF9 A;  4YXM A;  1JUD A;  4C4V B;  1JCK B;  2KMA A;  4K4H A;  4O3O A;  3A9J A;  4J9O A;  1DZN A;  2ZTD A;  2IHN A;  1L8P A;  3DER A;  4GIB A;  4BC7 A;  2KJH B;  4E71 A;  1E8W A;  3PSE B;  4OO1 J;  1UWX A;  2M0N A;  1XS9 D;  4JAY A;  5DG8 A;  1GB4 A;  2KWU B;  3N28 A;  1MBB A;  3SBF A;  3Q8S B;  4I6N B;  4Q2J A;  1YZ7 A;  2V4R A;  3MHZ A;  4HEA 1;  3BSM A;  3VFC A;  5KVH A;  3NHE B;  2WF6 A;  3THU A;  4L23 A;  1SIF A;  2KP7 A;  3NTU A;  4DL3 A;  2A3V A;  1ET9 A;  1K52 A;  1L4Z B;  1UZX B;  1VZ6 A;  2WXH A;  5E6P A;  3B0X A;  1WGK A;  2NPX A;  3N1Y C;  4M52 A;  1STZ A;  2CRX A;  5KFE A;  3W1Y A;  2ZXH A;  4GYP A;  2DKZ A;  4URK A;  2KVR A;  5FS9 A;  3T8M A;  1QQ5 A;  3I5J C;  3MY9 A;  4WWP A;  4GC7 A;  2K6Q A;  4O3S A;  2NVK X;  4ECT A;  1HXY D;  5AM1 A;  1WGR A;  1WMH A;  3H8S A;  3ZD8 A;  3MR6 A;  2PGW A;  3ZTC A;  4HYR A;  4Y2Y A;  4XDC A;  3W8Z A;  4KGS A;  3OTR A;  2JRH A;  3RF9 A;  5KFG A;  5DB7 A;  4ECX A;  1F52 A;  2JYT A;  5FS8 A;  4UAW A;  3TI0 A;  1KDH A;  1ACC A;  4DQS A;  2D3C A;  5JCN A;  3FYH A;  1E9I A;  4EQR A;  2KLG A;  4C7Y A;  4B6J A;  3WU2 U;  4IRD A;  1WZ3 A;  1EU4 A;  1PGA A;  3QC8 B;  2UVR A;  2LVP A;  1KN0 A;  1KFT A;  1UT8 A;  4FJY A;  3I1Y A;  4O0I A;  3RB3 A;  1BUI C;  3LYY A;  1COK A;  1D8B A;  5B5E U;  4HCD A;  1IP9 A;  1V9P A;  5BMH A;  2LYH A;  2KDM A;  3DBS A;  3DCG A;  5ALP A;  4QZC A;  5J04 A;  2XID A;  3PS6 A;  4KPR A;  1N6Z A;  2PMZ F;  3GC2 A;  2Y3A A;  3AE1 B;  1TKE A;  3RNM A;  1K8R B;  1L3V A;  9ICU A;  3GZN B;  4UDU C;  2OZ8 A;  4BJQ A;  1JWB D;  2E1F A;  1QSL A;  3IJI A;  2Y9T A;  4DF8 A;  3SN4 A;  4DL2 A;  2F2A B;  2HOF A;  4HK2 A;  2AAQ A;  4NAW A;  4EX6 A;  3D6J A;  4YWO A;  3EFC A;  4AJW A;  1BNO A;  2AHO B;  4BGD A;  4REZ A;  4WAF A;  3HP6 A;  2DPJ A;  3EJD B;  3Q8B A;  2I9G A;  2P6R A;  4U7C A;  9ICJ A;  1Q0W B;  3E2E A;  3RI7 C;  1BPE A;  5J0Q A;  3IRU A;  4IS7 A;  3NGD A;  1TZO A;  5D2M B;  3LVW A;  2LVQ A;  1FEC A;  5D3I B;  4KLQ A;  2OO6 A;  4YTM B;  2GH1 A;  3LWL A;  3I28 A;  1T3N A;  5AKL A;  5AI6 A;  3QEA Z;  2BVH A;  3QU9 A;  3TAD A;  4JE3 B;  4BXO A;  1NPX A;  1N5X A;  2BB6 A;  4DQP A;  1MN8 A;  2KKV A;  2JZB B;  1C4P A;  2ZZC A;  3VH3 B;  1EF1 A;  4JN8 A;  8ICA A;  1H4R A;  3TSS A;  1P3Q U;  3WK7 A;  2HVH A;  2M17 A;  1L0X B;  2EQ8 A;  1W6T A;  1ZOL A;  1ZQF A;  3MC1 A;  3Q6B A;  4EC3 A;  4ECY A;  1EBH A;  2GR1 A;  2AYO B;  2QB0 A;  2BQU A;  3EAN A;  4FN2 A;  4EWJ A;  2W43 A;  2BPG A;  2C7M B;  1CK1 A;  4S0R A;  3C2M A;  2JEJ A;  2OOB B;  2P13 A;  4G8T A;  4I6P A;  7ICM A;  4DSE A;  2JH1 A;  2KHV A;  2XSX A;  2V9H A;  3CP8 A;  4XRH A;  4O1N A;  3QQ8 B;  4F72 A;  2GGE A;  2P8C A;  1Z19 A;  2MCN B;  5HHD G;  4O3M A;  2ZJ8 A;  3PR4 A;  1V5T A;  2KTF A;  3V4B A;  4P16 A;  4I2F A;  4K4G A;  4ECS A;  3RR8 A;  3E0F A;  2I1J A;  3OP2 A;  4O3P A;  2GOW A;  4HXD A;  3ZDD A;  4IQW A;  2W8L A;  4O5K A;  1O08 A;  3UMC A;  1UBQ A;  3T9P A;  2GR3 A;  2XN9 C;  2ATL A;  4ZRP A;  3OJ3 A;  3TW9 A;  2G06 A;  9ICH A;  4YXJ A;  4U6P A;  3GSY A;  3MGH A;  3DDM A;  2AL3 A;  1N61 C;  3RO6 A;  2AQ0 A;  2HOI A;  9ICS A;  3ETL A;  2QKN A;  5DDY A;  2GGH A;  3AE4 B;  2Y9U A;  1E8Y A;  3DVN U;  1C1Y B;  8ICO A;  1TTN A;  1S5L U;  2F5Z A;  3MR5 A;  1VJK A;  2OEH A;  9ICF A;  2IGD A;  4TUQ A;  3MC8 A;  4P1C C;  3PW0 A;  5EWF A;  1B9R A;  5ADZ A;  1MQ3 A;  5HFY A;  2BVG A;  3TWB A;  3PV1 A;  2KKC A;  2XO7 A;  1HTQ A;  4FFD A;  3MAB A;  1N62 A;  1P43 A;  3DGZ A;  5L1I A;  5LNK 1;  3LXD A;  2E8O A;  4GFI A;  2LI5 A;  1IPG A;  2KSO B;  4FS2 A;  2GGI A;  2O6V D;  4UB4 A;  1Y8R C;  2LYA A;  1JW9 D;  2JT4 B;  2MBH A;  1FM0 D;  4J6I A;  5KFY A;  1L6U A;  2BCR A;  4OJ6 A;  4YR3 A;  3ZNH B;  3IVF A;  4NEW A;  2YQU A;  2WP6 A;  3DVG X;  3RRG A;  1ZRM A;  1QLN A;  2WWZ A;  2VZK D;  4LNI A;  4A8X C;  5ALW A;  1GRF A;  1TKK A;  4H4U A;  4P0Q A;  9ICA A;  2RP5 A;  2EKI A;  3LDA A;  4DL5 A;  3QUT A;  3RN9 C;  3OSP A;  4NNJ B;  3ABV B;  1EUV B;  2LGS A;  3BOX A;  1GER A;  1ED1 A;  8ICP A;  1TS3 A;  2LGY A;  4PWC A;  5AZH A;  2NBU A;  3R2I A;  1PGX A;  3BK2 A;  5J0U A;  3Q8K A;  3E58 A;  3CXO A;  4NLK A;  8ICW A;  4BKT A;  3HT3 A;  4KZC A;  1ZKH A;  4ML8 A;  3RYT A;  2UYZ B;  5HI1 A;  3IT6 B;  2I0K A;  4K7W A;  3BJS A;  4IWQ A;  3UCD A;  4DXG A;  2BCU A;  2P35 A;  3Q8P B;  1F1H A;  3CSF A;  4IM2 A;  2BDP A;  4NJ6 A;  4EZL A;  2QJJ A;  3AN1 A;  2LVO A;  3NZG A;  1QF6 A;  1ZQL A;  2PFO A;  2W11 A;  4UB3 A;  3N4M B;  2R8K A;  2BVC A;  3A1Q A;  3H6N A;  4ASW C;  4GR1 A;  4MEL A;  3PML A;  5I4D A;  2JRZ A;  4K81 A;  2VRR B;  3II4 A;  4DX3 A;  4HLE A;  3TJ4 A;  2WF8 A;  4M9L A;  5AIA A;  1FO4 A;  3S2A A;  2INP E;  4QWC A;  4MHV A;  2K4E A;  2LD9 A;  2QDE A;  3R2T A;  3RJG A;  3A0H U;  2I38 A;  2REX A;  1TKD A;  2BQR A;  3I6T A;  2W9C B;  2YMM A;  1MVK A;  5KAI U;  4YFK A;  1X9S A;  2W9A A;  5KFH A;  4ANV A;  4XWW A;  2QJM A;  2WAQ F;  5HNK A;  1F2R C;  1N56 A;  2C3D A;  2JV3 A;  1XC9 A;  1F9J A;  2HNE A;  3AE8 B;  1JXL A;  2IHM A;  1T6B X;  5BYS A;  2PKE A;  3GD3 A;  1F2R I;  2KE7 A;  4DFP A;  2R2Q A;  4HCP B;  4AWJ A;  2RPV A;  1E7U A;  3EHV A;  4J3O D;  4KIK A;  3PVX A;  3R3M A;  2ZIW B;  2EQ7 A;  1SL2 A;  4DFK A;  2Y08 A;  3NUH B;  1SJH D;  4HPL B;  1UPH A;  2MA9 B;  4NLN A;  4IOI E;  1DOQ A;  3HPO A;  2PPG A;  5GTH U;  4I2A A;  1NZP A;  9ICW A;  4GGQ A;  2POZ A;  4C56 C;  2L00 B;  3A7R A;  7ICP A;  2L32 A;  4KSK C;  1YX6 B;  2TPR A;  4WJO A;  4A90 A;  8ICZ A;  1KOT A;  3NVZ A;  5AIC A;  2HHU A;  2DYB A;  2UWQ A;  9ICM A;  2B21 A;  4I2J A;  3W1S C;  1VQZ A;  2QAR A;  3UM9 A;  1BVS A;  1QSS A;  1V97 A;  4DDG D;  4Y2Q A;  2J3N A;  3NFU A;  4KWS A;  3UMB A;  4I2D A;  3AQE A;  4TKN A;  2V6O A;  5B66 U;  2PKO A;  4C4S A;  2KAC A;  3MUC A;  2WFA A;  4Q43 A;  1EM7 A;  2R8J A;  3BS5 A;  3NRW A;  1TGZ B;  3NVW B;  3T8Q A;  3N6H A;  4ECU A;  3RNB C;  1VRA B;  4DNA A;  2MWS B;  4FI4 A;  3J81 j;  2RGF A;  3FYY A;  4JL9 A;  2NO5 A;  3ETR A;  3UQ2 A;  1C7Y A;  1E0Y A;  3IG8 A;  2R8D A;  4BWJ A;  5KFS A;  3SFD B;  5DPW A;  2NV3 A;  4B9V A;  2WS3 B;  3NG0 A;  5IN7 A;  4LVS A;  5LXI B;  4H19 A;  5J2G A;  1SKW A;  2AKZ A;  2ZW0 A;  2NRW A;  5ALH A;  2QEJ C;  1JCT A;  4YD2 A;  3EYZ A;  1SV0 C;  4HKZ E;  3ZIM A;  4EMW A;  2FCN A;  1HSK A;  2CPR A;  2WLB A;  1B0X A;  1I4G A;  1LFD A;  3TWA A;  1V49 A;  9ICL A;  2E8M A;  3R07 C;  2OPJ A;  3PR5 B;  4AJY B;  1ZD3 A;  4KN4 A;  5MPO A;  3CGB A;  3ML8 A;  8ICH A;  2K3U A;  3A0B U;  1U45 A;  1A5R A;  4WJN A;  3DJJ A;  2HDE A;  2V4L A;  1Q3U A;  1FXT B;  2RK5 A;  5E6N A;  2EQY A;  3PZP A;  2IO2 B;  4J9L A;  4YXD B;  4AYB F;  2KKP A;  1GOZ A;  2ZC8 A;  2G3Q B;  2KEY A;  5IIO A;  4JGH B;  2MP2 B;  2NMQ A;  2PP3 A;  5J2F A;  3PX6 A;  2Q0Z X;  1D5X C;  3I57 A;  4DXF A;  3GV7 B;  3OZY A;  4IZG A;  2C9W B;  2PW9 A;  2CU1 A;  3QYP A;  1NK7 A;  1XD3 B;  3EGR A;  2K8A A;  2PVG C;  3APF A;  3WAP A;  1L5U A;  1KTK A;  3PGE A;  3VUW A;  2H5X A;  4KLH A;  2ESE A;  2X8X X;  3KKA A;  2ZIU A;  4RQN A;  5AKH A;  4EEN A;  3V62 A;  2FUH B;  1LGR A;  3NXL A;  4YTP B;  3SQP A;  2XVT A;  2V3P A;  3KUZ A;  3AEF B;  4MGG A;  4DLE A;  5CHW A;  3A7A A;  3U4F A;  4RQ7 A;  8ICJ A;  1R7S A;  3FIL A;  3PZ7 A;  4YWG G;  2XGQ A;  4GLS C;  4IRK A;  4A35 A;  1GRA A;  1RZT A;  3MJ5 A;  3H7P B;  5JHA A;  4EBC A;  5AM5 A;  2V4Q A;  3KW5 B;  2KXJ A;  3PRP B;  4P4M A;  2W0H A;  1WFY A;  2W9B B;  1C3T A;  1XS2 A;  3B0Y A;  2KN4 A;  2RHF A;  1NK9 A;  1L7M A;  1T0S C;  4XYC A;  3RCZ A;  2VAO A;  2P88 A;  4HVB A;  3M6Z A;  2ZZ0 A;  3H0L B;  1ZQN A;  1PVR A;  5C0Y A;  2OQH A;  3ZO5 B;  1DXS A;  5ALE A;  2DKX A;  4PGX A;  2G09 A;  3I9V 1;  4KPL A;  2G0A A;  3WK5 A;  2O3G A;  3T5K A;  4QIW C;  3RJJ A;  1Z3E B;  1ZQG A;  5GMV A;  4KDL B;  1ARO P;  1SXT A;  1DK2 A;  5AKG A;  1WI0 A;  1TS4 A;  3WK9 A;  2AX5 A;  2ZVO A;  1T3Q A;  4GDK B;  3MKC A;  3Q8F A;  4UAV A;  1WIA A;  3ETR B;  2FPK A;  1WR1 A;  4I2H A;  1E9M A;  1UD7 A;  1V9J A;  2MUT B;  4RQ3 A;  2D3A A;  2JU6 X;  3ZJU A;  3R1Z A;  4MEM A;  3GY1 A;  2W3R A;  2M4N A;  4IW0 A;  5KFA A;  2BWF A;  4F5O A;  1KKR A;  3K9O B;  1SB3 C;  3MZN A;  4H1Z A;  4TVY A;  5KFV A;  4IP5 A;  4QZA A;  4BUG A;  1FNV A;  3DFY A;  4E6M A;  5AI9 A;  5J2H A;  1M6I A;  2XH2 A;  4MFF A;  4ZCW A;  4J9S A;  3ISD A;  4KX6 B;  1GRE A;  1MOK A;  1YEY A;  3FVD A;  3C5F A;  4Y2S A;  2FUG 1;  2PMQ A;  2J0M A;  4MEY A;  4B9T A;  4ZYS A;  3B2F A;  2KVS A;  5ALO A;  2XI9 A;  3RR7 A;  4J56 A;  4DHJ D;  5FXE A;  4MSM B;  4F4W A;  2MBO A;  1B4F A;  3DDH A;  2C7H A;  3MTN B;  4EQW A;  2NPT B;  4NM2 A;  7ICO A;  4MGI E;  5DGB A;  4MDK E;  3EJB B;  3D2H A;  3ZNI D;  1TT5 B;  2KHQ A;  3GDX A;  5AM0 A;  2KC2 A;  3U7D A;  5KFI A;  4CF5 A;  2ZNV C;  3M95 A;  4PS7 A;  2K1F A;  1UF0 A;  4XQ8 A;  3HW8 A;  1ZYQ A;  1X66 A;  1DOX A;  2DYO A;  2POD A;  2Y5C A;  1ZQJ A;  1KH0 A;  2WU5 B;  3P1M A;  1ZQH A;  3PLU A;  1DII A;  3PW5 A;  2WB1 F;  2LPE A;  3AXC A;  2QPM A;  5U25 A;  2K4I A;  5IIJ A;  4Q44 A;  2NBW B;  1QKZ A;  3K75 D;  4YG2 A;  1IGD A;  4W9C A;  4JPS A;  1Q1O A;  1MNS A;  3NZS A;  2EZY A;  3RD2 A;  1URJ A;  3VH4 B;  4ARI A;  2KOB A;  1FRR A;  3ONN A;  4H4T A;  2YVC A;  4LNO A;  4N9F 4;  5L6G A;  2GOL A;  5E6O A;  1J2M A;  4IWO A;  3EEC A;  1FIQ A;  2PEA A;  2J6U A;  3WKB A;  4JB1 A;  1ZRN A;  3HK0 A;  1WGG A;  3FM9 A;  3RJH A;  1SIJ A;  2K8H A;  3F2D A;  4RGN A;  2WU2 B;  3I99 A;  1Q1W A;  4GMV A;  3SU8 X;  2GLE A;  3R10 A;  3D2N A;  2RMM A;  1JPM A;  2QDF A;  2WXL A;  3UI3 A;  4RNO A;  3N1Z C;  4KVG B;  1MDL A;  2MSN A;  1X42 A;  2HI0 A;  4DL7 A;  2D11 A;  3AE5 B;  4C00 A;  4ZHO A;  4GLX A;  1T0R C;  4HPN A;  3UJS A;  2XEW A;  4H4R A;  3R9K A;  3M8R A;  1SXE A;  3U8Z A;  4FA6 A;  4PVH A;  5CWR A;  5BYR A;  3P2B A;  2OG9 A;  1EWY C;  1PVQ A;  2CR5 A;  4RPY A;  4F2R A;  3PSP A;  2KNJ A;  4KGR A;  3ZI4 A;  3AEB B;  4JV2 A;  3IN5 A;  4IKG A;  4IR1 A;  2J4X A;  1AOG A;  4IC9 A;  3L17 A;  1YQB A;  4IG7 B;  4DS4 A;  2DBY A;  2VH1 A;  3B9J B;  4M6W B;  3SI8 A;  1EC8 A;  3C8Y A;  4J9M A;  3H8H A;  5ALK A;  3DFH A;  3ZD9 A;  4IP4 A;  4CE6 A;  5HHH A;  4QZH A;  1IYF A;  1G6J A;  3TFR A;  1WXQ A;  3DK4 A;  1ZGU B;  4YTN B;  3VDG A;  3OAW A;  1S0N A;  2K8C A;  3V3X A;  4KMU A;  1WXS A;  4HKQ A;  2X8H A;  4F5N A;  4P2H A;  2WP9 B;  5BOF A;  3EW9 A;  5KFX A;  2PLP A;  5EE9 A;  3WAL A;  2I1K A;  3MJW A;  4NLB A;  1MJD A;  2MU2 A;  3MDA A;  4WJ3 B;  1WF9 A;  4XUS A;  2KD0 A;  4DHZ B;  2ASJ A;  4M0W A;  4RU9 A;  2C3C A;  3GV8 B;  2ZJ5 A;  1ZQE A;  1WJ6 A;  1WXA A;  2MBE A;  1P48 A;  4OAL A;  2IND C;  1LB2 B;  5I1W A;  1WXM A;  4G11 A;  3U30 A;  3QK0 A;  5CX3 A;  3DH9 A;  2K89 A;  4YCX A;  3A9K B;  3RNC C;  1RPL A;  1FEA A;  3JSV A;  4B0E A;  3R7R A;  2BPC A;  2GL5 A;  3VQI A;  4BBY A;  2OFJ A;  1ZKQ A;  3RJ8 A;  5AM3 A;  2N9X A;  5KFP A;  1H38 A;  4P0P A;  2XNA C;  4HWI B;  3RRH A;  3N20 C;  1SWV A;  1VLB A;  9ICX A;  3DHH C;  2IOH A;  2Z0D B;  3TCA A;  3NRZ B;  4LA1 A;  4EEW A;  2WXR A;  2KJ9 A;  1N60 C;  4BC9 A;  3PFR A;  3VC5 A;  2WDV B;  3AI5 A;  3DHI C;  1BKH A;  5EE3 A;  2H3F A;  5L1M A;  3C1Z A;  3RB4 A;  1NK4 A;  2DPI A;  1RXW A;  2O6K A;  3KD3 A;  2CDU A;  4H4Y A;  4C80 A;  1E8X A;  1FNU A;  3ICX A;  4C4V A;  1LO5 D;  4H4W A;  2LMR A;  3BJY A;  1PYW D;  4JWM A;  2BZF A;  3DJG X;  5KG5 A;  3PZ8 A;  2PGE A;  2K4H A;  1IGC A;  3GOE A;  2K9X A;  3JPS A;  4K1W A;  2TSS A;  1WGD A;  2BYF A;  5TR3 A;  4KIT B;  2QQ6 A;  4K7S A;  3L16 A;  3D9X A;  5AE3 A;  1SE3 A;  1L8O A;  2VAN A;  3BQ0 A;  1DNC A;  1SB3 B;  3NUQ A;  2G5I B;  2LM1 A;  2MQJ A;  4YR2 A;  1V38 A;  2KX0 A;  2GBK A;  3RNF C;  3ZVV A;  2PTX A;  1LKY B;  3C2L A;  2YVJ A;  3HW2 A;  3PHX B;  4RT2 A;  1Z4O A;  3KHH A;  1NYR A;  3B0A A;  2GQW A;  5DCN A;  1Y56 A;  3EFU A;  1ZJN A;  4LDT D;  5D94 A;  1WRI A;  1A76 A;  5A0L A;  1ZQI A;  1EC9 A;  5AKZ A;  5IDZ A;  3RNG C;  1XLO A;  1F0M A;  3KVF B;  5EWE A;  3TBL D;  2PTL A;  4A9A A;  1OQQ A;  3TFS A;  3N32 A;  2D10 A;  3ZLZ A;  2OHF A;  2N9E B;  3AE7 B;  4OCZ A;  4M9J A;  1UNS A;  3M8S A;  4JQ9 A;  4RNA A;  4ELT A;  1AQ6 A;  1NOM A;  1NDD A;  2BF8 B;  3Q8A A;  4DEZ A;  2BC0 A;  3DK8 A;  2KTR B;  3RJK A;  2IOF K;  5DG9 A;  1NHR A;  3RJF A;  1JWM D;  4CYE A;  2R8G A;  4F8R A;  2ZNV B;  4IQV A;  1SGH A;  2JZP A;  2ON8 A;  1OW5 A;  4OJ5 A;  5HMR A;  3AQF A;  3BQ1 A;  3TOY A;  2MJE A;  3X0W A;  1S1Q B;  3BZC A;  2KFK B;  3P4P B;  4LNF A;  3TAP A;  1TY2 A;  2Y5P A;  2RD0 A;  3U7Z A;  2M1M A;  1Q1R A;  2OQY A;  3H7S A;  3Q3F A;  1WJU A;  3PK7 A;  1TK8 A;  3AU4 A;  5ALD A;  4DS5 A;  4IRC A;  2N1V A;  3DWG C;  5JZE B;  3DK9 A;  4WAA A;  5BMI A;  4NY8 A;  3VTW A;  2UUU A;  5KFK A;  2XGP A;  5AK3 A;  3PV8 A;  3EPI A;  3UGV A;  2ALZ A;  3C19 A;  5AE2 A;  4J9R A;  1WG8 A;  5AKJ A;  5KT3 A;  2ZJA A;  2NCN A;  4S17 A;  4A3O A;  1FD6 A;  4PWB A;  4YMM A;  5AKY A;  2NRT A;  4EQS A;  5F9L A;  2YB1 A;  2XK5 B;  4IWP A;  1GUA B;  1R4N B;  1ZQT A;  2UU7 A;  4DDI D;  1GPX A;  1V1O A;  2A1A A;  4X57 B;  4R64 A;  5D79 A;  2AGO A;  1XWL A;  3C29 A;  1QTM A;  5JCI A;  3ZVH B;  1E6E B;  1X2G A;  2MBB B;  2IPK D;  2DFL A;  1JN3 A;  2KFZ A;  3EC8 A;  3IJQ A;  1HUZ A;  3VR8 B;  4CF3 A;  2HCF A;  4PL2 A;  4RQ1 A;  4ECV A;  2XY7 A;  1BNP A;  1WGH A;  3ZDT A;  3S5S A;  2IYD B;  4OW0 A;  4F5P A;  2JEF A;  3KWL A;  3FCP A;  2R8I A;  2BDU A;  4DFD A;  4CNQ A;  3SYZ A;  1LM8 B;  4DWI A;  5DQH A;  2R18 A;  3SDL C;  1MUC A;  4E8G A;  5ALJ A;  2EMS A;  2VJ5 A;  3QA8 A;  1HUO A;  2JZB A;  1QQR A;  1JPD X;  2X99 A;  2EKE C;  2KK8 A;  1FFV C;  1P7D A;  1C76 A;  1SL1 A;  3WAM A;  1E7P B;  5BOL A;  5EOZ A;  1E8F A;  3V5C A;  5DB6 A;  3N3K B;  3V3W A;  1LV5 A;  3L0W B;  3GIJ A;  2WGS A;  3PTF C;  2W3S A;  1XPY A;  2VJ4 A;  5ALG A;  3Q2A C;  2HHS A;  2KQ7 A;  3DDC B;  2N9L A;  4R3D A;  5DPS A;  2PTW A;  4H4X A;  4DN1 A;  4JK1 A;  4PYU A;  2FCS A;  2WXP A;  2F8L A;  2YTU A;  5AKX A;  3QU7 A;  2K8B B;  4ED0 A;  4B9L A;  3QWZ B;  3ZGZ A;  3Q6J A;  1K50 A;  2KFN A;  8ICR A;  1J0G A;  2IO0 B;  3VDZ A;  1UWM A;  2M0X A;  3H70 A;  4NL9 A;  5G5H B;  4HG0 A;  3U52 E;  4TUU A;  3LAD A;  4RNM A;  4KTQ A;  3SQI A;  4CDG A;  1BGX T;  4GU2 A;  2UVV A;  3TAC B;  4J9N A;  4OJO A;  2PE9 A;  2IA6 A;  3K1Z A;  3ZJV A;  3LYS A;  2BR0 A;  1ZQA A;  3PT2 B;  1W1K A;  2WXI A;  5TIS U;  3KOO A;  3JS8 A;  3U9I A;  1JX4 A;  1YD8 U;  3RZF A;  3K1G A;  4NV0 A;  5LLI A;  4JWN A;  1JEH A;  2PSN A;  4X2P A;  1DYQ A;  1C9F A;  1NKB A;  3H1U A;  4B95 A;  4RNN A;  3JVA A;  4US8 A;  3RH5 A;  2JQR B;  1T94 A;  3WKC A;  4M04 A;  3K4G A;  2PCE A;  4DFM A;  4FBU A;  1N63 C;  1ECQ A;  3ZXR A;  4W9K A;  5AHX A;  3QX7 A;  2IMW P;  5CR0 A;  5CJ7 A;  2GBR A;  2HXU A;  1JML A;  1GES A;  2KSO A;  4W9G A;  2JZZ A;  2HHW A;  4USA A;  2L05 A;  4EEY A;  1TV9 A;  1XU4 A;  2B0C A;  5EWG A;  1YOV B;  3N4F A;  4W9F A;  2HJ8 A;  2H3Z A;  5EDS A;  4PHD A;  1WE6 A;  3IT4 B;  2KTQ A;  1RXV A;  4J57 A;  3DG7 A;  5J17 A;  1PDY A;  4C4R A;  5J0W A;  3BDP A;  2EZZ A;  1JWA D;  5HP4 A;  2V3S A;  4DOA A;  2WX0 A;  3R7Q A;  3UIP B;  2N4F A;  5L1J A;  2PMZ C;  3MDC A;  2JXT A;  1KTQ A;  3KYD D;  2WXM A;  4JLC A;  4OVV A;  5J2A A;  1GRB A;  3H0M B;  8ICT A;  3CIR B;  2MUC A;  1GXF A;  3ES7 A;  7ICN A;  1D9D A;  1PUZ A;  4AP9 A;  1J19 A;  5LXH A;  3DIP A;  3WA0 A;  3VC6 A;  2AL2 B;  3SAF A;  1MC8 A;  4KX5 A;  3SEB A;  1RYR A;  5H8Y E;  1MBT A;  3KHL A;  2AXT U;  3AE3 B;  3OC4 A;  1X6I A;  3VTE A;  2HQM A;  4ICU A;  4TQS A;  1Q10 A;  2MJ3 A;  3RNE C;  3UIN B;  4MMW A;  1I19 A;  1UH6 A;  5J0Y A;  1JWU D;  1NJZ A;  2QB1 A;  3GRS A;  4J9P A;  3V6K A;  2N1W A;  4BBN F;  1ZUD 2;  2WXG A;  2L76 A;  4GGH A;  3BYT B;  2R61 A;  1MG8 A;  1ZX9 A;  4WWO A;  1BXT A;  2RAB A;  4ZDV A;  5KFR A;  4ANW A;  1KKO A;  3L5O A;  1QOF A;  3DHG C;  1EC7 A;  3T4W A;  4A55 A;  4ECR A;  1V81 A;  3C2K A;  1ZQC A;  2VZK B;  1D8Y A;  1AAR A;  5KFN A;  3WK6 A;  4MFA A;  4FXC A;  4BVU C;  3T3F A;  1F3P A;  4DYE A;  4MLA A;  1S76 D;  3BIN A;  3NJT A;  2RDI A;  2A8X A;  3CYM A;  2DQN B;  2Y0S F;  4IL6 U;  2O2V B;  3T79 A;  3PO0 A;  1F0X A;  2HXT A;  2W9C A;  5L83 A;  2YMP A;  4F4X A;  2VA2 A;  1XLQ A;  3A4R A;  1KKX A;  1L2N A;  1VCB A;  2Y5B B;  2JR5 A;  3QCA A;  4BBN C;  1FCC C;  2JVC A;  3A4S C;  3P4R B;  4M0X A;  5IA7 A;  3LJ3 A;  4ACF A;  2W04 A;  3TAQ A;  2BCQ A;  2VA3 A;  4II2 B;  2JXJ A;  4P4O A;  2BQQ A;  3DGH A;  1TFR A;  1GB1 A;  1L3T A;  1L7N A;  4ZHP A;  2AWT A;  3TEW A;  4IL2 A;  2ZIW A;  3QAQ A;  2MX2 A;  4ITK A;  2VA8 A;  3T3O A;  5JCL A;  2ZCB A;  2P8B A;  4W9L A;  2RDJ A;  4EYH B;  1X9W A;  3O0H A;  4KLO A;  3S1F A;  2NRV A;  2KV2 A;  2HDO A;  4FHK A;  2P3Z A;  2OX4 A;  2XH0 A;  1ESF A;  1Z5S B;  3TX1 A;  1BPY A;  4I29 A;  3HHM A;  1NI2 A;  1X2H A;  1ZDL A;  4J3Z A;  2KLC A;  5EE1 A;  9ICB A;  2L3Z A;  1L7O A;  2QHO A;  2LGD A;  4C8N A;  2KD1 A;  3UXP A;  2LMC A;  5H92 C;  1MA7 A;  1V59 A;  3VA8 A;  4B9U A;  4M0A A;  1PFD A;  3UQA A;  1GRH A;  1ENF A;  5ALZ A;  3VXW A;  1NJY A;  2F1J A;  1IXR A;  3NVW A;  1RWS A;  3VUY A;  4EM4 A;  5KG1 A;  1A6S A;  2IY0 B;  3DBH I;  4GRT A;  3R0K A;  2DAF A;  4ZRK A;  3KJM A;  3TCS A;  1TK0 A;  4P7I A;  3PRZ A;  5KG0 A;  2Y1J A;  2P0I A;  1DRG A;  7ICI A;  2KMC A;  2NO4 A;  3CXB A;  1W1R A;  1XAN A;  3IC9 A;  2HHT A;  5KL1 B;  2JHD A;  4TUP A;  4GGB A;  1WM2 A;  1GEU A;  5HML A;  1TAU A;  4D2K A;  4I2C A;  4G3I A;  2G5H B;  4KEM A;  3M6K A;  3ALR A;  4B9K A;  3SD7 A;  4RFB A;  5J2B A;  3NVV B;  3SQS A;  1ONE A;  4YD1 A;  4HCN B;  4MKS A;  1DGS A;  1IUE A;  2DX5 B;  2V4I B;  4DOC A;  3L3F X;  1JOA A;  4PGY A;  2ZPY A;  2H3Q A;  4KN7 A;  1JMS A;  2XY5 A;  4OVU A;  2Q4W A;  4LZG A;  3CW2 C;  3AV8 A;  2QAE A;  2EAN A;  3QU4 A;  4A6G A;  2GRI A;  5III A;  2PU1 A;  1NK8 A;  3H4B A;  5IO9 A;  1RYU A;  4ELU A;  3HSU A;  1N5W C;  2FYM A;  1L3U A;  3ES8 A;  7ICG A;  2MP2 A;  1EBG A;  3CMM B;  4BKS A;  1K1S A;  1N61 A;  2IDY A;  5BMG A;  3QEB Z;  3B08 A;  1JDF A;  1OJT A;  4G7F A;  4HPM B;  3VFK A;  3N7S C;  2W7O A;  1GV4 A;  3IFW B;  4FO6 A;  3V7J A;  1CMX B;  5HG2 A;  1E8H A;  1E5W A;  4MF8 A;  5DG7 A;  2FJ6 A;  2NVU I;  4A6Q A;  3F53 A;  2BBC A;  5KT5 A;  3R66 C;  3PW2 A;  3K9P B;  9ICR A;  3ENL A;  1MDR A;  5CEH A;  2KK0 A;  1I4X A;  5FXP A;  4H4Q A;  4UAR A;  3RR1 A;  3S47 A;  1L4D B;  5J2C A;  4KLM A;  3GIK A;  2AQ1 B;  1STE A;  2KVZ A;  3H7P A;  2J6S A;  3SMV A;  1XSN A;  2INN E;  2WAQ C;  4RF1 A;  5TSS A;  4BOZ B;  1TZZ A;  3AUL A;  1FXI A;  2W9B A;  1OEY J;  3SAG A;  1VZ8 A;  2VFT A;  5AWV A;  4J1O A;  4TQR A;  2KN7 A;  1KEJ A;  3GQC A;  1ZQM A;  1D5M C;  2EMT A;  2KMM A;  2Q4T A;  3RAQ A;  2PE6 B;  4NPN A;  3P3B A;  2DUY A;  2J7Q B;  1CEZ A;  1KFD A;  2WQY B;  4LJP B;  3APC A;  4JQW C;  2HE7 A;  4UB1 A;  4QWA A;  5KFD A;  7ICL A;  5JH5 C;  5BYQ A;  1ZR6 A;  4F8C B;  2N7J A;  1XLP A;  3EKG A;  3QHT A;  1TE2 A;  2G4S A;  2K5P A;  3TEZ A;  1P7E A;  4KMO B;  1C79 A;  3ZDM C;  3ZVI A;  5DBC A;  2C2D A;  1S3S G;  4GDK A;  4LK0 M;  4DHG A;  1WWU A;  2ZTE A;  1S77 D;  2KX3 A;  5AZG A;  4ZYN A;  3M62 B;  2ZIX B;  5KFO A;  7ICS A;  4TUS A;  2MUT A;  4Q8E A;  4WJQ A;  5ER0 A;  3V5F A;  2ZUC A;  2OAI A;  7ICV A;  4Z6D A;  4XA5 A;  4F2S A;  4MGZ E;  2O56 A;  1HZ6 A;  4LII A;  2VIX A;  4NLC A;  1FPY A;  1RYJ A;  4UAU A;  3QLD A;  4M00 A;  4WWN A;  5HR6 A;  4DSF A;  2N9K A;  4H50 A;  3R8B A;  2AQ2 B;  2QJL A;  4WUR A;  1GO3 F;  2GWS A;  1OQY A;  5AUK A;  3WAO A;  1E0Z A;  1DXL A;  1ZQZ A;  5DPR A;  4DO9 A;  2AU0 A;  2WPE A;  4I2E A;  2XBB C;  1ZQ1 C;  1H6V A;  1WX8 A;  3FJ4 A;  3B1L X;  3KQ4 A;  2DW7 A;  4NY0 A;  2KG5 A;  2Z8L A;  5ENL A;  5FJR A;  2YMQ A;  3DED A;  1M6Y A;  4GIV A;  2PLS A;  3VAW A;  2FMQ A;  2YLM A;  3ZDB A;  4OVZ A;  4ZRQ A;  4PJ0 U;  2EAM A;  3N97 B;  1U49 A;  2PVO D;  2BS3 B;  1SJC A;  1UA1 A;  4APN A;  1QT9 A;  3EAO A;  2Y1I A;  2E1E A;  1BQG A;  2FAZ A;  2V3A A;  3MP9 A;  2VFS A;  3RAX A;  3TKA A;  2NPT A;  3P4S B;  1SWW A;  2BKE A;  2YVF A;  5J0O A;  3ISC A;  2R8H A;  4G9B A;  2I1Q A;  5J8Y C;  2ZZB A;  2GRT A;  1FXA A;  4IL0 A;  2DF4 B;  5FS6 A;  3NZU A;  5J0S A;  1KBU A;  3AE2 B;  4PT5 A;  4Q45 A;  4QZB A;  1BPZ A;  1R4M I;  2KVC A;  1NBF C;  2RDG A;  3PSI A;  5CHV C;  5AIB A;  1VAO A;  3OGU A;  4PH5 A;  3MWC A;  4RUA A;  1RDF A;  1ZD2 P;  4AYB C;  2IGH A;  3F5E A;  2CHX A;  3PWI A;  3UJF A;  3SV3 A;  1ZQV A;  3W1S A;  4O5E A;  9ICE A;  2ASD A;  3N7R C;  4RCO A;  3PWG A;  1B43 A;  1SE4 A;  2C22 A;  3SZ2 A;  3ZKJ C;  5HHZ A;  4PPX A;  1GSN A;  5EBK A;  1SKS A;  2PJH A;  3O13 A;  3BZK A;  1Z2M A;  3WCQ A;  1ZW7 A;  1UXY A;  3DBH B;  3N9Y C;  2DNF A;  3UF8 A;  3M9N B;  2BCV A;  3BYY B;  1PDZ A;  4YSY B;  2GB1 A;  1PK3 A;  3IHQ B;  5BO4 B;  2Z7J A;  3BZD B;  2ZTC A;  5ALR A;  3M63 B;  4DHJ B;  4AQ7 A;  3I63 C;  1WGY A;  3PRE A;  9ICT A;  1RLF A;  5JRT A;  4FJZ A;  1WYW B;  8ICG A;  4GDL B;  4PYZ A;  3QN3 A;  4MGY E;  4PYT A;  2K60 A;  3S1C A;  4LZD A;  2YAU A;  5KFW A;  3DEE A;  4ED3 A;  1H8C A;  1GRT A;  5KFQ A;  5ALI A;  2WF5 A;  5KT4 A;  1SSN A;  1YJJ A;  3I6E A;  2INC C;  2ODG A;  3PST A;  1SJA A;  1SV0 A;  1SBB B;  3IJL A;  3ED5 A;  1U48 A;  5L95 C;  2KIV A;  2J6T A;  3OSN A;  2E3T A;  8ICS A;  1DOY A;  5T14 A;  5ALL A;  2MJD A;  5IIK A;  4PK1 A;  2E6X A;  2DZM A;  4FDC B;  2ZIV B;  1JAL A;  4JMU A;  2GBM A;  2HW3 A;  5JXV A;  1WVE A;  2FCM A;  2CXY A;  4II3 B;  3GII A;  2B76 B;  2ZVN A;  4B6W A;  1QLT A;  4PS3 A;  4EUT A;  3LVV A;  3QXG A;  4I2G A;  2K25 A;  5KFF A;  1S9F A;  6ENL A;  2YEP F;  3LB8 C;  4JV0 A;  2DZJ A;  1FHU A;  4E4U A;  2RLT A;  4C0Z A;  3PX0 A;  3HIL A;  4K8G A;  1TS2 A;  3WIM A;  2GQT A;  3AEV A;  1JQ4 A;  3B9J A;  4M6W A;  1NK0 A;  5E79 U;  1TYG B;  2FE8 A;  3ZRF A;  8ICC A;  3E56 A;  1A70 A;  1XCQ L;  3WKA A;  3O0F A;  5AZF A;  2LJI A;  2Y3S A;  4LJO B;  1P1A A;  4KKJ A;  2BS4 B;  4WH4 A;  4ED7 A;  4E74 A;  2XH4 A;  4MM3 B;  2HMX A;  3THV A;  1T0Q C;  2I6X A;  7ICQ A;  4FBJ B;  3P4Q B;  3VHT C;  2V1Y A;  2NTT A;  3RRA A;  1J7C A;  2IJ0 A;  3EA6 A;  2BYT A;  3JPQ A;  1IG6 A;  3A9K A;  2L8J A;  1ECW A;  4FE3 A;  4O5C A;  2KO3 A;  4MGK E;  3S1E A;  3LLB A;  1Z00 B;  2NTS A;  5K8E A;  3AB5 A;  2I5H A;  2RDH A;  3ZNG C;  3UJ2 A;  4H4Z A;  4HN8 A;  3HRD D;  5IP4 D;  2M9N A;  5L1L A;  5FKA C;  2JWZ A;  1ZMD A;  3NRZ A;  1AYF A;  5F9N A;  1XLN A;  4FLH A;  3HUI A;  1F44 A;  2FLN A;  1LPF A;  1WRD B;  2AL6 A;  2N0S B;  5ALM A;  3L5K A;  5HHI A;  4QZI A;  4I28 A;  3RJA A;  2WP5 A;  2IO3 B;  2PIA A;  3PY8 A;  4DXA B;  3Q3N C;  3ENE A;  2KMD A;  3PMN A;  2JEI A;  4R65 A;  3F2B A;  4DSK A;  2BKF A;  1ZXH A;  3HVZ A;  2ISP A;  1P0R A;  2NS5 A;  1PK1 B;  4ZOH C;  2QIE B;  1V1P B;  5J18 A;  1GC7 A;  1KN5 A;  2IO1 B;  2XGZ A;  3URH A;  4XDD A;  1K4Q A;  1WYG A;  2WB1 C;  4DOB A;  4IT1 A;  1CJE A;  4DQI A;  4KLT A;  3AMZ A;  2H89 B;  4JN7 A;  1GC6 A;  2EAP A;  3GE3 C;  3V60 A;  1HJP A;  2IZV B;  4RMA A;  4M47 A;  3IHP C;  1E8Z A;  1LKY A;  3KTQ A;  4NLG A;  1FFU C;  1E90 A;  1RM6 C;  3UXO A;  1PVP A;  1ROE A;  4DK5 A;  4KLL A;  3H8J A;  5AKI A;  4P4P A;  1KLG D;  3LWM A;  4KLI A;  4QAY A;  4FUL A;  3DVN V;  2R2Z A;  4W9D A;  3MGV A;  4KLF A;  5IOI A;  1LXD A;  3V61 A;  1YT3 A;  2NQW A;  4A20 A;  5DKW A;  5J2K A;  9ICG A;  2DL0 A;  2LHE A;  4O95 A;  3MFI A;  3TSJ A;  3AH7 A;  2C28 A;  3DBL I;  1ZQX A;  4Q8F A;  5BPC A;  1DTN A;  2OZ3 A;  2D3G A;  4N59 A;  2K4P A;  3MR2 A;  4EEK A;  1KW4 A;  2WHE A;  4KLG A;  3DPD A;  4IM0 A;  3QFA A;  1PGB A;  4BFR A;  4HNL A;  4E5T A;  5KFB A;  1HEZ E;  2KTR A;  5IAA C;  3R25 A;  5DB9 A;  2DLB A;  5ALQ A;  4ELV A;  2PMV A;  2W55 A;  3DWM A;  2A1J B;  2W54 A;  3CGC A;  5D49 A;  1LVL A;  4KX3 A;  1NZB A;  1L6N A;  2SEB D;  4HNC A;  2IOF A;  3NAS A;  1YIW A;  3AU5 A;  9ICI A;  2F1I A;  1NNL A;  1HIW A;  1L5P A;  2KFK A;  1JRO A;  5D7G A;  3Q45 A;  3ZDC A;  1WM3 A;  3KZX A;  3EPG A;  2LBO A;  4HRO A;  4KZ0 A;  9ICK A;  3C1Y A;  2XCA A;  4LDT B;  4IHC A;  1V2Y A;  1ZK7 A;  1D6E C;  1YQ4 B;  3PVL A;  3CAW A;  2PXI A;  3BII D;  5JHB A;  3HWT A;  3Q14 C;  4K3B A;  2AQ4 A;  4ED2 A;  4P1B C;  4RF0 A;  4W9J A;  3RNA C;  1FEB A;  2P4P A;  5DDM A;  1U4A A;  4R66 A;  2QSD A;  3UMG A;  2D3B A;  1KLV A;  4GIR A;  3W9C B;  4BZA A;  2KDI A;  3C21 A;  2XK5 A;  4PZF A;  2MSE D;  3R0U A;  1Z4N A;  5HR7 A;  3JZU A;  1VD2 A;  2ONE A;  2KAN A;  3ZUN A;  3QUQ A;  5AKE A;  1MG4 A;  3PNC A;  2M56 B;  2E5S A;  1SKR A;  3ZVH A;  3AL0 B;  1SL0 A;  4KT2 A;  1Q5W B;  2CHW A;  4CCH A;  3VRB B;  2IBI B;  3QE9 Y;  1U9L A;  1CQV A;  3N30 A;  1V5O A;  2AQ3 B;  1L7P A;  3B2G A;  3T5J A;  4B9M A;  2W9N A;  2ZPN A;  4RM9 A;  1ZXI C;  1TYT A;  1FNW A;  2WDQ B;  3RUI B;  4JV1 A;  2AKM A;  1XEE A;  5ALY A;  2WPC A;  1SEB D;  3WKD A;  4GXB A;  1WXV A;  1ISN A;  9ICO A;  2C7N B;  1VZ7 A;  3M3J A;  2PPH A;  3PPA A;  5AK4 A;  4DWD A;  3QKE A;  5KFL A;  1QSY A;  3HKZ F;  3N1X C;  5IIM A;  4ED6 A;  1W1M A;  4PVE A;  1S0M A;  4IR9 A;  5AUI A;  2AEH A;  1S97 A;  5KFC A;  2Y3R A;  5KTQ A;  1QOB A;  3RJE A;  5AI5 A;  1UQV A;  1ZMC A;  2E8N A;  3UQB A;  1KFS A;  1Q3V A;  2K8B A;  3FXG A;  4GN1 A;  3I4K A;  1TIF A;  3VTU A;  4E3C A;  1UT5 A;  1NVI D;  2LGX A;  1KCZ A;  2LXA A;  5G5H A;  3AEC B;  5JRB A;  1PDX A;  1AHV A;  4I2B A;  1W1O A;  4JIO U;  4PL1 A;  4NQK E;  4R8U B;  1JI7 A;  2L7R A;  1I35 A;  1YQZ A;  4WQO B;  2E8P A;  1UUP A;  1T8E A;  4K3C A;  3HKZ C;  2YEP B;  1FCL A;  5L1K A;  1KF6 B;  2PI5 A;  2ZCC A;  3GS2 A;  3SR6 B;  2DAJ A;  1W1L A;  3C5G A;  2PA6 A;  2G1E A;  3BW7 A;  3RBD A;  1EU3 A;  1T0Y A;  1VR9 A;  3HM6 X;  3RT3 B;  1NHQ A;  4L2Y A;  1ZET A;  1ZP0 B;  3BWU D;  5AI4 A;  4BDP A;  4UB5 A;  3PM9 A;  5DBB A;  1QIL A;  2GR0 A;  3TAN A;  2D8C A;  3GO2 A;  3V7K A;  2PLI A;  5TZV A;  2WPF A;  4Y2P A;  3DG6 A;  2OM6 A;  3H7I A;  3V72 A;  2WXO A;  5HQX A;  2FCQ A;  3DEQ A;  4RQM A;  3ZRC A;  3SFE B;  1N60 A;  3OHB A;  3IG3 A;  1D3Z A;  2MRL A;  2FBW B;  3E9S A;  5AE1 A;  5EU9 A;  2HOQ A;  3BQT A;  4GSW A;  4XE0 A;  1YN3 A;  1ZQR A;  3PO5 A;  2H3I A;  1QOA A;  3ZLH A;  1XT9 B;  4P6V F;  3OJS A;  1F0Z A;  3TSH A;  2KFJ A;  4RGO S;  3QFB A;  4GYP C;  2XC9 A;  2BPF A;  3D2D A;  2HBJ A;  8ICE A;  4PS8 A;  2X8G A;  1WCN A;  4RQ0 A;  4RQ8 A;  4F1S A;  2DGZ A;  5DLG A;  5D6J B;  2G9H D;  3TEX A;  1Z1V A;  1ZQS A;  2GQU A;  4Y2V A;  2ZEQ A;  2HVI A;  1S0V A;  2CKH B;  3VVW B;  3FW9 A;  5DBA A;  4YN4 A;  1TVA A;  2L0T A;  2C5L C;  3Q3M C;  4ANX A;  1K5O A;  1TY0 A;  2PI4 A;  1R6W A;  2YN4 A;  1MFW A;  1X1M A;  2RSU A;  1XNS A;  5F3X B;  1TZ1 A;  2F44 A;  4GFJ A;  2BPS A;  4JWU C;  3CGE A;  4HCH A;  3IAM 1;  2PTY A;  2AL2 A;  4UAT A;  3D2S A;  1RM6 B;  4XLO A;  5JUM A;  4ARC A;  1D7Y A;  3DBL B;  4F92 B;  1TK5 A;  2QKQ A;  1CZP A;  4JDR A;  2VH2 A;  1U4B A;  3MSY A;  2F3N A;  3O65 B;  4IQT A;  1C78 A;  2JWU A;  8ICX A;  3ZLF A;  2O6V A;  2PP0 A;  1ZDV A;  4HRS A;  4UB6 U;  1UEL A;  2PU0 A;  3OZM A;  4KLU A;  4KKI A;  1D5Z C;  2P6U A;  2Z0E B;  5KG2 A;  2HD5 B;  1KJT A;  3TJP A;  1KM7 A;  5AM2 A;  5CP2 A;  2ES6 A;  2BGF A;  3H4D A;  4RM8 A;  2GI9 A;  1XQQ A;  2ASL A;  2L0F A;  4RPZ A;  1F8W A;  3KUD B;  2M19 A;  1NJX A;  3P0W A;  2WDW A;  2LFI A;  1T4G A;  2AGP A;  4KLS A;  3PX4 A;  4HPP A;  3QUC A;  2O2V A;  2LWP A;  4I6L B;  3DVG Y;  1QZE A;  4X5V A;  2GSH A;  5CTR C;  3NVY B;  3KLJ A;  2FI1 A;  2FID A;  4KGT A;  4JHM A;  3SN0 A;  1SJB A;  3TMP B;  2YB4 A;  1E8G A;  4TMA B;  4YP3 A;  3OPX A;  4FJV B;  4DQO C;  4YL8 A;  4GIS A;  3SN1 A;  3TAD C;  8ICQ A;  1KLN A;  3SD5 A;  4UQG A;  4GME A;  2K22 A;  4C4T A;  4DCC A;  4F50 A;  1XSL A;  1ZQP A;  2BYE A;  2KQS A;  4OJL A;  4LLG M;  3UJR A;  4EM3 A;  1SE9 A;  4YSX B;  4AP4 C;  3EUB 3;  4RQ4 A;  1WX7 A;  3JW7 A;  4ED1 A;  1ZD5 A;  1M4V A;  3V6C B;  3L8K A;  1DGJ A;  5D4B A;  1NDA A;  3N6J A;  1X40 A;  5J29 A;  1A0P A;  2ASQ A;  5KG3 A;  4B9S A;  1QQ7 A;  2FDR A;  2GLS A;  4MJS B;  1E10 A;  4YR0 A;  4Y2J A;  1FEZ A;  2F8K A;  1V80 A;  3KBB A;  1NEL A;  3BQ7 A;  1OGW A;  4XWT A;  4MFC A;  4Z6C A;  3L54 A;  4F5R A;  1SZP A;  4G3X B;  5DQI A;  4IQU A;  1N48 A;  1IBX B;  1ZQK A;  3TEY A;  2D3D A;  2ZG6 A;  2HBK A;  5ALN A;  4GC6 A;  2L5Y A;  1FFV A;  1ZD4 A;  4JB3 A;  2EAO A;  3ISB A;  1MPE A;  2OWO A;  2CU3 A;  2E5A A;  4C8M A;  2DZK A;  1TJE A;  2OJR A;  2Y4G A;  5IKC M;  1XXG A;  3D32 A;  4YVZ A;  2WF7 A;  4BV6 A;  3M7D A;  2JMG A;  2PTZ A;  3BQ2 A;  3V05 A;  2KIW A;  4MF2 A;  4EZK A;  3H9D A;  3QAR A;  1ZQY A;  3NVV A;  3ZQ4 A;  4HJK A;  1NI3 A;  2WDT B;  2ISO A;  4J9Q A;  7ICF A;  2QVH A;  1PUT A;  2EEL A;  2O6V B;  1N62 C;  4F91 B;  2JY6 A;  4FP1 A;  1QLB B;  5L6F A;  5FXD A;  3C0R B;  3IP4 B;  2BQ3 A;  1CUK A;  3W2D A;  3H4K A;  3UXN A;  1TAQ A;  3SV4 A;  2RDB C;  1ZPS A;  3U2S C;  3DQV A;  3A9J B;  4RGM A;  1H2I A;  2DHZ A;  4YQW A;  3TTE A;  3T5L A;  1JRP A;  5C5J A;  3AEE B;  2VFV A;  2CN1 A;  3L13 A;  3MQT A;  3RBE A;  1I4H A;  4DNS A;  3VCC A;  4F4R A;  3GZF A;  5FXF A;  1V86 A;  3H8A A;  2MH7 A;  4EZ9 A;  1YX5 B;  3UQ0 A;  2PFP A;  2ZUB A;  4XGA B;  2KZZ A;  1HE8 A;  4YMN A;  2M0A A;  5C23 A;  4AS1 A;  2MBQ A;  1KL9 A;  1C4A A;  5DGA A;  1KFY B;  3SEN A;  1WE7 A;  1N63 A;  4OZA A;  2GGG A;  1Y88 A;  5KG4 A;  3WKE A;  3T9L A;  2NR2 A;  4ZA0 A;  3JYU A;  2KIC A;  1E7V A;  2YVS A;  1I42 A;  3NS1 A;  1IIP A;  3DGB A;  4I27 A;  2KAJ A;  4RUC A;  3QZ8 A;  3UIO B;  1KD0 A;  7ENL A;  1T5X D;  7ICR A;  2MW5 A;  1QLU A;  1RFA A;  3EF6 A;  3GRT A;  2KJR A;  4AOF A;  3W5V B;  2Y0S C;  2LHD A;  5KFZ A;  1EWC A;  2ACZ B;  1WMH B;  3OJ4 B;  5CB1 A;  4K2S A;  4IDI A;  1D4B A;  2ZZP B;  3D2J A;  7ICK A;  3KUM A;  2LI6 A;  5ALT A;  2K39 A;  3BK1 A;  4PVK A;  2ZAD A;  2EZX A;  2YVG A;  3MBY A;  2ONQ A;  5GXG B;  5KVI A;  4DWF A;  1RVK A;  1FEH A;  3NS8 A;  5DQG A;  3SAH A;  3RJI A;  2JH7 A;  3T5H A;  4UB8 U;  2WX1 A;  1QQ6 A;  3AE6 B;  3KWV A;  2AL1 A;  4EYI B;  4NAM A;  4QWD A;  2BWE S;  4QWE A;  2ZUD A;  1SJE D;  3MFG A;  5CRX A;  8ICI A;  3UCC A;  3U26 A;  2KOX A;  4DHZ E;  2M8S A;  4ZRJ A;  4GXI A;  3Q8Q B;  3TUO A;  2KHW B;  3RFZ B;  3JPP A;  3P63 A;  2YQE A;  3MHS D;  4M02 A;  5HKH A;  1UHU A;  1RYS A;  2ZIX A;  2J52 A;  2IPI A;  1WWV A;  3KYC D;  2HHV A;  3CWI A;  3H12 A;  2HSZ A;  2MLB A;  2HJ1 A;  1J97 A;  4FZL A;  2WXQ A;  4H4V A;  3ZJT A;  3JPR A;  4EMI A;  1YJ1 A;  1I7H A;  5C2T B;  4NAW B;  4H4S A;  1QH9 A;  1NKE A;  1MQ2 A;  4K4I A;  1OUQ A;  2G4D B;  1KSP A;  1HTO A;  1NK5 A;  1K53 A;  3HRD C;  4K8D A;  1AW7 A;  5BOE A;  2K0P A;  3I76 A;  2KJ6 A;  8ICY A;  2YY6 A;  2KJ8 A;  2EXR A;  2AGQ A;  2BYV E;  2DZI A;  3H7V A;  2GGJ A;  8ICV A;  5L9X A;  5CHG A;  4TQ1 A;  2VFU A;  4J03 A;  4Y2T A;  3ML9 A;  2OZT A;  5FJP A;  4PHP A;  4HDQ A;  7ICE A;  1WVF A;  3ALB A;  1NEK B;  4F4Z A;  5FMH A;  4ACO A;  1YNT E;  2X8C A;  1BPB A;  4BXO B;  3VRA B;  2DW6 A;  5J0T A;  1WWT A;  1GJZ A;  3IG5 A;  2KDF B;  1X2I A;  2CHZ A;  4LTU A;  3BS7 A;  3V6E B;  4EZJ A;  7ICU A;  2HBM A;  4OD0 A;  2UVW A;  4A3P A;  2KJ5 A;  4US9 A;  3Q8C A;  5AK6 A;  1C20 A;  5JCM A;  3DBR I;  1IV8 A;  4HJG E;  2OKT A;  2QB0 B;  3EEZ A;  3RPF C;  2W03 A;  2KDB A;  4TQ0 A;  2BCP A;  3PW7 A;  2L52 A;  5G55 A;  1AWD A;  2DYM A;  5AEK B;  5IIL A;  2KWV B;  2WHI A;  1GNU A;  3NS1 B;  8ICM A;  1L6V A;  3LK9 A;  4BX9 C;  4MSQ B;  2V3B A;  3NO1 A;  3K1R B;  3RH6 A;  7ICJ A;  2GMI C;  2KNB A;  3W5U B;  4HAI A;  4ECW A;  2J0K A;  4CHK A;  1F77 A;  1FHV A;  1OFF A;  4TV3 A;  4NLZ A;  3FWA A;  4F7Z A;  2P3H A;  3JPT A;  5ALX A;  4DQR A;  3PZD A;  1UA0 A;  3M9O B;  1X9X A;  2JXX A;  4RQ6 A;  2VFR A;  3UPQ A;  5DLF A;  4F4Y A;  2BS2 B;  5JU5 A;  4ECZ A;  2X50 A;  5AM4 A;  5CHF A;  3IDW A;  3FKY A;  4H2H A;  4PVJ A;  5JCK A;  1SXD A;  3NY5 A;  1J8C A;  4C8L A;  5J2J A;  4CO7 A;  3TAR A;  3CYJ A;  3HPF A;  3C23 A;  2BT6 A;  5AI0 A;  4GDL A;  4N6E B;  2OCE A;  2C2R A;  4W9E A;  5ALU A;  2LAS A;  3S6J A;  3V6J A;  3QX1 A;  4UAY A;  3CF6 E;  1VJ5 A;  3OTQ A;  1GG3 A;  4Z6E A;  1MHH E;  3Q3O C;  3H40 A;  4FS1 A;  4EFO A;  1EBD A;  2PFQ A;  2KWC A;  2V9W A;  2P66 A;  3AED B;  4PZN A;  2WXJ A;  3W8X A;  4ED8 A;  3KKA C;  2LRW A;  3DOW A;  1HA5 A;  1Q8K A;  2ZIV A;  2LRU A;  5U1O A;  3OLM D;  1M94 A;  4E4F A;  2LKY A;  4F93 B;  4DSL A;  2LUM A;  2L83 A;  3VC8 A;  2G45 B;  4Y2R A;  4JUZ A;  1BZL A;  2FLP A;  4L1B A;  3D47 A;  4FX9 A;  2LYB A;  5D3D A;  4FZN A;  4E0D A;  1TKG A;  2FE9 A;  4DXK A;  2OXO A;  9ICN A;  3RMK C;  3WAN A;  1N5W A;  4GXK A;  1EXN A;  3H8W A;  2UVU A;  1JIH A;  3IXS A;  2KC1 A;  2BHN A;  3VCN A;  1XDI A;  2QCZ A;  2B3A A;  1COO A;  4G50 A;  4OJP A;  4P0Q B;  3TL5 A;  2GR2 A;  3R11 A;  4K7Z A;  4ICA A;  1V8C A;  1B22 A;  4BKG A;  4XX5 A;  4PGQ A;  4QW9 A;  2B6G A;  1NKC A;  3V6H A;  4GOC A;  3G6X A;  5I1V A;  3APD A;  1N2X A;  2MA1 A;  4RQ5 A;  4KLJ A;  1W1S A;  4FZM A;  8ICK A;  2OJW A;  3BY4 B;  1WX9 A;  4MM3 A;  4C7Z A;  4DFJ A;  3GP7 A;  2HHX A;  4NJC A;  3G6V A;  3DV9 A;  1JWS D;  2KN5 A;  2X38 A;  3PW4 A;  1MHX A;  2MNR A;  2QJN A;  2SAK A;  2BW2 A;  2DWQ A;  1YMH E;  2JSV X;  3ONS A;  1T3Q C;  1WUF A;  3N4E A;  4O9M A;  4KDI C;  4EBE A;  8ICU A;  4K7U A;  3TIX A;  3TJI A;  4BUR A;  2N7D A;  4G0N B;  2RRD A;  5AI8 A;  1Z00 A;  3MC0 B;  2A4Z A;  2A5U A;  2JZ3 B;  2XY6 A;  1P98 A;  1ZDX A;  3RUL A;  2KQ4 X;  2PS2 A;  2A19 A;  2RDX A;  3QU5 A;  2WBA A;  3A1Q B;  3AEA B;  1OXJ A;  5KT7 A;  9ICP A;  2WOV A;  3CK5 A;  3CRX A;  3QIJ A;  5ALF A;  4R63 A;  1ZQB A;  3HX0 A;  1ZY8 A;  3W8W A;  4F4K A;  3PLV A;  1KLU D;  4O3N A;  3G6Y A;  1U47 A;  3X23 A;  2W9M A;  4QZ8 A;  4M9N A;  4EE2 A;  3EUB 2;  1XSP A;  4B0M A;  2WYQ A;  3UXK A;  3VUX A;  1BPD A;  1OEY A;  1LQB A;  4MEX A;  5KFM A;  3MC9 A;  4M9G A;  4M8N A;  1PK1 A;  3JPN A;  2IBK A;  5FJU A;  1K1Q A;  1V1P A;  3ECI A;  4IUM B;  3JW0 X;  4MAC A;  1X6J A;  2F1H A;  4KIK B;  2WOI A;  1HZ5 A;  3P42 A;  3UJE A;  3KHR A;  2FKP A;  1B1Z A;  4IC7 B;  4QIW F;  1A77 A;  5H2F U;  3RIT A;  2LEK A;  2W82 A;  7ICH A;  4Y2X A;  5KG6 A;  9ICQ A;  4WIP A;  1ZJM A;  2N7E A;  1W1J A;  3A7U A;  1QCK A;  3N7P D;  2CHR A;  1I4P A;  4QZD A;  1UBI A;  2IGG A;  2MBR A;  1Z1B A;  3RH4 A;  2ZW1 A;  5J0P A;  3NVZ B;  2JRI B;  1MRA A;  1OTR B;  1TBE A;  3GU3 A;  3IBE A;  2QAR B;  1VDV A;  2MAX A;  2BGW A;  3BVG A;  1ZQW A;  2WXF A;  3RB0 A;  3QJZ A;  2HZG A;  2Q5W D;  3HM3 A;  4EEL A;  4A8E A;  1KRH A;  4EX7 A;  2FMP A;  2HTH A;  4OZB A;  3DQ0 A;  1SZH A;  3P93 A;  3BS5 B;  5J8Y A;  2JEG A;  4O3R A;  1MI0 A;  3DBR B;  3CST A;  4LCD E;  2XH7 A;  3KZI U;  3LDZ E;  2A1J A;  1BPX A;  4BKS D;  4JX1 C;  4FAD A;  3H0R B;  3IAS 1;  5KHO A;  2HTM E;  3ZNZ B;  2CJO A;  1WJ4 A;  1PQS A;  2GDQ A;  1ONF A;  1TKY A;  4EOY A;  4YWS A;  4TUR A;  4LNK A;  1CRX A;  1P9D U;  5C1Z A;  3NZ3 A;  4NZL B;  2OED A;  2GBJ A;  1GET A;  8ICL A;  3UXL A;  1RQN A;  4Z6F A;  1ZQQ A;  3M1Y A;  3F2C A;  1WSP A;  5FJO A;  4M6U A;  1CI4 A;  2KYW A;  5BOM A;  4KV2 A;  3AU2 A;  2QMT A;  1DOI A;  3BVM A;  3URY A;  4CQN A;  1YN4 A;  3WK8 A;  3OPS A;  2ZJD A;  1TE6 A;  2WXK A;  4M9H A;  1XHC A;  2R2O A;  1O03 A;  4QZF A;  9ICV A;  4BWM A;  1BT0 A;  2KWD A;  4W9H A;  3PQB A;  4ZH4 A;  4DL6 A;  4JWS C;  1LVH A;  5CA7 A;  3C28 A;  4XZ4 A;  4Z17 A;  3LAE A;  3KH0 A;  2NBV B;  4CRX A;  1EF5 A;  2MHJ A;  2MEK A;  1I4R A;  4QJF B;  3FW7 A;  4IM3 A;  4RPX A;  1YN5 A;  1D9F A;  3D46 A;  3POP A;  4GXJ A;  2QLT A;  3SEI A;  1QOG A;  4HYK A;  1ZE3 D;  1L7Y A;  2LUE A;  1NHP A;  1PZN A;  2BTE A;  3FC4 A;  1TS5 A;  4K1R B;  2ZIU B;  4OHJ A;  1C4C A;  4UBB A;  3LXF A;  3AM9 A;  5FR6 A;  2NYV A;  2JGA A;  2ICI A;  4YT0 B;  1J2N A;  1SF0 A;  3VR9 B;  4BAX A;  4C8K A;  4WQM A;  1AHZ A;  4F3O A;  1MO9 A;  3GV5 B;  5JTI A;  2KT7 A;  1SE2 A;  3HVD A;  4MH8 A;  4CF4 A;  5KFU A;  1ZQD A;  2H88 B;  3LB8 A;  3FIL B;  2J42 A;  3FDS A;  3QZ7 A;  5FP0 A;  4QW8 A;  4QZE A;  3SHQ A;  3T3N A;  2G07 A;  3GB1 A;  5KT2 A;  3MGI A;  5IIN A;  4MH0 E;  4LJX A;  2OVL A;  2WNM A;  4W9I A;  1XF5 L;  3Q69 A;  3JVZ X;  3ZDE A;  1W1Q A;  3F5A A;  4RQ2 A;  3HJE A;  1XCT L;  1Q46 A;  2JF5 A;  5FS7 A;  1ELS A;  1X9M A;  4UAZ A;  5GTI U;  1RRB A;  1R4N I;  4R8U A;  3HIZ A;  2W7P A;  9ICC A;  4LNN A;  4BOS C;  1DIQ A;  3SR6 A;  4H4P A;  1DK3 A;  2D6F C;  5DB8 A;  1NYQ A;  2PFN A;  1FMA D;  3GE8 C;  5AK5 A;  1UGM A;  2R9Z A;  3T6C A;  2MRP A;  1L8L A;  1S0O A;  5KNI A;  1F5S A;  4DLG A;  4ECQ A;  3AEG B;  3ZW3 A;  1L3S A;  3OJU A;  4DSI A;  4QZG A;  1R4M B;  4M8M A;  3OW1 A;  3PHW B;  3TQP A;  4H83 A;  4NM1 A;  3PSF A;  2AXR A;  2FNJ B;  2CS4 A;  3VCB A;  1EO6 A;  4KLD A;  1JRU A;  4EBD A;  2HBL A;  3ORY A;  4DL4 A;  1J7A A;  1L0V B;  2CFY A;  1NK6 A;  1T7P A;  3J9C A;  4TVW A;  4QZ9 A;  2G08 A;  4UW9 A;  5KT6 A;  3OG5 A;  3ZYY X;  3GIL A;  4EMJ A;  8ICB A;  4NEV A;  2JUO A;  4EZ6 A;  1NEN B;  2LM4 A;  2Z59 B;  4NXZ A;  4F71 A;  2WTF A;  3AE9 B;  4ADW A;  4ANU A;  5C3J B;  3DES A;  4M01 A;  4FBT A;  1WCL A;  3D2Q A;  2N1R A;  1WUE A;  2XCP A;  2W8K A;  4QNL A;  2RQ5 A;  1KRP A;  4DQQ A;  3L08 A;  3KLS X;  5T8I A;  4YSZ B;  2PP1 A;  5G5G A;  5GRT A;  3Q8R B;  4EQX A;  1HEK A;  4ICV A;  5KL8 B;  2BCS A;  1C77 A;  4KLE A;  2BB5 A;  1KQQ A;  3AU6 A;  2JYE A;  4NJ8 A;  1ZQO A;  4C8O A;  1NHS A;  4RZR A;  4M2Y A;  2EDU A;  3IM1 A;  8ICN A;  1XO3 A;  1AHU A;  2DEN B;  2J0J A;  1FFU A;  3OWE B; 
#chains in the Genus database with same CATH homology
 3AV8 A;  1M4V A;  2GRI A;  1SXT A;  1DGJ A;  3FW8 A;  4MT5 A;  1TS4 A;  2AX5 A;  1ET6 A;  2D5G A;  1N5W C;  2Q85 A;  3HSU A;  3FAH A;  1T3Q A;  4GDK B;  1OQR A;  1E10 A;  3Q8F A;  1GAQ B;  3ETR B;  1N61 A;  2IDY A;  1E9M A;  5BMG A;  3ZJU A;  2JU6 X;  4XWT A;  1FRD A;  2W3R A;  2J53 A;  1SB3 C;  5HG2 A;  1IBX B;  3TEY A;  3L4P A;  1E8H A;  3C0P A;  4TVY A;  1FFV A;  4A6Q A;  1FNV A;  3U4E G;  2BBC A;  1MPE A;  1K51 A;  2QIL A;  2CU3 A;  1RFK A;  2E5A A;  5EE0 A;  1TJE A;  4KX6 B;  1XXG A;  1I4X A;  5FXP A;  1FIQ B;  5AE1 A;  2FUG 1;  3NVY A;  3V05 A;  1L4D B;  1YQ3 B;  2AQ1 B;  4ZYS A;  1STE A;  1L0Y B;  3B2F A;  1AN8 A;  2INN E;  5TSS A;  4RF1 A;  4UD8 A;  5FXE A;  1J7B A;  1FXI A;  3NVV A;  3ZQ4 A;  1BML C;  1NI3 A;  1VZ8 A;  4N58 A;  2VFT A;  5AWV A;  1PUT A;  2KMM A;  1D5M C;  3D2H A;  2EEL A;  3S1D A;  1N62 C;  5L6F A;  1QLB B;  2WQY B;  5FXD A;  4BCA A;  2CJN A;  3W2D A;  5BYQ A;  4WWM A;  1ZR6 A;  2N7J A;  1XLP A;  1ZPS A;  3U2S C;  2K5P A;  3TEZ A;  4RGM A;  1P7E A;  2DYO A;  1C79 A;  1DOX A;  1JRP A;  2WXN A;  1KH0 A;  2WU5 B;  2Y5C A;  3AEE B;  3P1M A;  1I4H A;  1YJI A;  1UGJ A;  4LK0 M;  4OZC A;  2VFV A;  4DNS A;  2QPM A;  5FXF A;  2BVF A;  2MH7 A;  2OAI A;  1QKZ A;  1ZXI A;  5G5G B;  1HZ6 A;  1IGD A;  2M0A A;  4JPS A;  4AS1 A;  4ZOH B;  1C4A A;  3BVZ A;  1KFY B;  4OZA A;  1RYJ A;  1N63 A;  5FR3 A;  1IBX A;  2N9K A;  2L1A A;  2AQ2 B;  2QJL A;  4RGT A;  4WUR A;  5AUK A;  3R8B A;  4ARI A;  1E0Z A;  1FRR A;  2YVS A;  1I4Q A;  4TSS A;  3NS1 A;  2V0G A;  3Q8E A;  2KAJ A;  1T5X D;  2JX5 A;  5E6J A;  5L6G A;  1QLU A;  3KQ4 A;  1FIQ A;  2Z8L A;  3W5V B;  4JB1 A;  3DED A;  2PLS A;  2LHD A;  2ACZ B;  1EWC A;  2UUV A;  4OVZ A;  4IDI A;  4ZRQ A;  2PVO D;  4RH6 A;  1D4B A;  2BS3 B;  2LGI A;  3D2J A;  1SIJ A;  1QT9 A;  3BK1 A;  4RGN A;  2WU2 B;  3I99 A;  4PVK A;  2WDR B;  3MP9 A;  2VFS A;  2RMM A;  2ONQ A;  3P4S B;  5GXG B;  2WXL A;  3UI3 A;  1FEH A;  2V3N A;  3AE5 B;  4ZHO A;  1DII A;  1FXA A;  4PVH A;  3KWV A;  4H2A A;  3AE6 B;  5BYR A;  3AE2 B;  4NAM A;  4PT5 A;  5FK9 C;  1EWY C;  1SJE D;  1P7F A;  3MFG A;  4KGR A;  2I2Y A;  1ZOY B;  1HQR D;  2RDG A;  3AEB B;  1JCK B;  1VAO A;  1DZN A;  4IKG A;  2J4X A;  2IGH A;  3TUO A;  3RFZ B;  2DBY A;  3B9J B;  3W1S A;  3P63 A;  4BC7 A;  4RCO A;  3C8Y A;  1SE4 A;  3H8H A;  2J52 A;  5HHZ A;  2IPI A;  1UWX A;  4JAY A;  3CWI A;  1WXQ A;  3O13 A;  1GB4 A;  4YTN B;  3V3X A;  3WCQ A;  1MBB A;  4Q2J A;  4HKQ A;  3MHZ A;  3N9Y C;  2WXQ A;  4HEA 1;  1UXY A;  3ZJT A;  3BYY B;  2WP9 B;  4YSY B;  1I7H A;  2GB1 A;  2PLP A;  4NAW B;  4L23 A;  3BZD B;  5EE9 A;  5C2T B;  1VZ6 A;  1ET9 A;  1K52 A;  4AQ7 A;  1L4Z B;  2WXH A;  1WGK A;  4M0W A;  1K53 A;  3HRD C;  4OAL A;  1AW7 A;  5I1W A;  2K0P A;  4GDL B;  4PYT A;  3S1C A;  2EXR A;  4B0E A;  1HXY D;  1SSN A;  1YJJ A;  4TQ1 A;  3VQI A;  2VFU A;  4BBY A;  3RJ8 A;  1WVF A;  1SBB B;  1NEK B;  4XDC A;  1YNT E;  3W8Z A;  4KGS A;  2XNA C;  3VRA B;  2E3T A;  2JYT A;  1DOY A;  1VLB A;  1WWT A;  2MJD A;  3NRZ B;  2Y4G A;  2E6X A;  1ACC A;  1N60 C;  1JAL A;  2WXR A;  4LTU A;  4BC9 A;  5JXV A;  1WVE A;  4C7Y A;  2WDV B;  1EU4 A;  2B76 B;  5EE3 A;  1QLT A;  1PGA A;  4US9 A;  3Q8C A;  4HJG E;  3RPF C;  4C80 A;  1BUI C;  2YEP F;  1FNU A;  3LB8 C;  3LYY A;  4TQ0 A;  2L52 A;  1LO5 D;  1AWD A;  2DYM A;  1PYW D;  5BMH A;  2KDM A;  1TS2 A;  2GQT A;  3NS1 B;  1L6V A;  1JQ4 A;  3PZ8 A;  3B9J A;  1IGC A;  1TYG B;  3W5U B;  2FE8 A;  2Y3A A;  2K9X A;  1TKE A;  1F77 A;  3AE1 B;  1A70 A;  2TSS A;  1OFF A;  1XCQ L;  3E56 A;  4UDU C;  3FWA A;  1JWB D;  2P3H A;  2LJI A;  1SE3 A;  5AE3 A;  1SB3 B;  2Y3S A;  2VFR A;  4KKJ A;  2BS4 B;  4WH4 A;  2BS2 B;  4MM3 B;  1NYR A;  4WAF A;  4REZ A;  1Y56 A;  4PVJ A;  3Q8B A;  1WRI A;  3P4Q B;  2NTT A;  1J7C A;  2BT6 A;  2IJ0 A;  3EA6 A;  4N6E B;  1XLO A;  2BYT A;  1TZO A;  2PTL A;  4A9A A;  1OQQ A;  3LLB A;  5D3I B;  3S1E A;  1MHH E;  2NTS A;  2OHF A;  4YTM B;  5K8E A;  3AB5 A;  3AE7 B;  1UNS A;  2RDH A;  4RNA A;  2BVH A;  4JE3 B;  3HRD D;  3AED B;  3Q8A A;  1N5X A;  2WXJ A;  2BB6 A;  5FKA C;  3W8X A;  3NRZ A;  1AYF A;  1XLN A;  1C4P A;  1HA5 A;  3HUI A;  1JWM D;  2LUM A;  3TSS A;  5HMR A;  2ON8 A;  2L83 A;  1L0X B;  2JZP A;  2N0S B;  4L1B A;  2MJE A;  4EC3 A;  3P4P B;  5D3D A;  1TY2 A;  1TKG A;  2Y5P A;  3U7Z A;  3RJA A;  2PIA A;  1N5W A;  1CK1 A;  1ZXH A;  3HVZ A;  3DWG C;  3IXS A;  4ZOH C;  2P13 A;  2QIE B;  1V1P B;  4O1N A;  4XDD A;  5BMI A;  1V8C A;  1WYG A;  2UUU A;  1CJE A;  2H89 B;  3AMZ A;  5HHD G;  5AE2 A;  5I1V A;  1FD6 A;  4PWB A;  1W1S A;  4P16 A;  4C7Z A;  3GP7 A;  1FFU C;  4NJC A;  1GPX A;  1RM6 C;  1JWS D;  1V1O A;  1ROE A;  1KLG D;  2X38 A;  5D79 A;  1MHX A;  2XN9 C;  2R2Z A;  2SAK A;  4ZRP A;  2BW2 A;  1E6E B;  2DWQ A;  1YMH E;  2JSV X;  1T3Q C;  3GSY A;  1X2G A;  2IPK D;  2NQW A;  2LHE A;  4O95 A;  3TSJ A;  1N61 C;  3AH7 A;  3VR8 B;  4N59 A;  2QKN A;  3MC0 B;  3AE4 B;  1ZDX A;  4OW0 A;  2KQ4 X;  3KWL A;  1PGB A;  1VJK A;  2IGD A;  3AEA B;  1B9R A;  1HEZ E;  5ADZ A;  5HFY A;  2BVG A;  2DLB A;  1QQR A;  2PMV A;  2W55 A;  3DWM A;  1FFV C;  2W54 A;  1N62 A;  3W8W A;  1C76 A;  5LNK 1;  1E7P B;  1KLU D;  2SEB D;  1E8F A;  1L5P A;  1JRO A;  5D7G A;  4EE2 A;  2W3S A;  3EUB 2;  1JW9 D;  4HRO A;  4B0M A;  1FM0 D;  1L6U A;  4R3D A;  2N9L A;  2WXP A;  3ZGZ A;  1V1P A;  2VZK D;  1D6E C;  1YQ4 B;  1K50 A;  4MAC A;  4A8X C;  3BII D;  2EKI A;  1UWM A;  2P4P A;  4RF0 A;  1HZ5 A;  3P42 A;  5G5H B;  4HG0 A;  3U52 E;  1B1Z A;  3ABV B;  2QSD A;  1TS3 A;  4PWC A;  2LEK A;  2W82 A;  3A7U A;  3W9C B;  1W1J A;  4WIP A;  3R2I A;  4PZF A;  1PGX A;  3BK2 A;  1I4P A;  3ZJV A;  2MBR A;  2IGG A;  1W1K A;  2WXI A;  3JS8 A;  4ML8 A;  2M56 B;  2ZW1 A;  5HI1 A;  3IT6 B;  2I0K A;  3NVZ B;  1DYQ A;  1C9F A;  3VRB B;  1VDV A;  4DXG A;  4US8 A;  3BVG A;  1CQV A;  2JQR B;  2AQ3 B;  3B2G A;  2WXF A;  3AN1 A;  2Q5W D;  1ZXI C;  1FNW A;  1QF6 A;  2WDQ B;  1KRH A;  4OZB A;  3DQ0 A;  1N63 C;  1MI0 A;  5I4D A;  1XEE A;  1FO4 A;  1SEB D;  4JX1 C;  3IAS 1;  1VZ7 A;  2INP E;  2HTM E;  1JML A;  2CJO A;  3R2T A;  2I38 A;  1TKY A;  4USA A;  1W1M A;  1MVK A;  4PVE A;  5AUI A;  4XWW A;  2Y3R A;  1QOB A;  3NZ3 A;  1F2R C;  4NZL B;  2OED A;  3IT4 B;  3AE8 B;  1T6B X;  5BYS A;  1WSP A;  1NVI D;  1JWA D;  1F2R I;  2RPV A;  2JXT A;  4J3O D;  2WXM A;  5G5H A;  3CIR B;  2QMT A;  3AEC B;  1DOI A;  1PDX A;  3BVM A;  3URY A;  1YN4 A;  4CQN A;  1AHV A;  1W1O A;  2Y08 A;  3NUH B;  1SJH D;  1UUP A;  2WXK A;  2YEP B;  4IOI E;  1KF6 B;  1FCL A;  3SR6 B;  3GS2 A;  1W1L A;  3SEB A;  3A7R A;  2KWD A;  5H8Y E;  4C56 C;  1MBT A;  2G1E A;  2L32 A;  3AE3 B;  1EU3 A;  3BW7 A;  1VR9 A;  3PQB A;  4JWS C;  4L2Y A;  1ZP0 B;  3BWU D;  4A90 A;  3VTE A;  1Q10 A;  2MJ3 A;  3LAE A;  3PM9 A;  3NVZ A;  1I19 A;  1QIL A;  1JWU D;  1VQZ A;  2MEK A;  1I4R A;  3FW7 A;  1YN5 A;  2PLI A;  3POP A;  1V97 A;  1QOG A;  1ZUD 2;  2WXG A;  1ZE3 D;  3BYT B;  2R61 A;  2BTE A;  2PKO A;  1BXT A;  3FC4 A;  1TS5 A;  2KAC A;  2WXO A;  4OHJ A;  5HQX A;  1C4C A;  1QOF A;  3LXF A;  3AM9 A;  1EM7 A;  1N60 A;  2ICI A;  4YT0 B;  3SFE B;  1SF0 A;  2FBW B;  3E9S A;  2VZK B;  3VR9 B;  4A55 A;  3NVW B;  4WQM A;  1AHZ A;  4XE0 A;  1VRA B;  1YN3 A;  1QOA A;  4FXC A;  4MLA A;  4P6V F;  3ETR A;  1F0Z A;  1E0Y A;  3TSH A;  4RGO S;  1SE2 A;  3HVD A;  4MH8 A;  2H88 B;  3PO0 A;  1F0X A;  3D2D A;  3SFD B;  2R8D A;  3FIL B;  1XLQ A;  2J42 A;  2WS3 B;  3T3N A;  3GB1 A;  2G9H D;  1FCC C;  3P4R B;  3TEX A;  2ZW0 A;  2WNM A;  2QEJ C;  2GQU A;  1XF5 L;  4HKZ E;  3Q69 A;  3FW9 A;  1HSK A;  2WLB A;  1W1Q A;  1I4G A;  1GB1 A;  1XCT L;  1TY0 A;  4ZHP A;  3TEW A;  3R07 C;  5MPO A;  4JWU C;  4ITK A;  2K3U A;  3T3O A;  3IAM 1;  1DIQ A;  3SR6 A;  2HDE A;  1RM6 B;  2RK5 A;  4XLO A;  1NYQ A;  1FMA D;  4YXD B;  4ARC A;  3S1F A;  1GOZ A;  3AEG B;  1ESF A;  1CZP A;  3TX1 A;  2NMQ A;  1D5X C;  3I57 A;  4DXF A;  2AXR A;  1X2H A;  1C78 A;  2PW9 A;  2JWU A;  5EE1 A;  3EGR A;  1ZDV A;  4HRS A;  2PVG C;  1L0V B;  1D5Z C;  1J7A A;  2LMC A;  1KTK A;  4KKI A;  3J9C A;  5H92 C;  4TVW A;  3ZYY X;  1PFD A;  1ENF A;  3NVW A;  1RWS A;  2GI9 A;  1NEN B;  3AE9 B;  4YTP B;  2V3P A;  3AEF B;  2M19 A;  3KJM A;  5C3J B;  2WDW A;  2LFI A;  3A7A A;  3PZ7 A;  1R7S A;  3FIL A;  4YWG G;  1W1R A;  3NVY B;  4GLS C;  4YSZ B;  3KLS X;  4KGT A;  5T8I A;  5G5G A;  3MJ5 A;  1E8G A;  4TMA B;  4D2K A;  1C77 A;  4DQO C;  2BB5 A;  4RFB A;  3NVV B;  2KN4 A;  2JYE A;  2VAO A;  1IUE A;  2K22 A;  2V4I B;  1AHU A;  1XO3 A;  3I9V 1;  4LLG M;  4YSX B;  2Q4W A;  3EUB 3;  2O3G A;  1FFU A;  3OWE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...