4PVHA

Phl p 4 n158h variant, a glucose dehydrogenase
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
490
structure length
490
Chain Sequence
b'EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTIGVGGHFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 4.0202
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Oxidoreductase
total genus 163
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pvhA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pvhA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pvhA03
2BVFA 5I1VA 5FXPA 3AN1A 1V97A 1UXYA 5L6GA 3C0PA 4PVHA 2QPMA 5I1WA 2IPIA 1W1SA 1ZXIC 5L6FA 1N5XA 5AE3A 1N62C 4PYTA 1FIQB 1VAOA 1E0YA 5AE2A 1W1KA 2BVGA 1E8GA 4PVKA 2VFTA 4JB1A 1JROA 5D79A 3TX1A 3TSJA 2VFUA 1F0XA 3BW7A 3B9JB 5FXFA 3W8ZA 3RJAA 3NRZB 3FW7A 2W54A 4PWCA 1W1JA 3SR6B 2WDWA 1N60C 3HSUA 1DZNA 3GSYA 3PM9A 4EC3A 4BC7A 1FFUC 1I19A 1E8FA 1FO4A 3TSHA 4JAYA 5FXEA 1MBTA 3S1FA 4UD8A 3ETRB 1W1QA 3W8XA 2Q4WA 5AWVA 1AHZA 1N63C 2W55A 1E8HA 1WVEA 2EXRA 5AE1A 2Y08A 3KJMA 3FW9A 1MBBA 3AMZA 2GQUA 3AM9A 2E3TA 2W3RA 3W8WA 2Y4GA 3NS1B 2Q85A 1W1MA 2Y3RA 1N61C 3D2JA 1QLUA 3DQ0A 3POPA 3I99A 5FXDA 2QKNA 3RJ8A 2VFRA 1ZR6A 4PVEA 1FFVC 4ZOHB 3JS8A 5HQXA 4BC9A 2VFSA 2I0KA 1WVFA 3VTEA 3S1DA 2GQTA 4BBYA 4OALA 3FWAA 2VAOA 4PZFA 1DIIA 2MBRA 1DIQA 2BVHA 1W1LA 3PQBA 4XLOA 5K8EA 1T3QC 1WYGA 3S1EA 4PWBA 1W1OA 5HHZA 4PVJA 1VDVA 5ADZA 1AHUA 3NVZB 3S1CA 1W1RA 1QLTA 1AHVA 3FW8A 4MLAA 3D2DA 3D2HA 1HSKA 2W3SA 4DNSA 1N5WC 4O95A 4BCAA 2VFVA 2AXRA 2Y3SA 5HMRA 4ML8A 3EUB3
chains in the Genus database with same CATH superfamily
2R2ZA 2BVFA 5I1VA 5FXPA 3AN1A 1V97A 1UXYA 5L6GA 3NVVB 3NVYB 3C0PA 4PVHA 2QPMA 5I1WA 2IPIA 1W1SA 1ZXIC 2PLSA 1N5XA 5AE3A 5L6FA 1N62C 4PYTA 1FIQB 1VAOA 1E0YA 5AE2A 1W1KA 2BVGA 1E8GA 4PVKA 2VFTA 4JB1A 1JROA 5D79A 3TX1A 2P3HA 3TSJA 2VFUA 1F0XA 3BW7A 3B9JB 5FXFA 3W8ZA 3RJAA 3NRZB 3FW7A 2W54A 4PWCA 1W1JA 3SR6B 2WDWA 1N60C 3HSUA 1DZNA 3GSYA 3PM9A 1JRPA 2O3GA 4EC3A 4BC7A 1FFUC 1I19A 1E8FA 2R8DA 1FO4A 3TSHA 4JAYA 5FXEA 1MBTA 3S1FA 4UD8A 3ETRB 3DEDA 1W1QA 3NVWB 3W8XA 2Q4WA 5AWVA 1AHZA 1N63C 2W55A 1E8HA 1WVEA 2EXRA 5AE1A 2Y08A 3KJMA 3FW9A 1MBBA 3AMZA 2GQUA 3AM9A 3LLBA 2YVSA 2E3TA 2W3RA 3W8WA 2Y4GA 3NS1B 2Q85A 1W1MA 2Y3RA 1N61C 3D2JA 1QLUA 3DQ0A 1SB3B 2NQWA 3POPA 3I99A 5FXDA 2QKNA 3RJ8A 2VFRA 1ZR6A 3HRDC 4PVEA 1FFVC 4ZOHB 3JS8A 2P4PA 2UUVA 5HQXA 4BC9A 2VFSA 2I0KA 1WVFA 2PLIA 3VTEA 3S1DA 2GQTA 4BBYA 4OALA 3FWAA 2VAOA 4PZFA 4HG0A 5G5HB 1DIIA 2RK5A 2MBRA 1DIQA 2BVHA 1W1LA 3PQBA 4XLOA 5K8EA 1T3QC 1WYGA 3EJEB 1RM6B 3S1EA 2OAIA 4PWBA 1W1OA 5HHZA 4PVJA 1VDVA 5ADZA 1AHUA 3NVZB 3S1CA 1W1RA 1QLTA 1AHVA 3FW8A 4MLAA 2P13A 3D2DA 3D2HA 1HSKA 2W3SA 4DNSA 3LAEA 1N5WC 4O95A 4BCAA 2VFVA 3EJBB 2AXRA 2Y3SA 5HMRA 4ML8A 2UUUA 5G5GB 3EJDB 3EUB3
chains in the Genus database with same CATH topology
2R2ZA 2BVFA 5I1VA 5FXPA 3AN1A 1V97A 1UXYA 5L6GA 3NVVB 3NVYB 3C0PA 4PVHA 2QPMA 5I1WA 2IPIA 1W1SA 1ZXIC 2PLSA 1N5XA 5AE3A 5L6FA 1N62C 4PYTA 1FIQB 1VAOA 1E0YA 5AE2A 1W1KA 2BVGA 1E8GA 4PVKA 2VFTA 4JB1A 1JROA 5D79A 3TX1A 2P3HA 3TSJA 2VFUA 1F0XA 3BW7A 3B9JB 5FXFA 3W8ZA 3RJAA 3NRZB 3FW7A 2W54A 4PWCA 1W1JA 3SR6B 2WDWA 1N60C 3HSUA 1DZNA 3GSYA 3PM9A 1JRPA 2O3GA 4EC3A 4BC7A 1FFUC 1I19A 1E8FA 2R8DA 1FO4A 3TSHA 4JAYA 5FXEA 1MBTA 3S1FA 4UD8A 3ETRB 3DEDA 1W1QA 3NVWB 3W8XA 2Q4WA 5AWVA 1AHZA 1N63C 2W55A 1E8HA 1WVEA 2EXRA 5AE1A 2Y08A 3KJMA 3FW9A 1MBBA 3AMZA 2GQUA 3AM9A 3LLBA 2YVSA 2E3TA 2W3RA 3W8WA 2Y4GA 3NS1B 2Q85A 1W1MA 2Y3RA 1N61C 3D2JA 1QLUA 3DQ0A 1SB3B 2NQWA 3POPA 3I99A 5FXDA 2QKNA 3RJ8A 2VFRA 1ZR6A 3HRDC 4PVEA 1FFVC 4ZOHB 3JS8A 2P4PA 2UUVA 5HQXA 4BC9A 2VFSA 2I0KA 1WVFA 2PLIA 3VTEA 3S1DA 2GQTA 4BBYA 4OALA 3FWAA 2VAOA 4PZFA 4HG0A 5G5HB 1DIIA 2RK5A 2MBRA 1DIQA 2BVHA 1W1LA 3PQBA 4XLOA 5K8EA 1T3QC 1WYGA 1RM6B 3S1EA 2OAIA 4PWBA 1W1OA 5HHZA 4PVJA 1VDVA 5ADZA 1AHUA 3NVZB 3S1CA 1W1RA 1QLTA 1AHVA 3FW8A 4MLAA 2P13A 3D2DA 3D2HA 1HSKA 2W3SA 4DNSA 3LAEA 1N5WC 4O95A 4BCAA 2VFVA 2AXRA 2Y3SA 5HMRA 4ML8A 2UUUA 5G5GB 3EUB3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BVF A;  5I1V A;  5FXP A;  3AN1 A;  1V97 A;  1UXY A;  5L6G A;  3C0P A;  4PVH A;  2QPM A;  5I1W A;  2IPI A;  1W1S A;  1ZXI C;  5L6F A;  1N5X A;  5AE3 A;  1N62 C;  4PYT A;  1FIQ B;  1VAO A;  1E0Y A;  5AE2 A;  1W1K A;  2BVG A;  1E8G A;  4PVK A;  2VFT A;  4JB1 A;  1JRO A;  5D79 A;  3TX1 A;  3TSJ A;  2VFU A;  1F0X A;  3BW7 A;  3B9J B;  5FXF A;  3W8Z A;  3RJA A;  3NRZ B;  3FW7 A;  2W54 A;  4PWC A;  1W1J A;  3SR6 B;  2WDW A;  1N60 C;  3HSU A;  1DZN A;  3GSY A;  3PM9 A;  4EC3 A;  4BC7 A;  1FFU C;  1I19 A;  1E8F A;  1FO4 A;  3TSH A;  4JAY A;  5FXE A;  1MBT A;  3S1F A;  4UD8 A;  3ETR B;  1W1Q A;  3W8X A;  2Q4W A;  5AWV A;  1AHZ A;  1N63 C;  2W55 A;  1E8H A;  1WVE A;  2EXR A;  5AE1 A;  2Y08 A;  3KJM A;  3FW9 A;  1MBB A;  3AMZ A;  2GQU A;  3AM9 A;  2E3T A;  2W3R A;  3W8W A;  2Y4G A;  3NS1 B;  2Q85 A;  1W1M A;  2Y3R A;  1N61 C;  3D2J A;  1QLU A;  3DQ0 A;  3POP A;  3I99 A;  5FXD A;  2QKN A;  3RJ8 A;  2VFR A;  1ZR6 A;  4PVE A;  1FFV C;  4ZOH B;  3JS8 A;  5HQX A;  4BC9 A;  2VFS A;  2I0K A;  1WVF A;  3VTE A;  3S1D A;  2GQT A;  4BBY A;  4OAL A;  3FWA A;  2VAO A;  4PZF A;  1DII A;  2MBR A;  1DIQ A;  2BVH A;  1W1L A;  3PQB A;  4XLO A;  5K8E A;  1T3Q C;  1WYG A;  3S1E A;  4PWB A;  1W1O A;  5HHZ A;  4PVJ A;  1VDV A;  5ADZ A;  1AHU A;  3NVZ B;  3S1C A;  1W1R A;  1QLT A;  1AHV A;  3FW8 A;  4MLA A;  3D2D A;  3D2H A;  1HSK A;  2W3S A;  4DNS A;  1N5W C;  4O95 A;  4BCA A;  2VFV A;  2AXR A;  2Y3S A;  5HMR A;  4ML8 A;  3EUB 3; 
#chains in the Genus database with same CATH topology
 2R2Z A;  2BVF A;  5I1V A;  5FXP A;  3AN1 A;  1V97 A;  1UXY A;  5L6G A;  3NVV B;  3NVY B;  3C0P A;  4PVH A;  2QPM A;  5I1W A;  2IPI A;  1W1S A;  1ZXI C;  2PLS A;  1N5X A;  5AE3 A;  5L6F A;  1N62 C;  4PYT A;  1FIQ B;  1VAO A;  1E0Y A;  5AE2 A;  1W1K A;  2BVG A;  1E8G A;  4PVK A;  2VFT A;  4JB1 A;  1JRO A;  5D79 A;  3TX1 A;  2P3H A;  3TSJ A;  2VFU A;  1F0X A;  3BW7 A;  3B9J B;  5FXF A;  3W8Z A;  3RJA A;  3NRZ B;  3FW7 A;  2W54 A;  4PWC A;  1W1J A;  3SR6 B;  2WDW A;  1N60 C;  3HSU A;  1DZN A;  3GSY A;  3PM9 A;  1JRP A;  2O3G A;  4EC3 A;  4BC7 A;  1FFU C;  1I19 A;  1E8F A;  2R8D A;  1FO4 A;  3TSH A;  4JAY A;  5FXE A;  1MBT A;  3S1F A;  4UD8 A;  3ETR B;  3DED A;  1W1Q A;  3NVW B;  3W8X A;  2Q4W A;  5AWV A;  1AHZ A;  1N63 C;  2W55 A;  1E8H A;  1WVE A;  2EXR A;  5AE1 A;  2Y08 A;  3KJM A;  3FW9 A;  1MBB A;  3AMZ A;  2GQU A;  3AM9 A;  3LLB A;  2YVS A;  2E3T A;  2W3R A;  3W8W A;  2Y4G A;  3NS1 B;  2Q85 A;  1W1M A;  2Y3R A;  1N61 C;  3D2J A;  1QLU A;  3DQ0 A;  1SB3 B;  2NQW A;  3POP A;  3I99 A;  5FXD A;  2QKN A;  3RJ8 A;  2VFR A;  1ZR6 A;  3HRD C;  4PVE A;  1FFV C;  4ZOH B;  3JS8 A;  2P4P A;  2UUV A;  5HQX A;  4BC9 A;  2VFS A;  2I0K A;  1WVF A;  2PLI A;  3VTE A;  3S1D A;  2GQT A;  4BBY A;  4OAL A;  3FWA A;  2VAO A;  4PZF A;  4HG0 A;  5G5H B;  1DII A;  2RK5 A;  2MBR A;  1DIQ A;  2BVH A;  1W1L A;  3PQB A;  4XLO A;  5K8E A;  1T3Q C;  1WYG A;  3EJE B;  1RM6 B;  3S1E A;  2OAI A;  4PWB A;  1W1O A;  5HHZ A;  4PVJ A;  1VDV A;  5ADZ A;  1AHU A;  3NVZ B;  3S1C A;  1W1R A;  1QLT A;  1AHV A;  3FW8 A;  4MLA A;  2P13 A;  3D2D A;  3D2H A;  1HSK A;  2W3S A;  4DNS A;  3LAE A;  1N5W C;  4O95 A;  4BCA A;  2VFV A;  3EJB B;  2AXR A;  2Y3S A;  5HMR A;  4ML8 A;  2UUU A;  5G5G B;  3EJD B;  3EUB 3; 
#chains in the Genus database with same CATH homology
 2R2Z A;  2BVF A;  5I1V A;  5FXP A;  3AN1 A;  1V97 A;  1UXY A;  5L6G A;  3NVV B;  3NVY B;  3C0P A;  4PVH A;  2QPM A;  5I1W A;  2IPI A;  1W1S A;  1ZXI C;  2PLS A;  1N5X A;  5AE3 A;  5L6F A;  1N62 C;  4PYT A;  1FIQ B;  1VAO A;  1E0Y A;  5AE2 A;  1W1K A;  2BVG A;  1E8G A;  4PVK A;  2VFT A;  4JB1 A;  1JRO A;  5D79 A;  3TX1 A;  2P3H A;  3TSJ A;  2VFU A;  1F0X A;  3BW7 A;  3B9J B;  5FXF A;  3W8Z A;  3RJA A;  3NRZ B;  3FW7 A;  2W54 A;  4PWC A;  1W1J A;  3SR6 B;  2WDW A;  1N60 C;  3HSU A;  1DZN A;  3GSY A;  3PM9 A;  1JRP A;  2O3G A;  4EC3 A;  4BC7 A;  1FFU C;  1I19 A;  1E8F A;  2R8D A;  1FO4 A;  3TSH A;  4JAY A;  5FXE A;  1MBT A;  3S1F A;  4UD8 A;  3ETR B;  3DED A;  1W1Q A;  3NVW B;  3W8X A;  2Q4W A;  5AWV A;  1AHZ A;  1N63 C;  2W55 A;  1E8H A;  1WVE A;  2EXR A;  5AE1 A;  2Y08 A;  3KJM A;  3FW9 A;  1MBB A;  3AMZ A;  2GQU A;  3AM9 A;  3LLB A;  2YVS A;  2E3T A;  2W3R A;  3W8W A;  2Y4G A;  3NS1 B;  2Q85 A;  1W1M A;  2Y3R A;  1N61 C;  3D2J A;  1QLU A;  3DQ0 A;  1SB3 B;  2NQW A;  3POP A;  3I99 A;  5FXD A;  2QKN A;  3RJ8 A;  2VFR A;  1ZR6 A;  3HRD C;  4PVE A;  1FFV C;  4ZOH B;  3JS8 A;  2P4P A;  2UUV A;  5HQX A;  4BC9 A;  2VFS A;  2I0K A;  1WVF A;  2PLI A;  3VTE A;  3S1D A;  2GQT A;  4BBY A;  4OAL A;  3FWA A;  2VAO A;  4PZF A;  4HG0 A;  5G5H B;  1DII A;  2RK5 A;  2MBR A;  1DIQ A;  2BVH A;  1W1L A;  3PQB A;  4XLO A;  5K8E A;  1T3Q C;  1WYG A;  1RM6 B;  3S1E A;  2OAI A;  4PWB A;  1W1O A;  5HHZ A;  4PVJ A;  1VDV A;  5ADZ A;  1AHU A;  3NVZ B;  3S1C A;  1W1R A;  1QLT A;  1AHV A;  3FW8 A;  4MLA A;  2P13 A;  3D2D A;  3D2H A;  1HSK A;  2W3S A;  4DNS A;  3LAE A;  1N5W C;  4O95 A;  4BCA A;  2VFV A;  2AXR A;  2Y3S A;  5HMR A;  4ML8 A;  2UUU A;  5G5G B;  3EUB 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...