4PVHA

Phl p 4 n158h variant, a glucose dehydrogenase
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTIGVGGHFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 4.0202
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Oxidoreductase
total genus 163
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pvhA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pvhA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pvhA03
1N5WC 4JB1A 1E8GA 5HQXA 5AE3A 1FFVC 4MLAA 3POPA 1T3QC 4PVHA 3KJMA 3TX1A 3I99A 1N62C 5FXDA 2BVGA 2VFVA 3FW7A 1WVFA 3NVZB 1W1OA 1WYGA 5FXPA 3D2HA 2AXRA 3S1EA 1W1KA 3NRZB 1ZR6A 1AHUA 5ADZA 3BW7A 3S1FA 2Y4GA 3VTEA 1FFUC 3B9JB 1N61C 4PWCA 3S1CA 2I0KA 1N60C 5K8EA 4PVKA 1DIIA 2VFUA 3JS8A 2GQTA 5AE1A 4ML8A 3W8ZA 1WVEA 2VAOA 2IPIA 1MBBA 4JAYA 1W1LA 3TSHA 3FW9A 1I19A 4OALA 2Q85A 1QLUA 2VFTA 5FXEA 3TSJA 3W8XA 2MBRA 5HMRA 5L6FA 3GSYA 2EXRA 5FXFA 2BVHA 4ZOHB 5L6GA 3SR6B 2BVFA 3D2JA 4O95A 3ETRB 3S1DA 5D79A 1QLTA 3DQ0A 5I1WA 1UXYA 4EC3A 1DIQA 2GQUA 2WDWA 3FWAA 2W3RA 4XLOA 4BCAA 4PVJA 2E3TA 2VFSA 1AHZA 1E0YA 3PQBA 1ZXIC 1VAOA 3FW8A 3NS1B 4UD8A 2QPMA 1FIQB 3D2DA 2Y3RA 3HSUA 1N5XA 3PM9A 1FO4A 4BC7A 3C0PA 1W1JA 4PYTA 3RJAA 2Q4WA 1MBTA 3EUB3 1E8FA 4BBYA 1E8HA 5HHZA 5AWVA 3RJ8A 3W8WA 1V97A 1W1QA 2Y08A 5I1VA 4DNSA 4PWBA 1HSKA 1F0XA 2VFRA 2W3SA 4PVEA 1DZNA 3AMZA 1JROA 2W54A 4PZFA 5AE2A 3AN1A 2W55A 1W1RA 1N63C 1VDVA 3AM9A 4BC9A 1W1MA 2QKNA 1AHVA 2Y3SA 1W1SA
chains in the Genus database with same CATH superfamily
1N5WC 4JB1A 1E8GA 5HQXA 5AE3A 1FFVC 4MLAA 3POPA 1T3QC 4PVHA 3KJMA 3TX1A 3I99A 1N62C 5FXDA 2BVGA 2VFVA 3FW7A 1WVFA 3NVZB 1W1OA 1WYGA 5FXPA 2OAIA 3D2HA 2AXRA 3S1EA 1W1KA 3NRZB 1ZR6A 1AHUA 3DEDA 5ADZA 1JRPA 3BW7A 3S1FA 2Y4GA 3NVYB 3VTEA 1FFUC 2P4PA 3NVVB 3B9JB 1N61C 4PWCA 3S1CA 2UUVA 2I0KA 1N60C 5K8EA 4PVKA 1DIIA 2VFUA 3JS8A 2GQTA 5AE1A 4ML8A 3W8ZA 1WVEA 2VAOA 2IPIA 2PLSA 1MBBA 4JAYA 1W1LA 3TSHA 3FW9A 1I19A 4OALA 1RM6B 2Q85A 1QLUA 2VFTA 2YVSA 5FXEA 3TSJA 1SB3B 3W8XA 2MBRA 5HMRA 5L6FA 3GSYA 2EXRA 3LLBA 5FXFA 2BVHA 2PLIA 4ZOHB 2NQWA 5L6GA 3SR6B 2BVFA 2P13A 3EJEB 3D2JA 4O95A 3ETRB 2R8DA 3S1DA 5D79A 1QLTA 3DQ0A 5I1WA 1UXYA 4EC3A 3LAEA 1DIQA 2GQUA 2WDWA 3FWAA 2W3RA 4XLOA 4BCAA 4PVJA 2E3TA 2VFSA 1AHZA 1E0YA 3PQBA 1ZXIC 3HRDC 1VAOA 3FW8A 3NS1B 4UD8A 2QPMA 1FIQB 3D2DA 2RK5A 2R2ZA 2Y3RA 3HSUA 1N5XA 3PM9A 1FO4A 4BC7A 3C0PA 1W1JA 4PYTA 3RJAA 2Q4WA 1MBTA 3EUB3 1E8FA 3NVWB 2P3HA 4BBYA 5G5GB 1E8HA 3EJDB 5HHZA 4HG0A 5AWVA 3RJ8A 3EJBB 3W8WA 1V97A 1W1QA 2Y08A 5I1VA 4DNSA 4PWBA 1HSKA 1F0XA 2VFRA 2W3SA 4PVEA 1DZNA 3AMZA 1JROA 2W54A 4PZFA 5AE2A 3AN1A 2W55A 1W1RA 1N63C 1VDVA 3AM9A 4BC9A 1W1MA 2QKNA 2UUUA 2O3GA 5G5HB 1AHVA 2Y3SA 1W1SA
chains in the Genus database with same CATH topology
1N5WC 4JB1A 1E8GA 5HQXA 5AE3A 1FFVC 4MLAA 3POPA 1T3QC 4PVHA 3KJMA 3TX1A 3I99A 1N62C 5FXDA 2BVGA 2VFVA 3FW7A 1WVFA 3NVZB 1W1OA 1WYGA 5FXPA 2OAIA 3D2HA 2AXRA 3S1EA 1W1KA 3NRZB 1ZR6A 1AHUA 3DEDA 5ADZA 1JRPA 3BW7A 3S1FA 2Y4GA 3VTEA 3NVYB 1FFUC 2P4PA 3NVVB 3B9JB 1N61C 4PWCA 3S1CA 2UUVA 2I0KA 1N60C 5K8EA 4PVKA 1DIIA 2VFUA 3JS8A 2GQTA 5AE1A 4ML8A 3W8ZA 1WVEA 2VAOA 2IPIA 2PLSA 1MBBA 4JAYA 1W1LA 3TSHA 3FW9A 1I19A 4OALA 1RM6B 2Q85A 1QLUA 2VFTA 2YVSA 5FXEA 3TSJA 1SB3B 3W8XA 2MBRA 5HMRA 5L6FA 3GSYA 2EXRA 3LLBA 5FXFA 2BVHA 2PLIA 4ZOHB 2NQWA 5L6GA 3SR6B 2BVFA 2P13A 3D2JA 4O95A 3ETRB 2R8DA 3S1DA 5D79A 1QLTA 3DQ0A 5I1WA 1UXYA 4EC3A 3LAEA 1DIQA 2GQUA 2WDWA 3FWAA 2W3RA 4XLOA 4BCAA 4PVJA 2E3TA 2VFSA 1AHZA 1E0YA 3PQBA 1ZXIC 3HRDC 1VAOA 3FW8A 3NS1B 4UD8A 2QPMA 1FIQB 3D2DA 2RK5A 2R2ZA 2Y3RA 3HSUA 1N5XA 3PM9A 1FO4A 4BC7A 3C0PA 1W1JA 4PYTA 3RJAA 2Q4WA 1MBTA 3EUB3 1E8FA 3NVWB 2P3HA 4BBYA 5G5GB 1E8HA 4HG0A 5HHZA 5AWVA 3RJ8A 3W8WA 1V97A 1W1QA 2Y08A 5I1VA 4DNSA 4PWBA 1HSKA 1F0XA 2VFRA 2W3SA 4PVEA 1DZNA 3AMZA 1JROA 2W54A 4PZFA 5AE2A 3AN1A 2W55A 1W1RA 1N63C 1VDVA 3AM9A 4BC9A 1W1MA 2QKNA 2UUUA 2O3GA 5G5HB 1AHVA 2Y3SA 1W1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5W C;  4JB1 A;  1E8G A;  5HQX A;  5AE3 A;  1FFV C;  4MLA A;  3POP A;  1T3Q C;  4PVH A;  3KJM A;  3TX1 A;  3I99 A;  1N62 C;  5FXD A;  2BVG A;  2VFV A;  3FW7 A;  1WVF A;  3NVZ B;  1W1O A;  1WYG A;  5FXP A;  3D2H A;  2AXR A;  3S1E A;  1W1K A;  3NRZ B;  1ZR6 A;  1AHU A;  5ADZ A;  3BW7 A;  3S1F A;  2Y4G A;  3VTE A;  1FFU C;  3B9J B;  1N61 C;  4PWC A;  3S1C A;  2I0K A;  1N60 C;  5K8E A;  4PVK A;  1DII A;  2VFU A;  3JS8 A;  2GQT A;  5AE1 A;  4ML8 A;  3W8Z A;  1WVE A;  2VAO A;  2IPI A;  1MBB A;  4JAY A;  1W1L A;  3TSH A;  3FW9 A;  1I19 A;  4OAL A;  2Q85 A;  1QLU A;  2VFT A;  5FXE A;  3TSJ A;  3W8X A;  2MBR A;  5HMR A;  5L6F A;  3GSY A;  2EXR A;  5FXF A;  2BVH A;  4ZOH B;  5L6G A;  3SR6 B;  2BVF A;  3D2J A;  4O95 A;  3ETR B;  3S1D A;  5D79 A;  1QLT A;  3DQ0 A;  5I1W A;  1UXY A;  4EC3 A;  1DIQ A;  2GQU A;  2WDW A;  3FWA A;  2W3R A;  4XLO A;  4BCA A;  4PVJ A;  2E3T A;  2VFS A;  1AHZ A;  1E0Y A;  3PQB A;  1ZXI C;  1VAO A;  3FW8 A;  3NS1 B;  4UD8 A;  2QPM A;  1FIQ B;  3D2D A;  2Y3R A;  3HSU A;  1N5X A;  3PM9 A;  1FO4 A;  4BC7 A;  3C0P A;  1W1J A;  4PYT A;  3RJA A;  2Q4W A;  1MBT A;  3EUB 3;  1E8F A;  4BBY A;  1E8H A;  5HHZ A;  5AWV A;  3RJ8 A;  3W8W A;  1V97 A;  1W1Q A;  2Y08 A;  5I1V A;  4DNS A;  4PWB A;  1HSK A;  1F0X A;  2VFR A;  2W3S A;  4PVE A;  1DZN A;  3AMZ A;  1JRO A;  2W54 A;  4PZF A;  5AE2 A;  3AN1 A;  2W55 A;  1W1R A;  1N63 C;  1VDV A;  3AM9 A;  4BC9 A;  1W1M A;  2QKN A;  1AHV A;  2Y3S A;  1W1S A; 
#chains in the Genus database with same CATH topology
 1N5W C;  4JB1 A;  1E8G A;  5HQX A;  5AE3 A;  1FFV C;  4MLA A;  3POP A;  1T3Q C;  4PVH A;  3KJM A;  3TX1 A;  3I99 A;  1N62 C;  5FXD A;  2BVG A;  2VFV A;  3FW7 A;  1WVF A;  3NVZ B;  1W1O A;  1WYG A;  5FXP A;  2OAI A;  3D2H A;  2AXR A;  3S1E A;  1W1K A;  3NRZ B;  1ZR6 A;  1AHU A;  3DED A;  5ADZ A;  1JRP A;  3BW7 A;  3S1F A;  2Y4G A;  3NVY B;  3VTE A;  1FFU C;  2P4P A;  3NVV B;  3B9J B;  1N61 C;  4PWC A;  3S1C A;  2UUV A;  2I0K A;  1N60 C;  5K8E A;  4PVK A;  1DII A;  2VFU A;  3JS8 A;  2GQT A;  5AE1 A;  4ML8 A;  3W8Z A;  1WVE A;  2VAO A;  2IPI A;  2PLS A;  1MBB A;  4JAY A;  1W1L A;  3TSH A;  3FW9 A;  1I19 A;  4OAL A;  1RM6 B;  2Q85 A;  1QLU A;  2VFT A;  2YVS A;  5FXE A;  3TSJ A;  1SB3 B;  3W8X A;  2MBR A;  5HMR A;  5L6F A;  3GSY A;  2EXR A;  3LLB A;  5FXF A;  2BVH A;  2PLI A;  4ZOH B;  2NQW A;  5L6G A;  3SR6 B;  2BVF A;  2P13 A;  3EJE B;  3D2J A;  4O95 A;  3ETR B;  2R8D A;  3S1D A;  5D79 A;  1QLT A;  3DQ0 A;  5I1W A;  1UXY A;  4EC3 A;  3LAE A;  1DIQ A;  2GQU A;  2WDW A;  3FWA A;  2W3R A;  4XLO A;  4BCA A;  4PVJ A;  2E3T A;  2VFS A;  1AHZ A;  1E0Y A;  3PQB A;  1ZXI C;  3HRD C;  1VAO A;  3FW8 A;  3NS1 B;  4UD8 A;  2QPM A;  1FIQ B;  3D2D A;  2RK5 A;  2R2Z A;  2Y3R A;  3HSU A;  1N5X A;  3PM9 A;  1FO4 A;  4BC7 A;  3C0P A;  1W1J A;  4PYT A;  3RJA A;  2Q4W A;  1MBT A;  3EUB 3;  1E8F A;  3NVW B;  2P3H A;  4BBY A;  5G5G B;  1E8H A;  3EJD B;  5HHZ A;  4HG0 A;  5AWV A;  3RJ8 A;  3EJB B;  3W8W A;  1V97 A;  1W1Q A;  2Y08 A;  5I1V A;  4DNS A;  4PWB A;  1HSK A;  1F0X A;  2VFR A;  2W3S A;  4PVE A;  1DZN A;  3AMZ A;  1JRO A;  2W54 A;  4PZF A;  5AE2 A;  3AN1 A;  2W55 A;  1W1R A;  1N63 C;  1VDV A;  3AM9 A;  4BC9 A;  1W1M A;  2QKN A;  2UUU A;  2O3G A;  5G5H B;  1AHV A;  2Y3S A;  1W1S A; 
#chains in the Genus database with same CATH homology
 1N5W C;  4JB1 A;  1E8G A;  5HQX A;  5AE3 A;  1FFV C;  4MLA A;  3POP A;  1T3Q C;  4PVH A;  3KJM A;  3TX1 A;  3I99 A;  1N62 C;  5FXD A;  2BVG A;  2VFV A;  3FW7 A;  1WVF A;  3NVZ B;  1W1O A;  1WYG A;  5FXP A;  2OAI A;  3D2H A;  2AXR A;  3S1E A;  1W1K A;  3NRZ B;  1ZR6 A;  1AHU A;  3DED A;  5ADZ A;  1JRP A;  3BW7 A;  3S1F A;  2Y4G A;  3VTE A;  3NVY B;  1FFU C;  2P4P A;  3NVV B;  3B9J B;  1N61 C;  4PWC A;  3S1C A;  2UUV A;  2I0K A;  1N60 C;  5K8E A;  4PVK A;  1DII A;  2VFU A;  3JS8 A;  2GQT A;  5AE1 A;  4ML8 A;  3W8Z A;  1WVE A;  2VAO A;  2IPI A;  2PLS A;  1MBB A;  4JAY A;  1W1L A;  3TSH A;  3FW9 A;  1I19 A;  4OAL A;  1RM6 B;  2Q85 A;  1QLU A;  2VFT A;  2YVS A;  5FXE A;  3TSJ A;  1SB3 B;  3W8X A;  2MBR A;  5HMR A;  5L6F A;  3GSY A;  2EXR A;  3LLB A;  5FXF A;  2BVH A;  2PLI A;  4ZOH B;  2NQW A;  5L6G A;  3SR6 B;  2BVF A;  2P13 A;  3D2J A;  4O95 A;  3ETR B;  2R8D A;  3S1D A;  5D79 A;  1QLT A;  3DQ0 A;  5I1W A;  1UXY A;  4EC3 A;  3LAE A;  1DIQ A;  2GQU A;  2WDW A;  3FWA A;  2W3R A;  4XLO A;  4BCA A;  4PVJ A;  2E3T A;  2VFS A;  1AHZ A;  1E0Y A;  3PQB A;  1ZXI C;  3HRD C;  1VAO A;  3FW8 A;  3NS1 B;  4UD8 A;  2QPM A;  1FIQ B;  3D2D A;  2RK5 A;  2R2Z A;  2Y3R A;  3HSU A;  1N5X A;  3PM9 A;  1FO4 A;  4BC7 A;  3C0P A;  1W1J A;  4PYT A;  3RJA A;  2Q4W A;  1MBT A;  3EUB 3;  1E8F A;  3NVW B;  2P3H A;  4BBY A;  5G5G B;  1E8H A;  4HG0 A;  5HHZ A;  5AWV A;  3RJ8 A;  3W8W A;  1V97 A;  1W1Q A;  2Y08 A;  5I1V A;  4DNS A;  4PWB A;  1HSK A;  1F0X A;  2VFR A;  2W3S A;  4PVE A;  1DZN A;  3AMZ A;  1JRO A;  2W54 A;  4PZF A;  5AE2 A;  3AN1 A;  2W55 A;  1W1R A;  1N63 C;  1VDV A;  3AM9 A;  4BC9 A;  1W1M A;  2QKN A;  2UUU A;  2O3G A;  5G5H B;  1AHV A;  2Y3S A;  1W1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...