4PVHA

Phl p 4 n158h variant, a glucose dehydrogenase
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTIGVGGHFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Pollen allergen Phl p 4.0202
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
total genus 163
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pvhA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pvhA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pvhA03
1HSKA 2Q4WA 1E8HA 1N61C 3TX1A 3D2DA 3KJMA 4PVJA 3NS1B 3D2JA 2QPMA 4BCAA 5K8EA 2W3RA 1FFUC 3W8ZA 5HHZA 3TSJA 3FWAA 2VFSA 2QKNA 1W1SA 3BW7A 1QLUA 1W1LA 4ZOHB 5D79A 4JB1A 5AE3A 2Y08A 3B9JB 4PVEA 4PYTA 2GQUA 1VAOA 3W8XA 4PWBA 3S1FA 5FXPA 3S1EA 4EC3A 2IPIA 5L6GA 1DIQA 1AHUA 2AXRA 1W1MA 1MBBA 4XLOA 3PQBA 3NRZB 1ZR6A 4ML8A 3ETRB 2VFUA 1I19A 1FFVC 2GQTA 3AN1A 1N5WC 5HQXA 4BBYA 4PVHA 3S1CA 3D2HA 2W54A 2W3SA 1WYGA 2Y3SA 3JS8A 3C0PA 3NVZB 1N63C 2BVGA 3TSHA 5FXEA 1N60C 1AHZA 3W8WA 3PM9A 2MBRA 3SR6B 1ZXIC 1W1QA 4OALA 1V97A 3FW7A 2VFTA 4UD8A 1FO4A 5I1WA 4PWCA 2W55A 4BC9A 1QLTA 4O95A 5FXFA 1MBTA 5AE1A 2BVFA 2WDWA 1DZNA 2EXRA 1VDVA 3DQ0A 3GSYA 3VTEA 3EUB3 2VFVA 1E8FA 4JAYA 3POPA 1AHVA 1W1JA 1UXYA 3FW9A 5AWVA 3HSUA 3AMZA 2VAOA 2VFRA 4BC7A 1W1OA 2BVHA 2E3TA 1JROA 5HMRA 4PZFA 5L6FA 3I99A 5ADZA 2Y3RA 3RJ8A 1N5XA 3AM9A 4MLAA 2I0KA 1T3QC 1N62C 1F0XA 2Y4GA 1W1RA 4PVKA 4DNSA 3RJAA 5I1VA 1E0YA 2Q85A 5AE2A 1FIQB 1WVFA 5FXDA 1E8GA 3FW8A 1DIIA 1W1KA 3S1DA 1WVEA
chains in the Genus database with same CATH superfamily
1HSKA 2Q4WA 1E8HA 1N61C 3TX1A 3D2DA 3KJMA 4PVJA 3NS1B 3D2JA 2UUUA 1RM6B 2QPMA 4BCAA 5K8EA 2W3RA 3NVYB 3EJBB 1FFUC 2OAIA 3NVWB 3W8ZA 5HHZA 3DEDA 3TSJA 3FWAA 2PLIA 2VFSA 2QKNA 1W1SA 3BW7A 1QLUA 1W1LA 4ZOHB 5D79A 4JB1A 5AE3A 2Y08A 3B9JB 4PVEA 4PYTA 2GQUA 1VAOA 3W8XA 4PWBA 3S1FA 5FXPA 3S1EA 4EC3A 2IPIA 3LLBA 5L6GA 1DIQA 3EJEB 1AHUA 2AXRA 1W1MA 2YVSA 5G5GB 1MBBA 4XLOA 3PQBA 3NRZB 1ZR6A 4ML8A 3ETRB 2VFUA 1I19A 1FFVC 2GQTA 3AN1A 2P4PA 1N5WC 3NVVB 5HQXA 2P13A 4BBYA 4PVHA 3S1CA 3D2HA 2W54A 5G5HB 2W3SA 1WYGA 2Y3SA 1JRPA 3JS8A 2P3HA 3C0PA 3NVZB 1N63C 2BVGA 3TSHA 2UUVA 5FXEA 1N60C 1AHZA 3W8WA 3PM9A 2MBRA 3SR6B 1SB3B 1ZXIC 1W1QA 4OALA 1V97A 3FW7A 2VFTA 4UD8A 1FO4A 5I1WA 4PWCA 2W55A 4BC9A 1QLTA 4O95A 5FXFA 1MBTA 5AE1A 2BVFA 2WDWA 2R2ZA 1DZNA 2R8DA 2EXRA 1VDVA 3DQ0A 3GSYA 3VTEA 2NQWA 3EUB3 2VFVA 1E8FA 4JAYA 3POPA 1AHVA 1W1JA 1UXYA 3EJDB 3FW9A 5AWVA 3HSUA 4HG0A 3AMZA 3HRDC 2VAOA 2VFRA 4BC7A 1W1OA 2BVHA 2E3TA 2RK5A 1JROA 5HMRA 4PZFA 5L6FA 3I99A 5ADZA 2Y3RA 3RJ8A 1N5XA 2PLSA 3AM9A 4MLAA 2I0KA 1T3QC 1N62C 1F0XA 3LAEA 2Y4GA 1W1RA 4PVKA 4DNSA 3RJAA 2O3GA 5I1VA 1E0YA 2Q85A 5AE2A 1FIQB 1WVFA 5FXDA 1E8GA 3FW8A 1DIIA 1W1KA 3S1DA 1WVEA
chains in the Genus database with same CATH topology
1HSKA 2Q4WA 1E8HA 1N61C 3TX1A 3D2DA 3KJMA 4PVJA 3NS1B 3D2JA 2UUUA 1RM6B 2QPMA 4BCAA 5K8EA 2W3RA 2OAIA 3DEDA 1FFUC 3NVYB 3W8ZA 3NVWB 5HHZA 3TSJA 3FWAA 2PLIA 2VFSA 2QKNA 1W1SA 3BW7A 1QLUA 1W1LA 4ZOHB 5D79A 4JB1A 5AE3A 2Y08A 3B9JB 4PVEA 4PYTA 2GQUA 1VAOA 3W8XA 4PWBA 3S1FA 5FXPA 3S1EA 4EC3A 2IPIA 3LLBA 5L6GA 1DIQA 1AHUA 2AXRA 1W1MA 2YVSA 5G5GB 1MBBA 4XLOA 3PQBA 3NRZB 1ZR6A 4ML8A 3ETRB 2VFUA 1I19A 1FFVC 2GQTA 3AN1A 2P4PA 1N5WC 2P13A 5HQXA 3NVVB 4BBYA 4PVHA 3S1CA 3D2HA 2W54A 5G5HB 2W3SA 1WYGA 2Y3SA 1JRPA 3JS8A 2P3HA 3C0PA 3NVZB 1N63C 2BVGA 3TSHA 2UUVA 5FXEA 1N60C 1AHZA 3W8WA 3PM9A 2MBRA 3SR6B 1SB3B 1ZXIC 1W1QA 4OALA 1V97A 3FW7A 2VFTA 4UD8A 1FO4A 5I1WA 4PWCA 2W55A 4BC9A 1QLTA 4O95A 5FXFA 1MBTA 5AE1A 2BVFA 2WDWA 2R2ZA 1DZNA 2R8DA 2EXRA 1VDVA 3DQ0A 3GSYA 3VTEA 2NQWA 3EUB3 2VFVA 1E8FA 4JAYA 3POPA 1AHVA 1W1JA 1UXYA 3FW9A 5AWVA 3HSUA 4HG0A 3AMZA 3HRDC 2VAOA 2VFRA 4BC7A 1W1OA 2BVHA 2E3TA 2RK5A 1JROA 5HMRA 4PZFA 5L6FA 3I99A 5ADZA 2Y3RA 3RJ8A 1N5XA 2PLSA 3AM9A 4MLAA 2I0KA 1T3QC 1N62C 1F0XA 3LAEA 2Y4GA 1W1RA 4PVKA 4DNSA 3RJAA 2O3GA 5I1VA 1E0YA 2Q85A 5AE2A 1FIQB 1WVFA 5FXDA 1E8GA 3FW8A 1DIIA 1W1KA 3S1DA 1WVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HSK A;  2Q4W A;  1E8H A;  1N61 C;  3TX1 A;  3D2D A;  3KJM A;  4PVJ A;  3NS1 B;  3D2J A;  2QPM A;  4BCA A;  5K8E A;  2W3R A;  1FFU C;  3W8Z A;  5HHZ A;  3TSJ A;  3FWA A;  2VFS A;  2QKN A;  1W1S A;  3BW7 A;  1QLU A;  1W1L A;  4ZOH B;  5D79 A;  4JB1 A;  5AE3 A;  2Y08 A;  3B9J B;  4PVE A;  4PYT A;  2GQU A;  1VAO A;  3W8X A;  4PWB A;  3S1F A;  5FXP A;  3S1E A;  4EC3 A;  2IPI A;  5L6G A;  1DIQ A;  1AHU A;  2AXR A;  1W1M A;  1MBB A;  4XLO A;  3PQB A;  3NRZ B;  1ZR6 A;  4ML8 A;  3ETR B;  2VFU A;  1I19 A;  1FFV C;  2GQT A;  3AN1 A;  1N5W C;  5HQX A;  4BBY A;  4PVH A;  3S1C A;  3D2H A;  2W54 A;  2W3S A;  1WYG A;  2Y3S A;  3JS8 A;  3C0P A;  3NVZ B;  1N63 C;  2BVG A;  3TSH A;  5FXE A;  1N60 C;  1AHZ A;  3W8W A;  3PM9 A;  2MBR A;  3SR6 B;  1ZXI C;  1W1Q A;  4OAL A;  1V97 A;  3FW7 A;  2VFT A;  4UD8 A;  1FO4 A;  5I1W A;  4PWC A;  2W55 A;  4BC9 A;  1QLT A;  4O95 A;  5FXF A;  1MBT A;  5AE1 A;  2BVF A;  2WDW A;  1DZN A;  2EXR A;  1VDV A;  3DQ0 A;  3GSY A;  3VTE A;  3EUB 3;  2VFV A;  1E8F A;  4JAY A;  3POP A;  1AHV A;  1W1J A;  1UXY A;  3FW9 A;  5AWV A;  3HSU A;  3AMZ A;  2VAO A;  2VFR A;  4BC7 A;  1W1O A;  2BVH A;  2E3T A;  1JRO A;  5HMR A;  4PZF A;  5L6F A;  3I99 A;  5ADZ A;  2Y3R A;  3RJ8 A;  1N5X A;  3AM9 A;  4MLA A;  2I0K A;  1T3Q C;  1N62 C;  1F0X A;  2Y4G A;  1W1R A;  4PVK A;  4DNS A;  3RJA A;  5I1V A;  1E0Y A;  2Q85 A;  5AE2 A;  1FIQ B;  1WVF A;  5FXD A;  1E8G A;  3FW8 A;  1DII A;  1W1K A;  3S1D A;  1WVE A; 
#chains in the Genus database with same CATH topology
 1HSK A;  2Q4W A;  1E8H A;  1N61 C;  3TX1 A;  3D2D A;  3KJM A;  4PVJ A;  3NS1 B;  3D2J A;  2UUU A;  1RM6 B;  2QPM A;  4BCA A;  5K8E A;  2W3R A;  3NVY B;  3EJB B;  1FFU C;  2OAI A;  3NVW B;  3W8Z A;  5HHZ A;  3DED A;  3TSJ A;  3FWA A;  2PLI A;  2VFS A;  2QKN A;  1W1S A;  3BW7 A;  1QLU A;  1W1L A;  4ZOH B;  5D79 A;  4JB1 A;  5AE3 A;  2Y08 A;  3B9J B;  4PVE A;  4PYT A;  2GQU A;  1VAO A;  3W8X A;  4PWB A;  3S1F A;  5FXP A;  3S1E A;  4EC3 A;  2IPI A;  3LLB A;  5L6G A;  1DIQ A;  3EJE B;  1AHU A;  2AXR A;  1W1M A;  2YVS A;  5G5G B;  1MBB A;  4XLO A;  3PQB A;  3NRZ B;  1ZR6 A;  4ML8 A;  3ETR B;  2VFU A;  1I19 A;  1FFV C;  2GQT A;  3AN1 A;  2P4P A;  1N5W C;  3NVV B;  5HQX A;  2P13 A;  4BBY A;  4PVH A;  3S1C A;  3D2H A;  2W54 A;  5G5H B;  2W3S A;  1WYG A;  2Y3S A;  1JRP A;  3JS8 A;  2P3H A;  3C0P A;  3NVZ B;  1N63 C;  2BVG A;  3TSH A;  2UUV A;  5FXE A;  1N60 C;  1AHZ A;  3W8W A;  3PM9 A;  2MBR A;  3SR6 B;  1SB3 B;  1ZXI C;  1W1Q A;  4OAL A;  1V97 A;  3FW7 A;  2VFT A;  4UD8 A;  1FO4 A;  5I1W A;  4PWC A;  2W55 A;  4BC9 A;  1QLT A;  4O95 A;  5FXF A;  1MBT A;  5AE1 A;  2BVF A;  2WDW A;  2R2Z A;  1DZN A;  2R8D A;  2EXR A;  1VDV A;  3DQ0 A;  3GSY A;  3VTE A;  2NQW A;  3EUB 3;  2VFV A;  1E8F A;  4JAY A;  3POP A;  1AHV A;  1W1J A;  1UXY A;  3EJD B;  3FW9 A;  5AWV A;  3HSU A;  4HG0 A;  3AMZ A;  3HRD C;  2VAO A;  2VFR A;  4BC7 A;  1W1O A;  2BVH A;  2E3T A;  2RK5 A;  1JRO A;  5HMR A;  4PZF A;  5L6F A;  3I99 A;  5ADZ A;  2Y3R A;  3RJ8 A;  1N5X A;  2PLS A;  3AM9 A;  4MLA A;  2I0K A;  1T3Q C;  1N62 C;  1F0X A;  3LAE A;  2Y4G A;  1W1R A;  4PVK A;  4DNS A;  3RJA A;  2O3G A;  5I1V A;  1E0Y A;  2Q85 A;  5AE2 A;  1FIQ B;  1WVF A;  5FXD A;  1E8G A;  3FW8 A;  1DII A;  1W1K A;  3S1D A;  1WVE A; 
#chains in the Genus database with same CATH homology
 1HSK A;  2Q4W A;  1E8H A;  1N61 C;  3TX1 A;  3D2D A;  3KJM A;  4PVJ A;  3NS1 B;  3D2J A;  2UUU A;  1RM6 B;  2QPM A;  4BCA A;  5K8E A;  2W3R A;  2OAI A;  3DED A;  1FFU C;  3NVY B;  3W8Z A;  3NVW B;  5HHZ A;  3TSJ A;  3FWA A;  2PLI A;  2VFS A;  2QKN A;  1W1S A;  3BW7 A;  1QLU A;  1W1L A;  4ZOH B;  5D79 A;  4JB1 A;  5AE3 A;  2Y08 A;  3B9J B;  4PVE A;  4PYT A;  2GQU A;  1VAO A;  3W8X A;  4PWB A;  3S1F A;  5FXP A;  3S1E A;  4EC3 A;  2IPI A;  3LLB A;  5L6G A;  1DIQ A;  1AHU A;  2AXR A;  1W1M A;  2YVS A;  5G5G B;  1MBB A;  4XLO A;  3PQB A;  3NRZ B;  1ZR6 A;  4ML8 A;  3ETR B;  2VFU A;  1I19 A;  1FFV C;  2GQT A;  3AN1 A;  2P4P A;  1N5W C;  2P13 A;  5HQX A;  3NVV B;  4BBY A;  4PVH A;  3S1C A;  3D2H A;  2W54 A;  5G5H B;  2W3S A;  1WYG A;  2Y3S A;  1JRP A;  3JS8 A;  2P3H A;  3C0P A;  3NVZ B;  1N63 C;  2BVG A;  3TSH A;  2UUV A;  5FXE A;  1N60 C;  1AHZ A;  3W8W A;  3PM9 A;  2MBR A;  3SR6 B;  1SB3 B;  1ZXI C;  1W1Q A;  4OAL A;  1V97 A;  3FW7 A;  2VFT A;  4UD8 A;  1FO4 A;  5I1W A;  4PWC A;  2W55 A;  4BC9 A;  1QLT A;  4O95 A;  5FXF A;  1MBT A;  5AE1 A;  2BVF A;  2WDW A;  2R2Z A;  1DZN A;  2R8D A;  2EXR A;  1VDV A;  3DQ0 A;  3GSY A;  3VTE A;  2NQW A;  3EUB 3;  2VFV A;  1E8F A;  4JAY A;  3POP A;  1AHV A;  1W1J A;  1UXY A;  3FW9 A;  5AWV A;  3HSU A;  4HG0 A;  3AMZ A;  3HRD C;  2VAO A;  2VFR A;  4BC7 A;  1W1O A;  2BVH A;  2E3T A;  2RK5 A;  1JRO A;  5HMR A;  4PZF A;  5L6F A;  3I99 A;  5ADZ A;  2Y3R A;  3RJ8 A;  1N5X A;  2PLS A;  3AM9 A;  4MLA A;  2I0K A;  1T3Q C;  1N62 C;  1F0X A;  3LAE A;  2Y4G A;  1W1R A;  4PVK A;  4DNS A;  3RJA A;  2O3G A;  5I1V A;  1E0Y A;  2Q85 A;  5AE2 A;  1FIQ B;  1WVF A;  5FXD A;  1E8G A;  3FW8 A;  1DII A;  1W1K A;  3S1D A;  1WVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...